WO2023004425A2 - Cd3-expressing natural killer cells with enhanced function for adoptive immunotherapy - Google Patents

Cd3-expressing natural killer cells with enhanced function for adoptive immunotherapy Download PDF

Info

Publication number
WO2023004425A2
WO2023004425A2 PCT/US2022/074062 US2022074062W WO2023004425A2 WO 2023004425 A2 WO2023004425 A2 WO 2023004425A2 US 2022074062 W US2022074062 W US 2022074062W WO 2023004425 A2 WO2023004425 A2 WO 2023004425A2
Authority
WO
WIPO (PCT)
Prior art keywords
seq
composition
cells
tcr
intracellular signaling
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2022/074062
Other languages
English (en)
French (fr)
Other versions
WO2023004425A3 (en
Inventor
Enli LIU
Katy REZVANI
Rafet BASAR
Bin Liu
David MARIN COSTA
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of Texas System
University of Texas at Austin
Original Assignee
University of Texas System
University of Texas at Austin
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CA3227317A priority Critical patent/CA3227317A1/en
Priority to US18/290,898 priority patent/US20240325443A1/en
Priority to KR1020247006166A priority patent/KR20240041964A/ko
Priority to EP22846863.3A priority patent/EP4373501A4/en
Priority to IL310307A priority patent/IL310307A/en
Priority to MX2024001073A priority patent/MX2024001073A/es
Priority to AU2022315301A priority patent/AU2022315301A1/en
Priority to JP2024503984A priority patent/JP2024527879A/ja
Application filed by University of Texas System, University of Texas at Austin filed Critical University of Texas System
Priority to CN202280061681.5A priority patent/CN118055770A/zh
Publication of WO2023004425A2 publication Critical patent/WO2023004425A2/en
Publication of WO2023004425A3 publication Critical patent/WO2023004425A3/en
Priority to PCT/US2023/070687 priority patent/WO2024020537A2/en
Priority to JP2025503087A priority patent/JP2025524005A/ja
Priority to EP23843917.8A priority patent/EP4558152A2/en
Priority to CN202380060899.3A priority patent/CN119744173A/zh
Priority to US18/993,710 priority patent/US20260021183A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/14Blood; Artificial blood
    • A61K35/17Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39558Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/15Natural-killer [NK] cells; Natural-killer T [NKT] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/32T-cell receptors [TCR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/33Antibodies; T-cell engagers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/35Cytokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/421Immunoglobulin superfamily
    • A61K40/4211CD19 or B4
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4267Cancer testis antigens, e.g. SSX, BAGE, GAGE or SAGE
    • A61K40/4269NY-ESO
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4267Cancer testis antigens, e.g. SSX, BAGE, GAGE or SAGE
    • A61K40/427PRAME
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • C07K14/5443IL-15
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • C07K14/55IL-2
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/7051T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70521CD28, CD152
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2809Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0646Natural killers cells [NK], NKT cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0647Haematopoietic stem cells; Uncommitted or multipotent progenitors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/46Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
    • A61K2239/48Blood cells, e.g. leukemia or lymphoma
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/46Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
    • A61K2239/57Skin; melanoma
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2300/00Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00Genetically modified cells

Definitions

  • CD3-EXPRE SSIN G NATURAL KILLER CELLS WITH ENHANCED FUNCTION
  • This disclosure relates at least to the fields of immunology, cell biology, molecular biology, and medicine, including at least cancer medicine.
  • NK cells Natural killer (NK) cells have been studied as potential anti-tumor effectors, yet a number of barriers limit their therapeutic exploitation, mainly related to their lack of antigen specificity.
  • One approach to overcome this is to transduce NK cells with a chimeric antigen receptor (CAR) or an engineered T-cell receptor (TCR) to target a desired antigen.
  • CAR chimeric antigen receptor
  • TCR engineered T-cell receptor
  • T cells one can utilize a bispecific or multi-specific antibody, such as a bispecific T cell engager (BiTE) that binds CD3 on the surface of T cells and that also binds an antigen on the surface of cancer cells.
  • BiTE bispecific T cell engager
  • CD3 is composed of four distinct chains, and in mammals, the complex contains a CD3y chain, a CD3 ⁇ chain, and two CD3 ⁇ chains. These chains associate with the T-cell receptor (TCR) and the z-chain (zeta-chain) to generate an activation
  • the present disclosure satisfies a long-felt need in the art to improve upon immunotherapies including those that utilize NK cells.
  • Embodiments of the disclosure include methods and compositions for treatment of an individual with cancer using adoptive cell therapy.
  • the individual is provided a therapeutically effective amount of a bipartite therapy that includes both modified NK cells and antibodies that are capable of being able to bind the NK cells to initiate signaling, activation, and killing of target cells.
  • the disclosure concerns NK cells that have been modified to express multiple proteins that are not naturally expressed in NK cells and that work in conjunction together, including heterologous proteins on the surface of the NK cells that are naturally not present in NK cells.
  • NK cells are engineered to express one or more proteins from a CD3 co-receptor complex and optionally a TCR receptor complex, each normally present on the surface of T cells.
