WO2024033446A1 - Système d'expression transitoire pour arn, pour l'édition de gènes - Google Patents

Système d'expression transitoire pour arn, pour l'édition de gènes Download PDF

Info

Publication number
WO2024033446A1
WO2024033446A1 PCT/EP2023/072112 EP2023072112W WO2024033446A1 WO 2024033446 A1 WO2024033446 A1 WO 2024033446A1 EP 2023072112 W EP2023072112 W EP 2023072112W WO 2024033446 A1 WO2024033446 A1 WO 2024033446A1
Authority
WO
WIPO (PCT)
Prior art keywords
rna
booster
sequence
virus
vector
Prior art date
Application number
PCT/EP2023/072112
Other languages
English (en)
Inventor
Nicolas GRANDCHAMP
Original Assignee
Geg Tech
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from US17/818,508 external-priority patent/US20240060085A1/en
Application filed by Geg Tech filed Critical Geg Tech
Publication of WO2024033446A1 publication Critical patent/WO2024033446A1/fr

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/67General methods for enhancing the expression
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/53DNA (RNA) vaccination
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/54Medicinal preparations containing antigens or antibodies characterised by the route of administration
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/54Medicinal preparations containing antigens or antibodies characterised by the route of administration
    • A61K2039/541Mucosal route
    • A61K2039/544Mucosal route to the airways
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/57Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
    • A61K2039/575Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 humoral response
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/10Type of nucleic acid
    • C12N2310/20Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPRs]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/16011Human Immunodeficiency Virus, HIV
    • C12N2740/16041Use of virus, viral particle or viral elements as a vector
    • C12N2740/16043Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/16011Human Immunodeficiency Virus, HIV
    • C12N2740/16041Use of virus, viral particle or viral elements as a vector
    • C12N2740/16045Special targeting system for viral vectors
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2830/00Vector systems having a special element relevant for transcription

