CN107373467A - Compound based on hairtail activity extract and preparation method thereof - Google Patents
Compound based on hairtail activity extract and preparation method thereof Download PDFInfo
- Publication number
- CN107373467A CN107373467A CN201710528630.XA CN201710528630A CN107373467A CN 107373467 A CN107373467 A CN 107373467A CN 201710528630 A CN201710528630 A CN 201710528630A CN 107373467 A CN107373467 A CN 107373467A
- Authority
- CN
- China
- Prior art keywords
- hairtail
- parts
- activity extract
- freeze
- preparation
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
- 230000000694 effects Effects 0.000 title claims abstract description 62
- 241001125843 Trichiuridae Species 0.000 title claims abstract description 43
- 150000001875 compounds Chemical class 0.000 title claims abstract description 17
- 238000002360 preparation method Methods 0.000 title claims description 16
- 238000000605 extraction Methods 0.000 title description 4
- 239000000203 mixture Substances 0.000 claims abstract description 17
- MSWZFWKMSRAUBD-IVMDWMLBSA-N 2-amino-2-deoxy-D-glucopyranose Chemical compound N[C@H]1C(O)O[C@H](CO)[C@@H](O)[C@@H]1O MSWZFWKMSRAUBD-IVMDWMLBSA-N 0.000 claims abstract description 6
- SQDAZGGFXASXDW-UHFFFAOYSA-N 5-bromo-2-(trifluoromethoxy)pyridine Chemical compound FC(F)(F)OC1=CC=C(Br)C=N1 SQDAZGGFXASXDW-UHFFFAOYSA-N 0.000 claims abstract description 6
- 229920001287 Chondroitin sulfate Polymers 0.000 claims abstract description 6
- 102000008186 Collagen Human genes 0.000 claims abstract description 6
- 108010035532 Collagen Proteins 0.000 claims abstract description 6
- MSWZFWKMSRAUBD-UHFFFAOYSA-N beta-D-galactosamine Natural products NC1C(O)OC(CO)C(O)C1O MSWZFWKMSRAUBD-UHFFFAOYSA-N 0.000 claims abstract description 6
- FNAQSUUGMSOBHW-UHFFFAOYSA-H calcium citrate Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O.[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O FNAQSUUGMSOBHW-UHFFFAOYSA-H 0.000 claims abstract description 6
- 239000001354 calcium citrate Substances 0.000 claims abstract description 6
- 229940059329 chondroitin sulfate Drugs 0.000 claims abstract description 6
- 229920001436 collagen Polymers 0.000 claims abstract description 6
- 229960002442 glucosamine Drugs 0.000 claims abstract description 6
- 235000013337 tricalcium citrate Nutrition 0.000 claims abstract description 6
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 67
- 239000004365 Protease Substances 0.000 claims description 36
- 108091005804 Peptidases Proteins 0.000 claims description 35
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 claims description 33
- 238000004108 freeze drying Methods 0.000 claims description 31
- 238000010828 elution Methods 0.000 claims description 27
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 26
- DTQVDTLACAAQTR-UHFFFAOYSA-N Trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 claims description 25
- 239000000706 filtrate Substances 0.000 claims description 24
- 102000004190 Enzymes Human genes 0.000 claims description 22
- 108090000790 Enzymes Proteins 0.000 claims description 22
- 239000000463 material Substances 0.000 claims description 22
- 210000000988 bone and bone Anatomy 0.000 claims description 19
- 239000003513 alkali Substances 0.000 claims description 16
- 241000006384 Jeotgalibacillus marinus Species 0.000 claims description 15
- 241000206613 Pyropia yezoensis Species 0.000 claims description 15
- 238000004128 high performance liquid chromatography Methods 0.000 claims description 14
- 238000005374 membrane filtration Methods 0.000 claims description 14
- 238000004519 manufacturing process Methods 0.000 claims description 11
- 239000012141 concentrate Substances 0.000 claims description 9
- 238000010521 absorption reaction Methods 0.000 claims description 8
- 241000251468 Actinopterygii Species 0.000 claims description 7
- 230000007062 hydrolysis Effects 0.000 claims description 7
- 238000006460 hydrolysis reaction Methods 0.000 claims description 7
- 238000001728 nano-filtration Methods 0.000 claims description 6
- 238000002604 ultrasonography Methods 0.000 claims description 5
- 239000002253 acid Substances 0.000 claims description 3
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 claims 3
- QGZKDVFQNNGYKY-UHFFFAOYSA-N Ammonia Chemical compound N QGZKDVFQNNGYKY-UHFFFAOYSA-N 0.000 claims 2
- 229910021529 ammonia Inorganic materials 0.000 claims 1
- 238000004458 analytical method Methods 0.000 claims 1
- 239000002585 base Substances 0.000 claims 1
- 230000008439 repair process Effects 0.000 abstract description 15
- 230000007774 longterm Effects 0.000 abstract description 6
- 238000005299 abrasion Methods 0.000 abstract description 5
- 230000001760 anti-analgesic effect Effects 0.000 abstract description 5
- 230000003110 anti-inflammatory effect Effects 0.000 abstract description 5
- 210000001188 articular cartilage Anatomy 0.000 abstract description 5
- 210000000845 cartilage Anatomy 0.000 abstract description 5
- 210000003321 cartilage cell Anatomy 0.000 abstract description 5
- 206010020718 hyperplasia Diseases 0.000 abstract description 5
- 230000001050 lubricating effect Effects 0.000 abstract description 5
- 230000036407 pain Effects 0.000 abstract description 5
- 230000009286 beneficial effect Effects 0.000 abstract description 4
- 235000019419 proteases Nutrition 0.000 description 29
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 27
- 229920001184 polypeptide Polymers 0.000 description 21
- 229940088598 enzyme Drugs 0.000 description 19
- 239000000047 product Substances 0.000 description 16
- 102000004169 proteins and genes Human genes 0.000 description 13
- 108090000623 proteins and genes Proteins 0.000 description 13
- 150000001413 amino acids Chemical class 0.000 description 11
- 238000000034 method Methods 0.000 description 11
- 125000003275 alpha amino acid group Chemical group 0.000 description 9
- 230000008569 process Effects 0.000 description 8
- 102000007079 Peptide Fragments Human genes 0.000 description 6
- 108010033276 Peptide Fragments Proteins 0.000 description 6
- 239000003814 drug Substances 0.000 description 6
- 238000001035 drying Methods 0.000 description 6
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 6
- 108010028690 Fish Proteins Proteins 0.000 description 5