  • Such engineering provides greater versatility for the NK cells to be utilized in conjunction with a variety of bispecific or multi-specific antibodies, including those that comprise an anti-CD3 antibody (e.g, an anti-CD3 scFv).
  • the modified NK cells are administered to an individual in need thereof in conjunction with one or more bispecific or multi-specific antibodies each having one antibody that targets CD3 and one antibody that binds a desired antigen, such as a cancer antigen.
  • the NK cells expressing CD3 are able to bind the anti-CD3 antibody part of the bispecific or multi-specific antibody, and the antibody that binds a cancer antigen binds the cancer antigen on the surface of a cancer cell.
  • Such a coordinated binding between the NK cells and the antibody results in activation of cytotoxicity against the target cancer antigen.
  • the present disclosure concerns modified NK cells that express the full or partial CD3 complex with or without TCRs, and in some cases individual CD3 chain(s) are heterologously linked to an NK-relevant signaling domain, all of which allows the modified NK cells to be utilized with a variety of bispecific antibodies.
  • Embodiments of the disclosure include compositions comprising NK cells modified to express part or all of a single chain or any combination of CD3 ⁇ , CD3 ⁇ , CD3y, or CD3 ⁇
  • the NK cells are modified to express the T-cell receptor (TCR) ab chains or the TCR gd chains.
  • TCR T-cell receptor
  • the NK cells may be modified to express part or all of CD3 ⁇ , two of CD3 ⁇ , CD3 ⁇ , and CD3y.
  • the NK cells are modified to express full length of CD3 ⁇ , CD3 ⁇ , CD3 ⁇ , and/or CD3y.
  • any one or more of the CD3 ⁇ , CD3 ⁇ , CD3 ⁇ , and CD3y are heterologously linked to one or more intracellular signaling domains.
  • the intracellular signaling domain may be selected from the group consisting of CD 16, NKG2D, DAP10, DAP12, 2B4, 4-1BB, CD2, CD28 and a combination thereof. In some embodiments, an intracellular signaling domain is fused to CD3 ⁇ . In some embodiments, an intracellular signaling domain is derived from DAP 10. In some embodiments, an intracellular signaling domain is derived from CD28. In some embodiments, an intracellular signaling domain comprises a sequence derived from DAPIO and a sequence derived from CD28. In some embodiments, the intracellular signaling domain could also include other costimulatory signals relevant to NK cell function such as but not limited to, 2B4, DNA, 4-1BB, DAP12, NKG2D, etc.
  • the composition further comprises one or more bispecific or multi-specific antibodies, wherein the bispecific or multi-specific antibody comprises an anti- CD3 antibody.
  • the NK cells may express the antibody and/or are complexed with the antibody.
  • the TCR is directed to a cancer antigen or a viral antigen.
  • the NK cells are derived from cord blood (CB), peripheral blood (PB), bone marrow, stem cells, or a mixture thereof.
  • the TCR is directed to an NY- ESO antigen.
  • the TCR is directed to a PRAME antigen.
  • the NK cells may be pre-activated, such as with one or more cytokines, including IL-2, IL-7, IL-12, IL-15, IL-18, IL-21, or a combination thereof, for example.
  • the NK cells are expanded, such as in the presence of IL-2.
  • the NK cells are modified to express one or more heterologous proteins, such as one or more engineered antigen receptors, one or more cytokines, one or more homing receptors, and/or one or more chemokine receptors.
  • the engineered antigen receptor is a chimeric antigen receptor and/or engineered T cell receptor.
  • the heterologous protein is a cytokine, such as one selected from the group consisting of IL-15, IL-12, IL-2, IL-18, IL-21, IL-23, GMCSF, or a combination thereof.
  • the cytokine may be membrane-bound, and the membrane-bound cytokine may comprise a transmembrane domain from CD8, CD28, CD27, B7H3, IgGl, IgG4, CD4, DAP10, or DAP12.
  • the NK cell expresses a chimeric antigen receptor and a cytokine.
  • the bispecific antibody comprises an antibody that targets a cancer antigen.
  • Embodiments of the disclosure include compositions comprising a complex, comprising: (1) NK cells modified to express part or all of the CD3 receptor complex and optionally modified to express the T-cell receptor (TCR) ab chains or the TCR gd chains; and (2) a bispecific or multi-specific antibody, wherein the bispecific or multi-specific antibody comprises an anti-CD3 antibody that is bound to CD3 on the NK cells.
  • the complex is housed in a pharmaceutically acceptable excipient.
  • the complex may be housed in a delivery device.
  • the NK cells and the antibody are administered to the individual at the same time.
  • the NK cells and the antibody may or may not be administered in the same formulation.
  • the NK cells and the antibody may be pre-complexed prior to administration to the individual.
  • the NK cells and the antibody are administered to the individual at different times.
  • the NK cells and the antibody may be administered by infusion.
  • the NK cells are autologous or allogeneic with respect to the individual.