Definitions

  • the present invention relates to means and methods for robust transient RNA expression.
  • Transferring genetic information to a cell typically requires the design of vectors capable of delivering this genetic information to the cell.
  • vectors capable of delivering this genetic information to the cell.
  • non-viral vectors and viral vectors, each of which is capable of transferring information, either in the form of DNA or RNA.
  • non-integrating DNA vectors or RNA vectors are excellent candidates.
  • non-integrating DNA vectors can induce adverse genotoxic effects due to the non-zero probability of any DNA molecule to recombine with another DNA molecule, for instance, with the DNA genome of the host cell.
  • RNA vectors do not exhibit this risk of genotoxicity, since RNA cannot recombine with DNA. Nonetheless, current RNA vectors are not devoid of drawbacks, in particular in terms of efficacy.
  • non-viral RNA vectors are underperforming, due to a low degree of RNA protection against degradation, and often, a low transfection rate. Hence, the few RNA molecules which ultimately reach the cytoplasm of a cell induce only poor transgene expression.
  • Relroviridae or retroviruses
  • RNA viruses which are capable of inserting a copy of their genome - after reverse transcription using their own reverse transcriptase enzyme (RT) - into the chromosomal DNA of the host cells that they invade.
  • the host cells then treat the viral DNA as part of their own genome, transcribing and translating the viral genes along with their own genes.
  • This ability of Retroviridae has made them (and more particularly viruses from the Gammaretrovirus and Lentivirus genera) a benchmark tool for therapeutic gene delivery and transfer into cells since the early 1980’s.
  • these RNA vectors have been engineered to allow transient expression of therapeutic proteins. Such engineered vectors were described in WO 2005/116225 Al, WO 2013/060819 A2 or Mock etal., 2014 (Sci Rep. 4:6409) relating to retroviral vectors with detective RT activity.
  • RT-defective retroviral vectors although offering a transient expression of therapeutic proteins from their mRNA without the need of a DNA intermediate, are not devoid of drawbacks. Indeed, they typically package only up to two copies of their RNA genome, into which the transgene of interest (e.g., a therapeutic mRNA) is inserted. In other words, one retroviral vector transducing a host cell can only deliver two copies of a transgene of interest.
  • RNAs are very labile molecules - and thus rapidly degraded in the host cell, this solution was considered somehow ineffective, unless high vector doses are repeatedly administered in order to outweigh these issues. For in vivo applications, this is not desirable. For instance, Mock et al. (2014. Sci Rep. 4:6409) came to this conclusion, stating that they “ observed very weak cap-dependent translation initiation from standard lentiviral vector genomes”. and called for further improvements.
  • RNA vectors capable of inducing high transient expression levels in host cells, but without requiring the administration of high loads of vector.
  • RNA Booster an artificial 9-nucleotide sequence, that they have named “RNA Booster” .
  • the Inventors have surprisingly observed that the presence of this RNA Booster upstream or downstream of a transgene highly improved transgene expression in various host cells.
  • the present invention relates to a ribonucleic acid (RNA) or deoxyribonucleic acid (DNA) molecule comprising: an RNA Booster sequence comprising or consisting of the ribonucleic acid or deoxyribonucleic acid sequence mmsknkkkm or its reverse sequence mkkknksmm, wherein:
  • ⁇ “m” indicates an adenine (a) or cytosine (c);
  • ⁇ “s” indicates a guanine (g) or a cytosine (c);
  • ⁇ “k” indicates a guanine (g) or a uracyl/thymine (u/t);
  • n indicates any nucleotide; and a sequence of interest encoding at least one genome editor; for use in a method of therapeutic treatment by genome engineering in a subject in need thereof.
  • the RNA Booster sequence comprises or consists of a ribonucleic acid or a deoxyribonucleic acid sequence mmskngkkm or its reverse sequence mkkgnksmm, preferably mmskngkgm or its reverse sequence mgkgnksmm, more preferably cmskhgkgm or its reverse mgkghksmc, even more preferably cmskwgkgm or its reverse sequence mgkgwksmc, yet even more preferably ccsuwgggm or its reverse sequence mgggwuscc, wherein:
  • ⁇ “m” indicates an adenine (a) or cytosine (c);
  • ⁇ “s” indicates a guanine (g) or a cytosine (c);
  • ⁇ “k” indicates a guanine (g) or a uracyl/thymine (u/t);
  • ⁇ “h” indicates an adenine (a) or a cytosine (c) or a uracyl/thymine (u/t);
  • ⁇ “w” indicates an adenine (a) or a uracyl/thymine (u/t);
  • ⁇ “n” indicates any nucleotide.
  • the RNA Booster sequence is selected from the group consisting of:
  • RNA Booster 9 comprising or consisting of the sequence ccguaggga or its reverse sequence agggaugcc;
  • RNA Booster 8 comprising or consisting of the sequence cccuugggc or its reverse sequence cggguuccc;
  • RNA Booster 7 comprising or consisting of the sequence cacgugugc or its reverse sequence cgugugcac;
  • RNA Booster 6 comprising or consisting of the sequence cccucgggc or its reverse sequence cgggcuccc;
  • RNA Booster 5 comprising or consisting of the sequence aacuggggc or its reverse sequence cggggucaa;
  • RNA Booster 4 comprising or consisting of the sequence ccguggugc or its reverse sequence cguggugcc;
  • RNA Booster 3 comprising or consisting of the sequence cccuaggua or its reverse sequence auggauccc;
  • RNA Booster 2 comprising or consisting of the sequence aaguuuggc or its reverse sequence cgguuugaa;
  • RNA Booster 1 comprising or consisting of the sequence cccgugugc or its reverse sequence cgugugccc.
  • the RNA or DNA molecule is comprised within a non-viral vector.
  • the RNA molecule is packaged into an RNA virus vector derived from a Group III, Group IV, Group V or Group VI RNA virus.
  • the RNA molecule is packaged into RNA virus vector derived from a Group VI RNA virus. More preferably, the RNA molecule is packaged into a Retroviridae vector.
  • the Retroviridae vector is an Orthoretrovirinae or a Spumaretrovirinae .
  • the Retroviridae vector is an Orthoretrovirinae .
  • the Retroviridae vector is selected from the group consisting of human immunodeficiency viruses (HIV), simian immunodeficiency viruses (SIV), feline immunodeficiency virus (FIV), bovine immunodeficiency virus (BIV), puma lentivirus (PLV), equine infectious anemia virus (EIAV), caprine arthritis encephalitis virus (CAEV), Visna-maedi virus, Jembrana disease virus, avian sarcoma leukosis virus (ASLV), Rous sarcoma virus (RSV), avian myeloblastosis virus (AMV), mouse mammary tumor virus (MMTV), Jaagsiekte sheep retrovirus (JSRV), enzootic nasal tumor
  • HAV human immunodeficiency viruses
  • the Retroviridae vector is a lentiviral vector.
  • the Retroviridae vector is a lentiviral vector selected from the group consisting of human immunodeficiency virus-1 (HIV-1) and HIV-2. More preferably, the Retroviridae vector is HIV- 1.
  • the Group VI RNA virus vector (preferably the Retroviridae vector) is reverse transcriptase (RT)-defective.
  • the Group VI RNA virus vector (preferably the Retroviridae vector) does not comprise a gene encoding a reverse transcriptase or wherein the retroviral vector comprises a gene encoding a mutated reverse transcriptase with abolished reverse transcription activity.
  • the RNA molecule when the RNA molecule is packaged into an RNA virus vector, the RNA molecule further comprises one or several of: a 5’ long terminal repeat (LTR), a packaging sequence, a Rev-response element sequence, a post-transcriptional regulation element sequence, and a 3’ LTR.
  • LTR long terminal repeat
  • the genome editor is selected from the group consisting of CRISPR-associated proteins (Cas), zinc finger nucleases (ZNFs), transcription activator-like effector nucleases (TALEN), and site-specific recombinases.
  • Cas CRISPR-associated proteins
  • ZNFs zinc finger nucleases
  • TALEN transcription activator-like effector nucleases
  • the genome editor is a CRISPR-associated protein, preferably selected from the group consisting of Cas9, Casl2 and Casl3.
  • the therapeutic treatment comprises preventing and/or treating a genetic disease in a subject in need thereof. [0020] In some embodiments, the therapeutic treatment further comprises administering to the subject in need thereof:
  • gRNA guide RNA
  • crRNA CRISPR RNA
  • tracrRNA trans-activating CRISPR RNA
  • the present invention also relates to a method of engineering the genome of a cell, comprising contacting the cell with a ribonucleic acid (RNA) or deoxyribonucleic acid (DNA) molecule as defined herein, and optionally further with
  • gRNA guide RNA
  • crRNA CRISPR RNA
  • tracrRNA trans-activating CRISPR RNA
  • said contacting is in vitro or ex vivo, with the proviso that the method is not a method of modifying the germ line identity of a human being;
  • the method is not a method of medical treatment practiced on the human or animal body.
  • said engineering is for the transgenesis of an organism with the proviso that the organism is not a human; or for the generation of a stable cell line for bioproduction.
  • a and “an” refer to one or to more than one (i.e., to at least one) of the grammatical object of the article.
  • an element means one element or more than one element.
  • “About” preceding a number encompasses plus or minus 10%, or less, of the value of said number. It is to be understood that the value to which the term “about” refers is itself also specifically, and preferably, disclosed.
  • Antigen also termed “immunogen”, refers to any substance that induces a state of sensitivity and/or immune responsiveness after any latent period (normally, days to weeks in humans) and that reacts in a demonstrable way with antibodies and/or immune cells of the sensitized subject in vivo or in vitro.
  • Collagen induction therapy also known as “microneedling”, “dermarolling”, or “skin needling” refers to a cosmetic procedure which involves repeatedly puncturing the skin of a subject with microneedles (/. ⁇ ., needles having a length typically ranging from about 100 pm to 1 000 pm).
  • composition means that the RNA or DNA molecule (or the vector comprising said RNA or DNA molecule), is the only one therapeutic agent or agent with a biological activity within said composition or pharmaceutical composition.
  • Encoding refers to the inherent property of a specific sequence of nucleotides in a nucleic acid, such as a gene, a complementary DNA (cDNA), or a messenger RNA (mRNA), to serve as template for the synthesis of other polymers and macromolecules in biological processes having either a defined sequence of nucleotides (e.g., ribosomal RNA (rRNA), transfer RNA (tRNA) and mRNA) or a defined sequence of amino acids (e.g., polypeptide or protein) and the biological properties resulting therefrom.
  • rRNA ribosomal RNA
  • tRNA transfer RNA
  • mRNA a defined sequence of amino acids
  • “Exogenous” refers to a molecule that is not naturally present in a cell, but can be introduced into the cell by one or more genetic, biochemical or other methods. Natural presence in the cell may be determined with respect to the particular developmental stage and environmental conditions of the cell. For instance, a molecule that is present only in a cell during embryonic development is exogenous with respect to a cell in an adult subject. Similarly, a molecule induced by heat shock of a cell is exogenous with respect to a non-heat- shocked cell. [0031] “Expression” refers to the transcription and/or translation of a particular nucleotide sequence, such as a gene.
  • the expression “has/having a sequence as set forth in SEQ ID NO: X” means that the given sequence comprises or consists of the sequence as set forth in SEQ ID NO: X.
  • the given sequence implicitly refers to a nucleic acid sequence (DNA or RNA sequence) or an amino acid sequence.
  • isolated nucleic acid refers to a nucleic acid altered or removed from the natural state.
  • a nucleic acid naturally present in a living organism is not “isolated” but the nucleic acid partially or completely separated from the coexisting materials of its natural state is “isolated”.
  • An “isolated nucleic acid” is thus a nucleic acid that is substantially separated from other nucleic acid sequences, such as genomic DNA or RNA, as well as proteins or complexes such as ribosomes and polymerases, which naturally accompany a native sequence.
  • An isolated nucleic acid can exist in substantially purified form, or can exist in a non-native environment such as, for example, a host cell.
  • a preparation of an isolated nucleic acid may comprise the nucleic acid at least about 80% pure, at least about 85% pure, at least about 90% pure, at least about 95% pure, greater than about 95% pure, greater than about 96% pure, greater than about 97% pure, greater than about 98% pure, or greater than about 99% pure.
  • Isolated nucleic acids thus include nucleic acids purified by standard purification methods, and encompass nucleic acid sequences that have been removed from their naturally occurring environment. Isolated nucleic acids also include chemically synthesized nucleic acids and nucleic acids biologically synthesized by heterologous systems.
  • LTRs Long-terminal repeats refer to sequences of several hundred base pairs long. In RNA viruses, their genome is flanked by LTRs (a 5’ LTR and a 3’ LTR), typically having identical sequences.
  • Rev-response element refers to a highly structured RNA segment interacting with the Rev protein, allowing the viral genome to be exported to the cytoplasm for downstream processing, including virion packaging.
  • Rev-response elements are typically characteristic of lentiviruses, but other RNA viruses of Group VI comprise similar systems, such as the Rem-response element in Betaretroviruses, the Rex-response element in Deltaretroviruses, or the constitutive transport element (CTE). These are also encompassed when mentioning Rev-response element herein, even if not explicitly cited.
  • Nucleic acid refers to a polymer of nucleotides (i.e., polynucleotides) covalently linked by phosphodiester bonds, such as deoxyribonucleic acids (DNA) or ribonucleic acids (RNA), in either single- or double-stranded form.
  • DNA deoxyribonucleic acids
  • RNA ribonucleic acids
  • a nucleic acid may thus be single-stranded, partially double-stranded, or fully doublestranded.
  • the nucleotides making up nucleic acids of the present disclosure may be unmodified (natural) nucleotides or non-natural or modified nucleotides.
  • Unmodified (or natural or naturally occurring) nucleotides include adenosine monophosphate (AMP), deoxyadenosine monophosphate (dAMP), cytidine monophosphate (CMP), deoxycytidine monophosphate (dCMP), guanosine monophosphate (GMP), deoxyguanosine monophosphate (dGMP), thymidine monophosphate (TMP), deoxythymidine monophosphate (dTMP), and uridine monophosphate (UMP).
  • AMP adenosine monophosphate
  • dAMP deoxyadenosine monophosphate
  • CMP cytidine monophosphate
  • dCMP deoxycytidine monophosphate
  • GMP guanosine monophosphate
  • dGMP deoxyguanosine monophosphate
  • TMP thymidine monophosphate
  • dTMP deoxythymidine monophosphate
  • UMP uridine monophosphate
  • nucleic acid sequence or “nucleotide sequence” refers to a contiguous sequence of nucleotides in a single nucleic acid. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions), alleles, orthologs, SNPs (single-nucleotide polymorphisms), and complementary sequences as well as the sequence explicitly indicated. Notably, a particular nucleic acid sequence described herein implicitly comprises its corresponding complementary sequence, named reverse sequence. It should be noted that a particular nucleic acid sequence described herein implicitly comprises the DNA sequence and the corresponding RNA sequence.
  • “Operatively linked” refers to functional linkage between a regulatory sequence and a heterologous nucleic acid sequence, e.g., a gene, resulting in a regulation of the expression of the latter by the former.
  • a first nucleic acid sequence is operably linked with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence.
  • a promoter is operably linked to a gene if the promoter affects the transcription or expression of the gene.
  • an RNA Booster is operably linked to a gene if the RNA Booster affects the expression of the gene.
  • a regulatory sequence is operably linked to a gene if the regulatory sequence affects (/. ⁇ ., either induces or inhibits (or represses)) the expression of the gene.
  • Operably linked sequences can be contiguous with each other.
  • Packaging sequence refers to a stem-loop structured cz.s-acting nucleic acid sequence, which regulates the process of packaging inside a viral capsid. This packaging sequence may be referred in the art to as “packaging signal” denoted “y”, or “encapsidation signal” denoted “E”. Packaging sequences may be of viral origin (z.e., wild-type viral packaging sequences) or may be synthetic.
  • “Pharmaceutically acceptable excipient” and “pharmaceutically acceptable carrier” include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, that are physiologically compatible.
  • the excipient or carrier does not produce any adverse, allergic or other untoward reaction when administered to a subject, preferably to a human.
  • a pharmaceutically acceptable excipient or carrier is typically a non-toxic solid, semi-solid or liquid filler, diluent, encapsulating material or formulation auxiliary of any type.
  • preparations should meet sterility, pyrogenicity, and general safety and purity standards as required by regulatory offices, such as, for example, the FDA (US Food and Drug Administration) or EMA (European Medicines Agency).
  • Post-transcriptional regulation elements refer to cz.s-acting RNA sequences that can increase the accumulation of cytoplasmic mRNA by promoting mRNA exportation from the nucleus to the cytoplasm, enhancing 3 ’-end processing and stability.
  • Gene broadly refers to an encoding nucleic acid sequence that can be transcribed into an RNA molecule, either a coding RNA molecule such as a mRNA which can be subsequently translated into a polypeptide or protein, or a non-coding RNA molecule such as a rRNA or a tRNA.
  • the term “gene” may refer to an encoding nucleic acid sequence comprising a coding sequence (or CDS) and at least one regulatory element that is transcribed but not translated, such as a 3’-UTR, a 5’-UTR and/or an intron.
  • sequence of interest refers to as “transgene (of interest)”, refers to any nucleic acid sequence encoding a product of interest.
