WO2024210294A1 - 피부 주름개선용 펩타이드 스냅-8(snap-8) 유도체의 효모 발효 생산 및 이의 이용 - Google Patents
피부 주름개선용 펩타이드 스냅-8(snap-8) 유도체의 효모 발효 생산 및 이의 이용 Download PDFInfo
- Publication number
- WO2024210294A1 WO2024210294A1 PCT/KR2023/019297 KR2023019297W WO2024210294A1 WO 2024210294 A1 WO2024210294 A1 WO 2024210294A1 KR 2023019297 W KR2023019297 W KR 2023019297W WO 2024210294 A1 WO2024210294 A1 WO 2024210294A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- snap
- derivative
- present
- sequence
- producing
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/80—Vectors or expression systems specially adapted for eukaryotic hosts for fungi
- C12N15/81—Vectors or expression systems specially adapted for eukaryotic hosts for fungi for yeasts
- C12N15/815—Vectors or expression systems specially adapted for eukaryotic hosts for fungi for yeasts for yeasts other than Saccharomyces
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K8/00—Cosmetics or similar toiletry preparations
- A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
- A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
- A61K8/64—Proteins; Peptides; Derivatives or degradation products thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q19/00—Preparations for care of the skin
- A61Q19/08—Anti-ageing preparations
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/06—Linear peptides containing only normal peptide links having 5 to 11 amino acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/80—Vectors or expression systems specially adapted for eukaryotic hosts for fungi
- C12N15/81—Vectors or expression systems specially adapted for eukaryotic hosts for fungi for yeasts
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2830/00—Vector systems having a special element relevant for transcription
- C12N2830/70—Vector systems having a special element relevant for transcription from fungi
- C12N2830/702—Vector systems having a special element relevant for transcription from fungi yeast
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12R—INDEXING SCHEME ASSOCIATED WITH SUBCLASSES C12C - C12Q, RELATING TO MICROORGANISMS
- C12R2001/00—Microorganisms ; Processes using microorganisms
- C12R2001/645—Fungi ; Processes using fungi
- C12R2001/84—Pichia
Definitions
- the present invention relates to yeast fermentation production of a peptide Snap-8 derivative for improving skin wrinkles and its use.
- the skin surrounds the entire body and is largely composed of three layers: the epidermis, dermis, and subcutaneous fat.
- the outermost layer, the epidermis contains the stratum corneum, which acts as a skin barrier to protect the body from various external stimuli.
- the stratum corneum and the layered structure of the skin effectively protect the body from external stress or harmful stimuli, but the effective ingredients of cosmetics may not be easily absorbed.
- SNARE Soluble Nethylmaleimide-sensitive factor Attachment Protein Receptor
- SNAP Receptor Soluble Nethylmaleimide-sensitive factor Attachment Protein Receptor
- SNAREs are involved in the binding of synaptic vesicles to the presynaptic membrane in neurons.
- the neurotransmitter release channel opens through the fusion of the presynaptic membrane with synaptic vesicles located at the nerve terminal containing neurotransmitters.
- the t-SNARE complex, a complex of syntaxin 1a protein and SNAP-25 protein attached to the target membrane, and v-SNARE attached to the vesicle are involved, and these SNARE peptides are twisted like a twisted train.
- the excretion of the SNARE complex is also closely related to wrinkles in the skin.
- botulinum toxin which is used to improve wrinkles in the skin, is a protease that cuts the SNARE peptide involved in the release of neurotransmitters. By cutting the SNARE peptide, it blocks neurotransmission and consequently paralyzes the muscle cells into which botulinum toxin has penetrated, thereby affecting the improvement of wrinkles in the skin.
- the inventors of the present invention have made extensive research efforts to develop a peptide having an anti-wrinkle effect that can be produced economically. As a result, the inventors of the present invention have completed the present invention by elucidating that the yeast fermentation-produced peptide (SNAP-8 derivative) of the present invention is not only economically producible but also has an excellent anti-wrinkle effect.
- the problem to be solved by the present invention is to provide an expression cassette for producing a SNAP-8 derivative.
- Another problem to be solved by the present invention is to provide an expression vector for producing a SNAP-8 derivative.
- Another problem to be solved by the present invention is to provide a transformant comprising an expression vector for producing a SNAP-8 derivative.
- Another problem that the present invention seeks to solve is to provide a method for producing a SNAP-8 derivative.
- Another problem to be solved by the present invention is to provide a pharmaceutical composition for preventing or treating skin wrinkles comprising a SNAP-8 derivative.
- Another problem to be solved by the present invention is to provide a cosmetic composition for preventing or improving wrinkles comprising a SNAP-8 derivative.
- Another problem to be solved by the present invention is to provide a pharmaceutical composition for preventing or improving skin wrinkles containing a SNAP-8 derivative.
- the inventors of the present invention have made extensive research efforts to develop a peptide having an anti-wrinkle effect that can be produced economically. As a result, it was discovered that the yeast fermentation-produced peptide of the present invention (SNAP-8 derivative) is not only economically producible but also has an excellent anti-wrinkle effect.
- the present invention relates to an expression cassette for producing a SNAP-8 derivative, an expression vector for producing a SNAP-8 derivative, a transformant comprising the expression vector for producing a SNAP-8 derivative, a method for producing a SNAP-8 derivative using the same, a pharmaceutical composition for preventing or treating skin wrinkles comprising a SNAP-8 derivative, a cosmetic composition for preventing or improving skin wrinkles comprising a SNAP-8 derivative, and a quasi-drug composition for preventing or improving skin wrinkles comprising a SNAP-8 derivative.
- One aspect of the present invention relates to an expression cassette for producing a SNAP-8 derivative, comprising a polynucleotide sequence represented by SEQ ID NO: 1 encoding a SNAP-8 (Acetyl octapeptide-3) derivative, wherein the polynucleotide sequence is operably linked to a promoter sequence capable of being expressed in yeast and a fusion partner SUMO3 sequence.
- the term "Acetyl octapeptide-3 (SNAP-8)" is a peptide cosmetic raw material with anti-wrinkle efficacy, but has the disadvantages of being produced by chemical synthesis, which results in a high unit price and the inclusion of various chemical substances. Accordingly, in order to supplement this, the inventors of the present invention have produced a strain producing SNAP-8 (short nucleic acid sequence, EEMQRRAD) through gene work, and have produced SNAP-8 through yeast fermentation.
- EEMQRRAD short nucleic acid sequence
- SNAP-8 derivative in the present invention refers to a peptide in which P is additionally attached in front of the existing SNAP-8 sequence, and the peptide produced by fermentation as a multimer can be converted into a monomer using a cleavage method utilizing formic acid during the separation and purification process, thereby enabling economical production.
- expression cassette for producing a SNAP-8 derivative means an expression construct capable of expressing a SNAP-8 derivative.
- the expression cassette may include a polynucleotide sequence encoding the SNAP-8 derivative, and specifically, the polynucleotide sequence encoding the SNAP-8 derivative included in the expression cassette may be composed of a base sequence (PEEMQRRAD) represented by SEQ ID NO: 1, but is not limited thereto.
- PEEMQRRAD a base sequence represented by SEQ ID NO: 1, but is not limited thereto.
- the base sequence used in the present invention is interpreted to include a sequence showing substantial identity with the sequence described in the sequence listing, considering a mutation having biologically equivalent activity.
- the term, 'substantial identity' means a sequence showing at least 60% homology, more specifically 70% homology, even more specifically 80% homology, and most specifically 90% homology, when the sequence of the present invention and any other sequence are aligned to the greatest extent possible and the aligned sequence is analyzed using an algorithm commonly used in the art.
- a base sequence having a high homology with the base sequence represented by the above sequence number 1 for example, a base sequence having a high homology of 70% or more, specifically 80% or more, and more specifically 90% or more, is also included in the scope of the present invention.
- the expression cassette for producing the SNAP-8 derivative may include a polynucleotide sequence represented by the sequence number 1 repeated multiple times.
- the expression cassette for producing the SNAP-8 derivative may be one in which the polynucleotide sequence represented by the above sequence number 1 is operably linked to a promoter sequence capable of being expressed in yeast and a high expression/high secretion signal sequence.
- the promoter may be AOX1, TEF, GAP or a combination thereof, but is not particularly limited thereto as long as it is a promoter suitable for expression in yeast.
- the sequence of the exemplified promoter may be a sequence known in the art.
- the high expression/high secretion signal sequence may be the fusion partner SUMO3, but is not particularly limited thereto as long as it can increase efficiency.
- the exemplified high expression/high secretion signal sequence may use a sequence known in the art.
- operably linked means a state in which a nucleic acid expression regulatory sequence and a nucleic acid sequence encoding a desired protein or peptide are functionally linked to perform a general function.
- a promoter and a nucleic acid sequence encoding a protein or peptide are operably linked to affect the expression of the coding sequence.
- the operably linked sequence with an expression vector can be produced using a genetic recombination technique well known in the art, and site-specific DNA cleavage and linkage can be performed using enzymes generally known in the art.
- the expression cassette for producing the SNAP-8 derivative may additionally include a polynucleotide encoding His upstream or downstream of the polynucleotide sequence in the expression cassette to facilitate purification of the expressed multimer SNAP-8 derivative.
- the expression cassette for producing the SNAP-8 derivative may further include components that control the expression of the SNAP-8 derivative, such as a transcription enhancer, a terminator, an initiator, and other genetic regulatory elements, in addition to a promoter, a high expression/high secretion signal sequence, a sequence encoding the SNAP-8 derivative, and a sequence such as His.
- an expression cassette for producing a SNAP-8 derivative was constructed, in which a TEF promoter sequence (SEQ ID NO: 2), an ⁇ -factor sequence (SEQ ID NO: 3), a His-tag sequence, a SUMO3 sequence (SEQ ID NO: 4), a D sequence, a polynucleotide sequence encoding a SNAP-8 derivative (SEQ ID NO: 1), and a CYC1 terminator sequence (SEQ ID NO: 5) were sequentially inserted (see FIG. 1).