  • Embodiments of the disclosure include methods of redirecting the specificity of NK cells against a cancer antigen for treatment of an individual with a bispecific or multi-specific anti-CD3 antibody, comprising the steps of administering to the individual the antibody and NK cells that express part or all of the CD3 receptor complex and that optionally express part or all of TCR ab chains or the TCR gd chains.
  • the method further comprising the step of modifying NK cells to express part or all of the CD3 receptor complex.
  • the method further comprises the step of modifying NK cells to express the TCR ab chains or the TCR gd chains.
  • the method further comprises the step of modifying the NK cells to express one or more heterologous proteins.
  • FIG. 1A illustrates various embodiments of NK cells engineered to express CD3, including for use with a variety of heterologous proteins, such as cytokines, bi-specific NK cell engagers, and engineered antigen receptors (CAR and/or TCR).
  • FIG. 1B illustrates NK cells accommodated for CD3 and TCR for optimal cancer immunotherapy.
  • FIG. 1C illustrates examples of single chimeric CD3 constructions.
  • FIG. 2A illustrates one example of an expression construct for CD3 receptor complex components for transduction or transfection of NK cells.
  • FIG. 2B shows an example of a plasmid map for the representative expression construct.
  • FIG. 3 provides a table of various TCR/CD3 expression construct designs for NK- TCR engineering.
  • FIG. 4 shows CD3 expression at day 4 on engineered NK cells after transduction with one example of a CMV-directed TCR complex.
  • FIG. 5 demonstrates TCR expression at day 4 on engineered NK cells following CMV-directed TCR complex transduction.
  • FIG. 6 shows TCR/CD3 expression at day 6 on engineered NK cells after transduction of a CMV-directed TCR complex into the cells.
  • FIG. 7 demonstrates binding at different concentrations of one example of a CD3- CD19 BiTE on NK cells through the CD3/TCR complex on the NK cells.
  • FIG. 8 shows NK-TCR cytokine production of TNFa and CD107a after stimulation with plate-bound CD3 antibody.
  • FIG. 9 demonstrates phosphorylation of CD3z in NK TCR/CD3 cells after crosslinking CD3.
  • FIGS. 10A-10B show that pre-culturing CD3-CD19 BiTEs with TCR/CD3- expressing NK cells increased its killing activity against Raji cells.
  • FIG. 10A represents a 1:1 EffectonTarget ratio
  • FIG. 10B represents a 1:5 EffectonTarget ratio.
  • FIG. 11 provides a schematic overview of multiple retroviral transductions to generate NK cells expressing CD3, IL-15, and a TCR complex.
  • FIG. 12 shows expression of NY-ESO TCR on NK cells transduced with uTNKl 5.
  • WT refers to wild type CD3 molecules with IL-15;
  • A refers to CD3-CD28 with IL-15;
  • B refers to CD3-DAP10 with IL-15;
  • C refers to CD3-CD28-DaplO with IL-15.
  • FIG. 13 shows the number of TCR molecules per cell expressed on NK cells.
  • WT refers to wild type CD3 molecules with IL-15;
  • A refers to CD3-CD28 with IL-15;
  • B refers to CD3-DAP10 with IL-15;
  • C refers to CD3-CD28-DaplO with IL-15.
  • Phycoerythrin Fluorescence Quantitation Kit (BD Biosciences) was used to determine the number of molecules of NY-ESO TCR on NK cells.
  • FIG. 14 shows expression of NY-ESO TCR on T cells.
  • FIG. 15 shows that NK cells transduced with NY-ESO TCR kill NY-ESO peptide- pulsed target cells in a dose-dependent manner.
  • WT refers to wild type CD3 molecules with IL-15;
  • A refers to CD3-CD28 with IL-15;
  • B refers to CD3-DAP10 with IL-15;
  • C refers to CD3-CD28-DaplO with IL-15.
  • FIG. 16 demonstrates endogenous NY-ESO expression on human tumor cell lines.
  • FIG. 17 demonstrates that NY-ESO TCR transduced T cells kill NY-ESO expressing tumor targets.
  • FIG. 18 provides results that NY-ESO TCR transduced NK cells kill NY-ESO expressing tumor targets even at low E:T ratios.
  • WT refers to wild type CD3 molecules with IL-15;
  • A refers to CD3-CD28 with IL-15;
  • B refers to CD3-DAP10 with IL-15;
  • C refers to CD3-CD28-DaplO with IL-15.
  • FIGS. 19A and 19B show that NY-ESO transduced NK cells have a similar phenotype (19A) and expression pattern (19B) to NT NK cells.
  • WT refers to wild type CD3 molecules with IL-15;
  • A refers to CD3-CD28 with IL-15;
  • B refers to CD3-DAP10 with IL-15;
  • C refers to CD3-CD28-DaplO with IL-15.
  • FIG. 20 provides a table representing the cellular composition of the expanded uTNK15 product.
  • WT refers to wild type CD3 molecules with IL-15;
  • A refers to CD3-CD28 with IL-15;
  • B refers to CD3-DAP10 with IL-15;
  • C refers to CD3-CD28-DaplO with IL- 15.