  • the product of interest may be a protein or a fragment thereof; in this case, the sequence of interest is said to be a coding nucleic acid sequence.
  • the transgenes refers in particular to a gene originating from one species which is to be introduced into an organism belonging to a different species. It should thus be noted that a gene may or may not encompass a coding sequence (or CDS), that is to say a nucleic acid sequence that actually codes for a protein.
  • a gene in particular a gene encompassing a CDS, may also preferably encompass untranslated transcribed regions (UTRs), such as a 3’-UTR and/or a 5’-UTR and other sequences, such as regulatory elements and/or introns, which are transcribed but not translated.
  • UTRs untranslated transcribed regions
  • other sequences such as regulatory elements and/or introns, which are transcribed but not translated.
  • the term also encompasses non-coding nucleic acid sequences, /. ⁇ ., nucleic acid sequences that do not encode a protein or a fragment thereof, but rather express an “RNA gene” (or “non-coding RNA”), such as, e.g., a transfer RNA, a ribosomal RNA, a small RNA, a long non-coding RNA, etc.
  • RNA gene or “non-coding RNA”
  • sequence of interest refers to a DNA or an RNA sequence.
  • Transgenesis refers to the process of introducing one or several transgenes from one organism into another, with the intent of enabling the latter to transmit this transgene to its offspring.
  • Treating” or “treatment” or “alleviation” refers to both therapeutic treatment and prophylactic measures; wherein the object is to slow down (lessen) the targeted pathologic condition or disorder.
  • a subject or mammal is successfully "treated” for an infection if, after receiving a therapeutic amount of an RNA or DNA molecule of the present invention, the patient shows observable and/or measurable reduction in or absence of one or more of the following: reduction in the number of pathogenic cells; reduction in the percent of total cells that are pathogenic; and/or relief to some extent, one or more of the symptoms associated with the specific disease or condition; reduced morbidity and mortality, and improvement in quality of life issues.
  • the above parameters for assessing successful treatment and improvement in the disease are readily measurable by routine procedures familiar to a physician.
  • Vector refers to a vehicle by which a nucleic acid sequence (e.g., a DNA or RNA molecule), for example a nucleic acid encoding an RNA or a polypeptide or protein of interest, can be introduced into a host cell, so as to transform, transfect or transduce the host cell and promote expression (e.g., transcription and/or translation) of the introduced nucleic acid sequence.
  • a nucleic acid sequence e.g., a DNA or RNA molecule
  • promote expression e.g., transcription and/or translation
  • “Expression vector” refers to a vector comprising regulatory elements (or regulatory sequences) operatively linked or to be operatively linked to a nucleic acid sequence of interest to be expressed, such as a gene of interest.
  • An expression vector thus comprises sufficient cis-acting regulatory elements for controlling the expression of a nucleic acid sequence of interest (present or to be inserted in the expression vector); other elements that may be required for controlling the expression of the nucleic acid sequence of interest may be supplied by a host cell or an in vitro expression system.
  • a first object of the invention is a ribonucleic acid (RNA) molecule or deoxyribonucleic acid (DNA) molecule, corresponding to nucleic acid molecule.
  • RNA ribonucleic acid
  • DNA deoxyribonucleic acid
  • the RNA or DNA molecule comprises, from 5’ to 3’ : an RNA Booster sequence characterized by a sequence mmsknkkkm or its reverse sequence mkkknksmm, and a sequence of interest.
  • the RNA or DNA molecule comprises, from 3’ to 5’ :
  • RNA Booster sequence characterized by a sequence mmsknkkkm or its reverse sequence mkkknksmm
  • RNA or DNA molecule comprises an RNA Booster sequence.
  • RNA Booster refers to an artificial 9-nucleotide sequence, which comprises or consists of a sequence mmsknkkkm or its reverse sequence mkkknksmm, wherein:
  • m indicates an adenine (a) or a cytosine (c);
  • s indicates a guanine (g) or a cytosine (c);
  • k indicates a guanine (g) or a thymine/uracyl (t/u);
  • n indicates any nucleotide.
  • the RNA Booster sequence comprises or consists of a sequence mmskngkkm or its reverse sequence mkkgnksmm, wherein:
  • m indicates an adenine (a) or a cytosine (c);
  • s indicates a guanine (g) or a cytosine (c);
  • k indicates a guanine (g) or a thymine/uracyl (t/u);
  • n indicates any nucleotide.
  • the RNA Booster sequence comprises or consists of a sequence of mmskngkgm or its reverse sequence mgkgnksmm, wherein:
  • m indicates an adenine (a) or a cytosine (c);
  • s indicates a guanine (g) or a cytosine (c);
  • k indicates a guanine (g) or a thymine/uracyl (t/u);
  • n indicates any nucleotide.
  • the RNA Booster sequence comprises or consists of a sequence cmskhgkgm or its reverse sequence mgkghksmc, wherein:
  • m indicates an adenine (a) or a cytosine (c);
  • s indicates a guanine (g) or a cytosine (c);
  • k indicates a guanine (g) or a thymine/uracyl (t/u);
  • h indicates an adenine (a) or a cytosine (c) or a thymine/uracyl (t/u).
  • the RNA Booster sequence comprises or consists of a sequence cmskwgkgm or its reverse sequence mgkgwksmc, wherein:
  • m indicates an adenine (a) or a cytosine (c);
  • s indicates a guanine (g) or a cytosine (c);
  • w indicates an adenine (a) or a thymine/uracyl (t/u);
  • h indicates an adenine (a) or a cytosine (c) or a thymine/uracyl (t/u).
  • the RNA Booster sequence comprises or consists of a sequence ccsuwgggm or its reverse sequence mgggwuscc, wherein:
  • s indicates a guanine (g) or a cytosine (c);
  • w indicates an adenine (a) or a thymine/uracyl (t/u);
  • m indicates an adenine (a) or a cytosine (c).
  • RNA Booster sequences in RNA molecule include, but are not limited to:
  • RNA Booster 1 cccgugugc, or its reverse sequence RNA Booster 10: cgugugccc
  • RNA Booster 2 aaguuuggc, or its reverse sequence RNA Booster 11: cgguuugaa
  • RNA Booster 3 cccuaggua, or its reverse sequence RNA Booster 12 : auggauccc
  • RNA Booster 4 ccguggugc, or its reverse sequence RNA Booster 13: cguggugcc
  • RNA Booster 5 aacuggggc, or its reverse sequence RNA Booster 14: cggggucaa
  • RNA Booster 6 cccucgggc, or its reverse sequence RNA Booster 15: cgggcuccc
  • RNA Booster 7 cacgugugc, or its reverse sequence
  • RNA Booster 16 cgugugcac
  • RNA Booster 8 cccuugggc, or its reverse sequence RNA Booster 17: cggguuccc
  • RNA Booster 9 ccguaggga, or its reverse sequence RNA Booster 18: agggaugcc
  • RNA Booster sequences in DNA molecule include, but are not limited to:
  • RNA Booster 1 cccgtgtgc, or its reverse sequence RNA Booster 10: cgtgtgccc
  • RNA Booster 2 aagtttggc, or its reverse sequence RNA Booster 11: cggtttgaa
  • RNA Booster 3 ccctaggta, or its reverse sequence RNA Booster 12: atggatccc
  • RNA Booster 4 ccgtggtgc, or its reverse sequence RNA Booster 13: cgtggtgcc
  • RNA Booster 5 aactggggc, or its reverse sequence RNA Booster 14: cggggtcaa
  • RNA Booster 6 ccctcgggc, or its reverse sequence RNA Booster 15: cgggctccc
  • RNA Booster 7 cacgtgtgc, or its reverse sequence RNA Booster 16: cgtgtgcac
  • RNA Booster 8 cccttgggc, or its reverse sequence RNA Booster 17: cgggttccc
  • RNA Booster 9 ccgtaggga, or its reverse sequence RNA Booster 18: agggatgcc [0059]
  • the RNA Booster is described as forward sequence, meaning the RNA Booster sequence is oriented from 5’ to 3’.
  • RNA Booster forward are selected in the group of RNA Booster 1 to 9.
  • the RNA Booster is described as reverse sequence, meaning the RNA Booster sequence is oriented from 3’ to 5’.
  • RNA Booster reverse are selected in the group of RNA Booster 10 to 18.
  • the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting RNA Booster 9, RNA Booster 8, RNA Booster 7, RNA Booster 6, RNA Booster 5, RNA Booster 4, RNA Booster 3, RNA Booster 2, and RNA Booster 1.
  • the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10,
  • the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10, RNA Booster 9, RNA Booster 8, RNA Booster 7, RNA Booster 6, RNA Booster 5, RNA Booster 4, RNA Booster 3, and RNA Booster 2.
  • RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10, RNA Booster 9, RNA Booster 8, RNA Booster 7, RNA Booster 6, RNA Booster 5, RNA Booster 4, RNA Booster 3, and RNA Booster 2.
  • the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10, RNA Booster 9, RNA Booster 8, RNA Booster 7, RNA Booster 6, RNA Booster 5, RNA Booster 4, and RNA Booster 3.
  • RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10, RNA Booster 9, RNA Booster 8, RNA Booster 7, RNA Booster 6, RNA Booster 5, RNA Booster 4, and RNA Booster 3.
  • the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10, RNA Booster 9, RNA Booster 8, RNA Booster 7, RNA Booster 6, RNA Booster 5, and RNA Booster 4.
  • RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10, RNA Booster 9, RNA Booster 8, RNA Booster 7, RNA Booster 6, RNA Booster 5, and RNA Booster 4.
  • the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10, RNA Booster 9, RNA Booster 8, RNA Booster 7, RNA Booster 6, and RNA Booster 5.
  • RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10, RNA Booster 9, RNA Booster 8, RNA Booster 7, RNA Booster 6, and RNA Booster 5.
  • the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10, RNA Booster 9, RNA Booster 8, RNA Booster 7, and RNA Booster 6.
  • RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10, RNA Booster 9, RNA Booster 8, RNA Booster 7, and RNA Booster 6.
  • the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10, RNA Booster 9, RNA Booster 8, and RNA Booster 7.
  • RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10, RNA Booster 9, RNA Booster 8, and RNA Booster 7.
  • the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10, RNA Booster 9, and RNA Booster 8.
  • RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10, RNA Booster 9, and RNA Booster 8.
  • the RNA or DNA molecule comprises RNA Booster 9. In some embodiments, the RNA or DNA molecule comprises RNA Booster 8.
  • the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10 and RNA Booster 9.
  • RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11, RNA Booster 10 and RNA Booster 9.
  • the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11 and RNA Booster 10.
  • RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12, RNA Booster 11 and RNA Booster 10.
  • the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12 and RNA Booster 11.
  • RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13, RNA Booster 12 and RNA Booster 11.
  • the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15, RNA Booster 14, RNA Booster 13 and RNA Booster 12.
  • the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17 , RNA Booster 16, RNA Booster 15, RNA Booster 14 and RNA Booster 13.
  • the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16, RNA Booster 15 and RNA Booster 14.
  • the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17, RNA Booster 16 and RNA Booster 15.
  • the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18, RNA Booster 17 and RNA Booster 16. [0081] In some embodiments, the RNA or DNA molecule comprises an RNA Booster sequence selected from the group comprising or consisting of RNA Booster 18 and RNA Booster 17.
  • the RNA or DNA molecule comprises RNA Booster 18. In some embodiments, the RNA or DNA molecule comprises RNA Booster 17.
  • the RNA Booster is located in 5’ of a sequence of interest, meaning that the RNA Booster is located upstream of a sequence of interest.
  • the RNA Booster is located in 5’ of a sequence of interest.
  • the RNA Booster is located in 3’ of a sequence of interest, meaning that the RNA Booster is located downstream of a sequence of interest.
  • the RNA Booster is capable to increase the expression of a gene of interest, as the transgene.
  • the RNA Booster is operably linked to the gene of interest.
  • the RNA Booster is located from 50 ribonucleotides or deoxyribonucleotide (50 nt) to 1000 ribonucleotides or deoxyribonucleotide (1 knt) upstream or downstream of a sequence of interest; such as, e.g., about 50 ⁇ 25 nt, 100 ⁇ 25 nt, 150 ⁇ 25 nt, 200 ⁇ 25 nt, 250 ⁇ 25 nt, 300 ⁇ 25 nt, 350 ⁇ 25 nt, 400 ⁇ 25 nt,
  • the RNA Booster is located about 500 ⁇ 25 nt upstream or downstream of a sequence of interest.
  • the RNA Booster is located from 5 ribonucleotides or deoxyribonucleotide (5 nt) to 2000 ribonucleotides or deoxyribonucleotide (2 knt) upstream or downstream of a sequence of interest; such as, e.g., about 50 ⁇ 25 nt,
  • RNA Booster is located about 2 ⁇ 0.025 knt upstream or downstream of a sequence of interest.
  • the RNA or DNA molecule comprises a sequence of interest.
  • the sequence of interest can be a sequence encoding a peptide or protein (e.g., without limitation, an enzyme, a transcription factor, a growth factor, a trophic factor, a hormone, a cytokine, an antibody, an antigen, a receptor, an immune regulator, a differentiation factor, a suicide protein, a cell-cycle modifying protein, an anti-proliferative protein, an angiogenic factor, an anti-angiogenic factor, a genome editor, a nuclease, a recombinase, a transposase, a neurotransmitter, and a reporter, including any precursor thereof, as well as fusion proteins).
  • the sequence of interest may typically be (or be derived from) an mRNA, a cDNA, a synthetic nucleic acid, or any combinations thereof.
  • sequence of interest can alternatively be a sequence of a non-coding RNA.
  • RNAs examples include, but are not limited to, transfer RNAs (tRNAs), ribosomal RNAs (rRNAs), small nuclear RNAs (snRNAs), small nucleolar RNAs (snoRNAs), SmY RNAs, small Cajal body-specific RNAs (scaRNAs), guide RNAs (gRNAs), Y RNAs, telomerase RNA component (TERC), spliced leader RNAs (SL RNAs), catalytic RNAs (/. ⁇ ., ribozymes; such as, e.g., ribonuclease P, ribonuclease MRP, and the like), antisense RNAs (aRNAs), c/.s-natural antisense transcript (cis-NAT), CRISPR RNAs (crRNAs), long non-coding RNAs (IncRNAs), microRNAs (miRNAs), piwi-interacting RNAs (tRNAs), transfer RNA
  • sequences of interest include any nucleic acid sequence encoding a molecule of therapeutic interest, such as any nucleic acid sequence encoding a peptide or protein, or a non-coding RNA, that is lacking, deficient and/or non-functional in a subject affected with a disease or condition.
  • sequences of interest include nucleic acid sequence encoding a CRISPR element (such as, e.g., Cas9, Casl2 or a gRNA), a zinc finger protein, a transcription activator-like effector nuclease (TALEN), a meganuclease, a spike protein of an enveloped virus (such as the spike protein of a Coronaviridae, e.g., of SARS-CoV-2; of an Orthomyxoviridae, e.g., of an Influenza virus; or of a Retroviridae), a fibroblast growth factor (such as, e.g., the glia-activating factor FGF9), a vascular endothelial growth factor (VEGF, including its isoforms, e.g., VEGF121, VEGF 121b, VEGF 145, VEGF 165, VEGF 165b, VEGF 189,
  • a CRISPR element such as,
  • the sequence of interest is an antigen
  • the RNA or DNA molecule of the invention is particularly suitable for vaccination purposes.
  • the sequence of interest is a genome editor, and the RNA or DNA molecule of the invention is particularly suitable for genome editing purposes.
  • the sequence of interest is FGF9 or FGF7, preferably FGF7, and the RNA or DNA molecule of the invention is particularly suitable for cosmetic purposes.
  • the expression of the sequence of interest is transient (z.e., not permanent or sustained).
  • the duration and amount of expression may be increased, e.g., by inserting a post-transcriptional regulatory element in 3’ (z.e., downstream) of the sequence of interest.
  • post-transcriptional regulatory element examples include, but are not limited to, the post-transcriptional regulatory element of Woodchuck hepatitis virus (WPRE) and the post-transcriptional regulatory element of hepatitis B virus (HPRE).
  • WPRE Woodchuck hepatitis virus
  • HPRE hepatitis B virus
  • the duration of expression of the sequence of interest in a cell may be at most 7 days (Fig. IB).
  • the RNA or DNA molecule encodes for an mRNA molecule.
  • the mRNA molecule is comprised within a non-viral vector.
  • the present invention encompasses thus a non-viral vector comprising the RNA or DNA molecule described herein.
  • the mRNA molecule may further comprise:
  • RNA Booster sequence Upstream of the RNA Booster sequence: a 5’-UTR sequence comprising a cap structure, and downstream of the sequence of interest, a 3’-UTR and a 3 ’-poly A.
  • the mRNA molecule may further comprise:
  • the mRNA molecule is encoded by a DNA molecule.
  • the DNA molecule is comprised within a non-viral vector selected in the group of: plasmid, cosmid, phage, Bacterial Artificial Chromosome (BAC), Yeast Artificial Chromosome, liposomes, exosomes, lipid nanoparticles, polypeptide nanoparticles, stable nucleic acid lipid particle (SNALP), and cationic lipoplexes.
  • the cap structure is a 5 ’-terminal m 7 G(5’)ppp(5’)G.
  • the cap structure may be an analog of m 7 G(5’)ppp(5’)G, such as, e.g., 3’-O-Me-m 7 G(5’)ppp(5’)G (called anti -reverse cap analog or ARC A), m 7 G(5’)ppp(5’)A, G(5’)ppp(5’)G or G(5’)ppp(5’)A.
  • the non-viral vector 1) has efficient encapsulation and protection on mRNAs from nuclease-based degradation upon administration to a subject; 2) prolongs the mRNAs half-life by preventing rapid clearance by a subject’s kidney and phagocytosis by the subject’s liver or spleen upon administration; 3) enhances targeted tissue/organ penetration and accumulation; 4) facilitates targeted cell internalization;
  • Typical examples of non-viral RNA vectors include, but are not limited to, liposomes, exosomes, lipid nanoparticles, polypeptide nanoparticles, stable nucleic acid lipid particle (SNALP), and cationic lipoplexes.
  • SNALP stable nucleic acid lipid particle
  • the RNA or DNA molecule may be packaged into or otherwise comprised within a viral vector.
  • the present invention encompasses thus a viral vector comprising the RNA or DNA molecule described herein.
  • the RNA or DNA molecule is packaged into or otherwise comprised within an DNA virus vector, z.e., an engineered viral particle derived from an DNA virus.
  • the RNA or DNA molecule is packaged into or otherwise comprised within an RNA virus vector, z.e., an engineered viral particle derived from an RNA virus.
