WO2023014070A1 - Stc-1 또는 그 유도체를 포함하는 간질환 예방 또는 치료용 조성물 - Google Patents

Stc-1 또는 그 유도체를 포함하는 간질환 예방 또는 치료용 조성물 Download PDF

Info

Publication number
WO2023014070A1
WO2023014070A1 PCT/KR2022/011447 KR2022011447W WO2023014070A1 WO 2023014070 A1 WO2023014070 A1 WO 2023014070A1 KR 2022011447 W KR2022011447 W KR 2022011447W WO 2023014070 A1 WO2023014070 A1 WO 2023014070A1
Authority
WO
WIPO (PCT)
Prior art keywords
stc
liver
present
derivative
cells
Prior art date
Application number
PCT/KR2022/011447
Other languages
English (en)
French (fr)
Inventor
구철룡
오주헌
강찬우
왕은경
홍진우
이용호
Original Assignee
연세대학교 산학협력단
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 연세대학교 산학협력단 filed Critical 연세대학교 산학협력단
Priority to US18/580,971 priority Critical patent/US20240325497A1/en
Publication of WO2023014070A1 publication Critical patent/WO2023014070A1/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/1703—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • A61K38/1709—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22—Hormones
    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23L—FOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
    • A23L33/00—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof
    • A23L33/10—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof using additives
    • A23L33/17—Amino acids, peptides or proteins
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00—Medicinal preparations characterised by special physical form
    • A61K9/0012—Galenical forms characterised by the site of application
    • A61K9/0053—Mouth and digestive tract, i.e. intraoral and peroral administration
    • A61K9/0056—Mouth soluble or dispersible forms; Suckable, eatable, chewable coherent forms; Forms rapidly disintegrating in the mouth; Lozenges; Lollipops; Bite capsules; Baked products; Baits or other oral forms for animals
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics

Definitions

  • the present invention relates to a composition for preventing or treating liver disease, and more particularly, to a pharmaceutical composition for preventing or treating liver disease comprising STC-1 or a derivative thereof as an active ingredient.
  • Liver fibrosis can be defined as excessive deposition of extracellular matrix due to chronic liver inflammation, and when such chronic liver inflammation continues, liver fibrosis develops into cirrhosis due to a decrease in the number of liver cells.
  • liver fibrosis Representative cells involved in liver fibrosis include hepatic stellate cells, Kuffer cells, and endothelial cells.
  • Hepatic stellate cells are the main producer of extracellular matrix and are involved in increasing the production of various extracellular matrix including collagen.
  • Kupffer cells exist in the sinusoidal space of the liver, and substances produced from activated Kupffer cells affect surrounding hepatocytes, endothelial cells, and hepatic stellate cells to promote hepatic fibrosis.
  • Endothelial cells play an important role in regulating blood flow in the liver, and in addition, they are also involved in the production of growth factors and extracellular matrix involved in the proliferation of hepatic stellate cells caused by inflammation or hepatic fibrosis.
  • TGF- ⁇ the most potent fibrosis-promoting cytokine of hepatic stellate cells.
  • TGF- ⁇ produced from hepatic stellate cells binds to type II receptors and phosphorylates type I receptors, which then come into contact with smad2 and smad3 and phosphorylate them. Afterwards, the smad2 and smad3 complexes bind to smad4 and move into the nucleus, where they regulate the transcription of target genes.
  • Smad7 inhibits phosphorylation of smad2 and smad3 by interacting with type I receptors, and delays hepatic fibrosis by interfering with TGF- ⁇ -induced smad signaling.
  • liver fibrosis process has been known as an irreversible reaction, but recent clinical and experimental studies have reported that the liver fibrosis process is a reversible reaction and that the degree of liver fibrosis can be controlled through this. Therefore, studies on inhibiting the progression of liver fibrosis through activated hepatic stellate cells have begun to attract attention.
  • STC-1 Stanniocalcin-1
  • STC-1 which has a function similar to a hormone, is known to be involved in calcium homeostasis and oxidative stress regulation response by secreting extracellularly or acting inside cells. It is known that extracellular STC-1 is secreted into the blood, enters cells through endocytosis, and mostly binds to the mitochondrial inner membrane to regulate superoxide production in mitochondria (Prior Documents 1, 2, and 3).
  • the present inventors performed gastrectomy on a diabetic animal model, confirmed that the expression of STC-1 increased in steatohepatitis-induced experimental animals, and when the STC-1 protein was administered to a liver fibrosis mouse model, fibrosis And it was confirmed that the expression of inflammation-related genes was reduced and the fibrotic lesion was reduced, and the present invention was completed.
  • Non-Patent Document 1 Ellard JP et al., Mol Cell Endocrinol. 264:90-101, 2007
  • Non-Patent Document 2 Wang Y et al., J Leukoc Biol., 86:981-8, 2009
  • Non-Patent Document 3 Sheikh-Hamad D et al.,. Am J Physiol Renal Physiol., 298(2):F248-54, 2010
  • Non-Patent Document 4 Yeung BH et al., PLoS One., 6(11):e27094, 2011.
  • Non-Patent Document 5 Sarapio E et al., Molecular and Cellular Endocrinology., 485:81-87, 2019
  • Non-Patent Document 6 (Non-Patent Document 6)6. Iyer VR et al., Science., 283(5398):83-7, 1999
  • Non-Patent Document 7 McCudden CR et al., J Biol Chem., 277(47):45249-58, 2002.
  • Non-Patent Document 8 8. Kahn J et al., Am J Pathol., 156(6):1887-900, 2000
  • Non-Patent Document 9 Filvaroff EH et al., Endocrinology., 156(6):1887-900, 2002
  • Non-Patent Document 10 10. Serlachius M et al., Br J Haematol., 119(2):359-63, 2002
  • Non-Patent Document 11 11. Chang AC et al., Endocr Relat Cancer., 10(3):359-73, 2003
  • Non-Patent Document 12 Leung CC et al., Oncotarget., 9(6):6852-6861, 2017
  • Non-Patent Document 13 Mohammadipoor A et al., Transl Res., 177:127-142, 2016
  • Non-Patent Document 14 Lin H et al., Cancer Cell., 39(4):480-493.e6, 2021
  • Non-Patent Document 15 Kamata T et al., Cell Rep., 31(12):107802, 2020
  • Non-Patent Document 16 17. Huang L et al., Sci Rep., 5:18117, 2015
  • Non-Patent Document 17 Pan JS et al., J Am Soc Nephrol., 26(2):364-78, 2015
  • Non-Patent Document 18 18. Xu M et al., Cell., 78(6):1478-1492.e20, 2019
  • An object of the present invention is to provide a preventive or therapeutic use for liver disease.
  • Another object of the present invention is to provide a health functional food for preventing or improving liver disease.
  • Another object of the present invention is to provide a health functional food for improvement.
  • the present invention provides a pharmaceutical composition for preventing or treating liver disease comprising STC-1 or a derivative thereof as an active ingredient.
  • the present invention also provides a health functional food for preventing or improving liver disease comprising STC-1 or a derivative thereof as an active ingredient.
  • the present invention also provides a health functional food for improving liver function containing STC-1 or a derivative thereof as an active ingredient.
  • the present invention also provides a method for preventing or treating liver disease comprising administering STC-1 or a derivative thereof.
  • the present invention also provides use of STC-1 or a derivative thereof for preventing or treating liver disease.
  • the present invention also provides use of atypical STC-1 or a derivative thereof for the preparation of a drug for preventing or treating liver disease.
  • Figure 1 shows the top 20 genes with a large difference in expression level among transcripts by analyzing the RNA sequence of alimentary limb tissue after 12 weeks of RYGB surgery after performing a high-fat diet in the OLETF model.
  • Figure 2 is an ELISA analysis of the expression level of STC-1 using plasma obtained after blood was collected from the inferior vena cava and portal vein of the RYGB surgery group and the simulated surgery (SHAM) group as a sample It shows the results confirmed by .
  • Figure 3 shows the difference in STC-1 expression between the FDG uptake increased portion and the FDG uptake not increased portion of alimentary limb tissues after 12 weeks of RYGB surgery after performing a high-fat diet in the OLETF model by qRT- The results were confirmed by PCR.
  • Figure 4 shows the results of confirming the expression of fat metabolism-related genes in the free fatty acid (FFA) treatment group or the free fatty acid and STC-1 treatment group in HepG cells, which are liver cancer cell lines, by qRT-PCR.
  • FIG. 5 shows the results of qRT-PCR confirming the expression of inflammation and fibrosis-related genes in the free fatty acid (FFA)-treated group or the free fatty acid and STC-1-treated group in HepG cells, which are a liver cancer cell line.
  • LX-2 hepatic stellate cell
  • STC-1 and GDF-15 markers related to inflammation and fibrosis It shows the result of confirming the expression change of by qRT-PCR.
  • Figure 7 shows the results of confirming the protein amounts of t-AMPK ⁇ , p-AMPK ⁇ and STC-1 in the cells after treatment with palmitic acid in the cell line in which STC-1 was overexpressed in HepG2 cells by Western blotting. will be.
  • Figure 8 is an intestinal epithelial cell line, when STC-1 is overexpressed (O / E) in IEC18 cells, or when STC-1 cells are added and cultured, qRT-PCR of changes in the expression of genes related to glucose metabolism It shows the results confirmed by .
  • Figure 10 shows the results of qPCR confirming the expression of genes related to fibrosis and inflammation in liver tissue in mice administered with STC-1 to a mouse model of liver fibrosis induced by MCD diet feeding.
  • FIG. 11 shows the results of Sirius red staining of the livers of mice administered with STC-1 to a mouse model of liver fibrosis induced by MCD diet feeding.
  • Figure 12 shows the results of confirming the expression of inflammatory cytokines in HepG2 cells (upper well) and LPS-treated macrophage cell line Raw264.7 (lower well) overexpressing STC-1 in transwells by qRT-PCR.
  • the present invention relates to a pharmaceutical composition for preventing or treating liver disease comprising STC-1 or a derivative thereof as an active ingredient.
  • the liver disease may be liver fibrosis, liver cirrhosis, acute hepatitis, chronic hepatitis, fatty liver or liver cancer, but is not limited thereto.
  • the STC-1 protein may be characterized by having an amino acid sequence represented by SEQ ID NO: 1, but is not limited thereto, and has STC-1 activity while having sequence similarity with SEQ ID NO: 1 Any protein can be used without limitation.
  • the STC-1 protein has 70% or more homology, 80% or more homology, 90% or more homology, 95% or more homology, 96% or more homology, 97% or more homology, 98% or more homology with SEQ ID NO: 1 It may be characterized by having more than 99% homology or more than 99% homology.
  • the STC-1 protein or derivative in the present invention is a form in which some amino acids at the N-terminus or C-terminus of the amino acid sequence of STC-1 of SEQ ID NO: 1 are truncated, and the activity of the STC-1 protein is still active. It is a concept including a fragment of the STC-1 protein that maintains, and further includes substitution of some amino acids in the STC-1 protein, preferably conservative substitution, and still retains the activity of the STC-1 protein. It is a concept that includes 1 protein.
  • “conservative substitution” refers to a modification of a polypeptide that involves substituting one or more amino acids with amino acids having similar biochemical properties that do not result in loss of biological or biochemical function of the polypeptide.
  • a “conservative amino acid substitution” is a substitution in which an amino acid residue is replaced with an amino acid residue having a similar side chain.
  • Classes of amino acid residues with similar side chains have been defined in the art and are well known. These classes include amino acids with basic side chains (e.g. lysine, arginine, histidine), amino acids with acidic side chains (e.g. aspartic acid, glutamic acid), and amino acids with uncharged polar side chains (e.g. glycine).
  • STC-1 protein of the present invention may have conservative amino acid substitutions and still retain activity, and as long as the characteristics of the STC-1 protein according to the present invention are maintained, the protein mutated by conservative substitutions Included in the scope of the present invention.
  • composition of the present invention may further include pharmaceutically acceptable additives, wherein the pharmaceutically acceptable additives include starch, gelatinized starch, microcrystalline cellulose, lactose, povidone, colloidal silicon dioxide, calcium hydrogen phosphate, lactose , Mannitol, Taffy, Gum Arabic, Pregelatinized Starch, Corn Starch, Powdered Cellulose, Hydroxypropyl Cellulose, Opadry, Sodium Starch Glycolate, Carnauba Wax, Synthetic Aluminum Silicate, Stearic Acid, Magnesium Stearate, Aluminum Stearate, Calcium Stearate, White sugar and the like may be used.
  • the pharmaceutically acceptable additive according to the present invention is preferably included in an amount of 0.1 to 90 parts by weight based on the composition, but is not limited thereto.
  • composition of the present invention can be administered in various oral or parenteral formulations at the time of actual clinical administration.
  • commonly used diluents or excipients such as fillers, extenders, binders, wetting agents, disintegrants, and surfactants are used. It can be prepared by, and suitable formulations known in the art are preferably those disclosed in literature (Remington's Pharmaceutical Science, recently, Mack Publishing Company, Easton PA).
  • Carriers, excipients and diluents that may be included in the composition include lactose, dextrose, sucrose, oligosaccharides, sorbitol, mannitol, xylitol, erythritol, maltitol, starch, acacia gum, alginate, gelatin, calcium phosphate, calcium silicate, cellulose, methyl cellulose, microcrystalline cellulose, polyvinyl pyrrolidone, water, methylhydroxy benzoate, propylhydroxy benzoate, talc, magnesium stearate, mineral oil, and the like.
  • Solid preparations for oral administration include tablets, pills, powders, granules, capsules, etc., and these solid preparations contain at least one excipient such as starch, calcium carbonate, sucrose or It is prepared by mixing lactose and gelatin.
  • excipients such as starch, calcium carbonate, sucrose or It is prepared by mixing lactose and gelatin.
  • lubricants such as magnesium stearate and talc are also used.
  • the liquid preparations for oral administration include suspensions, solutions for oral administration, emulsions, syrups, etc.
  • various excipients such as wetting agents, sweeteners, aromatics, preservatives, etc. this may be included.
  • Formulations for parenteral administration include sterilized aqueous solutions, non-aqueous solvents, suspensions, emulsions, freeze-dried formulations, and suppositories.
  • Propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable esters such as ethyl oleate may be used as non-aqueous solvents and suspending agents.
  • a base for the suppository witepsol, macrogol, tween 61, cacao butter, laurin paper, glycerogeratin and the like may be used.
  • the parenteral administration may be performed using an external skin or intraperitoneal injection, intrarectal injection, subcutaneous injection, intravenous injection, intramuscular injection or intrathoracic injection injection method.
  • the dosage of the pharmaceutical composition of the present invention varies in its range depending on the patient's body weight, age, sex, health condition, diet, administration time, administration method, excretion rate and severity of the disease, and may be administered once a day. It may be administered in several divided doses.
  • composition of the present invention can be administered to a subject by various routes. All modes of administration are contemplated, eg oral, rectal or intravenous, intramuscular, subcutaneous, intrauterine intrathecal or intracerebrovascular injection.
  • the pharmaceutical composition of the present invention can be used alone or in combination with methods using surgery, radiation therapy, hormone therapy, chemotherapy, and biological response modifiers for the prevention and treatment of liver disease.
  • prevention refers to any activity that suppresses or delays liver disease by administration of the pharmaceutical composition of the present invention
  • treatment means that symptoms caused by liver disease are improved by the pharmaceutical composition of the present invention. means any action that becomes or is advantageously altered.
  • prevention may include without limitation any action capable of blocking, suppressing or delaying symptoms caused by liver disease by using the composition of the present invention.
  • "improvement” can include without limitation any action that can improve symptoms caused by liver disease by using the composition of the present invention, or can be beneficial.
  • treatment refers to a series of activities performed to alleviate or/and improve a desired disease.