  • FIG. 21A shows that NK cells can be successfully transduced with CD3 and TCR constant alpha-beta (TCRCab) (called TCR6 construct) and that the engineered NK cell can bind Blinatumumab (FIG. 2 IB) and selectively kill CD 19+ lymphoma targets (FIG. 21C).
  • FIGS. 22A-22C shows the in vivo activity of effector cells (e.g., NK cells, or T cells) comprising NY-ESO targeted TCRs.
  • FIG. 22A is a schematic outlining the experimental procedure performed.
  • FIG. 22A is a schematic outlining the experimental procedure performed.
  • FIG. 22B displays bioluminescent imaging over time (day 1, day 7, day 14, and day 21) for the mice engrafted with U266B.1 cells transduced with FireFlyluciferase (FFluc) and treated with control, NY-ESO TCR NK cells, or NY-ESO TCR T cells (NK cells comprising WT, #A, or #B UT-NK15-NY ESO TCR constructs respectively; WT refers to wild type CD3 molecules with IL-15; #A refers to CD3-CD28 with IL-15; and #B refers to CD3- DAPIO with IL-15).
  • FIG. 22C is a graphical quantification of the bioluminescence average radiance displayed in FIG 22B.
  • FIGS. 23A-B shows the in vitro activity of effector cells (e.g., NK cells or T cells) comprising NY-ESO targeted TCRs and UT-NK15 constructs.
  • FIG. 23A are images of spheroids formed by osteosarcoma tumor cell line Saos-2 stably transduced to express GFP that were used to test the activity of NY-ESO 1 -specific TCR expressing NK and T cells cytotoxicity.
  • FIG. 23B is a graph showing percentage of cytotoxicity (Y axis) for representative images after 3 days of co-culture.
  • NK cells were co-transduced with NY-ESO- TCR, and the UT-NK15 signaling complex co-expressing different co-stimulatory molecules fused to the CD3 ⁇ signaling chain or the TCR complex without IL-15.
  • T cells were only transduced with NY-ESO TCR.
  • 28 CD3 ⁇ fused to a CD28 co stimulatory domain
  • 10 CD3 ⁇ fused to a Dap 10 co-stimulatory domain
  • 8 CD8 alpha/beta co-receptor as part of the NY ESO TCR construct
  • wo IL-15 the construct only contains CD3 zeta, epsilon, gamma and delta TCR complex without co-stimulation or IL-15.
  • FIGS. 24A-D shows the in vivo activity of effector cells (e.g., NK cells or T cells) comprising NY-ESO targeted TCRs and UT-NK15 constructs.
  • FIG. 24A depicts a plan for an in vivo study to test the activity of different NY ESO TCR transduced NK and T cells.
  • FIG. 24B depicts BLI imaging results of the test outlined and performed according to FIG.
  • FIG. 24A depicts region of interest average radiance intensity for the animals tested according to FIG. 24A and imaged in FIG. 24B.
  • FIG. 24D is a graph depicting the cohort survival curves for the aforementioned animals.
  • FIG. 25 shows the in vivo activity of effector cells (e.g., NK cells) engineered to express NY ESO TCR and CD3 complex with or without IL-15 transgene comprised in the construct.
  • effector cells e.g., NK cells
  • NSG mice were irradiated (300 cGy) and the next day were injected with 500,000 U266 cells (HLA-A2 positive, NY-ESO-expressing myeloma cell line) via the tail vein. Three days later, mice received 5 million TCR transduced T or NK cells. Mice were monitored for tumor control by BLI imaging.
  • NK cells were transduced with NY-ESO-specific TCR with or without expression of CD8 alpha/beta co-receptors, co-transduced with CD3 complex without IL-15 transgene or withUT-NK15 expressing CD3 ⁇ fused to CD28 (UT-NK15 CD28) or CD3 ⁇ fused to DAP 10 (UT-NK15 DAP 10) co-stimulatory molecules.
  • FIGS. 26A-C shows in vitro expression of Preferentially Expressed Antigen in Melanoma (PRAME) TCRs on effector cells (e.g., NK cells or T cells) and the in vitro activity of said cells.
  • FIG. 26A shows the expression of both UT-NK15 (x-axis, CD3) and PRAME- specific TCRs (y-axis, TCR) in NK cells (TCR clones 46, 54, or DSK3 respectively), or the expression of PRAME-specific TCRs in T cells transduced with the same (TCR clones 46 or 54).
  • 26B shows the in vitro cytotoxicity of NK cells expressing a PRAME-specific TCR against the U266 myeloma cell line.
  • Incucyte live cell imaging was used to measure the cytotoxicity of T cells transduced with PRAME-specific TCR and NK cells transduced with UT-NKl 5 and PRAME-specific TCR against U266 myeloma cells.
  • GFP-expressing U266 cells were co-cultured with PRAME-specific TCR expressing T cell or NK cells at 1:1 effector : target ratio. A reduction in GFP expression indicated cell death.
  • a second round of 50,000 tumor cells was added (noted as “rechallenging”) to each well for the tumor rechallenge assay.