  • engineered viral particle it is implied that (i) at least one exogenous nucleic acid sequence is introduced into the genome of the RNA virus, and/or (ii) at least one endogenous gene from the RNA virus is be mutated or deleted, either partially or totally.
  • RNA viruses are viruses that have ribonucleic acid as their genetic material. RNA viruses can be classified into four groups according to the Baltimore classification system:
  • Double-stranded RNA viruses including the following families: Birnaviridae, Chrysoviridae, Cystoviridae, Hypoviridae, Partitiviridae, Reoviridae, Totiviridae and Endornavirus .
  • Exemplary genera of double-stranded RNA viruses that can infect humans include, without limitation, Rotavirus and Coltivirus.
  • Group IV positive-sense single-stranded RNA viruses
  • Arteriviridae Coronaviridae
  • Roniviridae Astroviridae
  • Barnaviridae a Pacific Ocean
  • Bromoviridae a Pacific Ocean
  • Caliciviridae a Pacific Ocean
  • Closteroviridae a maltospinal virus
  • Dicistroviridae Flaviviridae, Flexiviridae , Hepeviridae, Leviviridae, Luteoviridae, Marnaviridae, Narnaviridae, Nodaviridae, Picornaviridae, Potyviridae, Sequiviridae , Tetraviridae, Togaviridae, Tombusviridae , Tymoviridae. Virgaviridae, Benyvirus. Cheravirus. Idaeovirus. Machlomovirus, Ourmiavirus, Sadwavirus Sobemovirus and Umbravirus.
  • Exemplary species of positive-sense single-stranded RNA viruses that can infect humans include, without limitation, hepatitis C virus, yellow fever virus, West Nile virus, dengue virus, Zika virus, Chikungunya virus, rubella virus, MERS, SARS, and SARS-CoV-2.
  • Group V negative-sense single-stranded RNA viruses
  • Qinviridae Aspiviridae. Chuviridae. Bornaviridae. Filoviridae, Mymonaviridae , Nyamiviridae, Paramyxoviridae, Pneumoviridae, Rhabdoviridae , Sunviridae. Yueviridae. Arenaviridae. Cruliviridae , Feraviridae, Fimoviridae, Hantaviridae , Jonviridae, Nairoviridae, Peribunyaviridae, Phasmaviridae, Phenuiviridae, Tospoviridae.
  • RNA viruses that can infect humans include, without limitation, Ebola virus, Lassa virus, Marburg virus, measles virus, rabies virus, mumps virus, Influenza viruses, and respiratory syncytial virus.
  • Group VI negative- strand single-stranded RNA-reverse transcriptase viruses
  • Metaviridae Pseudoviridae and Retroviridae
  • Exemplary species of negative- strand single-stranded RNA-reverse transcriptase viruses that can infect humans include, without limitation, human immunodeficiency virus (HIV), and human T-cell leukemia-lymphoma virus (HTLV).
  • the RNA molecule is packaged into or otherwise comprised within an RNA virus vector derived from a Group III, Group IV, Group V or Group VI RNA virus.
  • the RNA molecule is packaged into or otherwise comprised within an RNA virus vector derived from a Group VI RNA virus.
  • the RNA molecule may comprise a packaging sequence.
  • Viral packaging sequences include bacteriophage packaging sequences (such as, e.g., DNA phage packaging sequences and RNA phage packaging sequences) and eukaryotic virus packaging sequences (such as, e.g. , DNA virus packaging sequences and RNA virus packaging sequences).
  • the packaging sequence may be:
  • RNA virus (i) a wild-type packaging sequence from an RNA virus; or preferably
  • a wild-type packaging sequence from an RNA virus of the same genus as the one of the RNA virus into which the RNA molecule is to be packaged into or yet even more preferably (v) the wild-type packaging sequence from the RNA virus into which the RNA molecule is to be packaged into.
  • the packaging sequence may be a modified packaging sequence which shares more than 70 %, 75 %, 80 %, 85 %, 90 %, 95 % of sequence identity or even more with the wild-type packaging sequence of (i), (ii), (iii), (iv) or (v) above, while retaining its ability to trigger the process of packaging inside a viral capsid.
  • packaging sequences include, but are not limited to, the psi ( ) packaging signal of HIV or SIV; the core encapsidation signal from Gammaretrovirus the epsilon (a) encapsidation signal from HBV, and the encapsidation signal from BLV.
  • the RNA molecule is packaged into or otherwise comprised within an RNA virus vector derived from a Group VI RNA virus of the Retroviridae family.
  • the present invention encompasses thus a retroviral vector comprising the RNA molecule described herein.
  • Retroviruses are enveloped viruses from the Retroviridae family. They package two identical single-stranded ribonucleic acid (RNA) molecules of typically 7 to 10 kb in length, forming their genome.
  • the genome of retroviruses typically comprises gag, pol and env genes flanked by two long terminal repeat (LTRs) sequences. Each of these genes encodes for numerous peptides, which are initially expressed in the form of a single precursor polypeptide.
  • the gag gene encodes for the internal structure proteins (matrix, capsid and nucleocapsid); the pol gene encodes for retroviral enzymes reverse transcriptase, integrase and protease; and the env gene encodes for viral envelope glycoprotein.
  • the genome of retroviruses can further contain c/.s-acting elements, e.g., elements responsible for exporting out of the nucleus the unspliced viral genomic RNA which will be packaged, such as a Rev-response element (RRE) sequence.
  • RRE Rev-response element
  • the 5’ and 3’ LTRs serve to promote transcription and also serve as a polyadenylation sequence of the viral RNAs. Sequences necessary for the initiation of reverse transcription of the genome and for the encapsidation of viral RNA in particles (psi [T] packaging element) are typically adjacent to the 5’ LTR.
  • the genome of more complex retroviruses may comprise additional genes encoding accessory and/or regulatory proteins such as src, sag, tax, vif, vpr, vpx, vpu, nef, tat, rev, tmx, tas and/or bet.
  • the HIV-1 genome contains 7 accessory genes: vif, vpr, vpx, vpu, nef, tat and rev.
  • Retroviridae family is subdivided into two subfamilies: Orthoretrovirinae and Spumaretrovirinae .
  • the retroviral vector is (or is derived from) an Orthoretrovirinae or a Spumaretrovirinae .
  • the retroviral vector is (or is derived from) an Orthoretrovirinae .
  • the Orthoretrovirinae subfamily is subdivided into six genera: Alpharetrovirus, Betaretrovirus, Deltaretrovirus, Epsilonretrovirus, Gammaretrovirus, and Lentivirus.
  • Alpharetrovirus examples include, but are not limited to, avian sarcoma leukosis virus (ASLV), Rous sarcoma virus (RSV), and avian myeloblastosis virus (A V).
  • ASLV avian sarcoma leukosis virus
  • RSV Rous sarcoma virus
  • a V avian myeloblastosis virus
  • Betaretrovirus examples include, but are not limited to, mouse mammary tumor virus (MMTV), Jaagsiekte sheep retrovirus (JSRV), enzootic nasal tumor viruses (ENTV; including ENTV-1 and ENTV-2), simian retroviruses (SRV; including SRV-1 and SRV-2), and Mason-Pfizer monkey virus (M-PMV; formerly known as SRV-3).
  • MMTV mouse mammary tumor virus
  • JSRV Jaagsiekte sheep retrovirus
  • ENTV enzootic nasal tumor viruses
  • SRV simian retroviruses
  • M-PMV Mason-Pfizer monkey virus
  • Exemplary species of Deltaretrovirus include, but are not limited to, human T-lymphotropic viruses (HTLV; including HTLV-1, HTLV-2, HTLV-3 and HTLV-4), simian T-lymphotropic viruses (STLV; including STLV-1, STLV-2, STLV-3, and STLV-4), and bovine leukemia virus (BLV).
  • HTLV human T-lymphotropic viruses
  • STLV simian T-lymphotropic viruses
  • BLV bovine leukemia virus
  • Epsilonretrovirus examples include, but are not limited to, Walleye dermal sarcoma virus (WDSV), and Walleye epidermal hyperplasia viruses (WEHV; including WEHV-1 and WEHV-2).
  • WDSV Walleye dermal sarcoma virus
  • WEHV Walleye epidermal hyperplasia viruses
  • Exemplary species of Gammaretrovirus include, but are not limited to, murine leukemia viruses (MLV), Abelson murine leukemia virus (AMLV), Friend virus (FV), feline leukemia virus (FeLV), koala retrovirus (KoRV), xenotropic murine leukemia virus-related virus (XMRV), chick syncytial virus (CSV), murine sarcoma viruses (MSV; including Finkel-Biskis-Jinkins murine sarcoma virus, Harvey murine sarcoma virus, Kirsten murine sarcoma virus and Moloney murine sarcoma virus), feline sarcoma viruses (FSV; including Gardner- Arnstein feline sarcoma virus, Hardy -Zuckerman feline sarcoma virus and Snyder-Theilen feline sarcoma virus), Gibbon ape leukemia virus (GaLV), guinea pig type-C oncovirus,
  • Lentivirus examples include, but are not limited to, human immunodeficiency viruses (HIV; including HIV-1 and HIV-2), simian immunodeficiency viruses (SIV), feline immunodeficiency virus (FIV), bovine immunodeficiency virus (BIV), puma lentivirus (PLV), equine infectious anemia virus (EIAV), caprine arthritis encephalitis virus (CAEV), Visna-maedi virus, and Jembrana disease virus.
  • HSV human immunodeficiency viruses
  • SIV simian immunodeficiency viruses
  • FV feline immunodeficiency virus
  • BIV bovine immunodeficiency virus
  • PLV puma lentivirus
  • EIAV equine infectious anemia virus
  • CAEV caprine arthritis encephalitis virus
  • Visna-maedi virus and Jembrana disease virus.
  • the retroviral vector is (or is derived from) an Alpharetrovirus, a Betaretrovirus, a Deltaretrovirus, an Epsilonretrovirus, a Gammaretrovirus or a Lentivirus.
  • the retroviral vector is (or is derived from) a Lentivirus.
  • the retroviral vector is (or is derived from) a Lentivirus selected from the group comprising or consisting of human immunodeficiency viruses (HIV; including HIV-1 and HIV-2), simian immunodeficiency viruses (SIV), feline immunodeficiency virus (FIV), bovine immunodeficiency virus (BIV), puma lentivirus (PLV), equine infectious anemia virus (EIAV), caprine arthritis encephalitis virus (CAEV), Visna-maedi virus (VMV), and Jembrana disease virus (JDV).
  • HCV human immunodeficiency viruses
  • SIV simian immunodeficiency viruses
  • FV feline immunodeficiency virus
  • BIV bovine immunodeficiency virus
  • PLV puma lentivirus
  • EIAV equine infectious anemia virus
  • CAEV caprine arthritis encephalitis virus
  • the retroviral vector is (or is derived from) a human immunodeficiency virus, such as HIV-1 and HIV-2; more preferably HIV-1.
  • a retroviral vector as described herein packages two RNA molecules, each comprising an RNA Booster sequence and a sequence of interest, as described above.
  • the two RNA molecules may comprise the same sequence of interest, or different sequences of interest.
  • RNA Booster sequence a sequence of interest
  • the retroviral vector comprises a recombinant ribonucleic genome, itself comprising, from 5’ to 3’or from 3’ to 5’: a packaging sequence, an RNA Booster sequence, and a sequence of interest.
  • the retroviral vector comprises a recombinant ribonucleic genome, itself comprising, from 5’ to 3’: a 5’ LTR, a packaging sequence, an RNA Booster sequence, a sequence of interest, and a 3’ LTR.
  • the retroviral vector comprises a recombinant ribonucleic genome, itself comprising, from 5’ to 3’: a 5’ LTR, a packaging sequence, a Rev-response element, an RNA Booster sequence, a sequence of interest, and a 3’ LTR.
  • the retroviral vector comprises a recombinant ribonucleic genome, itself comprising, from 5’ to 3’: a 5’ LTR, a packaging sequence, a Rev-response element, an RNA Booster sequence, a sequence of interest, a post-transcriptional regulatory element, and a 3’ LTR.
  • the retroviral vector is reverse transcriptase-defective.
  • the gene encoding the reverse transcriptase may be mutated or deleted, so that the reverse transcription process is altered and cannot be completed, z.e., cannot give rise to a full-length retroviral double-stranded DNA intermediate molecule upon infection of a target cell, and consequently, cannot generate a proviral vector genome.
  • This inability in the context of the invention, can result either from (i) an absence of the reverse transcriptase gene in the retroviral vector, or (ii) at least one mutation in the reverse transcriptase gene in the retroviral vector.
  • a HIV-1 reverse transcriptase with SEQ ID NO: 4 may comprise a D110E substitution resulting in an abolished reverse transcriptase activity.
  • the retroviral vector might further be integrase-defective.
  • the gene encoding the integrase might be mutated or deleted, so that the integration process is altered and cannot be completed, i.e., a proviral vector genome cannot be integrated into the genome of a target cell.
  • This inability can result either from (i) an absence of the integrase gene in the retroviral vector, or (ii) at least one mutation in the integrase gene in the retroviral vector.
  • the RNA or DNA molecule in particular when packaged into or otherwise comprised within an RNA virus vector, may further comprise one or several elements, in particular one or several of long terminal repeats (LTR), including a 5’ LTR and a 3’ LTR; a Rev-response element (RRE) sequence; and a post-transcriptional regulation element sequence.
  • LTR long terminal repeats
  • RRE Rev-response element
  • the RNA or DNA molecule comprises a 5’ LTR, located in 5’ of the packaging sequence (in other words, before the packaging sequence).
  • the RNA or DNA molecule comprises a Rev-response element (RRE) sequence, located in 3’ of the packaging sequence but in 5’ of the RNA Booster sequence (in other words, between the packaging sequence and the RNA Booster sequence).
  • RRE Rev-response element
  • the RNA or DNA molecule comprises a post-transcriptional regulation element sequence, located in 3’ of the sequence of interest (in other words, after the sequence of interest).
  • the RNA or DNA molecule comprises a 3’ LTR, located in 3’ of the sequence of interest (in other words, after the sequence of interest).
  • the 3’ LTR is located in 3’ of this post-transcriptional regulation element sequence.
  • the RNA or DNA molecule may thus comprise, from 5’ to 3’ : optionally, a 5’ LTR, optionally, a packaging sequence, optionally, a Rev-response element, compulsorily, an RNA Booster sequence, compulsorily, a sequence of interest, optionally, a post-transcriptional regulatory element, and optionally, a 3’ LTR.
  • the RNA or DNA molecule may thus comprise, from 5’ to 3’ : optionally, a 5’ LTR, compulsorily, a packaging sequence, optionally, a Rev-response element, compulsorily, an RNA Booster sequence, compulsorily, a sequence of interest, optionally, a post-transcriptional regulatory element, and optionally, a 3’ LTR.
  • the RNA or DNA molecule may thus comprise, from 5’ to 3’ : optionally, a 5’ LTR, optionally, a packaging sequence, optionally, a Rev-response element, compulsorily, a sequence of interest, optionally, a post-transcriptional regulatory element, optionally, a 3’ LTR, and compulsorily, an RNA Booster sequence.
  • the RNA or DNA molecule may thus comprise, from 5’ to 3’ : optionally, a 5’ LTR, compulsorily, a packaging sequence, optionally, a Rev-response element, compulsorily, a sequence of interest, optionally, a post-transcriptional regulatory element, optionally, a 3’ LTR, and compulsorily, an RNA Booster sequence.
  • a second object of the invention is a composition comprising, consisting of, or consisting essentially of, the RNA or DNA molecule described above.
  • an object of the invention is a composition comprising, consisting of, or consisting essentially of, the non-viral vector described above, or the viral vector, in particular the retroviral vector, described above.
  • the composition is a pharmaceutical composition and further comprises at least one pharmaceutically acceptable excipient or carrier.
  • compositions or pharmaceutical composition include, but are not limited to, ion exchangers, alumina, aluminum stearate, lecithin, serum proteins (such as human serum albumin), buffer substances such as phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, salts or electrolytes, such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based substances (for example sodium carboxymethylcellulose), polyethylene glycol, polyacrylates, waxes, polyethylene-polyoxypropylene-block polymers, polyethylene glycol and wool fat.
  • ion exchangers alumina, aluminum stearate, lecithin
  • serum proteins such as human serum albumin
  • buffer substances such as phosphates, glycine, sorbic acid, potassium sorb
  • a third object of the invention relates to the various uses and applications of the RNA or DNA molecule, in particular of the non-viral vector or viral vector, in particular the retroviral vector, or of the composition, as described above.
  • the eukaryote is an animal, preferably a mammal, even more preferably a human.
  • a method in particular an in vitro or ex vivo method, of transiently expressing at least one sequence of interest in a cell, which method comprises contacting or otherwise transfecting or transducing the cell with the RNA or DNA molecule, or with the non-viral vector or viral vector, in particular the retroviral vector, as described above.
  • RNA or DNA molecule is under control of promoter noninducible. [0162] In some embodiments, RNA or DNA molecule is under control of promoter inducible.
  • RNA or DNA molecule is under control of strong promoter.
  • RNA or DNA molecule or the non-viral vector or viral vector, in particular the retroviral vector, or of the composition, for use in therapy, as a drug or as a medicament.
  • RNA or DNA molecule, or the non-viral vector or viral vector, in particular the retroviral vector, or the composition for use in preventing or treating a disease in a subject in need thereof; or a method of preventing or treating a disease, comprising administering to a subject in need thereof the RNA molecule or DNA molecule or the non-viral vector or viral vector, in particular the retroviral vector, or the composition.
  • the disease is selected from the group consisting of cancer, infectious diseases, neuromuscular diseases, ocular diseases, blood diseases, cardiovascular diseases, skin diseases, and neurodegenerative diseases.
  • the disease is cancer.
  • cancers include those listed in the 11 th revision of the International Statistical Classification of Diseases and Related Health Problems (ICD), under chapter 02 “Neoplasms”.
  • ICD International Statistical Classification of Diseases and Related Health Problems
  • cancers include, but are not limited to, recurrent, metastatic or multi-drug resistant cancer.
  • cancers include, but are not limited to, adenofibroma, adenoma, agnogenic myeloid metaplasia, AIDS-related malignancies, ameloblastoma, anal cancer, angiofollicular mediastinal lymph node hyperplasia, angiokeratoma, angiolymphoid hyperplasia with eosinophilia, angiomatosis, anhidrotic ectodermal dysplasia, anterofacial dysplasia, apocrine metaplasia, apudoma, asphyxiating thoracic dysplasia, astrocytoma (including, e.g., cerebellar astrocytoma and cerebral astrocytoma), atriodigital dysplasia, atypical melanocytic hyperplasia, atypical metaplasia, autoparenchymatous metaplasia, basal cell hyperplasia, benign giant lymph