- a TEF promoter sequence SEQ ID NO: 2
- an ⁇ -factor sequence SEQ ID NO: 3
- His-tag sequence a His-tag sequence
- a SUMO3 sequence SEQ ID NO: 4
- D sequence a polynucleotide sequence encoding a SNAP-8 derivative
- SEQ ID NO: 5 a CYC1 terminator sequence
- Another aspect of the present invention relates to an expression vector for producing a SNAP-8 derivative, comprising the expression cassette for producing a SNAP-8 derivative as described above.
- expression vector may refer to a genetic construct including essential regulatory elements operably linked to cause expression of a SNAP-8 derivative, which is a target peptide, as a means for efficiently inducing expression of a target gene by introducing DNA into a host cell.
- the above expression vector include a plasmid vector, a cosmid vector, a bacteriophage vector, or a viral vector. More specific examples include a plasmid derived from E. coli (pBR322, pBR325, pUC118, pUC119, pET30a, pET30c, or pGEX-GST), a plasmid derived from Bacillus subtilis (pUB110 or pTP5), a plasmid derived from yeast (YEp13, YEp24, YCp50, pPINK ⁇ -HC, pPink-HC, or pPink-LC), or a Ti plasmid, and animal viruses such as retrovirus, adenovirus, or vaccinia virus, insect viruses such as baculovirus, or plant viruses can be used, and binary vectors such as the pPZP, pGA, and pCAMBIA series can be used, but are not limited thereto as long as long as
- the expression vector may be functionally linked to an expression control sequence.
- the vector may include, in addition to expression control elements such as a promoter, an operator, an initiation codon, a termination codon, a polyadenylation signal, and an enhancer, a signal sequence or a leader sequence for membrane targeting or secretion, but is not limited thereto, and may be variously produced according to the purpose of the invention.
- it may include a selectable marker, and may self-replicate or be integrated into host DNA.
- the vector of the present invention may be produced using a genetic recombination technique well known in the art, and site-specific DNA cleavage and ligation may be performed using an enzyme generally known in the art.
- the expression cassette for producing the SNAP-8 derivative was inserted into the expression vector pPink ⁇ -HC vector using a conventional method to produce an expression vector for producing a SNAP-8 derivative (see FIGS. 2a and 2b).
- Another aspect of the present invention relates to a transformant comprising an expression vector for producing a SNAP-8 derivative as described above.
- transformant refers to an organism whose genetic traits have been changed by the introduction of foreign genetic material.
- the transformant may be a strain of the genus Pichia , Escherichia , Saccharomyces , Zygosaccharomyces , Kluyveromyces , Candida , Schizosaccharomyces , Issachenkia , Yarrowia or Hansenula , but is not particularly limited thereto as long as it can express the SNAP-8 derivative.
- the transformant may be Pichia pastoris, but is not particularly limited thereto as long as it can express the SNAP-8 derivative.
- the Pichia pastoris refers to a yeast strain most widely used for producing recombinant proteins.
- the yeast strain has the advantages of being easy to genetically manipulate, various expression systems have been developed, and easy to mass-cultivate. In addition, it provides the advantages of being able to perform a secretion function that can secrete proteins out of cells when producing recombinant proteins derived from higher cells such as human proteins, and a post-translational modification function of proteins such as sugar chain addition.
- Secretory production of recombinant proteins is made possible by artificially fusing a protein secretion signal and a target protein to enable secretion out of cells, and since protein folding, disulfide bond formation, and sugar chain addition processes proceed through the protein secretion process, it has the advantage of being able to produce recombinant proteins that are biologically fully active.
- a protein with biological activity can be obtained directly from a medium, it is very economical because it does not require economically inefficient cell pulverization or refolding steps.
- the expression vector for producing the SNAP-8 derivative was introduced (transformed) into a P. pastoris strain by a conventional method to produce a transformant (see Production Example).
- Another aspect of the present invention relates to a method for producing a SNAP-8 derivative, comprising the steps of culturing a transformant comprising the expression vector for producing the above-described SNAP-8 derivative; and the steps of isolating and purifying a peptide expressed from the cultured transformant.
- the step of culturing the above transformant can be performed taking into account the nutritional requirements of the transformant.
- P. pastoris is a methylotrophic yeast cell, and for its cultivation, buffered complex methanol medium (BMMY), buffered minimal methanol medium (BMM), etc. can be used, but are not limited thereto, and can be appropriately selected by a person skilled in the art according to the purpose of the invention.
- BMMY buffered complex methanol medium
- BMM buffered minimal methanol medium
- the recovery of the SNAP-8 derivative from the culture of the transformant can be performed by a method known in the art. Specifically, methods such as centrifugation, filtration, extraction, spraying, drying, distillation, precipitation, crystallization, electrophoresis, differential dissolution (e.g., ammonium sulfate precipitation), chromatography (e.g., ion exchange, affinity, hydrophobicity, and size exclusion) can be used, but are not particularly limited thereto as long as the SNAP-8 derivative of the present invention can be recovered.
- methods such as centrifugation, filtration, extraction, spraying, drying, distillation, precipitation, crystallization, electrophoresis, differential dissolution (e.g., ammonium sulfate precipitation), chromatography (e.g., ion exchange, affinity, hydrophobicity, and size exclusion) can be used, but are not particularly limited thereto as long as the SNAP-8 derivative of the present invention can be recovered.
- the step of isolating and purifying the SNAP-8 derivative expressed from the cultured transformant may additionally include a step of cleaving the expressed multimer SNAP-8 derivative into a monomer SNAP-8 derivative.
- formic acid may be used in the step of isolating and purifying the SNAP-8 derivative expressed from the cultured transformant, but is not limited thereto, and may be appropriately selected by a person skilled in the art in accordance with the purpose of the invention.
- a P. pastoris transformant containing an expression vector for producing a SNAP-8 derivative was cultured under various fermentation conditions, and then collected and dissolved to isolate a SNAP-8 derivative.
- a multimeric SNAP-8 derivative was cleaved into a monomeric SNAP-8 derivative using formic acid, and then separated and purified from the fermentation broth, and the SNAP-8 derivative fermentation product was confirmed through HPLC analysis (see Preparation Example).
- Another aspect of the present invention relates to a pharmaceutical composition for preventing or treating skin wrinkles, comprising a SNAP-8 derivative prepared by the method described above.
- the pharmaceutical composition of the present invention includes all dosage forms, but is not necessarily limited to a specific dosage form, and specific examples of dosage forms include plasters, granules, lotions, liniments, lemonades, aromatic waters, powders, syrups, liquids and solutions, aerosols, extracts, elixirs, ointments, fluidextracts, emulsions, suspensions, decoctions, infusions, tablets, suppositories, injections, spirits, cataplasmas, capsules, creams, It may be any one of troches, tinctures, pastes, pills, soft or hard gelatin capsules.
- the pharmaceutical composition of the present invention may further comprise a pharmaceutically acceptable carrier, diluent or excipient.
- a pharmaceutically acceptable carrier diluent or excipient.
- Usable carriers, excipients or diluents include lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, maltitol, starch, acacia gum, alginate, gelatin, calcium phosphate, calcium silicate, cellulose, methyl cellulose, microcrystalline cellulose, polyvinyl pyrrolidone, water, methyl hydroxybenzoate, propyl hydroxybenzoate, talc, magnesium stearate and mineral oil, and one or more selected from among these may be used.
- the content of the active ingredient peptide of the present invention included in the pharmaceutical composition of the present invention is preferably adjusted according to the method of use and the condition of the recipient. Preferably, it may be added to the pharmaceutical composition in an amount of 0.000001 to 50 wt% based on the dry weight, but is not necessarily limited thereto. However, if the content is less than 0.000001 wt%, the pharmacological effect may be minimal, and if it exceeds 50 wt%, the pharmacological effect increase rate is low compared to the amount used, which may be uneconomical.
- the dosage of the pharmaceutical composition of the present invention is preferably determined in consideration of the method of administration, the age, sex, and weight of the recipient, etc. For example, the composition of the present invention can be administered once or more at 0.000001 to 1 g/kg (body weight) per day. However, the above dosage is merely an example for illustrative purposes and may vary depending on the condition of the recipient.
- Another aspect of the present invention relates to a cosmetic composition for preventing or improving skin wrinkles, comprising a SNAP-8 derivative prepared by the method described above.
- the cosmetic composition of the present invention is not limited to a specific form (formulation), and may be prepared in a form selected from the group consisting of a solution, an external ointment, a cream, a foam, a nourishing toner, an emollient toner, a pack, an emollient, an emulsion, a makeup base, an essence, a soap, a liquid cleanser, a bath agent, a sunscreen cream, a sun oil, a suspension, an emulsion, a paste, a gel, a lotion, a powder, a soap, a surfactant-containing cleansing, an oil, a powder foundation, an emulsion foundation, a wax foundation, a patch, and a spray, but is not limited thereto.
- the cosmetic composition of the present invention may additionally contain one or more cosmetically acceptable carriers that are blended with general skin cosmetics, and may appropriately blend conventional ingredients such as oil, water, surfactants, moisturizers, lower alcohols, thickeners, chelating agents, pigments, preservatives, fragrances, etc., but is not limited thereto.
- the cosmetically acceptable carrier included in the cosmetic composition of the present invention varies depending on the formulation of the cosmetic composition.
- the formulation of the present invention is an ointment, paste, cream or gel, animal oil, vegetable oil, wax, paraffin, starch, tragacanth, cellulose derivatives, polyethylene glycol, silicone, bentonite, silica, talc, zinc oxide, etc. can be used as a carrier component, but are not limited thereto. These can be used alone or in a mixture of two or more.
- lactose, talc, silica, aluminum hydroxide, calcium silicate, polyamide powder, etc. can be used as carrier components, and especially in the case of a spray, a propellant such as chlorofluorocarbons, propane/butane, or dimethyl ether can be additionally included, but is not limited thereto. These can be used alone or in a mixture of two or more.