  • FIG. 26C shows the in vitro cytotoxicity of NK cells expressing a PRAME-specific TCR against the UA375 melanoma cell line. Incucyte live cell imaging was used to measure the cytotoxicity of T cells transduced with PRAME-specific TCR and NK cells transduced with UT-NK15 and PRAME-specific TCR (PRAME-specific TCR clone 46 (TCR-46), PRAME-specific TCR clone 54 (TCR-54), or PRAME-specific TCR clone DSK3 (DSK)) against UA375 melanoma cells.
  • PRAME-specific TCR clone 46 TCR-46
  • TCR-54 PRAME-specific TCR clone 54
  • DSK PRAME-specific TCR clone DSK3
  • x, y, and/or z can refer to “x” alone, “y” alone, “z” alone, “x, y, and z,” “(x and y) or z,” “x or (y and z),” or “x or y or z.” It is specifically contemplated that x, y, or z may be specifically excluded from an embodiment.
  • CD3 receptor complex or “CD3 co-receptor complex” refers to the protein complex that in nature acts as a T cell co-receptor and is comprised of CD3 ⁇ chain, CD3y chain, a CD35 chain, and two CD3e chains (although in alternatives only one CD3 ⁇ chain is used).
  • engineered refers to an entity that is generated by the hand of man, including a cell, nucleic acid, polypeptide, vector, and so forth.
  • an engineered entity is synthetic and comprises elements that are not naturally present or configured in the manner in which it is utilized in the disclosure.
  • a vector is engineered through recombinant nucleic acid technologies, and a cell is engineered through transfection or transduction of an engineered vector.
  • Cells may be engineered to express heterologous proteins that are not naturally expressed by the cells, either because the heterologous proteins are recombinant or synthetic or because the cells do not naturally express the proteins.
  • phrases “pharmaceutical or pharmacologically acceptable” refers to molecular entities and compositions that do not produce an adverse, allergic, or other untoward reaction when administered to an animal, such as a human, as appropriate.
  • the preparation of a pharmaceutical composition comprising an antibody or additional active ingredient will be known to those of skill in the art in light of the present disclosure.
  • animal (e.g ., human) administration it will be understood that preparations should meet sterility, pyrogenicity, general safety, and purity standards as required by FDA Office of Biological Standards.
  • “pharmaceutically acceptable carrier” includes any and all aqueous solvents (e.g., water, alcoholic/aqueous solutions, saline solutions, parenteral vehicles, such as sodium chloride, Ringer's dextrose, etc.), non-aqueous solvents (e.g, propylene glycol, polyethylene glycol, vegetable oil, and injectable organic esters, such as ethyloleate), dispersion media, coatings, surfactants, antioxidants, preservatives (e.g, antibacterial or antifungal agents, anti-oxidants, chelating agents, and inert gases), isotonic agents, absorption delaying agents, salts, drugs, drug stabilizers, gels, binders, excipients, disintegration agents, lubricants, sweetening agents, flavoring agents, dyes, fluid and nutrient replenishers, such like materials and combinations thereof, as would be known to one of ordinary skill in the art.
  • aqueous solvents e.g., water
  • the term “subject,” as used herein, generally refers to an individual having a that has or is suspected of having cancer.
  • the subject can be any organism or animal subject that is an object of a method or material, including mammals, e.g, humans, laboratory animals (e.g, primates, rats, mice, rabbits), livestock (e.g, cows, sheep, goats, pigs, turkeys, and chickens), household pets (e.g, dogs, cats, and rodents), horses, and transgenic non-human animals.
  • the subject can be a patient, e.g, have or be suspected of having a disease (that may be referred to as a medical condition), such as benign or malignant neoplasias, or cancer.
  • the subject may being undergoing or having undergone treatment.
  • the subject may be asymptomatic.
  • the subject may be healthy individuals but that are desirous of prevention of cancer.
  • the term “individual” may be used interchangeably, in at least some cases.
  • the “subject” or “individual”, as used herein, may or may not be housed in a medical facility and may be treated as an outpatient of a medical facility.
  • the individual may be receiving one or more medical compositions via the internet.
  • An individual may comprise any age of a human or non-human animal and therefore includes both adult and juveniles (i.e., children) and infants and includes in utero individuals.
  • treatment includes any beneficial or desirable effect on the symptoms or pathology of a disease or pathological condition, and may include even minimal reductions in one or more measurable markers of the disease or condition being treated, e.g ., cancer. Treatment can involve optionally either the reduction or amelioration of one or more symptoms of the disease or condition, or the delaying of the progression of the disease or condition. “Treatment” does not necessarily indicate complete eradication or cure of the disease or condition, or associated symptoms thereof. Treating may mean alleviation of at least one symptom of the disease or condition.
  • TCR/CD3 complex refers to a protein complex naturally found on the surface of T cells and that comprises T-cell receptor a and b chains and/or a T-cell receptor g and d chains, in addition to CD3 ⁇ , CD3y, CD3 ⁇ , and CD3 ⁇ chains.