- 241001559566 Osteoglossum bicirrhosum Species 0.000 description 5
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 4
- 230000009849 deactivation Effects 0.000 description 4
- 238000005516 engineering process Methods 0.000 description 4
- 239000001257 hydrogen Substances 0.000 description 4
- 229910052739 hydrogen Inorganic materials 0.000 description 4
- 239000001301 oxygen Substances 0.000 description 4
- 229910052760 oxygen Inorganic materials 0.000 description 4
- 238000000746 purification Methods 0.000 description 4
- 230000009471 action Effects 0.000 description 3
- 230000018044 dehydration Effects 0.000 description 3
- 238000006297 dehydration reaction Methods 0.000 description 3
- 235000013305 food Nutrition 0.000 description 3
- 238000007710 freezing Methods 0.000 description 3
- 230000008014 freezing Effects 0.000 description 3
- 238000003860 storage Methods 0.000 description 3
- DECCMEWNXSNSDO-ZLUOBGJFSA-N Ala-Cys-Ala Chemical compound C[C@H](N)C(=O)N[C@@H](CS)C(=O)N[C@@H](C)C(O)=O DECCMEWNXSNSDO-ZLUOBGJFSA-N 0.000 description 2
- 108010067722 Dipeptidyl Peptidase 4 Proteins 0.000 description 2
- 102100025012 Dipeptidyl peptidase 4 Human genes 0.000 description 2
- DGLAHESNTJWGDO-SRVKXCTJSA-N His-Ser-His Chemical compound C1=C(NC=N1)C[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CC2=CN=CN2)C(=O)O)N DGLAHESNTJWGDO-SRVKXCTJSA-N 0.000 description 2
- 102000035195 Peptidases Human genes 0.000 description 2
- 101710118538 Protease Proteins 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 230000000975 bioactive effect Effects 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- 108010040030 histidinoalanine Proteins 0.000 description 2
- 230000002401 inhibitory effect Effects 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 239000012528 membrane Substances 0.000 description 2
- 238000003756 stirring Methods 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 239000006228 supernatant Substances 0.000 description 2
- 239000013589 supplement Substances 0.000 description 2
- 230000001629 suppression Effects 0.000 description 2
- 238000010792 warming Methods 0.000 description 2
- QCVGEOXPDFCNHA-UHFFFAOYSA-N 5,5-dimethyl-2,4-dioxo-1,3-oxazolidine-3-carboxamide Chemical compound CC1(C)OC(=O)N(C(N)=O)C1=O QCVGEOXPDFCNHA-UHFFFAOYSA-N 0.000 description 1
- MXZYQNJCBVJHSR-KATARQTJSA-N Cys-Lys-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CS)N)O MXZYQNJCBVJHSR-KATARQTJSA-N 0.000 description 1
- BCFXQBXXDSEHRS-FXQIFTODSA-N Cys-Ser-Arg Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O BCFXQBXXDSEHRS-FXQIFTODSA-N 0.000 description 1
- WZJLBUPPZRZNTO-CIUDSAMLSA-N Cys-Ser-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](CS)N WZJLBUPPZRZNTO-CIUDSAMLSA-N 0.000 description 1
- JRZMCSIUYGSJKP-ZKWXMUAHSA-N Cys-Val-Asn Chemical compound SC[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(O)=O JRZMCSIUYGSJKP-ZKWXMUAHSA-N 0.000 description 1
- 102000002322 Egg Proteins Human genes 0.000 description 1
- 108010000912 Egg Proteins Proteins 0.000 description 1
- FFJQHWKSGAWSTJ-BFHQHQDPSA-N Gly-Thr-Ala Chemical compound [H]NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(O)=O FFJQHWKSGAWSTJ-BFHQHQDPSA-N 0.000 description 1
- IIKJNQWOQIWWMR-CIUDSAMLSA-N Leu-Cys-Ala Chemical compound C[C@@H](C(=O)O)NC(=O)[C@H](CS)NC(=O)[C@H](CC(C)C)N IIKJNQWOQIWWMR-CIUDSAMLSA-N 0.000 description 1
- JPYPRVHMKRFTAT-KKUMJFAQSA-N Lys-Phe-Cys Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CCCCN)N JPYPRVHMKRFTAT-KKUMJFAQSA-N 0.000 description 1
- 108090000526 Papain Proteins 0.000 description 1
- UIMCLYYSUCIUJM-UWVGGRQHSA-N Pro-Gly-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H]1CCCN1 UIMCLYYSUCIUJM-UWVGGRQHSA-N 0.000 description 1
- MPPHJZYXDVDGOF-BWBBJGPYSA-N Ser-Cys-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H](CS)NC(=O)[C@@H](N)CO MPPHJZYXDVDGOF-BWBBJGPYSA-N 0.000 description 1
- OSFZCEQJLWCIBG-BZSNNMDCSA-N Ser-Tyr-Tyr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O OSFZCEQJLWCIBG-BZSNNMDCSA-N 0.000 description 1
- 101000693530 Staphylococcus aureus Staphylokinase Proteins 0.000 description 1
- 102000005158 Subtilisins Human genes 0.000 description 1
- 108010056079 Subtilisins Proteins 0.000 description 1
- AVIQBBOOTZENLH-KKUMJFAQSA-N Tyr-Leu-Cys Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CC1=CC=C(C=C1)O)N AVIQBBOOTZENLH-KKUMJFAQSA-N 0.000 description 1
- NSGZILIDHCIZAM-KKUMJFAQSA-N Tyr-Leu-Ser Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CO)C(=O)O)NC(=O)[C@H](CC1=CC=C(C=C1)O)N NSGZILIDHCIZAM-KKUMJFAQSA-N 0.000 description 1
- XTDDIVQWDXMRJL-IHRRRGAJSA-N Val-Leu-His Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)NC(=O)[C@H](C(C)C)N XTDDIVQWDXMRJL-IHRRRGAJSA-N 0.000 description 1
- 150000008065 acid anhydrides Chemical class 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 238000013475 authorization Methods 0.000 description 1
- 210000001612 chondrocyte Anatomy 0.000 description 1
- 238000013329 compounding Methods 0.000 description 1
- 108010016616 cysteinylglycine Proteins 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 235000014103 egg white Nutrition 0.000 description 1
- 210000000969 egg white Anatomy 0.000 description 1
- 235000013601 eggs Nutrition 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- 235000019634 flavors Nutrition 0.000 description 1
- 108010007119 flavourzyme Proteins 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 108010085325 histidylproline Proteins 0.000 description 1
- 230000003301 hydrolyzing effect Effects 0.000 description 1
- 239000012535 impurity Substances 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- 231100000053 low toxicity Toxicity 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 108010009355 microbial metalloproteinases Proteins 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 238000011017 operating method Methods 0.000 description 1
- 235000019834 papain Nutrition 0.000 description 1
- 229940055729 papain Drugs 0.000 description 1
- 239000012466 permeate Substances 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 238000007493 shaping process Methods 0.000 description 1
- 239000002002 slurry Substances 0.000 description 1
- 238000000108 ultra-filtration Methods 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23L—FOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