  • the pharmaceutical composition according to the present invention contains 0.1 to 50% by weight of the active ingredient of the present invention based on the total weight of the composition.
  • Carriers, excipients and diluents that may be included in the composition of the present invention include lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, maltitol, starch, gum acacia, alginates, gelatin, calcium phosphate, calcium silicate, cellulose, methyl cellulose, microcrystalline cellulose, polyvinyl pyrrolidone, water, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate, and mineral oil.
  • administration means introducing the composition of the present invention to a patient by any suitable method, and the administration route of the composition of the present invention is through any general route as long as it can reach the target tissue. can be administered.
  • intraperitoneal administration intravenous administration, intramuscular administration, subcutaneous administration, intradermal administration, intranasal administration, intrapulmonary administration, intestinal administration, intracavity administration, intraperitoneal administration, intrathecal administration may be performed, but is not limited thereto.
  • the effective amount is the type of disease, the severity of the disease, the type and amount of the active ingredient and other ingredients contained in the composition, the type of formulation and the patient's age, weight, general health condition, sex and diet, administration time, administration route And it can be adjusted according to various factors including the secretion rate of the composition, the treatment period, and drugs used simultaneously.
  • the pharmaceutical composition of the present invention can be administered alone or together with other therapies known in the art, such as chemotherapeutic agents and surgery, for the treatment of desired liver diseases.
  • the pharmaceutical composition of the present invention may be administered in combination with other therapies designed to promote lowering of blood glucose, for example well known in the art.
  • Other standard delivery methods may also be used, such as biolistic delivery or ex vivo treatment.
  • the present invention relates to a method for preventing or treating liver disease comprising administering STC-1 or a derivative thereof.
  • the present invention relates to the use of STC-1 or a derivative thereof for preventing or treating liver disease.
  • the present invention relates to the use of STC-1 or a derivative thereof for the preparation of a medicament for preventing or treating liver disease.
  • the present invention relates to the use of STC-1 or a derivative thereof for the preparation of a drug for preventing or treating liver disease.
  • the present invention relates to a health functional food for preventing or improving liver disease comprising STC-1 or a derivative thereof as an active ingredient.
  • the present invention relates to a health functional food for improving liver function comprising STC-1 or a derivative thereof as an active ingredient.
  • health functional food refers to food having bioregulatory functions such as disease prevention and improvement, biodefense, immunity, recovery after illness, and aging suppression, and should be harmless to the human body when taken for a long time.
  • the STC-1 protein of the present invention When used as a food additive, the STC-1 or a derivative thereof may be added as it is or used together with other foods or food ingredients, and may be appropriately used according to a conventional method.
  • the mixing amount of active ingredients may be appropriately determined depending on the purpose of use (prevention, health or therapeutic treatment).
  • STC-1 or a derivative thereof of the present invention is added in an amount of 15% by weight or less, preferably 10% by weight or less, based on the raw material.
  • the active ingredient may be used in an amount above the above range.
  • the STC-1 or a derivative thereof of the present invention When using STC-1 or a derivative thereof of the present invention as a food additive, the STC-1 or a derivative thereof may be added as it is or used together with other foods or food ingredients, and may be appropriately used according to a conventional method.
  • the mixing amount of active ingredients may be appropriately determined depending on the purpose of use (prevention, health or therapeutic treatment).
  • STC-1 or a derivative thereof of the present invention is added in an amount of 15% by weight or less, preferably 10% by weight or less, based on the raw material.
  • the active ingredient may be used in an amount above the above range.
  • the health beverage composition of the present invention may include various flavoring agents or natural carbohydrates as additional components, like conventional beverages.
  • the aforementioned natural carbohydrates may include monosaccharides such as glucose and fructose, disaccharides such as maltose and sucrose, natural sweeteners such as dextrin and cyclodextrin, and synthetic sweeteners such as saccharin and aspartame.
  • the proportion of the natural carbohydrate is generally about 0.01 to 10 g, preferably about 0.01 to 0.1 g per 100 ml of the composition of the present invention, but is not limited thereto.
  • the composition of the present invention contains various nutrients, vitamins, electrolytes, flavors, colorants, pectic acid and its salts, alginic acid and its salts, organic acids, protective colloidal thickeners, pH adjusters, stabilizers, preservatives, glycerin, alcohol, It may include a carbonation agent used in carbonated beverages and the like.
  • the composition of the present invention may include fruit flesh for preparing natural fruit juice, fruit juice beverages, and vegetable beverages. These components may be used independently or in combination. The ratio of these additives is not critical, but is generally selected in the range of 0.01 to 0.1 part by weight per 100 parts by weight of the composition of the present invention.
  • "food composition” is variously used for the prevention or improvement of liver diseases, which are intended in the present invention
  • the food composition containing the composition of the present invention as an active ingredient is various foods, such as For example, it may be prepared in the form of beverages, gum, tea, vitamin complexes, powders, granules, tablets, capsules, confectionery, rice cakes, bread, and the like.
  • the food composition of the present invention can be safely used even when taken for a long period of time for preventive purposes because it is improved and composed of existing food intakes with little toxicity and side effects.
  • the amount may be added in an amount of 0.1 to 100% of the total weight.
  • natural carbohydrates include monosaccharides such as glucose, disaccharides such as fructose, polysaccharides such as sucrose, and common sugars such as dextrin and cyclodextrin, and sugar alcohols such as xylitol, sorbitol, and erythritol. can do.
  • the flavoring agent examples include natural flavoring agents (thaumatin, stevia extract (eg, rebaudioside A, glycyrrhizin, etc.) and synthetic flavoring agents (saccharin, aspartame, etc.).
  • Other foods of the present invention The composition includes various nutrients, vitamins, minerals (electrolytes), flavors such as synthetic flavors and natural flavors, colorants, pectic acid and its salts, alginic acid and its salts, organic acids, protective colloidal thickeners, pH adjusters, and stabilizers. , preservatives, glycerin, alcohol, carbonating agents used in carbonated beverages, etc. These components may be used independently or in combination
  • the ratio of these additives is usually 0.1 to 100 parts by weight per 100 parts by weight of the composition of the present invention It is generally selected from the range of 100 parts by weight, but is not limited thereto.
  • Example 1 Confirmation of steatohepatitis improvement effect after gastrectomy in type 2 diabetes red animal model OLETF (Otsuka Long-Evans Tokushima Fatty) red
  • OLETF Oleuka Long-Evans Tokushima Fatty
  • Japan SLC, Inc a representative obesity and diabetic disease red model, is a red model in which the cck-a gene has been deleted. do.
  • a total of 20 OLETF rats were fed ad libitum feed with a fat content of 60 Kcal for 28 weeks (high fat diet).
  • the rats were randomized to undergo Roux-en Y gastric bypass (RYGB) or sham operation. Sham surgery (SHAM) was performed on 8 OLETF rats, and RYGB surgery was performed on 12 rats.
  • RYGB Roux-en Y gastric bypass
  • SHAM Sham surgery
  • the RYGB procedure is as follows. Rats were anesthetized using 2% isoflurane gas and the abdomen was shaved. Iodine was applied to the midline of the abdomen, and the skin and peritoneum were opened open. The gastroesophageal junction was identified, cut, and sutured. The jejunum region about 34 cm away from the duodenum was measured, cut, and anastomosed to the esophagus. Then, the blind end of the gastric limb was anastomosis approximately 18 cm away from the anastomotic esophageal-jejunostomy site.
  • H&E staining and Masson's trichrome staining were performed after sampling the livers of the SHAM and RYGB surgery groups. It was confirmed that the progress of fibrosis was improved.
  • Example 2 Identification of Factors Affecting the Improvement of Steatohepatitis by Increased Glucose Metabolism in the Intestine After Gastrectomy in OLETF Red Animal Model of Type 2 Diabetes
  • RNA sequence analysis As a result of RNA sequence analysis, among the top 20 genes with the largest difference among transcripts, genes that translate proteins that can be secreted locally or into the blood were selected. It was confirmed that the expression increased significantly in the tissues with high FDG intake in the RYGB surgery group compared to the tissues with low FDG intake in the mock surgery group and the RYGB surgery group (FIG. 1).
  • ELISA analysis was performed to obtain plasma of blood extracted from the inferior vena cava and hepatic portal vein of the rat, and the amount of STC-1 protein was measured.
  • primers for confirming STC-1 expression primers of SEQ ID NOs: 1 to 2 were used (Table 1).
  • HepG2 cells the Seoul National University Hospital Cell Line Bank, Seoul, Republic of Korea
  • Hepatocyte a human liver cancer cell line
  • LX-2 cells hepatic stellate cell
  • DMEM Dulbecco's modified Eagle medium
  • FBS fetal bovine serum
  • penicillin-streptomycin penicillin-streptomycin
  • the cells were inoculated in a 6-well dish at a density of 2 x 10 5 cells/dish, cultured, and the culture medium was used 6 days after plating when the cell density was 1.5 x 10 5 cells/cm 2 .
  • palmitic acid and oleic acid (Sigma) were conjugated to 5% free fatty acid-free BSA at a ratio of 2:1, and the cells were then treated.
  • ReverTra Ace ReverTra Ace
  • Table 1 the forward (F) and reverse (R) primers shown in Table 1 were used for amplification.
  • LX-2 cells hepatic stellate cells, Merk, USA
  • TGF-beta a human hepatic stellate cell line that causes liver fibrosis
  • STC-1 and GDF-15 were each 100ng/ml 1 hour before TGF-beta treatment. After that, it was stimulated by treating with TGF-beta.
  • RNA was extracted and qRT-PCR was performed using primers related to inflammation and fibrosis (Table 1).
  • a cell line in which STC-1 was overexpressed was prepared in HepG2 cells (Seoul National University Hospital Cell Line Bank, Seoul, Republic of Korea), a human liver cancer cell line (Hepatocyte).
  • HepG2 cells were inoculated into a 6-well dish at a density of 2 x 10 5 cells/dish, cultured, and then transfected with pCMV-STC-1 vector using Polyjet (Signagen, USA) after 24 hours (transfection). ) to create STC-1 overexpressing cell lines.
  • the pCMV-STC-1 vector was prepared by inserting a gene fragment (SEQ ID NO: 142) encoding STC-1 into the pCMV vector (Korea Human Gene Bank (KHGB), Republic of Korea).
  • Equal amounts of protein in the cell lysate were separated by SDS-polyacrylamide gel electrophoresis and reacted with the primary antibody overnight at 4°C.
  • the blot was washed three times with TBST (Tris-buffered saline containing 0.05% Tween 20) and then incubated with horseradish peroxidase (HRP)-conjugated secondary antibody for 1 hour at 25°C.
  • HRP horseradish peroxidase
  • As secondary antibodies donkey anti-rabbit IgG-HRP antibody (1:2000, Santa Cruz) and donkey anti-mouse IgG-HRP antibody (1:2000, Santa Cruz) were used. Immunoreactivity was detected with SuperSignal West Pico Chemuluminescent Substrate (Thermo Fisher Scientific, MA, USA).
  • IEC18 cells (the Seoul National University Hospital Cell Line Bank, Seoul, Republic of Korea) were transformed with the pCMV-STC-1 vector to produce cells overexpressing STC-1, and RNA was obtained after 48 hours of culture. RNA was extracted from the cells 18 hours after wild-type IEC18 cells were treated with 50 ng/ml and 200 ng/ml of STC-1, respectively, and qRT was performed using primers capable of amplifying genes related to glucose metabolism. - PCR was performed.
  • Wild-type BL6 mice (OrientBio, Republic of Korea) were fed a methionine choline-deficient (MCD) diet for 8 weeks while daily intraperitoneal injection of recombinant human STC-1 protein or physiological saline (vehicle) was administered.
  • MCD methionine choline-deficient
  • Body weight was measured once a week, and AST and ALT levels in the serum of the mice were measured with an ELISA kit (SEO KWANG LABOTECH, Republic of Korea).
  • the level of Lect2 in the liver was confirmed through qPCR.
  • the excised mouse liver tissue was fixed with formaldehyde, a paraffin block was made, cut into 5 ⁇ M thickness, transferred to a slide, and Sirius Red staining was performed according to the manufacturer's instructions. The image was taken under a microscope and Sirius Red positive. Area was measured by image J quantification.
  • Example 7 Confirmation of anti-inflammatory effect by hSTC-1 overexpressing hepatocytes
  • Hepatocyte Human liver cancer cell line (Hepatocyte) HepG2 cells (the Seoul National University Hospital Cell Line Bank, Seoul, Republic of Korea) were seeded in upper wells using a transwell, and mouse macrophage cell line Raw264.7 (monocyte cell, ATCC TIB-71) was seeded. HepG2 cells in the upper well were transfected (transfected) with the pCMV-STC-1 vector to overexpress STC-1, and Raw264.7 cells in the lover well were treated with LPS (100ng/mL) and cultured for 48 hours. After, the expression change of inflammatory cytokines was confirmed by qRT-PCR in the method of Example 3.
  • Example 8 Confirmation of inflammatory cytokine expression changes by hSTC-1 treatment in inflammation-induced macrophages
  • Example 9 Confirmation of anti-inflammatory effect when treating inflammation-induced macrophages with hSTC-1 at different concentrations
  • Mouse macrophage cell line Raw264.7 was treated with 2ng/ml, 20ng/ml, and 200ng/ml of LPS (100ng/mL) and hSTC-1, respectively, and treated with ATP ( 2mM ) for 6 hours to promote the inflammatory response to reduce inflammation After induction, changes in mRNA expression of inflammatory cytokines were confirmed by qRT-PCR in the same manner as in Example 3.
  • the STC-1 protein according to the present invention reduces the expression of liver fibrosis markers ALT and Lect2 in liver fibrosis animal models, and reduces the area of fibrotic tissue, thereby having excellent effects in preventing and treating liver fibrosis and further liver cirrhosis. .