- a solvent, a solubilizer or an emulsifier can be used as a carrier component, and for example, water, ethanol, isopropanol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butyl glycol oil, and the like can be used, and in particular, cottonseed oil, peanut oil, corn germ oil, olive oil, castor oil and sesame oil, glycerol aliphatic ester, polyethylene glycol or fatty acid ester of sorbitan can be used, but is not limited thereto. These can be used alone or in a mixture of two or more.
- liquid diluents such as water, ethanol or propylene glycol
- suspending agents such as ethoxylated isostearyl alcohol, polyoxyethylene sorbitol ester and polyoxyethylene sorbitan ester, microcrystalline cellulose, aluminum metahydroxide, bentonite, agar or tragacanth may be used as carrier components, but are not limited thereto. These may be used alone or in combination of two or more.
- alkali metal salts of fatty acids fatty acid hemiester salts, fatty acid protein hydrolysates, isethionates, lanolin derivatives, fatty alcohols, vegetable oils, glycerol, sugars, etc. can be used as carrier components, but are not limited thereto. These can be used alone or in combination of two or more.
- the carrier component may include, but is not limited to, aliphatic alcohol sulfate, aliphatic alcohol ether sulfate, sulfosuccinic acid monoester, isethionate, imidazolinium derivative, methyl taurate, sarcositate, fatty acid amide ether sulfate, alkyl amidobetaine, fatty alcohol, fatty acid glyceride, fatty acid diethanolamide, vegetable oil, lanolin derivative, or ethoxylated glycerol fatty acid ester. These may be used alone or in a mixture of two or more.
- the cosmetic composition of the present invention may contain conventional auxiliary agents in the cosmetic field, such as hydrophilic or lipophilic gelling agents, hydrophilic or lipophilic active agents, preservatives, antioxidants, solvents, fragrances, fillers, blocking agents, pigments, deodorants, and dyes.
- auxiliary agents such as hydrophilic or lipophilic gelling agents, hydrophilic or lipophilic active agents, preservatives, antioxidants, solvents, fragrances, fillers, blocking agents, pigments, deodorants, and dyes.
- Another aspect of the present invention relates to a pharmaceutical composition for preventing or improving skin wrinkles, comprising a SNAP-8 derivative prepared by the method described above.
- the pharmaceutical composition of the present invention can be manufactured in a formulation selected from the group consisting of body cleanser, soap, and hand wash, but is not limited thereto.
- the present invention relates to yeast fermentation production of a peptide Snap-8 derivative for improving skin wrinkles and its use.
- a high-purity SNAP-8 derivative can be produced in large quantities at a low cost.
- the SNAP-8 derivative produced according to the present invention has an excellent anti-wrinkle effect, it can be widely used in various industries such as cosmetic materials, quasi-drugs, and pharmaceuticals for related purposes.
- Figure 1 is a schematic diagram of a DNA cassette manufactured according to one embodiment of the present invention.
- FIG. 2A and FIG. 2B are vector maps manufactured according to one embodiment of the present invention, where FIG. 2A is a 10-mer vector map and FIG. 2B is a 50-mer vector map.
- Figure 3 is a diagram confirming the D-P cleavage result of a SNAP-8 derivative according to one embodiment of the present invention.
- FIG. 4 is a diagram confirming the results of formic acid removal before/after freeze-drying after D-P cleavage of a SNAP-8 derivative according to one embodiment of the present invention.
- FIG. 5 is a diagram confirming the wrinkle improvement effect (membrane fusion assay) of a SNAP-8 derivative according to one embodiment of the present invention.
- a yeast strain ( Pichia pastoris ) recognized as safe for production was used.
- a DNA cassette for producing a multimeric SNAP-8 derivative capable of formic acid cleavage was prepared through gene work (see Fig. 1 and Table 1 below), and a vector (10 mer, 50 mer) containing the same (see Figs. 2a and 2b) was introduced (transformed) into a P. pastoris strain to produce a transformant. At this time, stable expression was induced by inserting fusion partner SUMO3.
- a medium suitable for a yeast strain for producing a SNAP-8 derivative was selected, and the strain was cultured in the medium at a scale of 10 L/flask.
- Flask test Promoter AOX1 TEF GAP Volume Baffled flask 30 ml / 250 ml Baffled flask 50 ml / 250 ml Fed-batch 0.5% Methanol, 1 ml / day 2% Glucose, 1 ml / day 2% Glucose, 1 ml / day Initial OD 600 25 ⁇ 30 Temperature 30°C After methanol induction 24°C 30°C Agitation 247 rpm Time 96 hr Media condition BMGY or BMMY 1% Yeast extract 2% Peptone 2% Glucose or 0.5% Methanol 100mM Potassium phosphate pH 6.0 Biotin 12 ppm BMGY 1% Yeast extract 2% Peptone 2% Glucose 100mM Potassium phosphate pH 6.0 Biotin 12 ppm YPDZ 1% Yeast extract 2% Peptone 2% Glucose 25 ⁇ g/L Zeocin
- the above-mentioned cultured yeast solution was centrifuged (3,000 rpm, 10 minutes) to recover only the supernatant (to remove the cells), and the culture solution and acetone were added in a ratio of 6:4 and frozen for 2 hours.
- the pellet was recovered by centrifugation (3,000 rpm, 10 minutes) and completely dried.
- a cleavage process using formic acid was performed - formic acid treatment of the His-tag purified fermentation product (see Table 4 below) and neutralization with 1 M NH 4 OH. HPLC analysis was performed after lyophilization.
- the formic acid treatment concentration, temperature, and time in Table 4 are illustrative and not limiting and may vary.
- the temperature may be about 30° C. to 40° C., or about 33° C. to 39° C., or about 35° C. to 38° C.
- the formic acid treatment concentration (%) may be about 50% to 99%, or about 60% to 95%, or about 60% to 90%.
- the treatment time may be about 40 hours to 120 hours, or about 45 hours to 100 hours.
- multimeric SNAP-8 derivatives were produced before formic acid treatment, and it was found that the multimers were cleaved into monomers after formic acid treatment. Furthermore, as can be seen in Fig. 4, it was found that formic acid was removed after freeze-drying.
- the membrane fusion inhibition effect was confirmed for three peptide samples (Argirelin, Argirelin derivative, SNAP-8) other than the SNAP-8 derivative peptide manufactured in the above manufacturing example.
- liposomes which are fine membrane-like particles labeled with fluorescent substances
- the fluorescence wavelength of NBD-PE is 465 nm/530 nm (excitation/emission), and the fluorescence wavelength of Rhodamine is 465 nm/625 nm (excitation/emission), so that Rhodamine can absorb the emission wavelength of NBD-PE.
- the method is called a fluorescence resonance energy transfer system (FRET (Flourescence Energy Transfer) system), and as the membrane fusion of T-vesicles and T-vesicles progresses, the distance between BDPE and Rhodamine increases, so that the absorbance can be measured over time, and the absorbance value of NBD-PE increases and that of Rhodamine decreases.
- FRET Fluorescence Energy Transfer
- Argirelin, Argirelin derivatives, SNAP-8, and SNAP-8 derivatives showed membrane fusion inhibition effects by SNARE complex formation of 1.83%, 17.36%, 26.03%, and 27.40%, respectively.
- SNAP-8 derivatives showed the best membrane fusion inhibition effect.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Medicinal Chemistry (AREA)
- Biotechnology (AREA)
- Wood Science & Technology (AREA)
- General Engineering & Computer Science (AREA)
- Biomedical Technology (AREA)
- Dermatology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Zoology (AREA)
- Molecular Biology (AREA)
- Mycology (AREA)
- Epidemiology (AREA)
- Pharmacology & Pharmacy (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Birds (AREA)
- Physics & Mathematics (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Plant Pathology (AREA)
- Microbiology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Gerontology & Geriatric Medicine (AREA)
- Immunology (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Abstract
본 발명은 피부 주름개선용 펩타이드 스냅-8(Snap-8) 유도체의 효모 발효 생산 및 이의 이용에 관한 것으로, 본 발명의 SNAP-8 유도체 제조용 발현 카세트, 발현 벡터 및 이를 포함하는 형질전환체를 이용하면, 적은 비용으로 고순도의 SNAP-8 유도체를 대량으로 제조할 수 있다. 또한, 본 발명에 따라 제조된 SNAP-8 유도체는 항-주름 효과가 뛰어나므로, 관련 용도의 화장품 소재, 의약외품 및 의약품 등 산업 전반에 널리 이용될 수 있다.
Description
본 발명은 피부 주름개선용 펩타이드 스냅-8(Snap-8) 유도체의 효모 발효 생산 및 이의 이용에 관한 것이다.
피부는 전신을 둘러싸며 크게 표피, 진피, 피하지방의 3층 구조로 이루어져 있다. 이 중 최외곽에 위치한 표피에는 각질층(stratum corneum)이 존재함으로써 외부의 여러 자극원으로부터 인체를 보호하는 피부장벽의 역할을 한다. 각질층 및 피부의 층 구조는 외부의 스트레스나 해로운 자극으로부터 인체를 효과적으로 보호할 수 있게 하지만 화장품의 유효성분 또한 쉽게 흡수되지 못할 수 있다.
본 기술분야에서 미백, 주름, 항산화, 항노화 등의 기능성 화장품의 신소재 개발과 더불어 실제적으로 피부에 적용 시 경피 흡수율을 높이는 것이 중요한 과제이다. 피부라는 매우 뛰어난 장벽에 의해 유효성분이 원활히 흡수되지 못하기 때문에 아무리 뛰어난 효능을 가진 성분이라고 할지라도 피부에 적용 시 그 효과를 발휘하지 못할 수 있다.
한편, SNARE(Soluble Nethylmaleimide-sensitive factor Attachment Protein Receptor; SNAP Receptor) 펩타이드는 모든 종에 존재하는 특정 단백질 군을 말하며, 주된 역할은 소포 융합(vesicle fusion) 매개이다. 즉 SNARE는 신경세포에서 시냅스 소포(synaptic vesicle)와 시냅스 전 막(presynaptic membrane)의 결합에 관여한다.