- A23L17/00—Food-from-the-sea products; Fish products; Fish meal; Fish-egg substitutes; Preparation or treatment thereof
- A23L17/20—Fish extracts
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23L—FOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
- A23L33/00—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof
- A23L33/10—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof using additives
- A23L33/17—Amino acids, peptides or proteins
- A23L33/18—Peptides; Protein hydrolysates
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23V—INDEXING SCHEME RELATING TO FOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES AND LACTIC OR PROPIONIC ACID BACTERIA USED IN FOODSTUFFS OR FOOD PREPARATION
- A23V2002/00—Food compositions, function of food ingredients or processes for food or foodstuffs
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Nutrition Science (AREA)
- Chemical & Material Sciences (AREA)
- Food Science & Technology (AREA)
- Polymers & Plastics (AREA)
- Zoology (AREA)
- Marine Sciences & Fisheries (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Mycology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Abstract
The invention discloses a kind of compound based on hairtail activity extract, composition and its parts by weight are：30 ~ 40 parts of 20 ~ 30 parts of hairtail activity extract, 3 ~ 5 parts of chondroitin sulfate, 7 ~ 14 parts of Glucosamine, 0.2 ~ 0.6 part of calcium citrate and collagen.Have the beneficial effect that：The compound based on hairtail activity extract being prepared can promote the hyperplasia of cartilage cell, repair the articular cartilage damaged by long term wear；Knuckle synovia largely can be expedited the emergence of and supplemented, lubricating joint cartilage surface, reduces abrasion, increases the flexibility ratio of joint part；It with the factor derived from capilary is suppressed, can also increase the generation of antibody, improve immunocompetence, there is the effect of anti-inflammatory and analgesic, pain can be mitigated, improve locomitivity.
Description
Technical field
The present invention relates to health products preparing technical field, specifically a kind of compound based on hairtail activity extract and its
Preparation method.
Background technology
Polypeptide attracts attention since earlier 1900s are just, and research finds that it is different from protein and is different from amino acid, tool
There is medicine.Having arrived the last century nineties just has tremendous development, under the technological guidance of continuous renewal, polypeptide
Application is more and more wider, and effect is also increasing, and this has just strided forward our life, and the share occupied in we live is got over
Come bigger, polypeptide drug high-efficiency low-toxicity high specificity has the peculiar advantage of other drugs of being different from, and just constantly affects me
Life.It is the another quantum jump and developing direction of bioscience development and polypeptide has a high potential.
Naturally occurring Marine Bioactive Peptides due in organism content it is low, and extract difficult, it is difficult to realize a large amount of
Needed for production supply, chemical artificial synthetic polypeptide is costly.So sight is more invested exploitation proteolysis production by people
Come in this approach of thing acquisition active peptides.Because the environment and terrestrial life of marine organisms existence are entirely different, such as high pressure, low
The extreme environment such as temperature, high temperature and high salt, in order to adapt to these extreme marine biological environments, marine protein matter no matter amino
The composition or the sequence of amino acid of acid are all very different with terrestrial life albumen, meanwhile, marine protein resource without
By being all far longer than land protein resource in type and quantity, and do not developed well.Miscellaneous ocean egg
In casamino acid sequence, potential many amino acid sequences with bioactivity, with special protease hydrolytic, just discharge
Active peptide fragment.Marine protein resource is the important of the important albumen group food of the 21 century mankind and bioactive substance
Source.The current marine protein total resources in China comes out at the top in countries in the world, but the protide aquatic products that China is current
In product, in addition to a part is directly edible, major part is made food by simple process technology and enters market, and process technology falls
Afterwards, product structure is single, and value-added content of product is low so that the competitiveness of product in the international market is poor.Therefore, China is badly in need of
Marine protein resource is optimized and utilized and high-valued processing.
Prior art such as Authorization Notice No. is CN103333940B Chinese invention patent, discloses one kind and utilizes hairtail system
The method of standby DPP IV peptide for inhibiting, step include：Hairtail plus water are rubbed into the uniform flesh of fish and starched；Flesh of fish slurry is put into enzyme
Solve in tank, add endo protease, stirring 4~12h of hydrolysis, obtain hydrolyzate；95~100 DEG C are warming up to, is kept for 10~15 minutes
Enzyme deactivation；Hydrolyzate is cooled to 40~60 DEG C, adds exoproteinase, 2~8h of stirring hydrolysis；95~100 DEG C are warming up to, keeps 10
Enzyme deactivation in~15 minutes；Endo protease is in papain, Neutrase neutral proteinases, Alcalase alkali proteases
It is a kind of.Exoproteinase is Flavourzyme flavor proteases.By the hydrolyzate centrifuging and taking supernatant after above-mentioned gained enzyme deactivation；
Supernatant is added in Ultra filtration membrane device, the pressure for adjusting milipore filter is 0.05~0.1MPa, the retention molecule of milipore filter
Measure as 3000Da, collection milipore filter permeate；DPP-IV peptide for inhibiting is isolated and purified using affinity chromatography method.Marine protein
The composition of matter amino acid or the sequence of amino acid are all very different with terrestrial life albumen, and the above method uses land
The protease of extraction digests to marine organisms on the ground, and enzymolysis efficiency is low.