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Engineering & Computer Science (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Health & Medical Sciences (AREA)
  • Public Health (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Epidemiology (AREA)
  • Zoology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Organic Chemistry (AREA)
  • Nutrition Science (AREA)
  • Immunology (AREA)
  • Mycology (AREA)
  • Food Science & Technology (AREA)
  • Polymers & Plastics (AREA)
  • Physiology (AREA)
  • Endocrinology (AREA)
  • Marine Sciences & Fisheries (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)

Abstract

본 발명은 STC-1 또는 그 유도체를 유효성분으로 포함하는 간 질환 예방 또는 치료용 약학 조성물에 관한 것으로, 발명에 따른 STC-1 단백질은 간섬유화 동물 모델에서 간 섬유화 마커인 ALT과 Lect2의 발현을 감소시키고, 섬유화 조직의 면적을 감소시켜, 간섬유증 더 나아가 간경화 등의 예방 및 치료에 뛰어난 효과를 가진다.

Description

STC-1 또는 그 유도체를 포함하는 간질환 예방 또는 치료용 조성물
본 발명은 간질환의 예방 또는 치료용 조성물에 관한 것으로 더욱 자세하게는 STC-1 또는 그 유도체를 유효성분으로 포함하는 간 질환 예방 또는 치료용 약학 조성물에 관한 것이다.
간섬유화는 만성 간 내 염증으로 인한 세포 외 기질(extracellular matrix)의 과다한 침착으로 정의될 수 있으며 이러한 만성 간 내 염증이 지속되는 경우 간 세포수의 감소로 간섬유화는 간경변으로 발전된다.
간섬유화에 관여하는 대표적인 세포로는 간성상세포(hepatic stellate cell), 쿠퍼세포(kuffer cell), 내피 세포(endothelial cell) 등이 있다. 간 성상세포는 세포 외 기질을 생산하는 주 생산원으로, 교원질을 포함한 각종 세포 외 기질의 생성 증가에 관여한다. 쿠퍼세포는 간 내 동모양 혈관강(sinusoidal space) 내에 존재하며 활성화된 쿠퍼 세포에서 생성된 물질들을 주위간세포, 내피세포, 그리고 간성상세포에 영향을 주게 되어 간섬유화를 촉진시킨다. 내피세포는 간 내 혈류 조절에 중요한 역할을 하며, 이 외에도 염증이나 간섬유화 등에 의한 간성상세포의 증식에 관여하는 성장인자와 세포 외 기질의 생성에도 관여한다.
간 섬유화에 관여하는 대표적 세포 내 신호전달은 간성상세포의 가장 강력한 섬유화 촉진 사이토카인인 TGF-β를 통해 이루어진다. 간성상세포로부터 생산된 TGF-β는 유형 Ⅱ 수용체와 결합하여 유형 I 수용체를 인산화시키고 이는 곧 smad2 및 smad3와 접촉하여 이들을 인산화시킨다. 이후 smad2 및 smad3 결합체는 smad4와 결합한후 핵 내로 이동하며 목표유전자의 전사를 조절한다. 반면 Smad7은 유형I 수용체와 작용하여 smad2 및 smad3의 인산화를 방해하며 TGF-β에 의한 smad 신호전달을 방해함으로써 간섬유화를 지연시키는데 작용한다.
지금까지 간섬유화 과정은 비가역적인 반응으로 알려졌으나, 최근 임상 및 실험 연구를 통해 간섬유화 과정이 가역적 반응이며, 이를 통해 간섬유화 정도를 조절할 수 있음이 보고된 바 있다. 따라서 활성화된 간성상세포를 통한 간 섬유증의 진행 억제 연구가 주목을 받기 시작했다.
한편, 진화적으로 보존된 포유류 Stanniocalcin-1(STC-1)은 분비되는 당 단백질로, 사람 난소, 신장, 뇌, 폐, 심장, 근육, 뼈 등 다양한 조직에서 발현된다. 호르몬과 비슷한 기능을 하는 STC-1은 세포밖으로 분비되거나 세포 안에서 작용하여 칼슘 항상성과 산화 스트레스 조절반응에 관여한다고 알려져 있다. 세포 밖의 STC-1은 혈액으로 분비되고 내포작용을 통해 세포 안으로 들어와 대부분 미토콘드리아 내막에 결합하여 미토콘드리아 내의 슈퍼옥사이드 생성을 조절한다고 알려져 있다(선행문헌 1, 2, 3).
STC-1의 잘 알려진 역할인 혈중 칼슘 농도 조절 역할 외에 포유류 STC-1 에 대한 연구가 최근들어 활발히 진행되고 있다. 최근에는 상처치료, 세포대사, 혈관생성, 근육 및 뼈 발달, 암 대사 및 섬유화 등 다양한 역할들이 보고되고 있다(선행문헌 2~17). 항산화반응, 항염증반응으로 대표되는 기능을 통해 STC-1은 면역세포의 침투현상 및 분화를 감소시키고, 심장, 신장 염증 반응에 대한 치료효과를 보이며, 폐 섬유증을 완화시키는 것으로 알려져 있다(선행문헌 2~17). 하지만, 다양한 질병의 치료인자로 각광받고 있지만 아직까지 간에 대한 연구는 거의 미진한 상태이다.
이에, 본 발명자들은 당뇨병 동물모델에 위 절제술을 수행하여, 지방간염을 유발한 실험 동물에서 STC-1의 발현이 증가하는 것을 확인하고, 간 섬유화 마우스 모델에 STC-1 단백질을 투여하는 경우, 섬유화 및 염증 관련 유전자의 발현이 감소하고, 섬유화 병변이 감소하는 것을 확인하고, 본 발명을 완성하게 되었다.
[선행기술문헌]
[비특허문헌]
(비특허문헌 1)1. Ellard JP et al., Mol Cell Endocrinol. 264:90-101, 2007
(비특허문헌 2)2. Wang Y et al., J Leukoc Biol., 86:981-8, 2009
(비특허문헌 3)3. Sheikh-Hamad D et al.,. Am J Physiol Renal Physiol., 298(2):F248-54, 2010
(비특허문헌 4)4. Yeung BH et al., PLoS One., 6(11):e27094, 2011.
(비특허문헌 5)5. Sarapio E et al., Molecular and Cellular Endocrinology., 485:81-87, 2019
(비특허문헌 6)6. Iyer VR et al., Science., 283(5398):83-7, 1999
(비특허문헌 7)7. McCudden CR et al., J Biol Chem., 277(47):45249-58, 2002.
(비특허문헌 8)8. Kahn J et al., Am J Pathol., 156(6):1887-900, 2000
(비특허문헌 9)9. Filvaroff EH et al., Endocrinology., 156(6):1887-900, 2002
(비특허문헌 10)10. Serlachius M et al., Br J Haematol., 119(2):359-63, 2002
(비특허문헌 11)11. Chang AC et al., Endocr Relat Cancer., 10(3):359-73, 2003
(비특허문헌 12)12. Leung CC et al., Oncotarget., 9(6):6852-6861, 2017
(비특허문헌 13)13. Mohammadipoor A et al., Transl Res., 177:127-142, 2016
(비특허문헌 14)14. Lin H et al., Cancer Cell., 39(4):480-493.e6, 2021
(비특허문헌 15)15. Kamata T et al., Cell Rep., 31(12):107802, 2020
(비특허문헌 16)16. Huang L et al., Sci Rep., 5:18117, 2015
(비특허문헌 17)17. Pan JS et al., J Am Soc Nephrol., 26(2):364-78, 2015
(비특허문헌 18)18. Xu M et al., Cell., 78(6):1478-1492.e20, 2019
발명의 요약
본 발명의 목적은 간질환의 예방 또는 치료용도를 제공하는데 있다.
본 발명의 다른 목적은 간 질환 예방 또는 개선용 건강기능 식품을 제공하는데 있다.
본 발명의 또 다른 목적은 개선용 건강기능 식품을 제공하는데 있다.
상기 목적을 달성하기 위하여, 본 발명은 STC-1 또는 그 유도체를 유효성분으로 포함하는 간 질환 예방 또는 치료용 약학 조성물을 제공한다.
본 발명은 또한, STC-1 또는 그 유도체를 유효성분으로 포함하는 간 질환 예방 또는 개선용 건강기능 식품을 제공한다.
본 발명은 또한, STC-1 또는 그 유도체를 유효성분으로 포함하는 간기능 개선용 건강기능 식품을 제공한다.
본 발명은 또한, STC-1 또는 그 유도체를 투여하는 단계를 포함하는 간 질환의 예방 또는 치료방법을 제공한다.
본 발명은 또한, 간질환의 예방 또는 치료를 위한 STC-1 또는 그 유도체의 용도를 제공한다.
본 발명은 또한, 간질환의 예방 또는 치료용 약제 제조를 위한 비정형 STC-1 또는 그 유도체의 사용을 제공한다.
도 1은 OLETF 모델에 고지방 식이를 수행한 후, RYGB 수술을 진행하고, 12 주 후, alimentary limb 조직의 RNA 서열을 분석하여 전사체 중 발현량의 차이가 큰 상위 20개 유전자를 나타낸 것이다.
도 2는 RYGB 수술그룹과 모의수술(SHAM) 그룹의 하대정맥(inferior vena cava)과 간문맥 (portal vein)에서 혈액을 채취한 후 수득한 혈장을 시료로 하여, STC-1의 발현량을 ELISA 분석으로 확인한 결과를 나타낸 것이다.
도 3은 OLETF 모델에 고지방 식이를 수행한 후, RYGB 수술을 진행하고, 12 주 후, alimentary limb 조직의 FDG 업테이크 증가 부분과 FDG 업테이크가 증가하지 않은 부분의 STC-1 발현 차이를 qRT-PCR로 확인한 결과를 나타낸 것이다.
도 4는 간암 세포주인 HepG 세포에서 자유지방산(FFA) 처리군 또는 자유지방산과 STC-1 처리군의 지방 대사 관련 유전자의 발현변화를 qRT-PCR로 확인한 결과를 나타낸 것이다.
도 5는 간암 세포주인 HepG 세포에서 자유지방산(FFA) 처리군 또는 자유지방산과 STC-1 처리군의 염증 및 섬유화 관련 유전자의 별현변화를 qRT-PCR로 확인한 결과를 나타낸 것이다.
도 6은 간섬유화를 일으키는 간 성상세포주인 LX-2(hepatic stellate cell)에 TGF-beta를 처리하여 섬유화 및 활성화를 유도하고, STC-1 및 GDF-15를 처리하였을 때, 염증 및 섬유화 관련 마커의 발현변화를 qRT-PCR로 확인한 결과를 나타낸 것이다.
도 7은 HepG2 세포에 STC-1을 과발현 시킨 세포주에 필미틱 산(palmitic acid)를 처리한 후 세포에서, t-AMPKα, p-AMPKα 및 STC-1의 단백질양을 웨스턴블럿으로 확인한 결과를 나타낸 것이다.
도 8은 장 상피세포주인 IEC18 세포에 STC-1을 과발현(O/E)시키거나, STC-1 세포를 첨가하여 배양한 경우, 글루코스 대사(Glucose metabolism)와 관련된 유전자의 발현 변화를 qRT-PCR로 확인한 결과를 나타낸 것이다.
도 9는 MCD 식이 급여에 의한 간 섬유화 유발 마우스 모델에서 STC-1을 투여한 마우스에서, 혈청 내 AST 및 ALT 수준을 ELISA로 확인한 결과(위)와 간 조직에서 Lect2 발현을 qPCR을 통하여 확인한 결과(아래)를 나타낸 것이다.
도 10은 MCD 식이 급여에 의한 간 섬유화 유발 마우스 모델에 STC-1을 투여한 마우스에서, 간 조직의 섬유화 및 염증 관련 유전자의 발현을 qPCR로 확인한 결과를 나타낸 것이다.
도 11은 MCD 식이 급여에 의한 간 섬유화 유발 마우스 모델에 STC-1을 투여한 마우스의 간을 적출하여 Sirius red 염색을 수행한 결과를 나타낸 것이다.