신경전달물질을 함유하는 신경말단에 위치하는 시냅스 소포와 시냅스 전 막의 막융합에 의해 신경전달물질 배출 통로가 열리게 되는데, 표적 막(target membrane)에 부착되어 있는 신탁신(Syntaxin) 1a protein과 SNAP-25 protein의 complex인 t-SNARE complex와 소포에 부착되어 있는 v-SNARE가 관여하게 되고, 이들 SNARE 펩타이드는 꽈배기처럼 꼬여 있게 된다.
생체막들은 서로 강하게 밀어내므로 이들 막은 자발적으로 융합되지 않고 외부에서 강한 힘이 주어져 막들 간의 반발력을 극복하여야 하는데, 이러한 힘을 제공하는 것이 SNARE 펩타이드인 것으로 알려져 있다. 이와 같이 SNARE complex의 형성은 신경전달물질의 배출을 포함하는 세포 외 배출작용(exocytosis)의 주요 현상이다.
SNARE complex의 배출작용은 피부의 주름에도 밀접한 연관성을 갖고 있다. 예로 피부 주름 개선용으로 사용중인 보톡스는 신경전달 물질 배출에 관여하는 SNARE 펩타이드를 절단하는 프로테아제로서, SNARE 펩타이드를 절단함으로써 신경전달을 차단하고 결과적으로 보톡스가 침투된 근육세포를 마비시킴으로써 피부 주름개선에 영향을 준다.
본 발명자들은 경제적 생산이 가능한 항-주름 효과를 가진 펩타이드를 개발하고자 예의 연구 노력하였다. 그 결과 본 발명의 효모 발효 생산 펩타이드(SNAP-8 유도체)가 경제적 생산이 가능할 뿐만 아니라 항-주름 효과도 우수함을 규명함으로써 본 발명을 완성하게 되었다.
본 발명이 해결하고자 하는 과제는 SNAP-8 유도체 제조용 발현 카세트를 제공하는 것이다.
본 발명이 해결하고자 하는 다른 과제는 SNAP-8 유도체 제조용 발현 벡터를 제공하는 것이다.
본 발명이 해결하고자 하는 또 다른 과제는 SNAP-8 유도체 제조용 발현 벡터를 포함하는 형질전환체를 제공하는 것이다.
본 발명이 해결하고자 하는 또 다른 과제는 SNAP-8 유도체의 제조방법을 제공하는 것이다.
본 발명이 해결하고자 하는 또 다른 과제는 SNAP-8 유도체를 포함하는 피부주름 예방 또는 치료용 약학적 조성물을 제공하는 것이다.
본 발명이 해결하고자 하는 또 다른 과제는 SNAP-8 유도체를 포함하는 피부주름 방지 또는 개선용 화장료 조성물을 제공하는 것이다.
본 발명이 해결하고자 하는 또 다른 과제는 SNAP-8 유도체를 포함하는 피부주름 방지 또는 개선용 의약외품 조성물을 제공하는 것이다.
본 발명의 과제들은 이상에서 언급한 기술적 과제로 제한되지 않으며, 언급되지 않은 또 다른 기술적 과제들은 아래의 기재로부터 당업자에게 명확하게 이해될 수 있을 것이다.
본 발명자들은 경제적 생산이 가능한 항-주름 효과를 가진 펩타이드를 개발하고자 예의 연구 노력하였다. 그 결과, 본 발명의 효모 발효 생산 펩타이드(SNAP-8 유도체)가 경제적 생산이 가능할 뿐만 아니라 항-주름 효과도 우수함을 규명하였다.
본 발명은 SNAP-8 유도체 제조용 발현 카세트, SNAP-8 유도체 제조용 발현 벡터, SNAP-8 유도체 제조용 발현 벡터를 포함하는 형질전환체, 이를 이용한 SNAP-8 유도체의 제조방법, SNAP-8 유도체를 포함하는 피부주름 예방 또는 치료용 약학적 조성물, SNAP-8 유도체를 포함하는 피부주름 방지 또는 개선용 화장료 조성물 및 SNAP-8 유도체를 포함하는 피부주름 방지 또는 개선용 의약외품 조성물에 관한 것이다.
이하, 본 발명을 더욱 자세히 설명하고자 한다.
본 발명의 일 양태는 SNAP-8(Acetyl octapeptide-3) 유도체를 코딩하는, 서열번호 1로 표시되는 폴리뉴클레오티드 서열을 포함하고, 상기 폴리뉴클레오티드 서열이 효모에서 발현될 수 있는 프로모터 서열 및 Fusion partner SUMO3 서열과 작동가능하게 연결되어 있는, SNAP-8 유도체 제조용 발현 카세트에 관한 것이다.
본 발명에서 용어 "Acetyl octapeptide-3(SNAP-8)"는 항 주름 효능을 가진 펩타이드 화장품 원료로, 화학적 합성으로 생산되어 단가가 높고 여러 화학물질이 함유될 수 있는 단점이 있다. 이에, 본 발명자는 이를 보완하기 위하여 Gene work을 통해 SNAP-8(짧은 핵산 서열, EEMQRRAD)를 생산하는 균주를 제조하였으며, 효모 발효를 통해 SNAP-8를 생산한 바 있다.
본 발명에서 용어 "SNAP-8 유도체"는 기존 SNAP-8 서열 앞에 P가 추가로 붙어 있는 펩타이드로, 분리, 정제 과정에서 포름산(formic acid)를 활용한 절단(cleavage) 방법을 사용하여 멀티머(multimer)로 발효 생산한 펩타이드를 모노머(monomer)로 전환할 수 있는 바, 경제적인 생산이 가능하다.
본 발명의 용어, "SNAP-8 유도체 제조용 발현 카세트"는 SNAP-8 유도체를 발현할 수 있는 발현구조체를 의미한다.
본 발명에서 상기 발현 카세트는 상기 SNAP-8 유도체를 코딩하는 폴리뉴클레오티드 서열을 포함할 수 있으며, 구체적으로 상기 발현 카세트가 포함하는 SNAP-8 유도체를 코딩하는 폴리뉴클레오티드 서열은 서열번호 1로 표시되는 염기서열(PEEMQRRAD)로 이루어진 것일 수 있으나, 이에 제한되는 것은 아니다.
본 발명에서 이용되는 염기서열은, 생물학적으로 균등 활성을 갖는 변이를 고려한다면, 서열목록에 기재된 서열과 실질적인 동일성(substantial identity)을 나타내는 서열도 포함하는 것으로 해석된다. 상기 용어, '실질적인 동일성'은 본 발명의 서열과 임의의 다른 서열을 최대한 대응되도록 얼라인(align)하고, 당업계에서 통상적으로 이용되는 알고리즘을 이용하여 얼라인된 서열을 분석한 경우에, 최소 60%의 상동성, 더욱 구체적으로 70%의 상동성, 더더욱 구체적으로 80%의 상동성, 가장 구체적으로 90%의 상동성을 나타내는 서열을 의미한다.
따라서 상기 서열번호 1로 표시되는 염기서열과 높은 상동성을 갖는 염기서열, 예를 들면 그 상동성이 70% 이상, 구체적으로 80% 이상, 더욱 구체적으로 90%이상의 높은 상동성을 갖는 염기서열도 본 발명의 범위에 포함되는 것으로 해석되어야 한다.
본 발명의 일 구현예에 따르면, 상기 SNAP-8 유도체 제조용 발현 카세트는 상기 서열번호 1로 표시되는 폴리뉴클레오티드 서열이 복수 회 반복하여 포함되는 것일 수 있다.
또한, 상기 SNAP-8 유도체 제조용 발현 카세트는 상기 서열번호 1로 표시되는 폴리뉴클레오티드 서열이, 효모에서 발현될 수 있는 프로모터 서열 및 고발현/고분비 신호 서열과 작동가능하게 연결된 것일 수 있다.
구체적인 예로, 상기 프로모터는 AOX1, TEF, GAP 또는 이들의 조합일 수 있으나, 효모에서 발현하기에 적절한 프로모터라면 특별히 이에 제한되지 않는다. 상기 예시된 프로모터의 서열은 당업계에 알려진 서열을 사용할 수 있다.
다른 구체적인 예로, 상기 고발현/고분비 신호 서열은 Fusion partner SUMO3일 수 있으나, 효율을 증대시킬 수 있으면 특별히 이에 제한되지 않는다. 상기 예시된 고발현/고분비 신호 서열은 당업계에 알려진 서열을 사용할 수 있다.
본 발명에서 용어, "작동가능하게 연결된(operably linked)"은 일반적 기능을 수행하도록 핵산 발현조절 서열과 목적하는 단백질 또는 펩타이드를 코딩하는 핵산 서열이 기능적으로 연결(functional linkage)되어 있는 상태를 의미한다. 예로, 프로모터와 단백질 또는 펩타이드를 코딩하는 핵산 서열이 작동가능하게 연결되어 코딩 서열의 발현에 영향을 미칠 수 있다. 발현 벡터와의 작동적 연결은 당해 기술분야에서 잘 알려진 유전자 재조합 기술을 이용하여 제조할 수 있으며, 부위 특이적 DNA 절단 및 연결은 당해 기술분야에서 일반적으로 알려진 효소 등을 사용할 수 있다.
또한, 상기 SNAP-8 유도체 제조용 발현 카세트는 발현된 멀티머(multimer) SNAP-8 유도체의 정제를 용이하게 하기 위하여, 상기 발현 카세트 내의 상기 폴리뉴클레오티드 서열의 업스트림 또는 다운스트림에 His을 코딩하는 폴리뉴클레오티드를 추가로 포함할 수 있다.
또한, 상기 SNAP-8 유도체 제조용 발현 카세트는 프로모터, 고발현/고분비 신호 서열, SNAP-8 유도체를 코딩하는 서열 및 His 등의 서열 외에도 전사증강인자, 종결인자, 개시인자 및 다른 유전적 조절 인자들과 같은 SNAP-8 유도체의 발현을 조절하는 구성요소들을 더 포함할 수 있다.
본 발명의 일 실시예에서는, TEF 프로모터 서열(서열번호 2), α-factor 서열(서열번호 3), His-tag 서열, SUMO3 서열(서열번호 4), D 서열, SNAP-8 유도체를 코딩하는 폴리뉴클레오티드 서열(서열번호 1), 및 CYC1 터미네이터 서열(서열번호 5)이 순차적으로 삽입된 SNAP-8 유도체 제조용 발현 카세트를 제작하였다(도 1 참조).