  • lymphangiomyoma including, e.g., AIDS-related lymphoma, central nervous system lymphoma, primary central nervous system lymphoma, Hodgkin’s lymphoma, non-Hodgkin’s lymphoma, Hodgkin’s lymphoma during pregnancy, non-Hodgkin’s lymphoma during pregnancy, mast cell lymphoma, B-cell lymphoma, adenolymphoma, Burkitt’s lymphoma, cutaneous T-cell lymphoma, large cell lymphoma, and small cell lymphoma), lymphopenic thymic dysplasia, lymphoproliferative disorders, macroglobulinemia (including, e.g., Waldenstrom’s macroglobulinemia), malignant carcinoid syndrome, malignant mesothelioma, malignant thymoma, mammary
  • the disease is an infectious disease.
  • infectious diseases include those listed in the 11 th revision of the International Statistical Classification of Diseases and Related Health Problems (ICD), under chapter 01 “Certain infectious or parasitic diseases”.
  • ICD International Statistical Classification of Diseases and Related Health Problems
  • infectious diseases include, but are not limited to, bacterial infections, viral infections, fungal infections, parasitic infections, ectoparasitic infections, and the like.
  • the disease is a neuromuscular disease.
  • neuromuscular diseases include, but are not limited to, acid maltase deficiency, amyotrophic lateral sclerosis, Andersen-Tawil syndrome, Becker muscular dystrophy, Becker myotonia congenita, Bethlem myopathy, bulbospinal muscular atrophy, carnitine deficiency, carnitine palmityl transferase deficiency, central core disease, centronuclear myopathy, Charcot-Marie-Tooth disease, congenital muscular dystrophy, congenital myasthenic syndromes, congenital myotonic dystrophy, Cori disease, Debrancher enzyme deficiency, Dejerine-Sottas disease, dermatomyositis, distal muscular dystrophy, Duchenne muscular dystrophy, dystrophia myotonica, Emery- Dreifuss muscular dystrophy, endocrine myopathies, Eulenberg disease, facioscapulohumeral muscular dystrophy,
  • the disease is an ocular disease.
  • ocular diseases include those listed in the 11 th revision of the International Statistical Classification of Diseases and Related Health Problems (ICD), under chapter 09 “Diseases of the visual system”.
  • AMD age-related macular degeneration
  • DME diabetic macular edema
  • DME diabetic macular edema
  • DR retinopathy, diabetic retinopathy
  • PDR proliferative DR
  • NPDR non-proliferative DR
  • high-altitude DR other ischemia-related retinopathies
  • ROP retinal vein occlusion
  • RVO retinal vein occlusion
  • BRVO retinal vein occlusion
  • uveitis e.g., infectious or non- infectious uveitis
  • choroiditis e.g., multifocal choroiditis
  • ocular histoplasmosis blepharitis, dry eye, traumatic eye injury, and Sjogren’s disease.
  • the disease is a blood disease.
  • Examples of blood diseases include those listed in the 11 th revision of the International Statistical Classification of Diseases and Related Health Problems (ICD), under chapter 03 “Diseases of the blood or blood-forming organs”.
  • ICD International Statistical Classification of Diseases and Related Health Problems
  • blood diseases include, but are not limited to, acute myeloid leukemia, acute promyelocytic leukemia, acute lymphoblastic leukemia, chronic myelogenous leukemia, myelodysplastic syndromes, anemia, methaemoglobinaemia, hemophilia, non-thrombocytopenic purpura, thrombocytosis, and thrombocytopenia.
  • the disease is a cardiovascular disease.
  • cardiovascular diseases include those listed in the 11 th revision of the International Statistical Classification of Diseases and Related Health Problems (ICD), under chapter 11 “Diseases of the circulatory system”.
  • cardiovascular diseases include, but are not limited to, aneurysm, angina, arrhythmia, atherosclerosis, cardiomyopathy, stroke, cerebrovascular disease, congenital heart disease, congestive heart failure, myocarditis, valve disease coronary, artery disease dilated, cardiomyopathy, diastolic dysfunction, endocarditis, hypertension, hypertrophic cardiomyopathy, mitral valve prolapse, myocardial infarction, and venous thromboembolism.
  • the disease is a skin disease.
  • Examples of skin diseases include those listed in the 11 th revision of the International Statistical Classification of Diseases and Related Health Problems (ICD), under chapter 14 “Diseases of the skin”.
  • ICD International Statistical Classification of Diseases and Related Health Problems
  • skin diseases include, but are not limited to, atopic dermatitis, hand dermatitis, contact dermatitis, allergic contact dermatitis, irritant contact dermatitis, neurodermatitis, perioral dermatitis, stasis dermatitis, dyshidrotic eczema, xerotic dermatitis, nummalar dermatitis, seborrheic dermatitis, eyelid dermatitis, diaper dermatitis, dermatomyositis, lichen planus, lichen sclerosis, alopecia areata, vitiligo, rosacea, epidermolysis bullosa, keratosis pilaris, pityriasis alba, pemphigus, vulvovaginitis, acne, chronic spontaneous urticaria, chronic idiopathic urticaria, chronic physical urticaria, Vogt-Koyanagi-Harada disease, Sutton
  • the disease is a neurodegenerative disease.
  • neurodegenerative diseases include, but are not limited to, Alzheimer’s disease, Parkinson’s disease, amyotrophic lateral sclerosis (ALS), frontotemporal dementia, spinocerebellar ataxia (SC A) type 1, SC A type 2, SC A type 6, SCA type 7, SCA type 17, Machado-Joseph disease/SCA type 3 (MID/SCA3), Huntington’s disease, dentatorubral pallidoluysian atrophy (DRPLA), spinal and bulbar muscular atrophy (SBMA), prion disease, and motor neuron disease.
  • DRPLA dentatorubral pallidoluysian atrophy
  • SBMA spinal and bulbar muscular atrophy
  • prion disease and motor neuron disease.
  • RNA molecule or DNA molecule or the non-viral vector or viral vector in particular the retroviral vector, or the composition
  • skin and/or skin appendages such as hair, nails or skin glands
  • a method of treating skin and/or skin appendages such as hair, nails or skin glands in a subject in need thereof against, comprising administering to the subject in need thereof the RNA molecule or DNA molecule or the non-viral vector or viral vector, in particular the retroviral vector, or the composition.
  • these uses and methods are preferably non-therapeutic uses and methods, /. ⁇ ., a cosmetic use or method.
  • these non-therapeutic uses and methods are applicable to substantially healthy subject.
  • a “substantially healthy subject” is a subject who has not been previously diagnosed or identified as suffering from skin and/or hair and/or nails diseases
  • a “substantially healthy subject” is a subject who has not been previously diagnosed or identified as suffering from skin and/or hair and/or nails diseases.
  • a “substantially healthy subject” is a subject who does not suffer from any known disease, disorder or condition.
  • a “substantially healthy subject” is a subject who is not seeking medical attention.
  • Examples of treatments of skin and/or skin appendages include for instance any or several of induction of hair growth, prevention of hair loss, induction of hair removal, hair coloring or bleaching, prevention of hair graying, promotion of hair thickening, promotion of or prevention of hair curling, promotion of skin healing, promotion of skin repairing, promoting skin appearance, prevention of wrinkle formation, improvement of skin elasticity, induction of skin tone homogenization, and reduction of sebum secretion.
  • the non-therapeutic treatment corresponds to promoting skin healing by improving the appearance of the skin.
  • inducing hair growth and/or promoting skin healing can be achieved using the RNA or DNA molecule, in particular the retroviral vector, of the invention, in particular wherein the sequence of interest encodes the glia-activating factor (aka FGF9).
  • FGF9 glia-activating factor
  • sequences of interest can be used for cosmetic purposes, including, for instance, sequences coding for growth factors.
  • sequences of interest that can be used for cosmetic purposes include, but are not limited to, sequences encoding the hepatocyte growth factor (HGF), the platelet-derived growth factor (PDGF), the fibroblast growth factor 5 (FGF5) (including FGF5-short [FGF5s] and FGF5-long [FGF51]), the fibroblast growth factor 7 (FGF7), the fibroblast growth factor 10 (FGF10), the transforming growth factor pi (TGFpi), the transforming growth factor a (TGFa), the keratinocyte growth factor (KGF), the insulin-like growth factor 1 (IGF-1), the insulin-like growth factor 2 (IGF-2), the insulin-like growth factor-binding protein 5 (IGFBP5), the vascular endothelial growth factor (VEGF), the acidic fibroblast growth factor (aFGF), the basic fibroblast growth factor (bFGF), the epidermal growth factor (EGF), the collagen genes (COL1 Al, COL1A
  • the RNA molecule, the non-viral vector or viral vector, in particular the retroviral vector, or the composition is in non-therapeutic concentration, in particular in a concentration low enough not to induce a therapeutic effect. Therefore, the non-therapeutic concentration is depending of the RNA molecule and more specifically, on the sequence of interest. The skilled artisan is familiar with the non-therapeutic concentrations.
  • the RNA molecule or DNA molecule or the non-viral vector or viral vector, in particular the retroviral vector, or the composition is to be administered topically, in particular cutaneously or transdermally.
  • the RNA molecule or DNA molecule or the non-viral vector or viral vector, in particular the retroviral vector, or the composition is to be administered topically after collagen induction therapy (CIT).
  • CIT collagen induction therapy
  • the RNA molecule or DNA molecule or the non-viral vector or viral vector, in particular the retroviral vector, or the composition is used as an epidermal and/or dermal stimulating agent, preferably as an epidermal agent.
  • collagen induction therapy also known as “microneedling”, “dermarolling”, or “skin needling” refers to a cosmetic procedure which involves repeatedly puncturing the skin of a subject with microneedles (i.e., needles having a length typically ranging from about 100 pm to 1 000 pm).
  • kits comprising a microneedling device and the RNA molecule or DNA molecule or the non-viral vector or viral vector, in particular the retroviral vector, or the composition of the invention.
  • the RNA molecule or DNA molecule or the non-viral vector or viral vector, in particular the retroviral vector, or the composition is to be administered topically though application onto the skin of a transdermal patch, in particular of a microneedle transdermal patch, comprising said RNA molecule or DNA molecule or non-viral vector or viral vector, in particular the retroviral vector, or the composition of the invention.
  • transdermal patch in particular a microneedle transdermal patch, comprising the RNA molecule or DNA molecule the non-viral vector or viral vector, in particular the retroviral vector, or the composition of the invention.
  • these uses and methods are preferably therapeutic uses and/or methods.
  • these non-therapeutic uses and methods are applicable to substantially sick subject.
  • a “substantially sick subject” is a subject who has been previously diagnosed or identified as suffering from skin and/or hair and/or nails diseases
  • a “substantially sick subject” is a subject who has been previously diagnosed or identified as suffering from skin and/or hair and/or nails diseases.
  • a “substantially sick subject” is a subject who does suffer from any known disease, disorder or condition.
  • a “substantially sick subject” is a subject who is seeking medical attention.
  • Examples of therapies of skin and/or skin appendages, in particular of therapeutic treatments, include for instance any or several of induction of promotion of skin and/or hair and/or nail healing.
  • RNA molecule in particular the retroviral vector, of the invention.
  • sequences of interest can be used for therapeutic purposes, as promoting skin and/or hair healing including, for instance, sequences coding for growth factors.
  • sequences of interest that can be used for cosmetic purposes include, but are not limited to, sequences encoding the hepatocyte growth factor (HGF), the platelet-derived growth factor (PDGF), the fibroblast growth factor 5 (FGF5) (including FGF5-short [FGF5s] and FGF5-long [FGF51]), the fibroblast growth factor 7 (FGF 7), the fibroblast growth factor 10 (FGF10), the transforming growth factor pi (TGFpi), the transforming growth factor a (TGFa), the keratinocyte growth factor (KGF), the insulin-like growth factor 1 (IGF-1), the insulin-like growth factor 2 (IGF-2), the insulin-like growth factor-binding protein 5 (IGFBP5), the vascular endothelial growth factor (VEGF), the acidic fibroblast growth factor (aFGF), the basic fibroblast growth factor (bFGF), the epidermal growth factor (EGF), the collagen genes (COL1 Al, COL1A
  • the RNA molecule, the non-viral vector or viral vector, in particular the retroviral vector, or the composition is in therapeutic concentration, in particular in a concentration high enough to induce a therapeutic effect. Therefore, the therapeutic concentration is depending of the RNA molecule and more specifically, on the sequence of interest. The skilled artisan is familiar with the therapeutic concentrations.
  • the RNA molecule, the non-viral vector or viral vector, in particular the retroviral vector, or the composition is to be administered topically, in particular cutaneously, transdermally or subdermally, and prefereably transdermally or subdermally, more preferably subdermally.
  • administration to the subject may be carried out by systemic injection.
  • systemic injections include, but are not limited to, intravenous (iv), subcutaneous (sc), intramuscular (im), intradermal (id), intraperitoneal (ip), and intranasal (in) injection.
  • Injections can be performed subcutaneously, intramuscularly, intranasally or intraperitoneally, with various combinations for the prime and boost injection.
  • the RNA molecule, the non-viral vector or viral vector, in particular the retroviral vector, or the composition is to be administered topically after collagen induction therapy (CIT).
  • CIT collagen induction therapy
  • the RNA molecule or DNA molecule or the non-viral vector or viral vector, in particular the retroviral vector, or the composition is used as an epidermal and/or dermal stimulating agent, preferably as an dermal agent.
  • collagen induction therapy also known as “microneedling”, “dermarolling”, or “skin needling” refers to a cosmetic procedure which involves repeatedly puncturing the skin of a subject with microneedles (i.e., needles having a length typically ranging from about 100 pm to 1 000 pm).
  • kits comprising a microneedling device and the RNA molecule, the non-viral vector or viral vector, in particular the retroviral vector, or the composition of the invention.
  • the RNA molecule, the non-viral vector or viral vector, in particular the retroviral vector, or the composition is to be administered topically though application onto the skin of a transdermal patch, in particular of a microneedle transdermal patch, comprising said RNA molecule, non-viral vector or viral vector, in particular the retroviral vector, or the composition of the invention.
  • transdermal patch in particular a microneedle transdermal patch, comprising the RNA molecule, the non-viral vector or viral vector, in particular the retroviral vector, or the composition of the invention.
  • RNA molecule or DNA molecule or the non-viral vector or viral vector for use in vaccinating a subject in need thereof against an infectious disease or against cancer; or a method of vaccinating a subject in need thereof against an infectious disease or against cancer, comprising administering to the subject in need thereof the RNA molecule or DNA molecule or the non-viral vector or viral vector, in particular the retroviral vector, or the composition.
  • vaccinating a subject can be efficiently achieved using the RNA molecule, in particular the retroviral vector, of the invention.
  • sequence of interest in this instance should encode an antigen against which an immunization is desired.
  • antigens include, without limitation, pathogen-related antigens (such as, e.g., antigens of microorganisms or parasites, such as viruses, fungi or bacteria, or archaea, or immunogenic molecules derived from them), self-antigens (such as, e.g., cellular antigens including cells containing normal transplantation antigens and/or tumor-related antigens, RR-Rh antigens, and antigens characteristic of, or specific to particular cells or tissues or body fluids), and allergen-related antigens (such as, e.g., those associated with environmental allergens, including grasses, pollens, molds, dust, insects, dander, venoms, and the like; occupational allergens, including latex, dander, urethanes, epoxy resins, and the like; food, including shellfish, peanuts, eggs, milk products, and the like; and drugs, including antibiotics, anesthetics, and the like).
  • pathogen-related antigens include, but are not limited to, antigens derived from vaccinia, avipox virus, turkey influenza virus, bovine leukemia virus, feline leukemia virus, avian influenza, chicken pneumovirosis virus, canine parvovirus, equine influenza, FHV, Newcastle disease virus (NDV), Chicken/Pennsylvania/1/83 influenza virus, infectious bronchitis virus, Dengue virus, measles virus, Rubella virus, pseudorabies, Epstein-Barr virus, HIV, SIV, EHV, BHV, HCMV, MERS, SARS, SARS-CoV-2, Hantaan, C.
  • tetani mumps, Morbillivirus, Herpes Simplex virus type 1, Herpes Simplex virus type 2, Human cytomegalovirus, hepatitis A virus, hepatitis B virus, hepatitis C virus, hepatitis E virus, respiratory syncytial virus, human papilloma virus, Influenza virus, Salmonella, Neisseria, Borrelia, Chlamydia, Bordetella, Plasmodium, Toxoplasma, Cryptococcus, Streptococcus, Staphylococcus, Haemophilus, Diptheria, Tetanus, Pertussis, Escherichia, Candida, Aspergillus, Entamoeba, Giardia, Trypanasoma, Leishmania, and Malaria.
  • Suitable examples of self-antigens include, but are not limited to, lupus autoantigen, Smith, Ro, La, Ul-RNP, fibrillin, nuclear antigens, histones, glycoprotein gp70, ribosomal proteins, pyruvate dehydrogenase, dehydrolipoamide acetyltransferase (PCD-E2), hair follicle antigens, human tropomyosin isoform 5 (hTM5), proinsulin, insulin, IA2, GAD65, collagen type II, human cartilage gp 39 (HCgp39), gpl30-RAPS, dnaJpl, citrullinated proteins and peptides (including citrullinated type II collagen, citrullinated vimentin and citrullinated fibrinogen), myelin basic protein, proteolipid protein (PLP), myelin oligodendrocyte glycoprotein (MOG), thyroid stimulating factor receptor (TSH-R), acet