도 12는 트랜스웰에서 STC-1을 과발현한 HepG2 세포(upper well)와 LPS을 처리한 대식세포주 Raw264.7(lower well)의 염증성 사이토카인의 발현을 qRT-PCR로 확인한 결과를 나타낸 것이다.
도 13은 LPS에 의한 염증 유도 대식세포에서 hSTC-1 처리에 의한 염증성 사이토카인 발현변화를 qRT-PCR로 확인한 결과를 나타낸 것이다.
도 14는 염증 유도 대식세포에 hSTC-1을 농도별로 처리에 의한 염증성 사이토카인 발현변화를 qRT-PCR로 확인한 결과를 나타낸 것이다.
발명의 상세한 설명 및 바람직한 구현예
다른 식으로 정의되지 않는 한, 본 명세서에서 사용된 모든 기술적 및 과학적 용어들은 본 발명이 속하는 기술 분야에서 숙련된 전문가에 의해서 통상적으로 이해되는 것과 동일한 의미를 갖는다. 일반적으로 본 명세서에서 사용된 명명법은 본 기술 분야에서 잘 알려져 있고 통상적으로 사용되는 것이다.
본 발명에서는 당뇨병 동물모델에 위 절제술을 수행하여, 지방간염을 유발한 실험 동물에서 STC-1의 발현이 증가하는 것을 확인하고, 간질환의 진행에 STC-1이 중요한 역할을 할 것으로 판단하였으며, STC-1이 과발현되는 간세포에 의해 LSP에 의해 유도되는 대식세포의 염증반응이 억제되는 것을 확인하였다. 아울러, 간 섬유화 마우스 모델에 STC-1 단백질을 투여하는 경우, 섬유화 및 염증 관련 유전자의 발현이 감소하고, 섬유화 병변이 감소하는 것을 확인하였다.
따라서, 본 발명은 일 관점에서, STC-1 또는 그 유도체를 유효성분으로 포함하는 간 질환 예방 또는 치료용 약학 조성물에 관한 것이다.
본 발명에 있어서, 상기 간 질환은 간섬유증, 간경화증, 급성 간염, 만성 간염, 지방간 또는 간암일 수 있으나, 이에 제한되는 것은 아니다.
본 발명에 있어서, 상기 STC-1 단백질은 서열번호 1로 표시되는 아미노산 서열을 가지는 것을 특징으로 할 수 있으나, 이에 한정되는 것은 아니며, 서열번호 1과 서열 유사성을 가지면서 STC-1의 활성을 가지는 단백질이라면 제한없이 사용될 수 있다.
서열번호 1:
MLQNSAVLLVLVISASATHEAEQNDSVSPRKSRVAAQNSAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESLKCIANGVTSKVFLAIRRCSTFQRMIAEVQEECYSKLNVCSIAKRNPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA
본 발명에서 STC-1 단백질은 서열번호 1과 70% 이상의 상동성, 80% 이상의 상동성, 90% 이상의 상동성, 95% 이상의 상동성, 96% 이상의 상동성, 97% 이상의 상동성, 98% 이상의 상동성 또는 99% 이상의 상동성을 가지는 것을 특징으로 할 수 있다.
본 발명에서의 STC-1 단백질 또는 유도체는 상기 서열번호 1의 STC-1의 아미노산 서열에서 N-말단 또는 C-말단에서의 일부 아미노산이 절단(truncation)된 형태로서, 여전히 STC-1 단백질의 활성을 유지하고 있는 STC-1 단백질의 절편을 포함하는 개념이며, 나아가 STC-1 단백질에서의 일부 아미노산의 치환, 바람직하게는 보존적 치환을 포함하며 여전히 STC-1 단백질의 활성을 유지하고 있는 STC-1 단백질을 포함하는 개념이다.
본 명세서에서 "보존적 치환"이란 1개 이상의 아미노산을 해당 폴리펩티드의 생물학적 또는 생화학적 기능의 손실을 야기하지 않는 유사한 생화학적 특성을 갖는 아미노산으로 치환하는 것을 포함하는 폴리펩티드의 변형을 의미한다. "보존적 아미노산 치환"은 아미노산 잔기를 유사한 측쇄를 갖는 아미노산 잔기로 대체시키는 치환이다. 유사한 측쇄를 갖는 아미노산 잔기 부류는 해당 기술분야에 규정되어 있으며, 잘 알려져 있다. 이들 부류는 염기성 측쇄를 갖는 아미노산(예를 들어, 라이신, 아르기닌, 히스티딘), 산성 측쇄를 갖는 아미노산(예를 들어, 아스파르트산, 글루탐산), 대전되지 않은 극성 측쇄를 갖는 아미노산(예를 들어, 글리신, 아스파라진, 글루타민, 세린, 트레오닌, 티로신, 시스테인), 비-극성 측쇄를 갖는 아미노산(예를 들어, 알라닌, 발린, 류신, 이소류신, 프롤린, 페닐알라닌, 메티오닌, 트립토판), 베타-분지된 측쇄를 갖는 아미노산(예를 들어, 트레오닌, 발린, 이소류신) 및 방향족 측쇄를 갖는 아미노산(예를 들어, 티로신, 페닐알라닌, 트립토판, 히스티딘)을 포함한다. 본 발명의 STC-1 단백질이 보존적 아미노산 치환을 갖고 여전히 활성을 보유할 수 있음이 예상되며, 본 발명에 따른 STC-1 단백질의 특성이 유지되는 한, 보존적 치환에 의한 변이가 일어난 단백질도 본 발명의 권리범위에 포함된다.
본 발명의 조성물은 약학적으로 허용 가능한 첨가제를 더 포함할 수 있으며, 이때 약제적으로 허용 가능한 첨가제로는 전분, 젤라틴화 전분, 미결정 셀룰로오스, 유당, 포비돈, 콜로이달실리콘디옥사이드, 인산수소칼슘, 락토스, 만니톨, 엿, 아라비아고무, 전호화전분, 옥수수전분, 분말셀룰로오스, 히드록시프로필셀룰로오스, 오파드라이, 전분글리콜산나트륨, 카르나우바납, 합성규산알루미늄, 스테아린산, 스테아린산마그네슘, 스테아린산알루미늄, 스테아린산칼슘, 백당 등이 사용될 수 있다. 본 발명에 따른 약제적으로 허용 가능한 첨가제는 상기 조성물에 대해 0.1 내지 90 중량부 포함되는 것이 바람직하나 이에 한정되는 것은 아니다.
본 발명의 조성물은 실제 임상투여시에 경구 또는 비경구의 여러 가지 제형으로 투여될 수 있는데, 제제화할 경우에는 보통 사용하는 충진제, 증량제, 결합제, 습윤제, 붕해제, 계면활성제 등의 희석제 또는 부형제를 사용하여 조제할 수 있으며, 당해 기술 분야에 알려진 적합한 제제는 문헌 (Remington's Pharmaceutical Science, 최근, Mack Publishing Company, Easton PA)에 개시되어 있는 것을 이용하는 것이 바람직하다. 상기 조성물에 포함될 수 있는 담체, 부형제 및 희석제로는 락토즈, 덱스트로즈, 수크로스, 올리고당, 솔비톨, 만니톨, 자일리톨, 에리스리톨, 말티톨, 전분, 아카시아 고무, 알지네이트, 젤라틴, 칼슘 포스페이트, 칼슘 실리케이트, 셀룰로오스, 메틸 셀룰로오스, 미정질 셀룰로오스, 폴리비닐 피롤리돈, 물, 메틸히드록시 벤조에이트, 프로필히드록시 벤조에이트, 탈크, 마그네슘 스테아레이트, 광물유 등이 있다.
상기 경구투여를 위한 고형제제에는 정제, 환제, 산제, 과립제, 캡슐제 등이 포함되며, 이러한 고형제제는 적어도 하나 이상의 부형제 예를 들면, 전분, 칼슘 카보네이트(Calcium carbonate), 수크로스 (Sucrose) 또는 락토오스(Lactose), 젤라틴 등을 섞어 조제된다. 또한 단순한 부형제 이외에 마그네슘 스티레이트 탈크 같은 윤활제들도 사용된다. 또한, 상기 경구투여를 위한 액상제제로는 현탁제, 내용액제, 유제, 시럽제 등이 해당되는데 흔히 사용되는 단순희석제인 물, 리퀴드 파라핀 이외에 여러 가지 부형제, 예를 들면 습윤제, 감미제, 방향제, 보존제 등이 포함될 수 있다.
상기 비경구투여를 위한 제제에는 멸균된 수용액, 비수성용제, 현탁제, 유제, 동결건조제제, 좌제가 포함된다.
비수성용제, 현탁용제로는 프로필렌글리콜(Propylene glycol), 폴리에틸렌 글리콜, 올리브 오일과 같은 식물성 기름, 에틸올레이트와 같은 주사 가능한 에스테르 등이 사용될 수 있다. 좌제의 기제로는 위텝솔(witepsol), 마크로골, 트윈(tween) 61, 카카오지, 라우린지, 글리세로제라틴 등이 사용될 수 있다. 상기 비경구투여는 피부외용 또는 복강 내 주사, 직장 내 주사, 피하주사, 정맥주사, 근육 내 주사 또는 흉부 내 주사 주입방식을 사용하여 이루어질 수 있다.
본 발명의 약학적 조성물의 투여량은 환자의 체중, 연령, 성별, 건강상태, 식이, 투여시간, 투여방법, 배설율 및 질환의 중증도에 따라 그 범위가 다양하며, 하루에 한 번 투여할 수도 있고, 수 회 나누어 투여할 수도 있다.
본 발명의 약학적 조성물은 개체에게 다양한 경로로 투여될 수 있다. 투여의 모든 방식은 예상될 수 있는데, 예를 들면, 경구, 직장 또는 정맥, 근육, 피하, 자궁 내 경막 또는 뇌혈관 내 주사에 의해 투여될 수 있다.
본 발명의 약학적 조성물은 간질환의 예방 및 치료를 위하여 단독으로, 또는 수술, 방사선 치료, 호르몬 치료, 화학 치료 및 생물학적 반응 조절제를 사용하는 방법들과 병용하여 사용할 수 있다.
본 발명에서 용어 "예방"은 본 발명의 약학적 조성물의 투여로 간질환을 억제 또는 지연시키는 모든 행위를 의미하며, 용어 "치료"는 본 발명의 약학적 조성물에 의해 간질환에 의한 증세가 호전되거나 이롭게 변경되는 모든 행위를 의미한다.
본 발명의 일 구체예에서 "예방"이란, 본 발명의 상기 조성물을 이용하여 간 질환에 의해 기인된 증상을 차단하거나, 그 증상을 억제 또는 지연시킬 수 있는 모든 행위라면 제한없이 포함될 수 있다.
본 발명의 일 구체예에서 "개선" 이란, 본 발명의 상기 조성물을 이용하여 간 질환에 의해 기인된 증상이 호전될 수 있도록 하거나, 이롭게 될 수 있도록 하는 모든 행위라면 제한없이 포함될 수 있다.
본 발명의 일 구체예에서 "치료"란, 목적하는 질병의 완화 또는/및 개선을 위해 수행되는 일련의 활동을 의미한다.
또한 본 발명에 따른 약학 조성물은 조성물 총 중량에 대하여 본 발명의 유효성분을 0.1 내지 50 중량 %로 포함한다. 본 발명의 조성물에 포함될 수 있는 담체, 부형제 및 희석제로는 락토즈, 덱스트로즈, 수크로스, 솔비톨, 만니톨, 자일리톨, 에리스리톨, 말티톨, 전분, 아카시아 고무, 알지네이트, 젤라틴, 칼슘 포스페이트, 칼슘 실리케이트, 셀룰로즈, 메틸 셀룰로즈, 미정질 셀룰로스, 폴리비닐 피롤리돈, 물, 메틸히드록시벤조에이트, 프로필히드록시벤조에이트, 탈크, 마그네슘 스테아레이트 및 광물유를 들 수 있으나, 이에 제한되는 것은 아니다.
본 발명의 일 구체예에서 "투여"란, 어떠한 적절한 방법으로 환자에게 본 발명의 조성물을 도입하는 것을 의미하며, 본 발명의 조성물의 투여경로는 목적 조직에 도달할 수 있는 한 어떠한 일반적인 경로를 통하여 투여될 수 있다.
경구 투여, 복강 내 투여, 정맥 내 투여, 근육 내 투여, 피하 투여, 피내 투여, 비내 투여, 폐내 투여, 장내 투여, 강내 투여, 복강 내 투여, 경막 내 투여가 이루어질 수 있으나, 이에 제한되지는 않는다. 본 발명에서 유효량은 질환의 종류, 질환의 중증도, 조성물에 함유된 유효 성분 및 다른 성분의 종류 및 함량, 제형의 종류 및 환자의 연령, 체중, 일반 건강 상태, 성별 및 식이, 투여 시간, 투여 경로 및 조성물의 분비율, 치료 기간, 동시 사용되는 약물을 비롯한 다양한 인자에 따라 조절될 수 있다. 또한 본 발명의 약학 조성물은 목적하고자 하는 간질환의 치료를 위해 단독 또는 당업계에 공지된 다른 치료법, 예를 들어 화학요법제, 및 수술과 같이 투여될 수 있다. 또한 본 발명의 약학 조성물은 혈당 강하를 촉진하기 위하여 고안된 다른 치료, 예를 들어 당업계에 주지된 것과 혼합하여 투여될 수 있다. 바이오리스틱(biolistic) 전달 또는 생체 외(ex vivo) 처리와 같은 다른 표준 전달 방법들이 사용될 수도 있다.
다른 관점에서, 본 발명은 STC-1 또는 그 유도체를 투여하는 단계를 포함하는 간질환의 예방 또는 치료방법에 관한 것이다.
또 다른 관점에서, 본 발명은 STC-1 또는 그 유도체를 간질환의 예방 또는 치료에 사용하는 용도에 관한 것이다.
또 다른 관점에서, 본 발명은 간질환의 예방 또는 치료용 약제의 제조를 위한 상기 STC-1 또는 그 유도체의 용도에 관한 것이다.
또 다른 관점에서, 본 발명은 간질환의 예방 또는 치료용 약제의 제조를 위한 상기 STC-1 또는 그 유도체의 사용에 관한 것이다.