본 발명의 다른 일 양태는 상술한 SNAP-8 유도체 제조용 발현 카세트를 포함하는, SNAP-8 유도체 제조용 발현 벡터에 관한 것이다.
본 발명의 용어, "발현 벡터"는 숙주세포에 DNA를 도입하여 목적 유전자의 발현을 효율적으로 유도하기 위한 수단으로서, 구체적으로 목적 펩타이드인 SNAP-8 유도체가 발현되도록 작동가능하게 연결된 필수적인 조절 요소를 포함하는 유전자 작제물을 의미할 수 있다.
상기 발현 벡터의 구체적인 예로, 플라스미드 벡터, 코스미드 벡터, 박테리오파지 벡터 또는 바이러스 벡터 등을 들 수 있다. 더욱 구체적인 예로, 대장균 유래 플라스미드(pBR322, pBR325, pUC118, pUC119, pET30a, pET30c 또는 pGEX-GST), 바실러스 서브틸러스 유래 플라스미드(pUB110 또는 pTP5), 효모 유래 플라스미드(YEp13, YEp24, YCp50, pPINKα-HC, pPink-HC 또는 pPink-LC) 또는 Ti 플라스미드 등을 사용할 수 있고, 레트로바이러스, 아데노바이러스 또는 백시니아바이러스와 같은 동물 바이러스, 배큘로바이러스와 같은 곤충 바이러스 또는 식물 바이러스가 사용될 수 있으며, pPZP, pGA 및 pCAMBIA 계열과 같은 바이너리 벡터를 사용할 수 있으나, 본 발명의 발현 카세트를 숙주세포 내로 도입할 수 있는 한 이에 제한되지 않는다.
또한, 상기 발현 벡터는 발현조절 서열과 기능적으로 연결될 수 있다. 구체적인 예로, 상기 벡터는 프로모터, 오퍼레이터, 개시코돈, 종결코돈, 폴리아데닐화 시그널, 인핸서 같은 발현 조절 요소 외에도 막 표적화 또는 분비를 위한 신호 서열 또는 리더 서열을 포함할 수 있으나, 이에 제한되는 것은 아니며, 발명의 목적에 따라 다양하게 제조될 수 있다. 또한, 선택성 마커를 포함할 수 있으며, 자가 복제하거나 숙주 DNA에 통합될 수 있다. 본 발명의 벡터는 당해 기술 분야에서 잘 알려진 유전자 재조합 기술을 이용하여 제조할 수 있으며, 부위-특이적 DNA 절단 및 연결은 당해 기술 분야에서 일반적으로 알려진 효소 등을 사용할 수 있다.
본 발명의 일 실시예에서는, 상기 SNAP-8 유도체 제조용 발현 카세트를 통상의 방법을 통해 발현 벡터 pPinkα-HC vector에 삽입하여 SNAP-8 유도체 제조용 발현 벡터를 제작하였다(도 2a 및 2b 참조).
본 발명의 또 다른 일 양태는 상술한 SNAP-8 유도체 제조용 발현 벡터를 포함하는 형질전환체에 관한 것이다.
본 발명의 용어, "형질전환체"는 외래의 유전물질이 도입되어 유전형질이 변화된 생물체를 의미한다.
구체적인 예로, 상기 형질전환체는 피치아(Pichia), 에쉬리키아(Escherichia), 사카로마이세스(Saccharomyces), 자이고사카로마이세스(Zygosaccharomyces), 클루베로마이세스(Kluyveromyces), 칸디다(Candida), 스키조사카로마이세스(Schizosaccharomyces), 이자켄키아(Issachenkia), 야로이야(Yarrowia) 또는 한세뉼라(Hansenula) 속 균주일 수 있으나, 상기 SNAP-8 유도체를 발현할 수 있으면 특별히 이에 제한되지 않는다.
보다 구체적으로, 상기 형질전환체는 피치아 파스토리스(Pichia pastoris)일 수 있으나, 상기 SNAP-8 유도체를 발현할 수 있으면 특별히 이에 제한되지 않는다.
본 발명에서, 상기 피치아 파스토리스는 재조합 단백질 생산에 가장 널리 활용되는 효모 균주를 의미한다. 상기 효모 균주는 유전자 조작이 용이하며 다양한 발현시스템이 개발되어 있고 대량배양이 용이하다는 장점을 갖는다. 뿐만 아니라, 인체 단백질과 같은 고등세포 유래의 재조합 단백질을 생산할 때 단백질을 세포 밖으로 분비할 수 있는 분비기능, 및 당쇄 부가 등과 같은 단백질의 번역 후 수식(post-translational modification) 기능을 수행할 수 있는 장점을 제공한다. 재조합 단백질의 분비 생산은 단백질 분비 신호와 목표단백질을 인위적으로 융합(fusion)하여 세포 외 분비를 가능하게 한 것으로, 단백질의 분비과정을 통해서 단백질의 폴딩(folding)이나 이황화 결합의 형성 및 당쇄 부가 과정이 진행됨에 따라, 생물학적으로 완전한 활성을 갖는 재조합 단백질을 생산할 수 있는 장점이 있다. 또한, 생물학적 활성을 갖는 단백질을 배지로부터 직접 얻을 수 있기 때문에 경제적으로 효율이 낮은 세포의 분쇄나 재접힘 단계를 필요로 하지 않아 매우 경제적이다.
본 발명의 일 실시예에서는, 상기 SNAP-8 유도체 제조용 발현 벡터를 통상의 방법으로 P. pastoris 균주에 도입(형질주입)하여 형질전환체를 제작하였다(제조예 참조).
본 발명의 또 다른 일 양태는 상술한 SNAP-8 유도체 제조용 발현 벡터를 포함하는 형질전환체를 배양하는 단계; 및 배양된 형질전환체로부터 발현된 펩타이드를 분리 및 정제하는 단계를 포함하는, SNAP-8 유도체의 제조방법에 관한 것이다.
상기 형질전환체를 배양하는 단계는 상기 형질전환체의 영양 요구성을 고려하여 수행될 수 있다.
구체적인 예로, P. pastoris는 메틸 영양 요구성 효모 세포로서, 이의 배양을 위해서 완충된 복합 메탄올 배지(BMMY), 완충된 최소 메탄올 배지(BMM) 등을 이용할 수 있으나, 이에 제한되지 않으며, 발명의 목적에 맞게 당업자에 의해 적절히 선택될 수 있다.
또한, 상기 형질전환체의 배양물로부터 SNAP-8 유도체의 회수는 당업계에 공지된 방법에 의해 수행될 수 있다. 구체적으로, 원심분리, 여과, 추출, 분무, 건조, 증방, 침전, 결정화, 전기영동, 분별용해(예를 들면 암모늄 설페이트 침전), 크로마토그래피(예를 들면 이온 교환, 친화성, 소수성 및 크기배제) 등의 방법을 사용할 수 있으나, 본 발명의 SNAP-8 유도체를 회수할 수 있는 한, 특별히 이에 제한되지 않는다.
본 발명에서, 배양된 형질전환체로부터 발현된 SNAP-8 유도체를 분리 및 정제하는 단계는 상기 발현된 멀티머(multimer) SNAP-8 유도체를 모노머(monomer) SNAP-8 유도체로 절단(cleavage)하는 단계를 추가로 포함할 수 있다. 이때, 상기 배양된 형질전환체로부터 발현된 SNAP-8 유도체를 분리 및 정제하는 단계에는 포름산(Formic acid)을 이용할 수 있으나, 이에 제한되는 것은 아니며, 발명의 목적에 맞게 당업자에 의해 적절히 선택될 수 있다.
본 발명의 일 실시예에서는, 상기 SNAP-8 유도체 제조용 발현 벡터를 포함하는 P. pastoris 형질전환체를 다양한 발효 조건에서 배양한 후, 이를 수집 및 용해하여 SNAP-8 유도체를 분리하였다. 또한, Formic acid를 이용하여 멀티머 SNAP-8 유도체를 모노머 SNAP-8 유도체로 절단 후 발효액에서 분리 및 정제하였으며, HPLC 분석을 통해 SNAP-8 유도체 발효 생산물을 확인하였다(제조예 참조).
본 발명의 또 다른 일 양태는 상술한 방법으로 제조된 SNAP-8 유도체를 포함하는 피부주름 예방 또는 치료용 약학적 조성물에 관한 것이다.
본 발명의 약학적 조성물은 특정의 제형으로 반드시 한정되는 것이 아닌 모든 제형을 포함하며, 구체적인 제형의 예로는 경고제(plasters), 과립제(granules), 로션제(lotions), 리니멘트제(liniments), 리모나데제(lemonades), 방향수제(aromatic waters), 산제(powders), 시럽제(syrups), 액제(liquids and solutions), 에어로솔제(aerosols), 엑스제(extracts), 엘릭실제(elixirs), 연고제(ointments), 유동엑스제(fluidextracts), 유제(emulsions), 현탁제(suspensions), 전제(decoctions), 침제(infusions), 정제(tablets), 좌제(suppositories), 주사제(injections), 주정제(spirits), 카타플라스마제(cataplsma), 캅셀제(capsules), 크림제(creams), 트로키제(troches), 틴크제(tinctures), 파스타제(pastes), 환제(pills), 연질 또는 경질 젤라틴 캅셀 중 선택되는 어느 하나일 수 있다.
또한, 본 발명의 약학적 조성물은 약제학적으로 허용 가능한 담체, 희석제 또는 부형제를 더 포함할 수 있다. 사용가능한 담체, 부형제 또는 희석제로는, 락토즈, 덱스트로즈, 수크로즈, 솔비톨, 만니톨, 자이리톨, 에리스리톨, 말티톨, 전분, 아카시아 고무, 알지네이트, 젤라틴, 칼슘 포스페이트, 칼슘 실리케이트, 셀룰로즈, 메틸 셀룰로즈, 미정질 셀룰로즈, 폴리비닐피롤리돈, 물, 메틸하이드록시벤조에이트, 프로필하이드록시벤조에이트, 탈크, 마그네슘 스테아레이트 및 광물유가 있으며, 이중 선택되는 하나 이상을 사용할 수 있다.