The content of the invention
It is an object of the invention to provide one kind can remarkably promote knuckle synovia generation, accelerate the proliferation of chondrocytes, repairing
Compound based on hairtail activity extract of the articular cartilage of damage and preparation method thereof.
The present invention is directed to the problem of being mentioned in background technology, and the technical scheme taken is：Based on hairtail activity extract
Compound, composition and its parts by weight are：20 ~ 30 parts of hairtail activity extract, 3 ~ 5 parts of chondroitin sulfate, Glucosamine 7 ~ 14
30 ~ 40 parts of part, 0.2 ~ 0.6 part of calcium citrate and collagen.The above-mentioned compounding based on hairtail activity extract being prepared
Thing can promote the hyperplasia of cartilage cell, repair the articular cartilage damaged by long term wear；It largely can expedite the emergence of and supplement joint cunning
Liquid, lubricating joint cartilage surface, abrasion is reduced, increase the flexibility ratio of joint part；With the factor derived from capilary is suppressed, may be used also
Increase the generation of antibody, improve immunocompetence, there is the effect of anti-inflammatory and analgesic, pain can be mitigated, improve locomitivity.
The preparation method of hairtail activity extract, including complex enzyme zymohydrolysis, multistage membrane filtration, nanofiltration, HPLC elution and it is cold
Lyophilized dry, above-mentioned complex enzyme zymohydrolysis step is to produce alkali protease and Porphyra yezoensis protease hydrolyzed band using bacillus marinus
Fish flesh of fish homogenate, and use ultrasound-assisted enzymolysis.Marine protein matter no matter the composition or amino acid of amino acid
Sequence is all very different with terrestrial life albumen, and bacillus marinus production alkali protease and Porphyra yezoensis protease are simultaneously
Band Fish protein is digested, can obtain a large amount of active peptide fragments.
Preferably, freeze-drying step is：Pre-freeze：- 35 ~ -45 DEG C of 3 ~ 5h of pre-freeze；Freeze-drying：- 45 ~ -35 DEG C, 3 ~
5Pa is freeze-dried 5 ~ 7h, and -10 ~ -5 DEG C, 10 ~ 20Pa is freeze-dried 2 ~ 3h；Lyophilization：10 ~ 15 DEG C, 50 ~ 60Pa lyophilizations
3~4h；Parsing-desiccation:7 ~ 14 DEG C, 3 ~ 5Pa, 2 ~ 4h of parsing-desiccation, obtain the hairtail activity extract for Bones and joints reparation.Freeze
Dry whole process is all under program control, simple to operate, and process is succinct, and automaticity is high, reduces human and material resources.It is low
The lower drying of temperature can preferably retentive activity peptide activity；Dried under low pressure, active peptide is not oxidizable, better efficacy；Lived when freezing
Property peptide form " skeleton ", preserve original shape after drying, be basically unchanged for porous loose structure and color, product appearance is more excellent；
Rehydration is good, and freeze drying activity peptide, which can absorb water rapidly, is reduced into lyophilized preceding state, easy to use；Dehydration is thorough, aqueous in active peptide
Measure low, typically in 1%-3%, and be advantageous to long-distance transport and long-term preserve.
Preferably, adding 30 ~ 40wt% auxiliary materials before freeze-drying, the composition and its parts by weight of auxiliary material are：80 ~ 90 parts of right sides
Revolve sugared acid anhydride -40 and 2 ~ 5 parts of active peptides.Above-mentioned auxiliary material is beneficial to formed product, that is, prevents that medicine is together with vapor when vacuumizing
Disperse or shunk when shaping, and can protection activity peptide.
Preferably, the amino acid sequence of active peptide is
HSHACASYYCSKHSHACKTACAKFCGTASCTHYLSYLCRVLHPGKLCACVNCSR.Above-mentioned active peptide passes through hydrogen bond and tool
The active peptide for having Bones and joints reparation connects, and can make it from storing with minimal amount of amount with regard to the good defencive function peptide of energy
Oxygen and other factors are to its structural damage in journey.
Preferably, in complex enzyme zymohydrolysis step bacillus marinus production alkali protease and Porphyra yezoensis protease plus
It is 1 ~ 2wt% to enter amount, and hydrolysis temperature is 25 ~ 35 DEG C, and pH is 7.0 ~ 9.0, and enzymolysis time is 40 ~ 60min.Under above-mentioned condition, albumen
The addition of enzyme is few and enzymolysis efficiency is high.
Preferably, multistage membrane filtration step is first to pass through filtrate respectively again with 0.2 ~ 0.4 μm of micro-filtrate membrane filtration, filtrate
Molecular cut off 14-18kDa, 6-8kDa milipore filter, concentrate filtrate.Purification process, behaviour are carried out to filtrate by physics mode
Work is simple, will not destroy the activity of Functional Polypeptides, has the content of the Functional Polypeptides of repair high in obtained ultrafiltrate to Bones and joints.
Preferably, elution step is 0 ~ 5min in HPLC elution steps, washed with 1 ~ 3% trifluoroacetic acid and 98 ~ 99% acetonitriles
De-, flow velocity is 0.8 ~ 1.5ml/min；5 ~ 15min, being eluted with 5 ~ 7% trifluoroacetic acids and 93 ~ 95% acetonitriles, flow velocity is 0.8 ~
1.5ml/min；15 ~ 30min, eluted with 8 ~ 12% trifluoroacetic acids and 88 ~ 92% acetonitriles, flow velocity is 0.8 ~ 1.5ml/min.According to work(
The polarity design eluant component and elution action of energy peptide, the Functional Polypeptides for having repair to Bones and joints are separated with other materials
Come, product is further purified.