다른 관점에서, 본 발명은 STC-1 또는 그 유도체를 유효성분으로 포함하는 간 질환 예방 또는 개선용 건강기능 식품에 관한 것이다.
또 다른 관점에서, 본 발명은 STC-1 또는 그 유도체를 유효성분으로 포함하는 간기능 개선용 건강기능 식품에 관한 것이다.
본 발명에서, "건강기능식품"이란, 질병의 예방 및 개선, 생체방어, 면역, 병후의 회복, 노화 억제 등 생체조절 기능을 가지는 식품을 말하는 것으로, 장기적으로 복용하였을 때 인체에 무해해야 한다.
본 발명의 STC-1 단백질을 식품 첨가물로 사용할 경우, 상기 STC-1 또는 그 유도체를 그대로 첨가하거나 다른 식품 또는 식품 성분과 함께 사용될 수 있고, 통상적인 방법에 따라 적절하게 사용될 수 있다. 유효성분의 혼합양은 사용 목적 (예방, 건강 또는 치료적 처치)에 따라 적합하게 결정될 수 있다. 일반적으로, 식품 또는 음료의 제조 시에 본 발명의 STC-1 또는 그 유도체는 원료에 대하여 15 중량% 이하, 바람직하게는 10 중량% 이하의 양으로 첨가된다. 그러나, 건강 및 위생을 목적으로 하거나 또는 건강 조절을 목적으로 하는 장기간의 섭취의 경우에는 상기 범위 이하일 수 있으며, 안전성 면에서 아무런 문제가 없기 때문에 유효성분은 상기 범위 이상의 양으로도 사용될 수 있다.
본 발명의 STC-1 또는 그 유도체를 식품 첨가물로 사용할 경우, 상기 STC-1 또는 그 유도체를 그대로 첨가하거나 다른 식품 또는 식품 성분과 함께 사용될 수 있고, 통상적인 방법에 따라 적절하게 사용될 수 있다. 유효성분의 혼합양은 사용 목적 (예방, 건강 또는 치료적 처치)에 따라 적합하게 결정될 수 있다. 일반적으로, 식품 또는 음료의 제조 시에 본 발명의 STC-1 또는 그 유도체는 원료에 대하여 15 중량% 이하, 바람직하게는 10 중량% 이하의 양으로 첨가된다. 그러나, 건강 및 위생을 목적으로 하거나 또는 건강 조절을 목적으로 하는 장기간의 섭취의 경우에는 상기 범위 이하일 수 있으며, 안전성 면에서 아무런 문제가 없기 때문에 유효성분은 상기 범위 이상의 양으로도 사용될 수 있다.
본 발명의 건강음료 조성물은 통상의 음료와 같이 여러 가지 향미제 또는 천연 탄수화물 등을 추가 성분으로서 포함할 수 있다. 상술한 천연 탄수화물은 포도당, 과당과 같은 모노사카라이드, 말토오스, 수크로오스와 같은 디사카라이드, 및 덱스트린, 사이클로덱스트린과 같은 천연 감미제나, 사카린, 아스파르탐과 같은 합성 감미제 등을 사용할 수 있다. 상기 천연 탄수화물의 비율은 본 발명의 조성물 100 ml 당 일반적으로 약 0.01 내지 10g, 바람직하게는 약 0.01 내지 0.1 g 이나, 이에 제한되지 않는다.
상기 외에 본 발명의 조성물은 여러 가지 영양제, 비타민, 전해질, 풍미제, 착색제, 펙트산 및 그의 염, 알긴산 및 그의 염, 유기산, 보호성 콜로이드 증점제, pH 조절제, 안정화제, 방부제, 글리세린, 알코올, 탄산음료에 사용되는 탄산화제 등을 포함할 수 있다. 그 밖에 본 발명의 조성물은 천연 과일주스, 과일주스 음료 및 야채 음료의 제조를 위한 과육을 포함할 수 있다. 이러한 성분은 독립적으로 또는 조합하여 사용할 수 있다. 이러한 첨가제의 비율은 크게 중요하진 않지만 본 발명의 조성물 100 중량부 당 0.01 내지 0.1 중량부의 범위에서 선택되는 것이 일반적이다.
본 발명의 일 구체예에서 "식품 조성물"이란, 본 발명에서 목적으로 하는 간 질환의 예방 또는 개선을 위해 다양하게 이용되는 것으로서, 본 발명의 조성물을 유효성분으로 포함하는 식품 조성물은 각종 식품류, 예를 들어, 음료, 껌, 차, 비타민 복합제, 분말, 과립, 정제, 캡슐, 과자, 떡, 빵 등의 형태로 제조될 수 있다. 본 발명의 식품 조성물은 독성 및 부작용이 거의 없는 기존의 식품용 섭취물로부터 개량되어 구성된 것이므로 예방 목적으로 장기간 복용 시에도 안심하고 사용할 수 있다. 본 발명의 조성물이 식품 조성물에 포함될 때 그 양은 전체 중량의 0.1 내지 100 %의 비율로 첨가할 수 있다. 여기서, 상기 식품 조성물이 음료형태로 제조되는 경우 지시된 비율로 상기 식품 조성물을 함유하는 것 외에 특별한 제한점은 없으며 통상의 음료와 같이 여러가지 향미제 또는 천연탄수화물 등을 추가 성분으로서 함유할 수 있다. 즉, 천연탄수화물로서 포도당 등의 모노사카라이드, 과당 등의 디사카라이드, 슈크로스 등의 및 폴리사카라이드, 덱스트린, 시클로덱스트린 등과 같은 통상적인 당 및 자일리톨, 소르비톨, 에리트리톨 등의 당알콜 등을 포함할 수 있다. 상기 향미제로서는 천연 향미제(타우마틴, 스테비아 추출물(예를 들어 레바우디오시드 A, 글리시르히진등) 및 합성향미제(사카린, 아스파탐 등) 등을 들 수 있다. 그 외 본 발명의 식품 조성물은 여러 가지 영양제, 비타민, 광물(전해질), 합성풍미제 및 천연풍미제 등의 풍미제, 착색제, 펙트산 및 그의 염, 알긴산 및 그의 염, 유기산, 보호성 콜로이드 증점제, pH 조절제, 안정화제, 방부제, 글리세린, 알콜, 탄산음료에 사용되는 탄산화제 등을 함유할 수 있다. 이러한 성분은 독립적으로 또는 조합하여 사용할 수 있다. 이러한 첨가제의 비율은 통상적으로 본 발명의 조성물 100 중량부 당 0.1 내지 100 중량부의 범위에서 선택되는 것이 일반적이나, 이에 제한되는 것은 아니다.
[실시예]
이하, 실시예를 통하여 본 발명을 더욱 상세히 설명하고자 한다. 이들 실시예는 오로지 본 발명을 예시하기 위한 것으로, 본 발명의 범위가 이들 실시예에 의해 제한되는 것으로 해석되지 않는 것은 당업계에서 통상의 지식을 가진 자에게 있어서 자명할 것이다.
실시예 1: 제 2형 당뇨병 렛드 동물 모델 OLETF (Otsuka Long-Evans Tokushima Fatty) 렛드에서 위 절제술 후 지방간염 호전효과 확인
대표적인 비만 및 당뇨질환 렛드 모델인 OLETF (Otsuka Long-Evans Tokushima Fatty) 렛드(Japan SLC, Inc)는 cck-a 유전자가 결실된 렛드 모델로서, 식욕조절 호르몬으로 알려져 있는 CCK 호르몬의 결핍을 주요 특징으로 한다.
총 20 마리의 OLETF 렛드에 28주 동안 자유롭게 60 Kcal의 지방함량의 사료를 급여하였다(고지방 식이). Roux-en Y 위장 우회술 (Roux-en Y gastric bypass; RYGB) 또는 모의수술(sham operation)을 실시하기 위하여 렛드를 무작위로 분류하였다. 8 마리의 OLETF 렛드에서는 모의수술(SHAM)을 진행하였고, 12 마리의 렛드에서는 RYGB 수술을 진행하였다.
RYGB 절차는 다음과 같다. 2% 아이소플루레인 가스를 사용하여 렛드를 마취시키고 복부를 면도하였다. 복부 중앙선에 요오드를 도포하고 피부와 복막을 개복하였다. 식도 위 접합부를 동정하고 절단하고나서 봉합하였다. 십이지장으로부터 약 34cm 떨어진 공장(jejunum) 부위를 측정하고 절단하여 식도에 문합하였다. 그리고나서, 위문 맹단부위(the blind end of gastric limb)는 문합된 식도-공장루(jejunostomy) 부위에서 약 18cm 떨어진 곳에서 문합하였다. 3개의 분지(limb), 식도-공장루 부위의 분지(esophagojejunostomy limb, 약 18cm), 위장 분지(glastric limb, 약 34cm) 및 공통 분지 (common limb, 약 24cm)를 형성하였다. 모의수술(SHAM)은 복강막을 열고 공장부위를 절단한 뒤 다시 문합하였다.
RYGB 수술 12주 후 모의수술(SHAM) 군과 RYGB 수술 군의 간을 적출하여 샘플링 한 후에 H&E 염색 및 Masson trichrome staining (섬유화 확인 염색법)을 수행하였으며, 모의수술군에 비하여 RYGB 수술군에서 지방간염 및 섬유화 진행정도가 호전된 것을 확인하였다.
실시예 2: 제2형 당뇨병 렛드 동물 모델 OLETF 렛드에서 위 절제술 후 장에서의 포도당 대사 증가에 의한 지방간염 호전에 미치는 인자 발굴
실시예 1과 동일한 방법으로 렛드를 수술 후 12주차에 1mCi의 Fluorodeoxyglucose(FDG)를 렛드의 꼬리 정맥에 주사하고, 1시간 후에 렛드를 희생시키고 창자를 절개하였다. RYGB 렛드의 경우, 창자 내강의 각 분지(식도 분지, 위장 분지, 및 공통 분지)를 일반 식염수로 세척하고 각각의 창자 부분에서 FDG 섭취량을 오토라디오그래피(autoradiography)로 평가하였다.
그리드 종이(grid paper) 상측면에 잘록창자팽대부(haustrum)와 창자를 정렬하여 진행하고, 오토라디오그래피 이미지는 BAS 1040 촬영 플레이트를 사용하여 취득하였다. 오토라디오그래피를 통하여 식도 분지에서 FDG uptake가 가장 많은 부분과 가장 적은 부분의 창자 조직을 선별하였다. 모의 수술군에서는 공장(jejunum) 조직을 선별하였다.
FDG 섭취가 가장 많이 증가한 부분의 조직과 가장 적게 섭취된 조직 그리고 모의수술 군의 공장 부분의 조직을 잘라서 RNA를 추출한 후에 초고속 RNA 서열분석(High throughput RNA Sequencing)을 진행하였다(Macrogen, Korea).
RNA 서열 분석 결과, 전사체 중에서 가장 차이가 큰 상위 20개의 유전자들 중에서 국소적으로 또는 혈액으로 분비될 수 있는 단백질을 translation 하는 유전자를 선별하였으며, 그 중에서 특히 STC-1 (stanniocalcin-1) 유전자의 발현이 모의수술 군 및 RYGB 수술 군 중에서 FDG 섭취가 적었던 조직에 비하여 RYGB 수술군의 FDG 섭취가 많았던 조직에서 유의미하게 증가하는 것을 확인하였다(도 1).
이를 바탕으로 렛드의 하대정맥 및 간문맥에서 추출한 혈액의 혈장을 얻어 ELISA 분석을 수행하여, STC-1 단백질의 양을 측정하였다.
ELISA 키트(Cat# ab213829, abcam, MA, USA)를 사용한 분석은 제조사의 지침에 따라 수행하였다.
그 결과, 도 2에 나타난 바와 같이, 모의수술(SHAM) 군에 비해 RYGB 수술군에서 하대정맥과 간문맥에서 모두 STC-1의 양이 증가하는 것을 확인하였다. 특히, 간문맥(장에서 간으로 가는 혈액 통로)에서 STC-1의 농도가 유의미하게 높아진 것을 확인하였다.
아울러, 오토라디오그래피를 통하여 Alimentary Limb (AL) 에서 FDG 업테이크가 증가한 부분과 증가되지 않은 부분의 조직과 간 조직에서 RNA를 추출하여, STC-1의 발현을 qRT-PCR을 통해 확인하였다. STC-1 발현확인을 위한 프라이머는 서열번호 1~2의 프라이머를 사용하였다(표 1).
그 결과 도 3에 나타난 바와 같이, SHAM(수술 대조군)에 비하여 RYGB AL- (-는 FDG 업테이크가 증가되지 않은 부분)과 AL+ (FDG 업테이크가 증가한 부분) 에서 STC-1 발현이 증가한 것을 확인하였다. 아울러, 수술대조군(SHAM)에 비하여 RYGB 수술을 진행한 랫드의 간에서 STC-1 의 mRNA 발현이 증가하는 것을 확인하였다.
실시예 3: 간 세포주에서 재조합 사람 STC-1 단백질 처리에 의하여 지방 대사 및 면역 반응, 섬유화의 정도 확인
사람 간암 세포주(Hepatocyte)인 HepG2 세포(the Seoul National University Hospital Cell Line Bank, Seoul, Republic of Korea), 사람 간 선상세포주인 LX-2 세포(hepatic stellate cell)(Merk, USA)의 배양을 위해, 10% 소 태아 혈청(FBS)과 페니실린-스트렙토마이신이 첨가된 Dulbecco's modified Eagle 배지(DMEM)에 넣고, 10% CO2와 90% 공기를 포함하는 가습 분위기에서 37℃로 유지하였다. 보존 배양은 3-4일마다 계대배양하였다.