한편, 본 발명의 약학적 조성물에 포함되는 본 발명 유효성분 펩타이드의 함량은, 사용방법, 복용자의 상태에 따라 바람직하게 조절하는 것이 좋다. 바람직하게는 약학 조성물에 건조 중량 기준으로 0.000001~50중량% 첨가될 수 있으나, 반드시 이적에 한정되는 것은 아니다. 그러나 그 함량이 0.000001중량% 미만일 경우 약리 효과가 미미할 수 있으며, 50중량%를 초과하는 경우에는 사용량 대비약리 효과 상승률이 낮아 비경제적일 수 있다. 다만, 본 발명 약학적 조성물의 투여량은 투여방법, 복용자의 연령, 성별 및 체중 등을 고려하여 결정하는 것이 좋다. 일 예로, 본 발명의 조성물은 1일 0.000001 내지 1g/kg(체중)으로 1회 이상 투여 가능하다. 그러나, 상기의 투여량은 예시하기 위한 일 예에 불과하며, 복용자의 상태에 의해 변화될 수 있다.
본 발명의 또 다른 일 양태는 상술한 방법으로 제조된 SNAP-8 유도체를 포함하는 피부주름 방지 또는 개선용 화장료 조성물에 관한 것이다.
본 발명의 화장료 조성물은 특정의 형태(제형)에 국한되지 않고, 용액, 외용 연고, 크림, 폼, 영양 화장수, 유연 화장수, 팩, 유연수, 유액, 메이크업 베이스, 에센스, 비누, 액체 세정료, 입욕제, 선 스크린 크림, 선 오일, 현탁액, 유탁액, 페이스트, 겔, 로션, 파우더, 비누, 계면 활성제-함유 클렌징, 오일, 분말 파운데이션, 유탁액 파운데이션, 왁스 파운데이션, 패치 및 스프레이로 이루어진 군으로부터 선택되는 제형으로 제조할 수 있으나, 이에 제한되는 것은 아니다.
상기 본 발명의 화장료 조성물은 일반 피부 화장료에 배합되는 화장품학적으로 허용 가능한 담체를 1종 이상 추가로 포함할 수 있으며, 통상의 성분으로 예를 들면 유분, 물, 계면 활성제, 보습제, 저급 알코올, 증점제, 킬레이트제, 색소, 방부제, 향료 등을 적절히 배합할 수 있으나, 이에 제한되는 것은 아니다.
상기 본 발명의 화장료 조성물에 포함되는 화장품학적으로 허용 가능한 담체는 화장료 조성물의 제형에 따라 다양하다.
본 발명의 제형이 연고, 페이스트, 크림 또는 젤인 경우에는, 담체 성분으로서 동물성 유, 식물성 유, 왁스, 파라핀, 전분, 트라칸트, 셀룰로오스 유도체, 폴리에틸렌 글리콜, 실리콘, 벤토나이트, 실리카, 탈크, 산화 아연 등이 이용될 수 있으나, 이에 제한되는 것은 아니다. 이들은 단독으로 사용되거나 2종 이상 혼합되어 사용될 수 있다.
본 발명의 제형이 파우더 또는 스프레이인 경우에는, 담체 성분으로서 락토스, 탈크, 실리카, 알루미늄 히드록사이드, 칼슘 실케이트, 폴리아미드 파우더 등이 이용될 수 있고, 특히 스프레이인 경우에는 추가적으로 클로로플루오로하드로카본, 프로판/부탄 또는 디메틸 에테르와 같은 추진제를 포함할 수 있으나, 이에 제한되는 것은 아니다. 이들은 단독으로 사용되거나 2종 이상 혼합되어 사용될 수 있다.
본 발명의 제형이 용액 또는 유탁액인 경우에는, 담체 성분으로서 용매, 용해화제 또는 유탁화제 등이 이용될 수 있으며, 예컨대 물, 에탄올, 이소프로판올, 에틸 카보네이트, 에틸 아세테이트, 벤질 알코올, 벤질 벤조에이트, 프로필렌 글리콜, 1,3-부틸글리콜 오일 등이 이용될 수 있고, 특히, 목화씨 오일, 땅콩 오일, 옥수수 배종 오일, 올리브 오일, 피마자 오일 및 참깨 오일, 글리세롤 지방족 에스테르, 폴리에틸렌 글리콜 또는 소르비탄의 지방산 에스테르가 이용될 수 있으나, 이에 제한되는 것은 아니다. 이들은 단독으로 사용되거나 2종 이상 혼합되어 사용될 수 있다.
본 발명의 제형이 현탁액인 경우에는, 담체 성분으로서 물, 에탄올 또는 프로필렌 글리콜과 같은 액상의 희석제, 에톡실화 이소스테아릴 알코올, 폴리옥시에틸렌 소르비톨 에스테르 및 폴리옥시에틸렌 소르비탄 에스테르와 같은 현탁제, 미소결정성 셀룰로오스, 알루미늄 메타하이드록시드, 벤토나이트, 아가 또는 트라칸트 등이 이용될 수 있으나, 이에 제한되는 것은 아니다. 이들은 단독으로 사용되거나 2종 이상 혼합되어 사용될 수 있다.
본 발명의 제형이 비누인 경우에는, 담체 성분으로서 지방산의 알칼리 금속 염, 지방산 헤미에스테르 염, 지방산 단백질 히드롤리제이트, 이세티오네이트, 라놀린 유도체, 지방족 알코올, 식물성 유, 글리세롤, 당 등이 이용될 수 있으나, 이에 제한되는 것은 아니다. 이들은 단독으로 사용되거나 2종 이상 혼합되어 사용될 수 있다.
본 발명의 제형이 계면-활성제 함유 클렌징인 경우에는, 담체 성분으로서 지방족 알코올 설페이트, 지방족 알코올 에테르 설페이트, 설포숙신산 모노에스테르, 이세티오네이트, 이미다졸리늄 유도체, 메틸타우레이트, 사르코시테이트, 지방산 아미드 에테르 설페이트, 알킬아미도베타인, 지방족 알코올, 지방산 글리세리드, 지방산 디에탄올아미드, 식물성 오일, 라놀린 유도체 또는 에톡실화 글리세롤 지방산 에스테르 등이 이용될 수 있으나, 이에 제한되는 것은 아니다. 이들은 단독으로 사용되거나 2종 이상 혼합되어 사용될 수 있다.
또한, 본 발명의 화장료 조성물은 화장 분야에서 통상적인 보조제 예컨대 친수성 또는 친유성 겔화제, 친수성 또는 친유성 활성제, 보존제, 항산화제, 용매, 방향제, 충전제, 차단제, 안료, 흡취제 및 염료를 함유할 수 있다.
본 발명의 또 다른 일 양태는 상술한 방법으로 제조된 SNAP-8 유도체를 포함하는 피부주름 방지 또는 개선용 의약외품 조성물에 관한 것이다.
본 발명의 의약외품 조성물은 바디 클렌저, 비누, 및 핸드워시로 이루어진 군에서 선택되는 제형으로 제조할 수 있으나, 이에 제한되는 것은 아니다.
한편, 본 명세서에서 사용하는 용어 '펩타이드' 및 '단백질'은 서로 동일한 의미로 정의하며, 필요에 의해 혼용해서 사용하기로 한다.
본 발명은 피부 주름개선용 펩타이드 스냅-8(Snap-8) 유도체의 효모 발효 생산 및 이의 이용에 관한 것으로, 본 발명의 SNAP-8 유도체 제조용 발현 카세트, 발현 벡터 및 이를 포함하는 형질전환체를 이용하면, 적은 비용으로 고순도의 SNAP-8 유도체를 대량으로 제조할 수 있다. 또한, 본 발명에 따라 제조된 SNAP-8 유도체는 항-주름 효과가 뛰어나므로, 관련 용도의 화장품 소재, 의약외품 및 의약품 등 산업 전반에 널리 이용될 수 있다.
본 발명의 실시예들에 따른 효과는 이상에서 예시된 내용에 의해 제한되지 않으며, 더욱 다양한 효과들이 본 명세서 내에 포함되어 있다.
도 1는 본 발명의 일 실시예에 따라 제조된 DNA cassette 모식도이다.
도 2a 및 도 2b는 본 발명의 일 실시예에 따라 제조된 벡터맵으로, 도 2a는 10 mer, 도 2b는 50 mer 벡터맵이다.
도 3은 본 발명의 일 실시예에 따라 SNAP-8 유도체의 D-P cleavage 결과를 확인한 도이다.
도 4는 본 발명의 일 실시예에 따라 SNAP-8 유도체의 D-P cleavage 후 동결건조 전/후의 포름산 제거 결과를 확인한 도이다.
도 5는 본 발명의 일 실시예에 따라 SNAP-8 유도체의 주름 개선 효과(membrane fusion assay)를 확인한 도이다.
이하, 실시예를 통하여 본 발명을 더욱 상세히 설명하고자 한다. 이들 실시예는 오로지 본 발명을 보다 구체적으로 설명하기 위한 것으로, 본 발명의 요지에 따라 본 발명의 범위가 이들 실시예에 의해 제한되지 않는다는 것은 당업계에서 통상의 지식을 가진 자에 있어서 자명할 것이다.