Preferably, collecting the eluate for having absorption in 250nm after elution terminates in HPLC elution steps, merge and dense
Contracting.The Functional Polypeptides excellent to Bones and joints repair have stronger absorption at 250nm.
Compared with prior art, the advantage of the invention is that：1）Marine protein matter no matter amino acid composition or
The sequence of amino acid is all very different with terrestrial life albumen, bacillus marinus production alkali protease and Porphyra yezoensis egg
White enzyme digests to band Fish protein simultaneously, can obtain a large amount of active peptide fragments；2）Added in the product before freeze-drying auxiliary
Expect, it is HSHACASYYCSKHSHACKTACAKFCGTASCTHYLSYLCRVLHPGKLCACVNCSR to have amino acid sequence in auxiliary material
Active peptide.Above-mentioned active peptide is connected by hydrogen bond with the active peptide of Bones and joints reparation, can just can be very with minimal amount of amount
Good defencive function peptide, oxygen and other factors are made it from storage to its structural damage；3）It is prepared
Compound based on hairtail activity extract can promote the hyperplasia of cartilage cell, and it is soft to repair the joint damaged by long term wear
Bone；Knuckle synovia largely can be expedited the emergence of and supplemented, lubricating joint cartilage surface, reduces abrasion, increases the flexibility ratio of joint part；Have
Suppress the factor derived from capilary, can also increase the generation of antibody, improve immunocompetence, there is the effect of anti-inflammatory and analgesic, can
To mitigate pain, improve locomitivity.
Specific embodiment
The present invention program is described further below by embodiment：
Embodiment 1：
Based on the compound of hairtail activity extract, composition and its parts by weight are：26 parts of hairtail activity extract, chondroitin sulfate
37 parts of 4 parts, 12 parts of Glucosamine, 0.3 part of calcium citrate and collagen.It is above-mentioned be prepared based on hairtail activity extract
The compound of thing can promote the hyperplasia of cartilage cell, repair the articular cartilage damaged by long term wear；Largely it can expedite the emergence of and mend
Knuckle synovia is filled, lubricating joint cartilage surface, reduces abrasion, increases the flexibility ratio of joint part；With derived from suppression capilary
It the factor, can also increase the generation of antibody, improve immunocompetence, there is the effect of anti-inflammatory and analgesic, pain can be mitigated, improve fortune
Kinetic force.
The preparation method of hairtail activity extract, including complex enzyme zymohydrolysis, multistage membrane filtration, nanofiltration, HPLC elution and it is cold
Lyophilized dry, above-mentioned complex enzyme zymohydrolysis step is to produce alkali protease and Porphyra yezoensis protease hydrolyzed band using bacillus marinus
Fish flesh of fish homogenate, and use ultrasound-assisted enzymolysis.Marine protein matter no matter the composition or amino acid of amino acid
Sequence is all very different with terrestrial life albumen, and bacillus marinus production alkali protease and Porphyra yezoensis protease are simultaneously
Band Fish protein is digested, can obtain a large amount of active peptide fragments.
Being freeze-dried step is：Pre-freeze：- 40 DEG C of pre-freeze 5h；Freeze-drying：- 40 DEG C, 4Pa freeze-drying 6h, -7 DEG C,
16Pa is freeze-dried 2.6h；Lyophilization：13 DEG C, 57Pa lyophilizations 3h；Parsing-desiccation:10 DEG C, 4Pa parsing-desiccation 3h, obtain
To the hairtail activity extract for Bones and joints reparation.Lyophilized whole process is all under program control, simple to operate, process letter
Clean, automaticity is high, reduces human and material resources.Under low temperature drying can preferably retentive activity peptide activity；Done under low pressure
Dry, active peptide is not oxidizable, better efficacy；Active peptide forms " skeleton " when freezing, and preserves original shape after drying, is porosity and looseness knot
Structure and color is basically unchanged, product appearance is more excellent；Rehydration is good, and freeze drying activity peptide, which can absorb water rapidly, is reduced into lyophilized preceding shape
State, it is easy to use；Dehydration is thorough, and water content is low in active peptide, and is advantageous to long-distance transport and preserves for a long time.
36wt% auxiliary materials are added before freeze-drying, the composition and its parts by weight of auxiliary material are：87 parts of dextran-40s and 3 parts of work
Property peptide.Above-mentioned auxiliary material is beneficial to formed product, that is, prevents from shrinking when when vacuumizing, medicine disperses or shaped together with vapor, and
And can protection activity peptide.
The amino acid sequence of active peptide is HSHACASYYCSKHSHACKTACAKFCGTASCTHYLSYLCRVLHPGKLCAC
VNCSR.Above-mentioned active peptide is connected by hydrogen bond with the active peptide with Bones and joints reparation, can be good with regard to energy with minimal amount of amount
Defencive function peptide, oxygen and other factors are made it from storage to its structural damage.
The addition of bacillus marinus production alkali protease and Porphyra yezoensis protease is in complex enzyme zymohydrolysis step
1.6wt%, hydrolysis temperature are 30 DEG C, pH 8.0, enzymolysis time 50min.Under above-mentioned condition, the addition of protease is few and enzyme
Solve efficiency high.
Multistage membrane filtration step is that filtrate is first passed through into molecular cut off respectively again with 0.3 μm of micro-filtrate membrane filtration, filtrate
15kDa, 7kDa milipore filter, concentrate filtrate.Purification process is carried out to filtrate by physics mode, it is simple to operate, it will not destroy
The activity of Functional Polypeptides, there is in obtained ultrafiltrate the content of the Functional Polypeptides of repair high to Bones and joints.
Elution step is 0 ~ 5min in HPLC elution steps, is eluted with 2% trifluoroacetic acid and 98% acetonitrile, flow velocity 1ml/
min；5 ~ 15min, eluted with 6% trifluoroacetic acid and 94% acetonitrile, flow velocity 1ml/min；15 ~ 30min, with 10% trifluoroacetic acid and
90% acetonitrile elutes, flow velocity 1ml/min.Eluant component and elution action are designed according to the polarity of Functional Polypeptides, will be to Bones and joints
The Functional Polypeptides and other materials for having repair are separated, and product is further purified.