  • Natural killer (NK) cells are an emerging cellular immunotherapy for patients with malignant hematologic disease, as well as solid tumors.
  • the present disclosure specifically relates to NK cells that have been modified to render the NK cells to have enhanced function as an immunotherapy compared to NK cells not so modified.
  • the modifications allow for the NK cells to have greater versatility when used with other therapeutic agents and at least in some embodiments to have T cell-like activity by utilizing the CD3/TCR receptor complex.
  • the NK cells are modified to express (i) either a single CD3 chain (CD3zeta, CD3 epsilon, CD3 delta, or CD3 gamma) or part or all of the human CD3 receptor complex (including any combination of CD3 delta, epsilon (one or two copies of epsilon), gamma, and zeta); or (ii) either a single CD3 chain or the human CD3 receptor complex (including any combination of CD3 delta, epsilon (one or two molecules), gamma, and zeta) as a full length protein or as a partial protein heterologously linked to one or more intracellular signaling domains); and (iii) the CD3 complex may or may not include the T-cell receptor (ab or gd).
  • a single CD3 chain CD3zeta, CD3 epsilon, CD3 delta, or CD3 gamma
  • the human CD3 receptor complex including any combination of CD3 delta, e
  • the disclosure concerns the use of CD3 -expressing NK cells in the diagnosis and treatment of disease, including use of the cells in combination with bispecific or multi-specific antibodies in which one epitope of the antibody binds CD3 on the CD3 -expressing NK cells).
  • the CD3 -expressing NK cells can either be pre-complexed ex vivo with the bi/multi-specific antibody to redirect their specificity toward the target antigen and/or combined in vivo.
  • labeled NK cells may be loaded with bispecific or multi-specific antibodies of any kind, including that comprise at least an anti-CD3 antibody, and the loaded, labeled NK cells may be monitored for trafficking to the site of the target antigen for which another antibody on the bispecific or multi-specific antibody binds.
  • compositions that at least include modified NK cells that express at least parts of the TCR/CD3 complex.
  • the compositions also include bispecific or multi-specific antibodies, including in the same formulation, although in alternative embodiments the NK cells and antibodies are utilized as physically separate compositions.
  • compositions that comprise NK cells that have been modified by the hand of man to express part or all of the TCR receptor complex and part or all of the CD3 co-receptor complex.
  • the NK cells are modified to include all components of the CD3 complex, including CD3 ⁇ , CD3 ⁇ , CD3y and CD3 ⁇ .
  • CD 3z, CD3 ⁇ , CD3y and CD3 ⁇ are utilized, including their extracellular domain, transmembrane domain, and intracellular domain
  • CD3 ⁇ , CD3 ⁇ , CD3y and CD3 ⁇ are utilized each of which that may or may not be combined with one or more intracellular signaling domains such as CD16, NKG2D, DAP10, DAP12, CD28, 41BB, 2B4, CD27, 0X40, or any combination thereof.
  • the NK cells may also be modified to express the TCR receptor complex, although in alternative embodiments none of the TCR receptor complex components are utilized.
  • an amino acid sequence may comprise an amino acid represented by a single letter “X” or a three letter code “Xaa”.
  • the amino acid represented by “X” or “Xaa” is any naturally occurring amino acid, such as but not limited to, Arginine (Arg, R), Histidine (His, H), Lysine (Lys, K), Aspartic Acid (Asp, D), Glutamic Acid (Glu, E), Serine (Ser, S), Threonine (Thr, T), Asparagine (Asn, N), Glutamine (Gin, Q), Glycine (Gly, G), Proline (Pro, P), Cysteine (Cys, C), Alanine (Ala, A), Valine (Val, V), Isoleucine (lie, I), Leucine (Leu, L), Methionine (Met, M), Phenylalanine (Phe, F), Tyrosine (Ty
  • the amino acid represented by “X” or “Xaa” in SEQ ID NO: 25 or SEQ ID NO: 88 is Arginine (Arg, R). In some embodiments, the amino acid represented by “X” or “Xaa” in SEQ ID NO: 25 or SEQ ID NO: 88 is Histidine (His, H). In some embodiments, the amino acid represented by “X” or “Xaa” in SEQ ID NO: 25 or SEQ ID NO: 88 is Lysine (Lys, K). In some embodiments, the amino acid represented by “X” or “Xaa” in SEQ ID NO: 25 or SEQ ID NO: 88 is Aspartic Acid (Asp, D).
  • the amino acid represented by “X” or “Xaa” in SEQ ID NO: 25 or SEQ ID NO: 88 is Glutamic Acid (Glu, E).
  • the amino acid represented by “X” or “Xaa” in SEQ ID NO: 25 or SEQ ID NO: 88 is Serine (Ser, S).
  • the amino acid represented by “X” or “Xaa” in SEQ ID NO: 25 or SEQ ID NO: 88 is Threonine (Thr, T).
  • the amino acid represented by “X” or “Xaa” in SEQ ID NO: 25 or SEQ ID NO: 88 is Asparagine (Asn, N).