  • Suitable examples of tumor-related antigens include, but are not limited to, MART- 1 /Mel an- A, gplOO, dipeptidyl peptidase IV (DPPIV), adenosine deaminase-binding protein (ADAbp), cyclophilin b, colorectal associated antigen (CRC)-CO17-1A/GA733, carcinoembryonic antigen (CEA) and its immunogenic epitopes CAP-1 and CAP-2, etv6, amll, prostate specific antigen (PSA) and its immunogenic epitopes PSA-1, PSA-2, and PSA-3, prostate-specific membrane antigen (PSMA), T-cell receptor/CD3-zeta chain, MAGE-family of tumor antigens (e.g., MAGE-A1, MAGE-A2, MAGE-A3, MAGE-A4, MAGE-A5, MAGE-A6, MAGE-A7, MAGE-A8, MAGE-A9, MAGE-family
  • HER2/neu p21ras, RCAS1, alpha-fetoprotein, E-cadherin, alpha-catenin, beta-catenin and gamma-catenin, pl20ctn, gpl00.sup.Pmelll7, PRAME, NY-ESO-1, cdc27, adenomatous polyposis coli protein (APC), fodrin, connexin 37, Ig-idiotype, pl5, gp75, GM2 and GD2 gangliosides, Smad family of cancer antigens brain glycogen phosphorylase, SSX-1, SSX-2 (HOM-MEL-40), SSX-1, SSX-4, SSX-5, SCP-1 and CT-7, and c-erbB-2 and viral antigens such as the HPV-16 and HPV-18 E6 and E7 antigens and the EBV-encoded nuclear antigen (EBNA)-l, and the like
  • tumor-related antigens are described in, e.g., Li etal., 2004. Cancer Immunol Immunother . 53(3): 139-43; Novellino et al., 2005. Cancer Immunol Immunother. 54(3): 187-20; which are herein incorporated by reference in their entirety.
  • the RNA molecule, DNA molecule, the non-viral vector or viral vector, in particular the retroviral vector, or the composition can be administered to a subject in need thereof once, twice, or more.
  • the first administration is typically referred to as “priming step”, and the subsequent administration(s) are referred to as “boosting step”.
  • the boosting step can be carried out once, twice, three times, four times or more.
  • the period of time between the priming step and the boosting step and/or between each iteration of the “boosting step” ranges from about 1 day to about 6 months, preferably from about 1 week to about 3 months, more preferably from about 2 weeks to about 1 month.
  • the period of time between the priming step and the boosting step and/or between each iteration of the “boosting step” is about 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 1 week, 2 weeks, 3 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, or 6 months.
  • administration to the subject may be carried out by systemic injection.
  • systemic injections include, but are not limited to, intravenous (iv), subcutaneous (sc), intramuscular (im), intradermal (id), intraperitoneal (ip), and intranasal (in) injection.
  • each injection may be carried out via the same route, or by different route.
  • the priming step can be carried out by intramuscular injection and the boosting step can be carried out by intranasal injection; or the priming step can be carried out by intraperitoneal injection and boosting step by intranasal injection.
  • both the priming and boosting steps can be carried out by intraperitoneal injection.
  • RNA molecule or DNA molecule or the non-viral vector or viral vector in particular the retroviral vector, or the composition, for use in genome engineering; or a method of genome engineering, comprising administering to a subject in need thereof the RNA molecule or DNA molecule or the non-viral vector or viral vector, in particular the retroviral vector, or the composition.
  • Such genome engineering applications are useful, in particular in the field of bioproduction, or in methods of therapeutic treatment such as cell therapy or gene therapy. [0239] These uses and methods may be in vivo or in vitro.
  • RNA molecules or DNA molecule or the non-viral vector or viral vector, in particular the retroviral vector, or the composition are contacted ex vivo with a cell or a population of cells from a subject, and optionally the cell or population of cells is then administered back to said subject.
  • sequence of interest in this instance should encode a genome editor.
  • Examples of genome editors include, but are not limited to, CRISPR-associated proteins (Cas), zinc finger nucleases (ZNFs), transcription activator-like effector nucleases (TALEN), and site-specific recombinases (such as, e.g., a Cre recombinase or flippase [Flp]).
  • Cas CRISPR-associated proteins
  • ZNFs zinc finger nucleases
  • TALEN transcription activator-like effector nucleases
  • site-specific recombinases such as, e.g., a Cre recombinase or flippase [Flp]).
  • CRISPR-associated proteins include, without limitation, class 2 Cas proteins such as, e.g., Cas9, Casl2 (including Cas 12a (or Cpfl), Cas 12b (or C2cl), Casl2c (or C2c3), Casl2d (or CasY), Casl2e (or CasX), Casl2f (or Casl4 or C2cl0), Cas 12g, Casl2h, Casl2i, and Cas 12k (or C2c5)), and Cas 13 (including Cast 3a (or C2c2), Cas 13b, Cas 13c, and Cas 13d).
  • the nucleic acid coding for CRISPR-associated proteins can be fused with at least another nucleic acid sequence, such as prime editing guide RNA (pegRNA) and/or base editing RNA.
  • pegRNA prime editing guide RNA
  • base editing RNA base editing RNA
  • genome editors may require at least one RNA or DNA molecule, in particular in the case of CRISPR-associated proteins, which RNA or DNA molecule is capable of interacting with the genome editor and targeting it to a locus of interest in a cell’s genome.
  • Said RNA molecule may be known in the art as guide RNA (gRNA) and/or prime editing guide RNA (pegRNA) and/or base editing RNA.
  • gRNA guide RNA
  • pegRNA prime editing guide RNA
  • base editing RNA RNA molecules
  • two RNA molecules a CRISPR RNA named crRNA and a trans-activating CRISPR RNA named tracrRNA
  • crRNA a CRISPR RNA named crRNA
  • tracrRNA trans-activating CRISPR RNA
  • the uses and methods may thus comprise contacting the cell or administering to the subject such gRNA, or a mix of crRNA and tracrRNA, before, concomitantly with or after, the RNA molecule or DNA molecule or the non-viral vector or viral vector, in particular the retroviral vector, or the composition.
  • genome editors may further require at least one exogenous nucleic acid, in particular at least one exogenous DNA, which is to be inserted in the genome of a target cell.
  • This exogenous nucleic acid may comprise, for instance, the sequence of a gene of interest to be inserted in the genome of a target cell.
  • This gene of interest may be, for instance, a functional version of a malfunctioning endogenous gene, or alternatively, a malfunctional version of a normally functioning endogenous gene. It can also be any other gene which expression is desired in a cell, depending on the purpose.
  • the method of genome engineering may be particularly suitable for the transgenesis of an organism.
  • the organism may be a plant or an animal. In some embodiments, the animal is not a human.
  • the method comprises the steps of transfecting or transducing an animal cell with the RNA molecule or DNA molecule or the non-viral vector or viral vector, in particular the retroviral vector, or the composition; collecting the animal cell’s nucleus; inserting the animal cell’s nucleus into an unfertilized oocyte; allowing the oocyte to develop, thereby obtaining a transgenic animal, preferably wherein the transgenic animal is not a human.
  • the sequence of interest of the RNA or DNA molecule is a genome editor, and the nucleic acid sequence encoding the transgene of interest is brought to the cell in addition to the RNA or DNA molecule of the invention, for stable integration into the genome of said cell and development of a transgenic organism.
  • the method of genome engineering may be particularly suitable for bioproduction (or recombinant production), in particular for the generation of stable expression systems.
  • Such method is applicable, for instance, to the production of recombinant proteins of interest in any suitable expression system, including without limitation, bacterial cells, yeast cells, insect cells, mammalian cells, and human cells.
  • the method comprises the steps of transfecting or transducing a cell or a population of cells with the RNA molecule or the DNA molecule or the RNA molecule vectorized or DNA molecule vectorized in a non-viral vector or in a viral vector, in particular the retroviral vector, or the composition; culturing the cell or population of cells for a period of time sufficient to allow the production by said cell or population of cells of a protein of interest encoded by the RNA or DNA molecule; recovering the protein of interest; optionally, purifying the protein of interest.
  • sequence of interest of the RNA or DNA molecule is a genome editor, and the nucleic acid sequence encoding the protein of interest is brought to the cell or population of cells in addition to the RNA or DNA molecule of the invention, for stable integration into the genome of said cell or population of cells and recombinant production of the protein of interest.
  • a fourth object of the invention is a nucleic acid system comprising at least one nucleic acid sequence comprising the RNA Booster.
  • Another object of the invention is a kit comprising said nucleic acid system or RNA or DNA molecule; a cell or cell population comprising said nucleic acid system or RNA or DNA molecule; and/or a method of producing said nucleic acid system or the RNA molecule or the DNA molecule as described herein.
  • the invention can be a nucleic acid system; a kit comprising said nucleic acid system; a cell or cell population comprising said nucleic acid system; and a method of producing an RNA virus vector, in particular a retroviral vector, as described above, using said nucleic acid system or said cell or cell population.
  • the nucleic acid system comprises at least one nucleic acid sequence encoding a recombinant expression cassette comprising:
  • RNA Booster sequence characterized by a sequence mmsknkkkm or its reverse sequence mkkknksmm, and/or
  • MCS multiple cloning site
  • an origin of replication ORI
  • ORI origin of replication
  • the first nucleic acid system can be provided in a single linear nucleic acid or plasmid.
  • the purpose of the selectable marker is to allow for the selection or identification of cells or organisms that have taken up the gene of interest.
  • the selectable marker is an antibiotic resistance gene.
  • the antibiotic resistance gene is selected in the group of: ampicillin, kanamycin, neomycin, tetracycline, bleomycin, chloramphenicol, streptomycin resistance gene.
  • the origin of replication is selected in the group of: oriC, pl5A, ColEl, SV40.
  • the nucleic acid system comprises:
  • At least one first nucleic acid sequence encoding an RNA virus genome in particular a retrovirus genome comprising at least a viral, preferably retroviral, gag and pol sequence; optionally wherein the pol sequence encodes a defective reverse-transcriptase (RT) or wherein the pol sequence lacks a RT gene;
  • At least one third nucleic acid sequence encoding a recombinant expression cassette comprising: optionally, a promoter, optionally, a 5’ long terminal repeat (LTR), optionally, a packaging sequence, optionally, a Rev-response element, an RNA Booster sequence characterized by a sequence mmsknkkkm or its reverse sequence mkkknksmm, optionally, a multiple cloning site (MCS), optionally, a sequence of interest, optionally, an origin of replication (ORI), optionally a selectable marker, optionally, a post-transcriptional regulatory element, and optionally, a 3’ LTR; wherein the first and second nucleic acid sequences lack a functional packaging sequence.
  • LTR long terminal repeat
  • a packaging sequence optionally, a Rev-response element
  • an RNA Booster sequence characterized by a sequence mmsknkkkm or its reverse sequence mkkknksmm, optionally, a multiple
  • the nucleic acid system comprises:
  • At least one first nucleic acid sequence encoding an RNA virus genome in particular a retrovirus genome comprising at least a viral, preferably retroviral, gag and pol sequence; optionally wherein the pol sequence encodes a defective reverse-transcriptase (RT) or wherein the pol sequence lacks a RT gene;
  • At least one third nucleic acid sequence encoding a recombinant expression cassette comprising: optionally, a 5’ long terminal repeat (LTR), a packaging sequence, optionally, a Rev-response element, an RNA Booster sequence characterized by a sequence mmsknkkkm or its reverse sequence mkkknksmm, optionally, a multiple cloning site (MCS), optionally, a sequence of interest, optionally, a post-transcriptional regulatory element, and optionally, a 3’ LTR; wherein the first and second nucleic acid sequences lack a functional packaging sequence.
  • LTR long terminal repeat
  • MCS multiple cloning site
  • Each nucleic acid sequence (i), (ii) and (iii) defined above is a DNA nucleic acid sequence.
  • the RNA Booster sequence in DNA form will comprise thymine in lieu uracyl defined above for the RNA molecule.
  • RNA Booster sequences in the third nucleic acid sequence include thus, but are not limited to: a deoxyribonucleic acid sequence mmskngkkm or its reverse sequence mkkgnksmm, preferably mmskngkgm or its reverse sequence mgkgnksmm, more preferably cmskhgkgm or its reverse mgkghksmc, even more cmskwgkgm or its reverse sequence mgkgwksmc, yet even more preferably ccsuwgggm or its reverse sequence mgggwuscc, wherein:
  • ⁇ “m” indicates an adenine (a) or cytosine (c);
  • ⁇ “s” indicates a guanine (g) or a cytosine (c);
  • ⁇ “k” indicates a guanine (g) or a thymine (t);
  • ⁇ “h” indicates an adenine (a) or a cytosine (c) or a thymine (t);
  • ⁇ “w” indicates an adenine (a) or a thymine (t);
  • n indicates any nucleotide
  • RNA Booster 1 cccgtgtgc, or its reverse sequence RNA Booster 10: cgtgtgccc
  • RNA Booster 2 aagtttggc, or its reverse sequence RNA Booster 11: cggtttgaa
  • RNA Booster 3 ccctaggta, or its reverse sequence RNA Booster 12: atggatccc
  • RNA Booster 4 ccgtggtgc, or its reverse sequence RNA Booster 13: cgtggtgcc
  • RNA Booster 5 aactggggc, or its reverse sequence RNA Booster 14: cggggtcaa RNA Booster 6: ccctcgggc, or its reverse sequence RNA Booster 15: cgggctccc RNA Booster 7: cacgtgtgc, or its reverse sequence RNA Booster 16: cgtgtgcac RNA Booster 8: cccttgggc, or its reverse sequence RNA Booster 17: cgggttccc RNA Booster 9: ccgtaggga, or its reverse sequence RNA Booster 18: agggatgcc.
  • the at least one first and the at least one second nucleic acid sequences are /ra/rs-compl ementation sequences, /. ⁇ ., sequences encoding /ra/M-com pl ementation proteins or peptides which are intended to be part of the RNA viral vector, preferably the retroviral vector, as proteins or peptides, but not as nucleic acid information in its ribonucleic genome.
  • These /ra/rs-complementation proteins or peptides are thus typically expressed in trans within a cell or population of cell during the production of the RNA viral vector, preferably the retroviral vector.
  • /ra/rs-complementation sequences should be present in nucleic acid sequences lacking a functional packaging sequence.
  • each at least one nucleic acid sequence (i), (ii) and (iii) defined above may, independently from each other, be a linear nucleic acid or a plasmid.
  • the first nucleic acid sequence encoding the RNA virus genome can be provided in a single linear nucleic acid or plasmid, or in two or more linear nucleic acids or plasmids.
  • the at least one second nucleic acid sequence encodes an envelope glycoprotein, such as an envelope glycoprotein from (or derived from) an enveloped virus, possibly from a Retroviridae or from any other enveloped virus, such as, e.g. from a Rhabdoviridae, or a cellular glycoprotein or a synthetic glycoprotein.
  • an envelope glycoprotein such as an envelope glycoprotein from (or derived from) an enveloped virus, possibly from a Retroviridae or from any other enveloped virus, such as, e.g. from a Rhabdoviridae, or a cellular glycoprotein or a synthetic glycoprotein.
  • the at least one second nucleic acid sequence encodes an envelope glycoprotein from Indiana vesiculovirus (formerly known as vesicular stomatitis virus or VSV).
  • the at least one third nucleic acid sequence does not comprise a sequence of interest. If so, it is desirable however that the at least one third nucleic acid sequence comprises at least one restriction site (and preferably at least two different restriction sites), or any other means suitable for introducing a gene of interest downstream the RNA Booster sequence.
  • the method of producing an RNA viral vector comprises the steps of:
  • RNA viral vector preferably the retroviral vector
  • RNA viral vector preferably the retroviral vector.
  • the method of producing a RNA viral vector alternatively comprises the steps of:
  • RNA viral vector preferably the retroviral vector
  • RNA viral vector preferably the retroviral vector.
  • the kit comprising at least one nucleic acid system as described above may comprise at least one first, second and third nucleic acid sequences in separate vials or containers.
  • two of the first, second and third nucleic acid sequences can be mixed in a single vial or container; in this case, the first and second nucleic acid sequences can preferably be mixed in a single vial or container, and the third nucleic acid sequence can be provided in a separate vial or container.
  • the kit may further comprise instructions for use, in particular, instructions for performing the method of producing a RNA viral vector, preferably a retroviral vector, as described above.
  • Figures 1A-B show the expression of GFP in 293T cells transduced with an RNA vector derived from lentivirus expressing GFP and comprising one of RNA Booster 1 to RNA Booster 9, or without RNA Booster (0 RNA Booster).
  • the RNA Booster being located about 500 nt upstream of GFP.
  • Figure 1A is a histogram showing the relative efficacy of GFP expression in 293T cells. The relative expression based on the level of expression after transduction with an RNA vector derived from lentivirus without RNA Booster is shown.
  • Figure IB is a histogram showing the transientness of GFP expression in 293T cells. Results are shown as a percentage of 293T cells expressing GFP at day 3 (D3) and day 7 (D7) post-transduction.
  • Figure l is a histogram showing the percentage of GFP-positive human PBMC after transduction with an integrating lentiviral vector expressing GFP [Integrating LV-GFP], or a RNA vector derived from lentivirus with a mutated reverse transcriptase (D110E substitution) expressing GFP and comprising RNA Booster 8 at two different doses, as indicated [LV-RNA Booster 8/GFP], versus negative control without any transduction [0 vector].