세포를 2 x 105 세포/접시의 밀도로 6-웰 접시에 접종한 후, 배양하여, 세포 밀도가 1.5 x 105 세포/cm2 일 때 도말 6일 후에 배양액을 사용하였다. 자유지방산 처리군에는 팔미트산 및 올레트산 (Sigma)을 2:1 비율로하여, 5% 자유지방산이 없는 BSA에 컨츄게이션시킨 후에 세포에 처리하였으며, 자유지방산 + STC-1 처리군의 경우, 상기 자유지방산과 100ng/mL의 STC-1(Cat# RD172095100, Biovendor R&D)를 처리하였으며, 18시간 후 세포에서 RNA를 추출하여 지방대사 유전자 및 면역반응(inflammation) 관련 유전자의 발현 변화를 qRT-PCR로 확인하였다.
Rneasy Mini kit(Qiagen)를 사용하여 HepG2 세포로부터 총 RNA를 추출하고, ReverTra Ace(Toyobo, Osaka, Japan)를 사용하여 cDNA를 제조하였다. PCR에는 표 1에 나타낸 순방향(F) 및 역방향(R) 프라이머를 증폭에 사용하였다.
Figure PCTKR2022011447-appb-img-000001
Figure PCTKR2022011447-appb-img-000002
Figure PCTKR2022011447-appb-img-000003
Figure PCTKR2022011447-appb-img-000004
Figure PCTKR2022011447-appb-img-000005
그 결과, 도 4 및 도 5에 나타난 바와 같이, HepG2 세포에 팔미트산과 올레트산을 2:1 비율로 처리하였을 때 지방대사 관련 유전자 발현이 증가하는 반면, STC-1을 함께 처리하면 지방대사 유전자(도 4) 및 염증 및 섬유화 관련 유전자(도 5)의 발현이 감소하는 것을 확인하였다.
또한, 간 섬유화를 일으키는 사람 간성상세포주인 LX-2 세포(hepatic stellate cell, Merk, USA)에 TGF-beta 로 자극하여 섬유화(fibrosis) 및 활성화를 유도하였다. 먼저 혈청이 없는 배지에서 세포를 24시간 동안 처리 한 후, STC-1와 GDF-15(Cat#957-GD R&D systems, USA)는 각각 100ng/ml을 TGF-beta를 처리하기 1시간 전에 미리 반응시킨 후 TGF-beta를 처리하여 자극하였다. 18시간 배양 후 RNA를 추출하여 염증 및 섬유화와 관련된 프라이머(표 1)를 이용하여 qRT-PCR을 수행하였다.
그 결과, 도 6에 나타난 바와 같이, TGF-beta 처리군에 비하여 STC-1 또는 GDF15 처리군에서 염증 및 섬유화 마커 유전자가 유의미하게 감소하는 것을 확인하였다. 특히, GDF15 처리 군에 비하여 STC-1 처리군에서 더 좋은 효과가 나타나는 것을 확인하였다.
실시예 4: STC-1을 과발현 시킨 간 세포주에서의 AMPKα의 인산화 확인
사람 간암 세포주(Hepatocyte)인 HepG2 세포(Seoul National University Hospital Cell Line Bank, Seoul, Republic of Korea)에 STC-1을 과발현시킨 세포주를 제작하였다.
HepG2 세포를 2 x 105 세포/접시의 밀도로 6-웰 접시에 접종한 후, 배양한 후, 24시간 후에 Polyjet(Signagen, USA)을 이용하여 pCMV-STC-1 vector를 트렌스펙션(형질주입) 시켜 STC-1 과발현 세포주를 만들었다.
상기 pCMV-STC-1 vector는 pCMV 벡터(Korea Human Gene Bank(KHGB), Republic of Korea)에 STC-1를 코딩하는 유전자 단편(서열번호 142)를 삽입하여 제작하였다.
상기 제작된 STC-과발현 세포주에 필미트산(palmitic acid)을 처리한 후 세포에서 단백질을 추출하여 t-AMPKα 항체, p-AMPKα 항체 및 STC-1을 1차항체로 사용하여, 웨스턴블럿을 수행하였다.
전체 세포 단백질 용해물을 제조하고, 표준 절차에 따라 웨스턴 블롯 분석을 수행하였다. 간략하게는, 세포를 얼음 상에서 냉각시키고, 빙냉된 인산-완충 식염수로 2회 세척하고, 1mM 페닐메틸술포닐플루오라이드 및 1x 프로테아제 억제제(sigma-Aldrich)를 함유하는 완충액에서 용해시켰다. 단백질 농도는 BCA protein assay 키트(Thermo Scientific)로 측정하였다.
세포 용해물에 동량의 단백질을 SDS-폴리아크릴아미드젤 전기영동으로 분리하고 1차 항체와 함께 4 ℃에서 밤새 반응시켰다. 블롯을 TBST(0.05% Tween 20을 함유하는 트리스-완충된 식염수)로 3회 세척한 후, 25 ℃에서 1시간 동안 호스래디쉬 퍼옥시다아제(HRP)-컨쥬게이트된 2차 항체로 반응시켰다. 2차 항체는 당나귀 항-토끼 IgG-HRP 항체 (1:2000, Santa Cruz), 당나귀 항-마우스 IgG-HRP 항체 (1:2000, Santa Cruz)를 사용하였다. 면역반응성은 SuperSignal West Pico Chemuluminescent Substrate(Thermo Fisher Scientific, MA, USA)로 검출하였다.
그 결과, 도 7에 나타난 바와 같이, STC-1을 과발현시킨 세포에 팔미틱산을 처리할 경우 phosphor AMPKα가 증가하는 것을 확인하였다. P-AMPKα가 증가할 경우 미토콘드리아의 언커플(mitochondrial uncouple) 작용을 통하여 NASH가 완화된다.
실시예 5: 장 상피 세포주에서 STC-1 과발현이 글루코스 대사에 미치는 영향 확인
장 상피세포주인 IEC18 세포(the Seoul National University Hospital Cell Line Bank, Seoul, Republic of Korea)에 pCMV-STC-1 vector를 형질전환시켜 STC-1이 과발현되는 세포를 제작하고, 48시간 배양 후 RNA를 추출하고, 야생형 IEC18 세포에 STC-1를 각 50ng/ml 및 200ng/ml 처리한 후 18시간 후에 세포에서 RNA를 추출하여 글루코스 대사(Glucose metabolism)과 관련된 유전자를 증폭할 수 있는 프라이머를 이용하여 qRT-PCR 를 진행하였다.
Figure PCTKR2022011447-appb-img-000006
그 결과, 도 8에 나타난 바와 같이, STC-1의 농도의존적으로 GLUT1 유전자 및 헥소키나아제(HK) 유전자의 발현이 증가하는 것을 확인하였다. 또한, STC-1의 과발현(O/E)에 의해서도 GLUT1 유전자 및 헥소키나아제(HK) 유전자의 발현이 증가하는 것을 확인하였다.
실시예 6: 간섬유화 마우스 모델에서 STC-1 단백질 투여 효과 확인
야생형 BL6 마우스(OrientBio, Republic of Korea)에 8주동안 MCD(methionine choline-deficient) 식이를 급여하면서 재조합 사람 STC-1 단백질 또는 생리식염수(비히클)을 매일 복강주사로 투여하였다. 매주 한 번씩 체중을 측정하였고, 마우스의 혈청에서 AST 및 ALT 수준을 ELISA 키트(SEO KWANG LABOTECH, Republic of Korea)로 측정하였다. 또한, 간에서의 Lect2 수준을 qPCR을 통하여 확인하였다.
그 결과, 도 9에 나타난 바와 같이, 대조군인 Vehicle 그룹에 비하여 STC-1을 투여한 그룹에서 AST 및 ALT 수준이 감소하는 경향을 확인하였다. Cirrhosis 환자에서도 normal ALT 수준을 보이는 군이 있어 ALT 수준만으로는 cirrhosis를 정확히 구분할 수 없고, Lect2 수준에 의해 좀 더 확실한 cirrhosis 병변을 구별할 수 있다는 것이 최근 논문에서 밝혀졌다(Xu, M et al., Cell, 178(6), 1478-1492, 2019).
본 실시예에서는 도 9에 나타난 바와 같이, STC-1 투여군에서 ALT 수준뿐만 아니라, Lect2 mRNA 수준이 유의미하게 감소하는 것을 확인하였으며, 결론적으로 STC-1 투여에 의해 섬유화가 완화되는 것을 확인하였다.
또한, 8주 후 마우스의 간을 적출한 다음 RNA를 추출하여 섬유화 및 염증관련 유전자의 발현 수준을 확인하기 위하여, qPCR 진행하였다.
그 결과, 도 10에 나타난 바와 같이, MCD 식이 급여 마우스에 STC-1을 투여한 그룹에서 Fibrosis 및 inflammation 관련 유전자들의 발현이 감소하는 것을 확인하였다.
또한, 시리우스 레드 염색(Sirius Red staining)을 통해 섬유화 정도를 확인하였다. 적출한 마우스 간 조직을 조직을 포름알데하이드로 고정시켜, 파라핀 블록을 만든 후, 5μM 두께로 절단하여 슬라이드에 옮긴 후에 Sirius Red 염색을 제조사 지침에 따라 진행하였으며, 이미지를 현미경으로 촬영하고, Sirius Red 양성 면적은 image J quantification으로 측정하였다.
그 결과, 도 11에 나타난 바와 같이, MCD 식이 급여 마우스에 STC-1을 투여한 그룹에서 Sirius red 양성 면적이 유의미하게 감소하는 것을 확인하였다.
실시예 7: hSTC-1 과발현 간세포에 의한 항염증 효과 확인
트랜스웰을 사용하여 upper well에 사람 간암 세포주(Hepatocyte)인 HepG2 세포(the Seoul National University Hospital Cell Line Bank, Seoul, Republic of Korea)을 시딩하고, lower well에 마우스 대식세포주 Raw264.7 (monocyte cell, ATCC TIB-71) 을 시딩하였다. upper well의 HepG2 세포에 pCMV-STC-1 vector를 트렌스펙션(형질주입) 시켜 STC-1를 과발현시키고, lover well의 Raw264.7세포에는 LPS(100ng/mL)을 처리하고, 48시간 동안 배양한 후, 염증성 사이토카인의 발현변화를 실시예 3의 방법으로 qRT-PCR로 확인하였다.
그 결과, 도 12에 나타난 바와 같이, hSTC-1을 과발현시킨 간암세포에서 분비된 hSTC-1에 의해 LPS에 의해 유발되는 염증이 감소한 것을 확인하였다.
실시예 8: 염증 유도 대식세포에서 hSTC-1 처리에 의한 염증성 사이토카인 발현변화 확인
마우스 대식세포주 Raw264.7에 LPS(100ng/mL), hSTC-1(100ng/ml) 및 ATP(2mM)을 6시간 처리하여 NRLP3 활성화를 유도한 후, 염증성 사이토카인 IL-1beta, TNF, IL-6, Ccl2 및 TGF-beta의 발현변화를 실시예 3의 방법으로 qRT-PCR로 확인하였다.
그 결과, 도 13에 나타난 바와 같이, hSTC-1 처리에 의하여 LPS에 의해 유도된 염증이 감소하는 것을 확인하였다.
실시예 9: 염증 유도 대식세포에 hSTC-1을 농도별로 처리 시 항염효과 확인
마우스 대식세포주 Raw264.7에 LPS(100ng/mL) 및 hSTC-1을 각각 2ng/ml, 20ng/ml, 200ng/ml 처리하고, 염증반응을 촉진시키기 위해 ATP(2mM)을 6시간 처리하여 염증을 유도한 후, 염증성 사이토카인의 mRNA 발현 변화를 실시예 3의 방법으로 qRT-PCR로 확인하였다.
그 결과, 도 14에 나타난 바와 같이, 처리되는 hSTC-1의 농도에 비례하게(dose-dependently) 염증이 완화되는 것을 확인하였다.
본 발명에 따른 STC-1 단백질은 간섬유화 동물 모델에서 간 섬유화 마커인 ALT과 Lect2의 발현을 감소시키고, 섬유화 조직의 면적을 감소시켜, 간섬유증 더 나아가 간경화 등의 예방 및 치료에 뛰어난 효과를 가진다.
이상으로 본 발명 내용의 특정한 부분을 상세히 기술하였는바, 당업계의 통상의 지식을 가진 자에게 있어서 이러한 구체적 기술은 단지 바람직한 실시태양일 뿐이며, 이에 의해 본 발명의 범위가 제한되는 것이 아닌 점은 명백할 것이다. 따라서, 본 발명의 실질적인 범위는 첨부된 청구항들과 그것들의 등가물에 의하여 정의된다고 할 것이다.
전자파일 첨부하였음.