제조예. SNAP-8 유도체(PEEMQRRAD, 서열번호 1) 펩타이드의 제조
1) 균주, DNA 카세트, 벡터
생산용 균주로 안전성을 인정받은 효모 균주(Pichia pastoris)를 사용하였다. Gene work을 통하여 포름산 절단이 가능한 멀티머인 SNAP-8 유도체를 생산하는 DNA 카세트를 제조하고(도 1 및 하기 표 1 참조), 이를 포함하는 벡터(10 mer, 50 mer)(도 2a 및 2b 참조)를 P. pastoris 균주에 도입(형질주입)하여 형질전환체를 제작하였다. 이때, Fusion partner SUMO3를 삽입하여 안정적인 발현을 유도하였다.
| 서열 | |
| TEF Promoter | ATAACTGTCGCCTCTTTTATCTGCCGCACTGCATGAGGTGTCCCCTTAGTGGGAAAGAGTACTGAGCCAACCCTGGAGGACAGCAAGGGAAAAATACCTACAACTTGCTTCATAATGGTCGTAAAAACAATCCTTGTCGGATATAAGTGTTGTAGACTGTCCCTTATCCTCTGCGATGTTCTTCCTCTCAAAGTTTGCGATTTCTCTCTATCAGAATTGCCATCAAGAGACTCAGGACTAATTTCGCAGTCCCACACGCACTCGTACATGATTGGCTGAAATTTCCCTAAAGAATTTTTTTTTCACGAAAATTTTTTTTTTACACAAGATTTTCAGCAGATATAAAATGGAGAGCAGGACCTCCGCTGTGACTCTTCTTTTTTTTCTTTTATTCTCACTACATACATTTTAGTTATTCGCCAAC(서열번호 2) |
| α-Factor | MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLEGDFDVAVLPFSNSTNNGLLFINTTIASIAAKEEGVSLEKR(서열번호 3) |
| His-tag | HHHHHH |
| Fusion partner SUMO3 | EEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG(서열번호 4) |
| D | GAT |
| CYC1 Terminator | TCATGTAATTAGTTATGTCACGCTTACATTCACGCCCTCCTCCCACATCCGCTCTAACCGAAAAGGAAGGAGTTAGACAACCTGAAGTCTAGGTCCCTATTTATTTTTTTTAATAGTTATGTTAGTATTAAGAACGTTATTTATATTTCAAATTTTTCTTTTTTTTCTGTACAAACGCGTGTACGCATGTAACATTATACTGAAAACCTTGCTTGAGAAGGTTTTGGGACGCTCGAAGGCTTTAATTTGC(서열번호 5) |
2) SNAP-8 유도체 발현 벡터가 도입된 효모의 배양
하기 표 2 및 3의 조건대로, SNAP-8 유도체 생산용 효모 균주에 적합한 배지를 선정하고, 상기 배지에서 각 플라스크/10L 규모로 균주를 배양하였다.
| Promoter | AOX1 | TEF | GAP |
| Volume | Baffled flask 30 ml / 250 ml | Baffled flask 50 ml / 250 ml | |
| Fed-batch | 0.5% Methanol, 1 ml / day | 2% Glucose, 1 ml / day | 2% Glucose, 1 ml / day |
| Initial OD600 | 25~30 | ||
| Temperature | 30℃ After methanol induction 24℃ |
30℃ | |
| Agitation | 247 rpm | ||
| Time | 96 hr | ||
| Media condition | BMGY or BMMY 1% Yeast extract 2% Peptone 2% Glucose or 0.5% Methanol 100 mM Potassium phosphate pH 6.0 Biotin 12 ppm |
BMGY 1% Yeast extract 2% Peptone 2% Glucose 100 mM Potassium phosphate pH 6.0 Biotin 12 ppm |
YPDZ 1% Yeast extract 2% Peptone 2% Glucose 25 ㎍/L Zeocin |
| Volume | 2 L | ||
| Media condition | 1% Yeast extract 2% Peptone 2% Glycerol 100 mM Potassium phosphate pH 6.0 Biotin 40 ppm |
||
| Fed-batch | Glycerol batch phase | Glycerol fed-batch phase | Glucose fed-batch phase |
| Until wet cell 90~150 g/L |
2% Glycerol+PTM1, 25 ㎖/hr until wet cell 150~220 g/L |
4 % Glucose+PTM1 3.6 ㎖/hr/L 4hr 7.3 ㎖/hr/L 2hr 10.9 ㎖/hr/L 66hr |
|
| Temperature | 30℃ | 28℃ | 24℃ |
| Time | 24 hr | 24 hr | 72 hr |
| pH | 6.0 | ||
| Agitation | 600~800 rpm | ||
| Aeration | 1~2 vvm | ||
PTM1, pichia Trace Metrals
3) SNAP-8 유도체 펩타이드의 분리·정제
상기 배양된 효모 배양액을 원심분리(3,000 rpm, 10 분)하여 상등액만 회수(균체 제거)하고, 배양액과 아세톤을 6:4의 비율로 넣고 2시간 냉동시켰다. 원심분리(3,000 rpm, 10 분)하여 펠릿(pellet)을 회수하여 완전히 건조시켰다. His-tag로 분리 후, 포름산(Formic acid)을 활용한 절단(cleavage) 공정-His-tag 정제된 발효물에 포름산 처리(하기 표 4 참조) 후 1M NH4OH로 중성화-을 진행하였다. 동결건조 후 HPLC 분석을 수행하였다.
| 조건 | 회수율 | 모노머 전환율 |
| 37℃, 60%, 48h | 75% | 31.3% |
| 37℃, 60%, 72h | 65.7% | 40% |
| 37℃, 60%, 96h | 62% | 45% |
| 37℃, 90%, 48h | 72.3% | 48.2% |
표 4의 포름산 처리 농도, 온도 및 시간은 예시적인 것으로 이에 제한되는 것은 아니며, 다양할 수 있다. 비제한적인 예를 들어, 온도는 약 30℃ 내지 40℃, 또는 약 33℃ 내지 39℃, 또는 약 35℃ 내지 38℃일 수 있다. 포름산 처리 농도(%)는 약 50% 내지 99%, 또는 약 60% 내지 95%, 또는 약 60% 내지 90%일 수 있다. 또, 처리 시간은 약 40시간 내지 120시간, 또는 약 45시간 내지 100시간일 수 있다.
도 3에서 확인할 수 있듯이, 포름산 처리 전 멀티머 SNAP-8 유도체가 생산되었으며, 포름산을 처리한 후에 멀티머가 모노머로 절단된 것을 알 수 있었다. 나아가, 도 4에서 확인할 수 있듯이, 동결건조 후에는 포름산이 제거되는 것을 알 수 있었다.
실험예. SNAP-8 유도체 펩타이드의 주름 개선 효과 확인(Membrane Fusion Assay)
상기 제조예에서 제조된 SNAP-8 유도체 펩타이드 외 3 종(Argirelin, Argirelin 유도체, SNAP-8)의 펩타이드 시료에 대한 막 융합(membrane fusion) 저해 효과를 확인하였다.
먼저, 형광물질이 표시된 미세한 피막입자인 리포좀을 제조하기 위해 1-팔미토일-1,2-디올레오 일-sn-글리세로-3-포스파티딜콜린(POPC, 62mol%), 1,2-디올에오일-sn-글리세로-3-포스파티딜세린(DOPS, 35mol%), 1,2-디올레오일-sn-글리세로-3-포스포세린-N-(7-니트로-2-1,3-벤즈옥사디아졸-4-일)(NBD-PE, 1.5mol%)인 형광물질인 로다민(Rhodamin-PE, 1.5mol%)을 혼합하여 10mM 리포좀(v-vesicle)을 제조하였다. 한편, 형광물질이 표시되지 않는 리포좀을 제조하기 위해 DOPS와 POPC를 35:65가 되도록 혼합하여 리포좀(t-vesicle)을 제조하였다.
정제된 SNAP25와 Syntaxin 1a의 complex를 만들기 위해 몰농도가 1:1이 되도록 혼합하여 실온에서 1시간 반응시킨 후 형광물질이 표시되지 않은 리포좀과 몰비율이 100:1이 되도록 섞고, VAMP-2는 형광물질이 들어있는 리포좀과 몰비율이 50:1로 결합시켰다.
그 다음, 22종의 리포좀을 투석한 후 1:9(v-vesicle:t-vesicle)의 비율로 섞은 후, SNAP-25, Syntaxin 1a 및 VAMP-2를 포함하는 상기 혼합물에 Control(Argirelin, Argirelin 유도체, SNAP-8) 및 SNAP-8 유도체 펩타이드를 첨가하여 분석하였다. 형광강도 측정기(모델명: SpectraMax M2, 제조사: Molecular Device)를 이용하여 형광강도를 측정하였다.
NBD-PE의 형광파장은 465nm/530nm(excitation/emission)이며, Rhodamine의 형광파장은 465nm/625nm(excitation/emission)으로 NBD-PE의 방출파장을 Rhodamine이 흡수할 수 있게 설정되었다. 상기 방법은 형광 공명 에너지 전이 시스템(FRET(Flourescence Energy Transfer) system)이라고 하며, T-vesicle과 T-vesicle의 막 융합(membrane fusion)이 진행될수록 상기 BDPE와 Rhodamine의 거리는 멀어져 흡광도를 시간순으로 측정할 수 있고, NBD-PE의 흡광도 값은 증가하고 Rhodamine의 값은 감소하게 된다.
| Control | Argirelin | Argirelin 유도체 | SNAP-8 | SNAP-8 유도체 | |
| Membrane Fusion(%) | 15.68 | 14.90 | 12.78 | 11.18 | 10.61 |
| Membrane Fusion(% of control) | 100 | 95.05 | 81.54 | 71.33 | 67.68 |
| Inhibition rate of Membrane Fusion(% of control) | - | 4.95 | 18.146 | 28.67 | 32.32 |
상기 표 5 및 도 5에서 확인할 수 있듯이, 대조군과 비교하여 Argirelin은 1.83%, Argirelin 유도체는 17.36%, SNAP-8은 26.03%, SNAP-8 유도체는 27.40%의 SNARE complex 형성에 의한 막 융합 저해 효과를 확인하였다. 특히, SNAP-8 유도체가 가장 우수한 막 융합 저해 효과를 나타내었다.