  • the RNA Booster being located about 500 nt upstream of GFP.
  • Figure 3 is a histogram showing the percentage of GFP-positive human dendritic cells after transduction with an integrating lentiviral vector expressing GFP [Integrating LV-GFP], a non-integrating lentiviral vector expressing GFP [Non-integrating LV-GFP], or a RNA vector derived from lentivirus with a mutated reverse transcriptase (D110E substitution) expressing GFP and comprising RNA Booster 8 [LV-AWd Booster 8/GFP], versus negative control without any transduction [0 vector].
  • the RNA Booster being located about 500 nt upstream of GFP.
  • Figure 4 is an histogram showing the percentage of GFP-positive human hematopoietic stem cells after transduction with an integrating lentiviral vector expressing GFP [Integrating LV-GFP], or a non-integrating lentiviral vector expressing GFP [Non-integrating LV-GFP], or a RNA vector derived from lentivirus with a mutated reverse transcriptase (D110E substitution) expressing GFP and comprising RNA Booster 8 at two different doses (Multiplicity Of Infection (MOI)), as indicated [LV-AWd Booster 8/GFP], versus negative control without any transduction [0 vector].
  • the RNA Booster being located about 500 nt upstream of GFP.
  • Figure 5 is a histogram showing the results of a cell proliferation assay of human hair follicle dermal papilla cells transduced or not with different doses (as indicated) of a RNA vector derived from lentivirus with a mutated reverse transcriptase (D110E substitution) expressing FGF9 and comprising RNA Booster 8 [LV-AWd Booster 8/FGF9], and cultured in presence or absence of cortisol and/or VEGF (as indicated).
  • the RNA Booster being located about 500 nt upstream of FGF9.
  • Figure 6 is a histogram showing the quantification of immunoglobulin G (IgG) against ovalbumin (OVA) in C57BL/6J mice after prime/boost immunization with unadjuvanted ovalbumin [Pos Unadj OVA], adjuvanted OVA [Pos Adj OVA (Alun)], or with a RNA vector derived from lentivirus with a mutated reverse transcriptase (DI 10E substitution) expressing ovalbumin and comprising RNA Booster 8 [LV-RNA-OVA], or with a non-integrating lentiviral vector expressing ovalbumin, which does not comprise RNA Booster [LV-DNA-OVA], versus negative control without any transduction [Neg C], The RNA Booster being located about 500 nt upstream of the gene of interest. Prime and boost injections were performed by various routes as indicated [prime/boost]: subcutaneously [SC], intramuscularly [IM], intranas
  • Figure 7 is a histogram showing the percentage of GFP-positive HeLa cells constitutively expressing GFP after a co-transduction with a RNA vector derived from lentivirus with a mutated reverse transcriptase (DI 10E substitution) expressing Cas9 and comprising RNA Booster 8 [LV-AWd Booster 8/Cas9] and a non-integrating lentiviral vector expressing a guide RNA targeting the GFP [Non-integrating LV-gRNA], versus a co-transduction with a non-integrating lentiviral vector expressing Cas9 [Non-integrating LV-Cas9] and a non-integrating lentiviral vector expressing a guide RNA targeting GFP [Non-integrating LV-gRNA], versus negative control without any transduction [0 vector].
  • the RNA Booster being located about 500 nt upstream of Cas9.
  • Figure 8 is a histogram showing the expression of GFP in 293T cells transduced with an RNA vector derived from lentivirus expressing GFP, and comprising the RNA Booster 9 forward or its reverse sequence RNA Booster 9 reverse corresponding to RNA Booster 18, versus negative control corresponding to an RNA vector without RNA Booster (0 RNA Booster).
  • the RNA Booster being located about 2000 nt upstream (5’) of GFP.
  • Figure 9 is a histogram showing the expression of GFP in 293T cells transduced with an RNA vector derived from lentivirus expressing GFP, and comprising the RNA Booster 9 forward or its reverse sequence RNA Booster 9 reverse corresponding to RNA Booster 18, versus a negative control corresponding to an RNA vector without RNA Booster (0 RNA Booster).
  • the RNA Booster being located about 500 nt downstream (3’) of GFP.
  • Figure 10 shows the skin healing by the human epidermal keratinocyte migration kinetic.
  • Figure 10A shows a model of skin healing without treatment (control), with EGF at 10 ng/ml in the medium of culture or transduced with a RNA vector derived from lentivirus expressing FGF7, and comprising the RNA Booster 8.
  • the RNA Booster being located about 500 nt upstream of FGF7.
  • Figure 10B is a histogram showing the human epidermal keratinocytes migration kinetic representing by the percentage of healing without treatment (control), with EGF at 10 ng/ml in the medium of culture or transduced with a RNA vector derived from lentivirus expressing FGF7, and comprising the RNA Booster 8.
  • the RNA Booster being located about 500 nt upstream of FGF7.
  • the envelope trans-complementation plasmid encodes the vesicular stomatitis virus envelope glycoprotein (VSV-G) with SEQ ID NO: 1, under control of a cytomegalovirus-immediate early (CMV-IE) promoter.
  • VSV-G vesicular stomatitis virus envelope glycoprotein
  • CMV-IE cytomegalovirus-immediate early
  • the capsid trans-complementation plasmid encodes a functional integrase (with SEQ ID NO: 2) and a functional reverse transcriptase (with SEQ ID NO: 4) of HIV-1; or a mutant integrase with abolished integrase activity (SEQ ID NO: 2 comprising a D64V substitution, as set forth in SEQ ID NO: 3); or a mutant reverse transcriptase with abolished reverse transcriptase activity (SEQ ID NO: 4 comprising a D110E substitution, as set forth in SEQ ID NO: 5).
  • the vector plasmid encodes a recombinant expression cassette comprising a 5’ LTR (with SEQ ID NO: 6) and a 3’ LTR (with SEQ ID NO: 7) flanking a transgene (i.e., a sequence of interest), either GFP including a tobacco extension signal sequence (with SEQ ID NO: 8, encoding SEQ ID NO: 9), human fibroblast growth factor 9 (FGF9) (with SEQ ID NO: 10 encoding SEQ ID NO: 11), human fibroblast growth factor 7 (FGF7) (with SEQ ID NO: 19 encoding SEQ ID NO: 20), ovalbumin (with SEQ ID NO: 12 encoding SEQ ID NO: 13), or Cas9 (with SEQ ID NO: 14 encoding SEQ ID NO: 15), with or without a RNA Booster sequence in 5 ’ or in 3 ’ of the transgene (RNA Booster 1 to RNA Booster 18, according in part to Table 1) inserted in a Sall restriction site
  • Regulatory sequences such as retroviral psi packaging signal (with SEQ ID NO: 16), Rev-response element (RRE, with SEQ ID NO: 17) and WHV post-transcriptional regulatory element (WPRE, with SEQ ID NO: 18), were also included.
  • Lentiviral vectors were generated by the transient transfection of 293T cells by using the calcium phosphate precipitation method. Briefly, cells were co-transfected with the VSV-G trans-complementation plasmid, the capsid trans-complementation plasmid and a vector plasmid. Supernatant was collected 48 hours after transfection, treated with DNasel and filtered. Viral particles were then concentrated by ultracentrifugation and resuspended in 0.1 M PBS. The genome of particles was quantified for each stock by RT-qPCR to determine a titer of gRNA by pL. Cell culture
  • 293T cells were grown in Dulbecco’s modified medium supplemented with antibiotics (lOO U/mL penicillin and 100 mg/mL streptomycin) and 10 % heat-inactivated fetal calf serum. The cells were plated and cultured in a humidified incubator at 37°C in a 5 % CO2 and 90 % air atmosphere.
  • Human PBMC were grown in RPMI-160 + L-Glu medium supplemented with
  • HEPES 5 M 1 % HEPES 5 M, 0.1 % P-mercaptoethanol 55 mM, antibiotics (100 U/mL penicillin and 100 mg/mL streptomycin) and 10 % heat-inactivated fetal calf serum.
  • the cells were plated and cultured in a humidified incubator at 37°C in a 5 % CO2 and 90 % air atmosphere.
  • Human dendritic cells were grown in RPMI-160 + L-Glu medium supplemented with 1 % HEPES 5 M, lOO ng/mL GM-CSF, 50 ng/mL IL-4, antibiotics (lOO U/mL penicillin and 100 mg/mL streptomycin) and 10 % heat-inactivated fetal calf serum.
  • the cells were plated and cultured in a humidified incubator at 37°C in a 5 % CO2 and 90 % air atmosphere.
  • HSC Human hematopoietic stem cells
  • Human hair follicle dermal papilla cells were grown in HFDPC Basal culture medium with HFDPC supplement mix. The cells were plated and cultured in a humidified incubator at 37°C in a 5 % CO2 and 90 % air atmosphere.
  • GFP + HeLa cells were generated with an integrating lentiviral vector expressing GFP. A clonal population with one integration and a stable expression of GFP was selected for the experiments.
  • GFP + HeLa cells were grown in Dulbecco’s modified medium supplemented with antibiotics (lOO U/mL penicillin and 100 mg/mL streptomycin) and 10 % heat-inactivated fetal calf serum. The cells were plated and cultured in a humidified incubator at 37°C in a 5 % CO2 and 90 % air atmosphere.
  • PBMC peripheral blood mononuclear cells
  • RNA vector derived from lentivirus with a mutated D110E reverse transcriptase
  • GFP expression was measured by FACS 96 hours after transduction.
  • HSC Human hematopoietic stem cells
  • RNA vector derived from lentivirus with a mutated D110E reverse transcriptase
  • FGF9 or FGF7 with RNA Booster 8.
  • RNA Booster 8 RNA Booster 8.
  • the cells were treated with 300 nM of cortisol (which has a negative effect on proliferation).
  • a control with or without VEGF (which inhibits the cortisol effect) was performed.
  • Cell proliferation was measured through BrdU (5-bromo-2’ -deoxyuridine) incorporation.
  • GFP + HeLa cells were contacted and co-transduced with an RNA vector derived from lentivirus (with a mutated D110E reverse transcriptase) expressing Cas9 with RNA Booster 8 and a non-integrating lentiviral vector expressing a guide RNA targeting the GFP (without RNA Booster), or co-transduced with a non-integrating lentiviral vector expressing Cas9 (without RNA Booster) and a non-integrating lentiviral vector expressing a guide RNA targeting the GFP (without RNA Booster).
  • GFP expression was measured by FACS 96 hours after. Flow cytometry analysis
  • GFP expression was analyzed by flow cytometry to determine the percentage of GFP-positive cells. Transduced cells were harvested, trypsinized, and fixed with 1 % formaldehyde before analysis.
  • C57BL/6J mice were immunized with an RNA vector derived from lentivirus (with a mutated DI 10E reverse transcriptase) expressing ovalbumin with RNA Booster 8, or with a non-integrating lentiviral vector expressing ovalbumin (without RNA Booster .
  • a boost injection with the same vector was administered 28 days after the prime injection. Injections were performed subcutaneously, intramuscularly, intranasally or intraperitoneally, with various combinations for the prime and boost injection. Immunization was measured through the dosage of ovalbumin-specific immunoglobulin G (IgG) 14 days after prime injection and again 14 days after boost injection.
  • IgG ovalbumin-specific immunoglobulin G
  • Ovalbumin-specific IgG were measured from thawed blood samples using the “Mouse anti-OVA IgG antibody assay kit” (Chondrex, Inc.; Ref. 3011).
  • the keratinocytes have been seeded in culture medium in 24-well plates previously coated with a collagen I solution. After 24 hours of incubation, the medium will be replaced by test medium then a mechanical scraping has been carried out and the cells have been characterized with calcein-AM. After 30 minutes of incubation, images have been taken (TO) then the medium has been replaced by test medium containing or not (control) the test vector or the reference (EGF at 10 ng/ml). For the test vector, 15 pl of vector and 200 pl of test medium have been added and incubated for 5 hours then medium has been added (qsp 600 pl).
  • the cells have been incubated until the next morning and again labeled with calcein-AM (30 minutes incubation) to produce the 24- hour time images.
  • the cells have been incubated again for another 24 to 48 hours and then again labeled with calcein-AM and photographed according to a similar protocol.
  • the cell migration area has been monitored with a high-resolution imaging system, INCell AnalyzerTM2200 automated microscope (GE Healthcare) and the artificial wound surface has been analyzed with Image J software. Representative images will be inserted in the report and all images will be provided via a secure sharing site.
  • RNA vector derived from lentivirus expressing GFP was compared at a same Multiplicity Of Infection (MOI).
  • RNA Booster 1-9 in 5’ of the transgene of interest in the RNA vector derived from lentivirus improved the efficacy of GFP expression in transduced 293T cells, as compared to a lentiviral vector without RNA Booster.
  • the RNA Booster sequences were shown to enhance GFP expression by at least a factor 2 (for RNA Booster 7) and increasingly, up to a factor 12 (for RNA Booster 9).
  • Figure 2 shows that the RNA vector derived from lentivirus expressing GFP, in presence of RNA Booster 8, and both at 10 pL and 15 pL doses, enabled to transduce human PBMC with high efficacy and induced an increase of the GFP expression by a factor 2.7-2.9, as compared to the integrating vector without RNA Booster.
  • RNA vector derived from lentivirus comprising such RNA Booster could be good candidates to induce transient expression of a gene of interest in PBMC, which cells are of interest in a wide range of immunotherapy strategies and gene therapy.
  • Figure 3 shows that the RNA vector derived from lentivirus expressing GFP, in presence of RNA Booster 8, enabled to transduce human dendritic cells with high efficacy and induced an increase of the GFP expression 5.75 to 22 times higher than when using an integrative lentiviral vector or a non-integrative lentiviral vector in absence of RNA Booster, respectively.
  • RNA vectors derived from lentivirus comprising such RNA Booster could be good candidates to induce transient expression of a gene of interest in primary cells such as dendritic cells.
  • Figure 4 shows that the RNA vector derived from lentivirus expressing GFP, in presence of RNA Booster 8, enabled to transduce human hematopoietic stem cells with a higher efficacy than DNA integrating lentiviral vectors at a MOI 10 to 20 times lower, and induced an increase of the GFP expression around 35-42 times higher than when using a non-integrating lentiviral vector in absence of RNA Booster.
  • RNA vectors derived from lentivirus comprising such RNA Booster could be good candidates to induce transient expression of a gene of interest in human HSC, which cells are of interest in a wide range of immunotherapy strategies and gene therapy.
  • Figure 5 shows that cortisol decreased cell proliferation, as compared to the non-treated condition (without cortisol, VEGF or vector), while adding VEGF and cortisol restored cell proliferation (with cortisol and VEGF, without vector).
  • RNA vectors derived from lentivirus comprising such RNA Booster could be useful for treating a variety of diseases, for example promoting skin healing, or in non-therapeutic indications, for example in dermatology or cosmetology, to induce hair growth.
  • Figure 6 shows that an RNA vector derived from lentivirus expressing ovalbumin, in presence of RNA Booster 8, induced high levels of OVA-specific IgG when administered intramuscularly/intranasally, intraperitoneally/intraperitoneally, or intraperitoneally/intranasally (prime/boost - 5 * 10 8 transducing units (TU) per injection).
  • this RNA vector derived from lentivirus induced higher levels of OVA-specific IgG as compared to a non-integrative lentiviral vector expressing ovalbumin administered by the same routes.
  • RNA vectors derived from lentivirus comprising such RNA Booster can improve immunization in mice, and suggest that these RNA vectors derived from lentivirus could be useful for vaccination.
  • Figure 7 shows that an RNA vector derived from lentivirus expressing Cas9, in presence of RNA Booster 8, combined with a guide RNA targeting GFP brought to the cell using a non-integrating lentiviral vector, induces the knock-out of the GFP gene in HeLa cells with an efficacy close than 100 %.
  • RNA Booster 8 combined with a guide RNA targeting GFP brought to the cell using a non-integrating lentiviral vector, induces the knock-out of the GFP gene in HeLa cells with an efficacy close than 100 %.
  • non-integrating lentiviral vectors expressing Cas9 and a gRNA yield similar results, using these vectors in ex vivo or in vivo therapy is not desirable since DNA molecules have a non-zero probability of recombination with another DNA molecule, such as with a DNA genome. This would induce adverse effects.
  • RNA vectors derived from lentivirus do not show any risk of reverse transcriptase activity leakage, which ensures thus 100 % of information transfer in the form of RNA, which cannot recombine with DNA.
  • the data shows the RNA vector comprising the RNA Booster performs at least as well as a DNA vector.
  • RNA vectors derived from lentivirus comprising such RNA Booster could be good candidates to induce transient expression of a genome editor, and could thus be useful for genome engineering in the field of bioproduction, cell therapy, gene therapy and transgenesis.
  • RNA vector derived from lentivirus expressing GFP with the forward and reverse sequence of the RNA Booster 9 at 2 different positions than initially, or without RNA Booster was compared at a same Multiplicity Of Infection (MOI).
  • RNA Booster 9 As shown in Figure 8, the presence of the forward and reverse RNA Booster 9 in 5’ and remote side of 2kb of the transgene of interest in the RNA vector derived from lentivirus improved the efficacy of GFP expression in transduced 293T cells, as compared to a lentiviral vector without RNA Booster.
  • the RNA Booster sequences were shown to enhance GFP expression by a factor 2,5 for forward RNA Booster 9 and by a factor 2,2 for reverse RNA Booster 9.
  • RNA Booster 9 As shown in Figure 9, the presence of the forward and reverse RNA Booster 9 in 3’ of the transgene of interest in the RNA vector derived from lentivirus improved the efficacy of GFP expression in transduced 293T cells, as compared to a lentiviral vector without RNA Booster.
  • the RNA Booster sequences were shown to enhance GFP expression by a factor 6.1 for forward RNA Booster 9 and by a factor 6.9 for reverse RNA Booster 9.
  • SEQ ID NO 2 FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHG QVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAG RWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELK KIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQ

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Zoology (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Wood Science & Technology (AREA)
  • General Health & Medical Sciences (AREA)
  • Microbiology (AREA)
  • Biochemistry (AREA)
  • Plant Pathology (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Physics & Mathematics (AREA)
  • Veterinary Medicine (AREA)
  • Immunology (AREA)
  • Medicinal Chemistry (AREA)
  • Mycology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Virology (AREA)
  • Oncology (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)

Abstract

La présente invention concerne des moyens et des procédés d'expression d'ARN transitoire robuste, en particulier dans le domaine de l'édition de gènes.
PCT/EP2023/072112 2022-08-09 2023-08-09 Système d'expression transitoire pour arn, pour l'édition de gènes WO2024033446A1 (fr)

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US17/818,508 US20240060085A1 (en) 2022-08-09 2022-08-09 Transient expression system for rna, for gene editing
US17/818,508 2022-08-09
EP22306198 2022-08-09
EP22306198.7 2022-08-09

Publications (1)

Publication Number Publication Date
WO2024033446A1 true WO2024033446A1 (fr) 2024-02-15

Family

ID=87571654

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2023/072112 WO2024033446A1 (fr) 2022-08-09 2023-08-09 Système d'expression transitoire pour arn, pour l'édition de gènes

Country Status (1)

Country Link
WO (1) WO2024033446A1 (fr)

Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2003018828A2 (fr) * 2001-08-21 2003-03-06 Isis Pharmaceuticals, Inc. Sites d'interaction moleculaire d'arn ribosomique 16s et leurs procedes de modulation
WO2003106684A2 (fr) * 2002-06-14 2003-12-24 Chromagenics B.V. Procede permettant la production simultanee de plusieurs proteines; vecteurs et cellules utilises dans ce procede
WO2005116225A1 (fr) 2004-05-25 2005-12-08 Children's Hospital Medical Center Methode d'introduction et d'expression d'arn dans des cellules
WO2007010221A2 (fr) * 2005-07-15 2007-01-25 Medical Research Council Compositions et procedes relatifs a des paires d'arnm de ribosomes orthogonaux
WO2009043353A2 (fr) * 2007-10-04 2009-04-09 Santaris Pharma A/S Oligonucléotides micromir
WO2013060819A2 (fr) 2011-10-26 2013-05-02 Newvectys Vecteurs d'expression transitoires, préparation et utilisations associées

Patent Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2003018828A2 (fr) * 2001-08-21 2003-03-06 Isis Pharmaceuticals, Inc. Sites d'interaction moleculaire d'arn ribosomique 16s et leurs procedes de modulation
WO2003106684A2 (fr) * 2002-06-14 2003-12-24 Chromagenics B.V. Procede permettant la production simultanee de plusieurs proteines; vecteurs et cellules utilises dans ce procede
WO2005116225A1 (fr) 2004-05-25 2005-12-08 Children's Hospital Medical Center Methode d'introduction et d'expression d'arn dans des cellules
WO2007010221A2 (fr) * 2005-07-15 2007-01-25 Medical Research Council Compositions et procedes relatifs a des paires d'arnm de ribosomes orthogonaux
WO2009043353A2 (fr) * 2007-10-04 2009-04-09 Santaris Pharma A/S Oligonucléotides micromir
WO2013060819A2 (fr) 2011-10-26 2013-05-02 Newvectys Vecteurs d'expression transitoires, préparation et utilisations associées

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
LI ET AL., CANCER IMMUNOL IMMUNOTHER., vol. 53, no. 3, 2004, pages 139 - 43
MOCK ET AL., SCI REP., vol. 4, 2014, pages 6409
NOVELLINO ET AL., CANCER IMMUNOL IMMUNOTHER., vol. 54, no. 3, 2005, pages 187 - 20

Similar Documents

Publication Publication Date Title
AU2019202498B2 (en) AADC polynucleotides for the treatment of Parkinson's Disease
RU2733424C2 (ru) Способ повышения экспрессии кодируемых рнк белков
US9163219B2 (en) Single expression vector for generation of a virus with a segmented genome
EA031321B1 (ru) Нуклеиновые кислоты, кодирующие белки вируса гриппа, композиции на их основе и способы профилактики и лечения
CN114014937A (zh) 稳定化的流感血凝素茎区三聚体及其用途
KR20200018586A (ko) 인간 감마-델타 t-세포를 통한 종양 세포독성의 활성화를 위한 방법 및 조성물
JP2002512804A (ja) ヌクレオチド配列の導入のためのトリプレックス構造のdna配列の利用
CN107208099A (zh) 共表达疫苗和共刺激分子的载体
EA015534B1 (ru) Антитела к миостатину и способы их применения
JP5264840B2 (ja) 3つの完全な転写単位を有するプラスミドおよびhivに対する免疫応答を誘発するための免疫原組成物
KR102455340B1 (ko) 최적화된 핵산 항체 작제물
EP3082760A1 (fr) Compositions et formulations d'arnm de la leptine
KR20150127586A (ko) 인플루엔자 핵산 분자 및 이로부터 제조된 백신
US20220040329A1 (en) Inducible expression cassette, and uses thereof
CN110418800A (zh) 治疗溶酶体紊乱的方法
KR20230006819A (ko) 표적화된 지질 입자 및 이의 조성물 및 용도
TW202039855A (zh) 表現因子ix之慢病毒載體的用途
US20240060067A1 (en) Transient expression system for rna, for cosmetic uses
US20240060085A1 (en) Transient expression system for rna, for gene editing
US20240060084A1 (en) Transient expression system for rna
US20240058430A1 (en) Transient expression system for rna, for vaccination
WO2024033446A1 (fr) Système d'expression transitoire pour arn, pour l'édition de gènes
WO2024033444A1 (fr) Système d'expression transitoire pour arn, destiné à des utilisations cosmétiques
WO2024033441A1 (fr) Système d'expression transitoire pour arn
WO2024033448A1 (fr) Système d'expression transitoire pour arn, utilisé pour la vaccination

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 23754781

Country of ref document: EP

Kind code of ref document: A1