Claims (5)

  1. STC-1 또는 그 유도체를 유효성분으로 포함하는 간 질환 예방 또는 치료용 약학 조성물.
  2. 제1항에 있어서, 상기 간 질환은 간섬유증, 간경화증, 급성 간염, 만성 간염, 지방간 및 간암으로 구성된 군에서 선택되는 것을 특징으로 간 질환 예방 또는 치료용 약학 조성물.
  3. 제1항에 있어서, STC-1은 서열번호 1로 표시되는 아미노산 서열로 이루어진 것을 특징으로 하는 간 질환 예방 또는 치료용 약학 조성물.
  4. STC-1 또는 그 유도체를 유효성분으로 포함하는 간 질환 예방 또는 개선용 건강기능 식품.
  5. STC-1 또는 그 유도체를 유효성분으로 포함하는 간기능 개선용 건강기능 식품.
PCT/KR2022/011447 2021-08-03 2022-08-03 Stc-1 또는 그 유도체를 포함하는 간질환 예방 또는 치료용 조성물 WO2023014070A1 (ko)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US18/580,971 US20240325497A1 (en) 2021-08-03 2022-08-03 Composition for preventing or treating liver diseases, comprising stc-1 or derivative thereof

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR20210101932 2021-08-03
KR10-2021-0101932 2021-08-03

Publications (1)

Publication Number Publication Date
WO2023014070A1 true WO2023014070A1 (ko) 2023-02-09

Family

ID=85156238

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2022/011447 WO2023014070A1 (ko) 2021-08-03 2022-08-03 Stc-1 또는 그 유도체를 포함하는 간질환 예방 또는 치료용 조성물

Country Status (3)

Country Link
US (1) US20240325497A1 (ko)
KR (1) KR20230022806A (ko)
WO (1) WO2023014070A1 (ko)

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR101727506B1 (ko) * 2016-07-14 2017-05-04 충남대학교 산학협력단 Gdf15 단백질 또는 이를 암호화하는 폴리뉴클레오티드를 유효성분으로 함유하는 지방간의 예방 또는 치료용 약학적 조성물
KR20170135544A (ko) * 2016-05-31 2017-12-08 인하대학교 산학협력단 간질환 예방 또는 치료용 펩타이드 및 이를 유효성분으로 포함하는 조성물
KR20200089381A (ko) * 2019-01-16 2020-07-27 서울대학교산학협력단 12-lox 발현 촉진제를 포함하는 간 질환 예방 또는 치료용 조성물

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20170135544A (ko) * 2016-05-31 2017-12-08 인하대학교 산학협력단 간질환 예방 또는 치료용 펩타이드 및 이를 유효성분으로 포함하는 조성물
KR101727506B1 (ko) * 2016-07-14 2017-05-04 충남대학교 산학협력단 Gdf15 단백질 또는 이를 암호화하는 폴리뉴클레오티드를 유효성분으로 함유하는 지방간의 예방 또는 치료용 약학적 조성물
KR20200089381A (ko) * 2019-01-16 2020-07-27 서울대학교산학협력단 12-lox 발현 촉진제를 포함하는 간 질환 예방 또는 치료용 조성물

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
DATABASE Protein 7 February 2023 (2023-02-07), ANONYMOUS : "stanniocalcin-1 precursor [Homo sapiens]", XP093031952, retrieved from Genbank Database accession no. NP_003146 *
WALDERIK W. ZOMERMAN, SABINE L. A. PLASSCHAERT, SANDER H. DIKS, HARM-JAN LOURENS, TINY MEEUWSEN-DE BOER, EELCO W. HOVING, WILFRED : "Exogenous HGF Bypasses the Effects of ErbB Inhibition on Tumor Cell Viability in Medulloblastoma Cell Lines", PLOS ONE, vol. 10, no. 10, 1 January 2015 (2015-01-01), US , pages 1 - 16, XP055709757, ISSN: 1932-6203, DOI: 10.1371/journal.pone.0141381 *

Also Published As

Publication number Publication date
US20240325497A1 (en) 2024-10-03
KR20230022806A (ko) 2023-02-16

Similar Documents

Publication Publication Date Title
WO2015156649A1 (ko) 섬유증 억제 활성을 가지는 펩티드 및 이를 포함하는 조성물
WO2019103203A1 (ko) 신규 펩티드 및 이를 포함한 조성물
WO2015093854A1 (ko) 전립선 암 치료용 조성물
WO2012169798A2 (en) Novel oxyntomodulin derivatives and pharmaceutical composition for treating obesity comprising the same
WO2015167067A1 (ko) 장기, 조직 또는 세포 이식용 조성물, 키트 및 이식 방법
WO2016190660A1 (ko) 신규 펩티드 및 이를 포함한 조성물
WO2013180336A1 (ko) 15-히드록시프로타글란딘 디히드로게나제 및 ｐｇｅ2 활성을 조절하는 황칠나무 추출물의 용도
WO2021261632A1 (ko) 신규한 피칼리박테리움 프로스니치 균주 eb-fpdk11 및 그의 용도
WO2014200261A1 (ko) 혼합 생약 추출물을 유효성분으로 포함하는 항암용 조성물
WO2022131791A1 (ko) 다중구리 산화효소 펩타이드를 포함하는 구리대사 관련 신경계 질환의 예방 또는 치료용 조성물
WO2018074682A1 (ko) 항비만 및 항당뇨 효능을 갖는 펩타이드 및 이의 용도
WO2023014070A1 (ko) Stc-1 또는 그 유도체를 포함하는 간질환 예방 또는 치료용 조성물
WO2019022482A2 (ko) 황칠나무 추출물을 유효성분으로 포함하는 섬유화 질환의 예방 또는 치료용 조성물
WO2015163533A1 (ko) Ａｄｋ 단백질을 유효성분으로 포함하는 패혈증 또는 패혈증성 쇼크의 예방 또는 치료용 조성물
WO2020226438A1 (ko) 염증성 장질환의 예방 또는 치료용 펩타이드
WO2020116810A1 (ko) Ｆａｓ 신호전달 억제용 펩티드를 포함하는 비만, 지방간 또는 지방간염의 예방 또는 치료용 약학적 조성물
WO2018105998A1 (ko) 플라보노이드 유도체 화합물을 유효성분으로 함유하는 남성 불임증 예방 및 치료용 조성물 및 이의 용도
WO2016018090A1 (ko) 혈관신생촉진용 펩타이드 및 이의 용도
WO2017213435A1 (ko) Slit-robo 시스템을 이용한 근감소증 예방 또는 치료용 조성물
WO2021261631A1 (ko) 신규한 피칼리박테리움 프로스니치 eb-fpdk9 균주 및 그의 용도
WO2017111388A1 (ko) 페리오스틴 유래 펩타이드를 유효성분으로 포함하는 혈관신생 촉진용 조성물
WO2015111971A1 (ko) Gpr119 리간드를 유효성분으로 포함하는 비알콜성 지방간 질환의 예방 또는 치료용 약학적 조성물
WO2014051359A1 (ko) 네퍼린을 유효성분으로 포함하는 간암 예방 또는 치료용 약제학적 조성물
WO2023191384A1 (ko) 항염증 및 항섬유화 활성을 갖는 펩타이드 및 이의 용도
WO2023182567A1 (ko) 항당뇨 활성을 갖는 펩타이드, 펩타이드 복합체 및 이의 용도

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22853447

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 18580971

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 22853447

Country of ref document: EP

Kind code of ref document: A1