The eluate for having absorption in 250nm is collected after elution terminates in HPLC elution steps, merges and concentrates.To Bones and joints
The excellent Functional Polypeptides of repair have stronger absorption at 250nm.
Embodiment 2：
Based on the compound of hairtail activity extract, composition and its parts by weight are：23 parts of hairtail activity extract, chondroitin sulfate
38 parts of 4 parts, 10 parts of Glucosamine, 0.4 part of calcium citrate and collagen.It is above-mentioned be prepared based on hairtail activity extract
The compound of thing can promote the hyperplasia of cartilage cell, repair the articular cartilage damaged by long term wear；Largely it can expedite the emergence of and mend
Knuckle synovia is filled, lubricating joint cartilage surface, reduces abrasion, increases the flexibility ratio of joint part；With derived from suppression capilary
It the factor, can also increase the generation of antibody, improve immunocompetence, there is the effect of anti-inflammatory and analgesic, pain can be mitigated, improve fortune
Kinetic force.
The preparation method of hairtail activity extract, including complex enzyme zymohydrolysis, multistage membrane filtration, nanofiltration, HPLC elution and it is cold
Lyophilized dry, above-mentioned complex enzyme zymohydrolysis step is to produce alkali protease and Porphyra yezoensis protease hydrolyzed band using bacillus marinus
Fish flesh of fish homogenate, and use ultrasound-assisted enzymolysis.Marine protein matter no matter the composition or amino acid of amino acid
Sequence is all very different with terrestrial life albumen, and bacillus marinus production alkali protease and Porphyra yezoensis protease are simultaneously
Band Fish protein is digested, can obtain a large amount of active peptide fragments.
Being freeze-dried step is：Pre-freeze：- 40 DEG C of pre-freeze 5h；Freeze-drying：- 40 DEG C, 3Pa freeze-drying 5h, -5 DEG C,
12Pa is freeze-dried 2h；Lyophilization：13 DEG C, 52Pa lyophilizations 3.4h；Parsing-desiccation:10 DEG C, 4Pa parsing-desiccation 3h, obtain
To the hairtail activity extract for Bones and joints reparation.Lyophilized whole process is all under program control, simple to operate, process letter
Clean, automaticity is high, reduces human and material resources.Under low temperature drying can preferably retentive activity peptide activity；Done under low pressure
Dry, active peptide is not oxidizable, better efficacy；Active peptide forms " skeleton " when freezing, and preserves original shape after drying, is porosity and looseness knot
Structure and color is basically unchanged, product appearance is more excellent；Rehydration is good, and freeze drying activity peptide, which can absorb water rapidly, is reduced into lyophilized preceding shape
State, it is easy to use；Dehydration is thorough, and water content is low in active peptide, and is advantageous to long-distance transport and preserves for a long time.
34wt% auxiliary materials are added before freeze-drying, the composition and its parts by weight of auxiliary material are：85 parts of dextran-40s and 3 parts of work
Property peptide.Above-mentioned auxiliary material is beneficial to formed product, that is, prevents from shrinking when when vacuumizing, medicine disperses or shaped together with vapor, and
And can protection activity peptide.
The amino acid sequence of active peptide is HSHACASYYCSKHSHACKTACAKFCGTASCTHYLSYLCRVLHPGKLCAC
VNCSR.Above-mentioned active peptide is connected by hydrogen bond with the active peptide with Bones and joints reparation, can be good with regard to energy with minimal amount of amount
Defencive function peptide, oxygen and other factors are made it from storage to its structural damage.
The addition of bacillus marinus production alkali protease and Porphyra yezoensis protease is in complex enzyme zymohydrolysis step
1.5wt%, hydrolysis temperature are 30 DEG C, pH 8.0, enzymolysis time 44min.Under above-mentioned condition, the addition of protease is few and enzyme
Solve efficiency high.
Multistage membrane filtration step is that filtrate is first passed through into molecular cut off respectively again with 0.3 μm of micro-filtrate membrane filtration, filtrate
16kDa, 7kDa milipore filter, concentrate filtrate.Purification process is carried out to filtrate by physics mode, it is simple to operate, it will not destroy
The activity of Functional Polypeptides, there is in obtained ultrafiltrate the content of the Functional Polypeptides of repair high to Bones and joints.
Elution step is 0 ~ 5min in HPLC elution steps, is eluted with 2% trifluoroacetic acid and 98% acetonitrile, flow velocity 1ml/
min；5 ~ 15min, eluted with 6% trifluoroacetic acid and 94% acetonitrile, flow velocity 1ml/min；15 ~ 30min, with 10% trifluoroacetic acid and
90% acetonitrile elutes, flow velocity 1ml/min.Eluant component and elution action are designed according to the polarity of Functional Polypeptides, will be to Bones and joints
The Functional Polypeptides and other materials for having repair are separated, and product is further purified.
The eluate for having absorption in 250nm is collected after elution terminates in HPLC elution steps, merges and concentrates.To Bones and joints
The excellent Functional Polypeptides of repair have stronger absorption at 250nm.