서열번호 1:
PEEMQRRAD
서열번호 2:
ATAACTGTCGCCTCTTTTATCTGCCGCACTGCATGAGGTGTCCCCTTAGTGGGAAAGAGTACTGAGCCAACCCTGGAGGACAGCAAGGGAAAAATACCTACAACTTGCTTCATAATGGTCGTAAAAACAATCCTTGTCGGATATAAGTGTTGTAGACTGTCCCTTATCCTCTGCGATGTTCTTCCTCTCAAAGTTTGCGATTTCTCTCTATCAGAATTGCCATCAAGAGACTCAGGACTAATTTCGCAGTCCCACACGCACTCGTACATGATTGGCTGAAATTTCCCTAAAGAATTTTTTTTTCACGAAAATTTTTTTTTTACACAAGATTTTCAGCAGATATAAAATGGAGAGCAGGACCTCCGCTGTGACTCTTCTTTTTTTTCTTTTATTCTCACTACATACATTTTAGTTATTCGCCAAC
서열번호 3:
MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLEGDFDVAVLPFSNSTNNGLLFINTTIASIAAKEEGVSLEKR
서열번호 4:
EEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG
서열번호 5:
TCATGTAATTAGTTATGTCACGCTTACATTCACGCCCTCCTCCCACATCCGCTCTAACCGAAAAGGAAGGAGTTAGACAACCTGAAGTCTAGGTCCCTATTTATTTTTTTTAATAGTTATGTTAGTATTAAGAACGTTATTTATATTTCAAATTTTTCTTTTTTTTCTGTACAAACGCGTGTACGCATGTAACATTATACTGAAAACCTTGCTTGAGAAGGTTTTGGGACGCTCGAAGGCTTTAATTTGC
Claims (10)
- SNAP-8(Acetyl octapeptide-3) 유도체를 코딩하는, 서열번호 1로 표시되는 폴리뉴클레오티드 서열을 포함하고,상기 폴리뉴클레오티드 서열이 효모에서 발현될 수 있는 프로모터 서열 및 Fusion partner SUMO3 서열과 작동가능하게 연결되어 있는,SNAP-8 유도체 제조용 발현 카세트.
- 제1항에 있어서, 상기 SNAP-8 유도체 제조용 발현 카세트는 상기 서열번호 1로 표시되는 폴리뉴클레오티드 서열이 복수 회 반복하여 포함되는 것인, 발현 카세트.
- 제1항 또는 제2항의 발현 카세트를 포함하는, SNAP-8 유도체 제조용 발현 벡터.
- 제3항의 발현 벡터를 포함하는 형질전환체.
- 제4항에 있어서,상기 형질전환체는 피치아(Pichia), 에쉬리키아(Escherichia), 사카로마이세스(Saccharomyces), 자이고사카로마이세스(Zygosaccharomyces), 클루베로마이세스(Kluyveromyces), 칸디다(Candida), 스키조사카로마이세스(Schizosaccharomyces), 이자켄키아(Issachenkia), 야로이야(Yarrowia) 및 한세뉼라(Hansenula) 속 균주로 이루어진 군으로부터 선택되는 것인, 형질전환체.
- 제4항 또는 제5항의 형질전환체를 배양하는 단계; 및배양된 형질전환체로부터 발현된 펩타이드를 분리 및 정제하는 단계를 포함하는, SNAP-8 유도체의 제조방법.
- 제6항에 있어서, 상기 분리 및 정제하는 단계는 멀티머(multimer) SNAP-8 유도체를 모노머(monomer) SNAP-8 유도체로 절단(cleavage)하여 수행되는 것인, SNAP-8 유도체의 제조방법.
- 서열번호 1로 표시되는 SNAP-8 유도체를 포함하는 피부주름 예방 또는 치료용 약학적 조성물.
- 서열번호 1로 표시되는 SNAP-8 유도체를 포함하는 피부주름 방지 또는 개선용 화장료 조성물.
- 서열번호 1로 표시되는 SNAP-8 유도체를 포함하는 피부주름 방지 또는 개선용 의약외품 조성물.
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR10-2023-0044543 | 2023-04-05 | ||
| KR1020230044543A KR102854635B1 (ko) | 2023-04-05 | 2023-04-05 | 피부 주름개선용 펩타이드 스냅-8(Snap-8) 유도체의 효모 발효 생산 및 이의 이용 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2024210294A1 true WO2024210294A1 (ko) | 2024-10-10 |
Family
ID=92972382
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/KR2023/019297 Ceased WO2024210294A1 (ko) | 2023-04-05 | 2023-11-28 | 피부 주름개선용 펩타이드 스냅-8(snap-8) 유도체의 효모 발효 생산 및 이의 이용 |
Country Status (2)
| Country | Link |
|---|---|
| KR (1) | KR102854635B1 (ko) |
| WO (1) | WO2024210294A1 (ko) |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2011008904A1 (en) * | 2009-07-17 | 2011-01-20 | Tabor Aaron T | Compositions and methods for genetic modification of cells having cosmetic function to enhance cosmetic appearance |
| US8865651B2 (en) * | 2007-05-08 | 2014-10-21 | Tupperware Products S.A. | Cosmetic anti-ageing skin care compositions |
| KR101766876B1 (ko) * | 2016-10-14 | 2017-08-14 | 한국생산기술연구원 | 카퍼펩타이드 제조용 발현 카세트 및 이의 이용 |
| KR102370679B1 (ko) * | 2021-06-30 | 2022-03-11 | (주)아쿠아렉스 | 피부주름 개선용 화장료 조성물 및 그 제조방법 |
-
2023
- 2023-04-05 KR KR1020230044543A patent/KR102854635B1/ko active Active
- 2023-11-28 WO PCT/KR2023/019297 patent/WO2024210294A1/ko not_active Ceased
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8865651B2 (en) * | 2007-05-08 | 2014-10-21 | Tupperware Products S.A. | Cosmetic anti-ageing skin care compositions |
| WO2011008904A1 (en) * | 2009-07-17 | 2011-01-20 | Tabor Aaron T | Compositions and methods for genetic modification of cells having cosmetic function to enhance cosmetic appearance |
| KR101766876B1 (ko) * | 2016-10-14 | 2017-08-14 | 한국생산기술연구원 | 카퍼펩타이드 제조용 발현 카세트 및 이의 이용 |
| KR102370679B1 (ko) * | 2021-06-30 | 2022-03-11 | (주)아쿠아렉스 | 피부주름 개선용 화장료 조성물 및 그 제조방법 |
Non-Patent Citations (1)
| Title |
|---|
| JI, M. ET AL.: "Method development for acetyl octapeptide-3 analysis by liquid chromatography-tandem mass spectrometry", JOURNAL OF ANALYTICAL SCIENCE AND TECHNOLOGY, vol. 11, no. 34, 2020, pages 1 - 7, XP021280701, DOI: 10.1186/s40543-020-00232-8 * |
Also Published As
| Publication number | Publication date |
|---|---|
| KR20240149464A (ko) | 2024-10-15 |
| KR102854635B1 (ko) | 2025-09-04 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP2456457B1 (en) | Compounds which inhibit muscle contraction | |
| WO2018070829A1 (en) | Expression cassette for preparing copper peptide and use thereof | |
| KR100753472B1 (ko) | 사람 콜라겐 ⅰ형의 c-말단에서 유래된 펩타이드에tat 펩타이드가 결합된 융합 펩타이드, 이의 제조방법,및 이를 포함하는 피부주름개선 화장료 조성물 | |
| WO2021153946A1 (ko) | Snare 복합체의 형성을 저해하는 펩티드, 및 그의 용도 | |
| WO2017105161A2 (ko) | 피부 미백 활성을 갖는 펩타이드 및 이의 용도 | |
| WO2022031044A1 (ko) | 아스코르브산 유도체 및 이를 포함하는 조성물 | |
| WO2020159143A1 (ko) | 피부 노화방지 및 주름개선용 펩타이드 및 이를 포함하는 조성물 | |
| WO2023054817A1 (ko) | 항노화 활성을 갖는 펩타이드 및 이의 용도 | |
| WO2021251791A1 (ko) | 보툴리눔 톡신 유사 활성을 갖는 펩타이드 및 이의 용도 | |
| WO2022039572A1 (ko) | 포로스테레움속 신균주 Porostereum sp.(KCTC18837P) 균사체 배양물 및 이를 포함하는 피부상태 개선용 화장료 조성물 | |
| WO2019004543A1 (ko) | 경피투과도가 향상된 신경전달물질 조절 펩타이드 화장료 조성물 | |
| WO2024210294A1 (ko) | 피부 주름개선용 펩타이드 스냅-8(snap-8) 유도체의 효모 발효 생산 및 이의 이용 | |
| WO2018034453A1 (ko) | 미녹시딜과 펩타이드의 결합체 | |
| KR101710486B1 (ko) | 올리고펩타이드 유도체 및 이를 포함하는 주름개선용 조성물 | |
| WO2020060202A1 (ko) | 티뮬린 또는 아지레닌 제조용 발현 카세트 및 이의 이용 | |
| WO2018199358A1 (ko) | 피부 미백 활성을 갖는 펩타이드 및 이의 용도 | |
| WO2023055010A1 (ko) | 항노화 활성을 갖는 펩타이드 및 이의 용도 | |
| WO2024136545A1 (ko) | 아세틸콜린을 포함한 신경전달물질 방출을 저해하는 인 실리코 설계된 보툴리눔 독소 모방 펩티드, 및 주름 개선에서의 이의 용도 | |
| WO2025135955A1 (ko) | 탈모 예방 또는 발모 촉진용 흉선 유래 펩타이드 유도체 및 이의 이용 | |
| WO2018208124A2 (ko) | 이소트레티노인과 펩타이드의 결합체 | |
| WO2026071788A1 (ko) | 펩타이드 스냅-8(snap-8) 유도체의 대량 생산 방법 | |
| WO2024128729A1 (ko) | 피부 개선용 화장료 조성물 | |
| US20240301000A1 (en) | Tetrapeptide derivative,cosmetic composition or pharmaceutical composition and use thereof | |
| WO2020222315A1 (ko) | 피부 또는 세포 투과능이 우수한 피부 주름 개선 또는 치료용 조성물 | |
| WO2017074163A1 (ko) | 초저분자 케라틴 펩타이드의 제조 방법 및 그의 이용 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 23932228 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 23932228 Country of ref document: EP Kind code of ref document: A1 |