  • the amino acid represented by “X” or “Xaa” in SEQ ID NO: 25 or SEQ ID NO: 88 is Glutamine (Gin, Q). In some embodiments, the amino acid represented by “X” or “Xaa” in SEQ ID NO: 25 or SEQ ID NO: 88 is Glycine (Gly, G). In some embodiments, the amino acid represented by “X” or “Xaa” in SEQ ID NO: 25 or SEQ ID NO: 88 is Proline (Pro, P). In some embodiments, the amino acid represented by “X” or “Xaa” in SEQ ID NO: 25 or SEQ ID NO: 88 is Cysteine (Cys, C).
  • the amino acid represented by “X” or “Xaa” in SEQ ID NO: 25 or SEQ ID NO: 88 is Alanine (Ala, A). In some embodiments, the amino acid represented by “X” or “Xaa” in SEQ ID NO: 25 or SEQ ID NO: 88 is Valine (Val, V). In some embodiments, the amino acid represented by “X” or “Xaa” in SEQ ID NO: 25 or SEQ ID NO: 88 is Isoleucine (lie, I). In some embodiments, the amino acid represented by “X” or “Xaa” in SEQ ID NO: 25 or SEQ ID NO: 88 is Leucine (Leu, L).
  • the amino acid represented by “X” or “Xaa” in SEQ ID NO: 25 or SEQ ID NO: 88 in SEQ ID NO: 25 or SEQ ID NO: 88 is Methionine (Met, M).
  • the amino acid represented by “X” or “Xaa” in SEQ ID NO: 25 or SEQ ID NO: 88 is Phenylalanine (Phe, F).
  • the amino acid represented by “X” or “Xaa” in SEQ ID NO: 25 or SEQ ID NO: 88 is Tyrosine (Tyr, Y).
  • the amino acid represented by “X” or “Xaa” in SEQ ID NO: 25 or SEQ ID NO: 88 is Tryptophan (Trp, W).
  • sequences for any of the CD3 receptor components are utilized, including wildtype or mutants of the components so long as the CD3 receptor having the mutant is able to allow signaling through the CD3 complex leading to activation and killing of targets.
  • sequences for CD3 ⁇ , CD3 ⁇ , CD3y, and CD3 ⁇ are utilized for modification of the NK cells.
  • CD3 Epsilon (UniProtKB - P07766 (CD3E HUMAN)) [0059] Signal Peptide
  • CD3E Homo sapiens CD3e molecule
  • mRNA is at NCBI Reference Sequence: GENBANK® Accession No. NM_000733.4
  • nucleic acid and amino acid CD3 epsilon sequences in their entirety are as follows (underlining refers to signal peptide sequence):
  • CD3 Delta (UniProtKB - P04234 (CD3D HUMAN))
  • GIIVTDVIATLLLALGVFCFA SEQ ID NO: 8
  • nucleic acid and amino acid CD3 delta sequences in their entirety are as follows (underlining refers to signal peptide sequence):
  • CD3 Gamma T-cell surface glycoprotein CD3 gamma chain Gene CD3G P09693
  • CD3g molecule (CD3G), mRNA; NM_000073.3:81-629 Homo sapiens CD3g molecule (CD3G), mRNA
  • nucleic acid and amino acid CD3 gamma sequences in their entirety are as follows (underlining refers to signal peptide sequence):
  • nucleic acid and amino acid CD3 zeta sequences in their entirety are as follows (underlining refers to signal peptide sequence):
  • CD247 also referred to as CD3 Zeta
  • transcript variant 1 mRNA NCBI Reference Sequence: NM_198053.3
  • NM_198053.3:65-559 Homo sapiens CD247 molecule (CD247), transcript variant 1, mRNA
  • the NK cells are modified to express one of more of the TCRa chain, the TCR ⁇ chain, the TCRy chain, and the TCR ⁇ chain, and any combination thereof may be utilized.
  • the NK cells are modified to express the T-cell receptor (TCR) ab chains or the TCR y ⁇ chains.
  • the NK cells are modified to express part or all of only the constant region of one of more of the TCR ⁇ chain, the TCR ⁇ chain, the TCRy chain, and the TCR ⁇ chain.
  • the NK cells may be modified to express part or all of only the constant region of the T-cell receptor (TCR) ⁇ chains or the TCR gd chains.
  • the part of the constant region may be at least 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, or 400 amino acids, including contiguous amino acids of any constant region.
  • the part of the constant region may comprise at least 50, 55, 60, 65, 70, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% of the amino acids of a constant region, including contiguous amino acids of a constant region.
  • any sequences encompassed herein are utilized to modify the NK cells, although in other cases sequences that are related to these in identity are utilized.
  • related sequences that are at least 80, 85, 90, 95, 96, 97, 98, 99% identical to any sequence encompassed herein may be utilized in the disclosure.
  • the NK cells may be transduced or transfected with one or more vectors to express any of the various proteins encompassed herein, including at least any one or more components of the TCR/CD3 complex.
  • the one or more vectors themselves may or may not be multi cistronic by being able ultimately to produce more than one separate polypeptide.