Embodiment 3：
1）Complex enzyme zymohydrolysis：Alkali protease and the homogenate of the Porphyra yezoensis protease hydrolyzed hairtail flesh of fish are produced using bacillus marinus
Liquid, and use ultrasound-assisted enzymolysis.Bacillus marinus produces alkali protease and the addition of Porphyra yezoensis protease is
1.4wt%, hydrolysis temperature are 30 DEG C, pH 8.0, enzymolysis time 44min, ultrasonic frequency 25kHZ.Enzymolysis boils after terminating
Water-bath enzyme deactivation 3min.The composition of marine protein matter amino acid or the sequence of amino acid all have with terrestrial life albumen
Very big difference, bacillus marinus production alkali protease and Porphyra yezoensis protease digest to band Fish protein simultaneously, can
Obtain a large amount of active peptide fragments；
2）Multistage membrane filtration：Filtrate is first passed through into molecular cut off 16kDa, 7kDa respectively again with 0.3 μm of micro-filtrate membrane filtration, filtrate
Milipore filter, concentration filtrate is to the 1/20 of original volume.Purification process is carried out to filtrate by physics mode, it is simple to operate, no
The activity of Functional Polypeptides can be destroyed, has the content of the Functional Polypeptides of repair high in obtained ultrafiltrate to Bones and joints；
3）Nanofiltration：The concentrate that step 2 is obtained carries out nanofiltration operation, and the separating mechanism of NF membrane spreads simultaneously for screening and dissolving
Deposit, while there is electrical charge rejection effect again, can effectively remove divalence and multivalent ion, removal molecular weight are each more than 200
Class material, the material that monovalention and molecular weight are less than 200 can be partly removed, can reach to desalt well and be more than with molecular weight
The purpose of 200 impurity；
4）HPLC is eluted：Elution step is 0 ~ 5min in HPLC elution steps, is eluted with 2% trifluoroacetic acid and 98% acetonitrile, flow velocity
For 1ml/min；5 ~ 15min, eluted with 6% trifluoroacetic acid and 94% acetonitrile, flow velocity 1ml/min；15 ~ 30min, with 10% trifluoro
Acetic acid and the elution of 90% acetonitrile, flow velocity 1ml/min.Elution collects the eluate for having absorption in 250nm after terminating, and merges and dense
It is reduced to the 1/30 of original volume；
5）Freeze-drying：35wt% auxiliary materials are added in the concentrate that step 4 obtains to be freeze-dried.The composition of auxiliary material and its
Parts by weight：86 parts of dextran-40s and 3 parts of active peptides.The amino acid sequence of active peptide is HSHACASYYCSKHSHACKTACAK
FCGTASCTHYLSYLCRVLHPGKLCACVNCSR.Pre-freeze：- 40 DEG C of pre-freeze 5h；Freeze-drying：- 40 DEG C, 3Pa freeze-dryings
5h, -5 DEG C, 12Pa freeze-dryings 2h；Lyophilization：13 DEG C, 52Pa lyophilizations 3.4h；Parsing-desiccation:10 DEG C, 4Pa parsings are dry
Dry 3h, obtain hairtail activity extract；
6）The preparation of compound：By 25 parts of hairtail activity extract, 5 parts of chondroitin sulfate, 10 parts of Glucosamine, calcium citrate
0.5 part well mixed with 38 parts of collagen, crosses 120 mesh sieves, obtains the compound based on hairtail activity extract.
Routine operation in the operating procedure of the present invention is well known to those skilled in the art, herein without repeating.
Technical scheme is described in detail embodiment described above, it should be understood that it is described above only
For the specific embodiment of the present invention, it is not intended to limit the invention, all any modifications made in the spirit of the present invention,
Supplement or similar fashion replacement etc., should be included in the scope of the protection.
SEQUENCE LISTING
<110>Pujiang County is safe such as food science and technology Co., Ltd
<120>Compound based on hairtail activity extract and preparation method thereof
<130> 1
<160> 1
<170> PatentIn version 3.5
<210> 1
<211> 54
<212> PRT
<213>It is artificial synthesized
<400> 1
His Ser His Ala Cys Ala Ser Tyr Tyr Cys Ser Lys His Ser His Ala
1 5 10 15
Cys Lys Thr Ala Cys Ala Lys Phe Cys Gly Thr Ala Ser Cys Thr His
20 25 30
Tyr Leu Ser Tyr Leu Cys Arg Val Leu His Pro Gly Lys Leu Cys Ala
35 40 45
Cys Val Asn Cys Ser Arg
50
Claims (9)
1. the compound based on hairtail activity extract, it is characterised in that composition and its parts by weight are：Hairtail activity extract 20 ~
30 ~ 40 parts of 30 parts, 3 ~ 5 parts of chondroitin sulfate, 7 ~ 14 parts of Glucosamine, 0.2 ~ 0.6 part of calcium citrate and collagen.
2. the compound according to claim 1 based on hairtail activity extract, it is characterised in that：Described hairtail activity
Extract is eluted by complex enzyme zymohydrolysis, multistage membrane filtration, nanofiltration, HPLC and freeze-drying is made；Described complex enzyme zymohydrolysis step
Rapid is to produce alkali protease and Porphyra yezoensis protease hydrolyzed hairtail flesh of fish homogenate using bacillus marinus, and using ultrasound
Ripple assistance enzymolysis.
3. the preparation method of hairtail activity extract according to claim 2, it is characterised in that：Described freeze-drying step
Suddenly it is：Pre-freeze：- 35 ~ -45 DEG C of 3 ~ 5h of pre-freeze；Freeze-drying：- 45 ~ -35 DEG C, 3 ~ 5Pa be freeze-dried 5 ~ 7h, -10 ~ -5 DEG C, 10 ~
20Pa is freeze-dried 2 ~ 3h；Lyophilization：10 ~ 15 DEG C, 50 ~ 60Pa lyophilizations, 3 ~ 4h；Parsing-desiccation:7 ~ 14 DEG C, 3 ~ 5Pa solutions
2 ~ 4h is dried in analysis, obtains the hairtail activity extract for Bones and joints reparation.
4. the preparation method of hairtail activity extract according to claim 2, it is characterised in that：Before described freeze-drying
30 ~ 40wt% auxiliary materials are added, the composition and its parts by weight of auxiliary material are：80 ~ 90 parts of dextran-40s and 2 ~ 5 parts of active peptides.
5. the preparation method of hairtail activity extract according to claim 4, it is characterised in that：The ammonia of described active peptide
Base acid sequence is HSHACASYYCSKHSHACKTACAKFCGTASCTHYLSYLCRVLHPGKLCACVNCSR.
6. the preparation method of hairtail activity extract according to claim 2, it is characterised in that：Described complex enzyme zymohydrolysis
The addition of bacillus marinus production alkali protease and Porphyra yezoensis protease be 1 ~ 2wt% in step, hydrolysis temperature for 25 ~
35 DEG C, pH is 7.0 ~ 9.0, and enzymolysis time is 40 ~ 60min.
7. the preparation method of hairtail activity extract according to claim 2, it is characterised in that：Described multistage membrane filtration
Step is that filtrate is first passed through into molecular cut off 14-18kDa, 6-8kDa respectively again with 0.2 ~ 0.4 μm of micro-filtrate membrane filtration, filtrate
Milipore filter, concentrate filtrate.
8. the preparation method of hairtail activity extract according to claim 2, it is characterised in that：Described HPLC elution steps
Elution step is 0 ~ 5min in rapid, is eluted with 1 ~ 3% trifluoroacetic acid and 98 ~ 99% acetonitriles, flow velocity is 0.8 ~ 1.5ml/min；5~
15min, eluted with 5 ~ 7% trifluoroacetic acids and 93 ~ 95% acetonitriles, flow velocity is 0.8 ~ 1.5ml/min；15 ~ 30min, with 8 ~ 12% trifluoros
Acetic acid and the elution of 88 ~ 92% acetonitriles, flow velocity is 0.8 ~ 1.5ml/min.
9. the preparation method of hairtail activity extract according to claim 2, it is characterised in that：Described HPLC elution steps
The eluate for having absorption in 250nm is collected after elution terminates in rapid, merges and concentrates.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710528630.XA CN107373467A (en) | 2017-07-01 | 2017-07-01 | Compound based on hairtail activity extract and preparation method thereof |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710528630.XA CN107373467A (en) | 2017-07-01 | 2017-07-01 | Compound based on hairtail activity extract and preparation method thereof |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CN107373467A true CN107373467A (en) | 2017-11-24 |
Family
ID=60335185
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201710528630.XA Withdrawn CN107373467A (en) | 2017-07-01 | 2017-07-01 | Compound based on hairtail activity extract and preparation method thereof |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN107373467A (en) |
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN102342404A (en) * | 2011-09-23 | 2012-02-08 | 北京东方红航天生物技术股份有限公司 | Composite calcium preparation |
| CN102747125A (en) * | 2012-06-25 | 2012-10-24 | 宁波武盛化学有限公司 | Preparation method of antioxidative peptide of hairtail |
| CN104926925A (en) * | 2015-03-18 | 2015-09-23 | 浙江海洋学院 | Antioxidant peptide of hairtail fish protein as well as preparation method and uses of antioxidant peptide |
| CN107245508A (en) * | 2017-06-21 | 2017-10-13 | 兰溪市沉默生物科技有限公司 | The hairtail activity extract repaired for Bones and joints |
| CN107312811A (en) * | 2017-06-20 | 2017-11-03 | 兰溪市捷喜食品加工技术有限公司 | The preparation method for the hairtail activity extract repaired for Bones and joints |
-
2017
- 2017-07-01 CN CN201710528630.XA patent/CN107373467A/en not_active Withdrawn
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN102342404A (en) * | 2011-09-23 | 2012-02-08 | 北京东方红航天生物技术股份有限公司 | Composite calcium preparation |
| CN102747125A (en) * | 2012-06-25 | 2012-10-24 | 宁波武盛化学有限公司 | Preparation method of antioxidative peptide of hairtail |
| CN104926925A (en) * | 2015-03-18 | 2015-09-23 | 浙江海洋学院 | Antioxidant peptide of hairtail fish protein as well as preparation method and uses of antioxidant peptide |
| CN107312811A (en) * | 2017-06-20 | 2017-11-03 | 兰溪市捷喜食品加工技术有限公司 | The preparation method for the hairtail activity extract repaired for Bones and joints |
| CN107245508A (en) * | 2017-06-21 | 2017-10-13 | 兰溪市沉默生物科技有限公司 | The hairtail activity extract repaired for Bones and joints |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN103992384B (en) | A kind of large yellow croaker fish bone collagen peptide and its production and use | |
| CN101711591B (en) | Preparation method of fish cartilage extracts and obtained product | |
| CN107236777A (en) | The method that collagen is extracted from crucian fish-skin | |
| CN103772734A (en) | Preparation method of high-purity collagen protein sponge | |
| CN104774896A (en) | Preparation method for iron-chelated collagen peptide of hairtail fish-bones | |
| CN102808010A (en) | Method for preparing antihypertensive peptides through enzymolysis of ground meat proteins of tuna | |
| CN105219827A (en) | The preparation method of air bladder collagen protein multifunctional polypeptide | |
| CN103819552B (en) | A kind of Cyanea capillata polypeptide growth factor and its preparation method and application | |
| CN100369929C (en) | Jellyfish collagen and method for preparing the same | |
| CN106367460A (en) | Method for preparing collagen sponge under acid condition | |
| CN104762358A (en) | Rapid preparation method of mussel protein antihypertensive peptide | |
| CN104131055B (en) | Preparation method for phycoerythrin ACE inhibitory peptide | |
| KR880004084A (en) | Lipase and Lipase Extracts, Their Preparation and Therapeutic Uses | |
| CN107164440A (en) | High F value oligopeptide Coarse liquid separation purification process | |
| CN111235204A (en) | Production method of bone collagen peptide | |
| CN107245098A (en) | With the tuna extract for suppressing cancer cell effect | |
| CN107245508A (en) | The hairtail activity extract repaired for Bones and joints | |
| CN107312811A (en) | The preparation method for the hairtail activity extract repaired for Bones and joints | |
| CN109258916A (en) | A kind of fish scale collagen peptide calcium and preparation method thereof, purposes | |
| CN107373467A (en) | Compound based on hairtail activity extract and preparation method thereof | |
| CN107384999A (en) | From the method for Ba Sha fish-skin abstraction function protein peptides | |
| CN107267583A (en) | Preparation method with the tuna extract for suppressing cancer cell effect | |
| CN107279972A (en) | Compound based on Spanish mackerel active peptides | |
| CN107312063A (en) | The preparation method of blunt top spirulina activated protein | |
| CN103740793A (en) | Method for producing fish skin collagen |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| WW01 | Invention patent application withdrawn after publication |
Application publication date: 20171124 |
|
| WW01 | Invention patent application withdrawn after publication |