  • the multi cistronic vectors may utilize one or more internal ribosome entry sites (IRES) and/or one or more 2A self-cleaving peptide sites.
  • IRS internal ribosome entry sites
  • 2A sequences the following may be used, where GSG is an optional linker: [0088] T2A ( GSG) EGRGSLLTCGDVEENPGP ( SEQ ID NO : 21 )
  • P2A GSG
  • ATNFSLLKQAGDVEENPGP SEQ ID NO : 22
  • E2A GSG
  • QCTNYALLKLAGDVESNPGP SEQ ID NO : 23
  • F2A GSG
  • VKQTLNFDLLKLAGDVESNPGP SEQ ID NO : 24
  • the order in a 5’ to 3’ direction on the polynucleotide vector may be of any order, although in alternative cases they are present on the vector in a particular order.
  • a multi cistronic vector may express multiple components of the CD3 receptor complex and no other heterologous protein, or the multi cistronic vector may express multiple components of the CD3 receptor complex and one or more other heterologous proteins.
  • a multi cistronic vector may express multiple components of the TCR receptor complex and no other heterologous protein, or the multi cistronic vector may express multiple components of the TCR receptor complex and one or more other heterologous proteins.
  • a multi cistronic vector may or may not express one or more multiple components of the TCR receptor complex and one or more multiple components of the CD3 complex.
  • a multi cistronic vector includes one or multiple components of the CD3 receptor complex and one or more heterologous proteins, such as a cytokine and an engineered antigen receptor, such as a CAR.
  • FIG. 2A of a multi cistronic vector in which full lengths of CD3 ⁇ , CD3 ⁇ , CD3y, and CD3 ⁇ are present and separated by the same or different 2A self- cleaving peptide sites.
  • a multi cistronic vector may include the signal peptide, extracellular domain, transmembrane domain, and intracellular domain of each of CD3 ⁇ , CD3 ⁇ , CD3y, and CD3 ⁇ .
  • FIG. 3 provides a table showing examples of various TCR expression constructs for engineering of TCR-expressing NK cells.
  • CD3 receptor components and TCR receptor components are expressed from different vectors in the NK cells.
  • the vector(s) may express a TCR directed against a particular antigen, such as a cancer antigen or a viral antigen.
  • the TCR may or may not comprise at least part of CD3 ⁇ , including the intracellular domain of CD3 ⁇ , in addition to the NK cells also expressing CD3 ⁇ as a separate molecule from the TCR and as part of the CD3 receptor complex.
  • a CAR may or may not comprise at least part of CD3 ⁇ , including the intracellular domain of CD3 ⁇ , in addition to the NK cells also expressing CD3 ⁇ as a separate molecule from the TCR and as part of the CD3 receptor complex.
  • a TCR of the modified NK cells is utilized not necessarily as a therapeutic aspect for the cells but as a structural support or scaffold to facilitate function or enhanced function of the CD3 receptor complex. That is, the TCR may be any TCR and may not be utilized for its ability to target a particularly desired antigen. In such cases, and as an example, a TCR that targets a viral antigen may be employed for NK cells that will be used for cancers that are not necessarily related to that particular virus. In other cases, the TCR is selected for the ability to target a particular cancer antigen. Examples of antigens to which the TCR may be directed are provided elsewhere herein.
  • TCR1 refers to TCRpp65 (the TCR against the HLA-A2 restricted CMVpp65) linked to the intracellular CD3zeta domain and full length CD3 gamma, full length CD3 delta, and full length CD3 epsilon, and the construct may also be referred to as TCRpp65ZicdGDEFL that may comprise the following sequence:
  • TCRpp65ZicdGDEFL the corresponding component sequences are as follows, although these particular sequences or others may be utilized in this and/or other constructs: [0099] TCRb-extracellular domain. MLEGVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDQGEVP NGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASSPVTGGI YGYTFGSGTRLTW EDLNKVFPP EVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALND SRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD (SEQ ID NO: 40)
  • CD3 zeta intracellular domain Z-ICD
  • CD3 gamma delta epsilon CD3GDE:
  • IL-15 MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIED LIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDAS IHDTVENLIILANNSLSS NGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS* (SEQ ID NO: 48)
  • TCR2 refers to TCRpp65 linked to full length CD3zeta, full length CD3 gamma, full length CD3 delta, and full length CD3 epsilon; it lacks IL-15. Representative sequences are as follows:
  • TCR3 refers to TCRpp65 linked to the intracellular CD3z domain and IL-15, and it may also be referred to as TCRpp65Zicdl5, with a representative sequence as follows:
  • TCRpp65Zicdl5 the corresponding component sequences are as follows, although these particular sequences or others may be utilized in this and/or other constructs: [0107] TCRb-extracellular domain:
  • CD3 zeta intracellular domain Z-ICD
  • CD 3 zeta intracellular domain (Z-ICD)(m specific embodiments, two or more Z-
  • ICD sequences may be utilized):
  • TCR4 refers to TCRpp65 that also may be referred to as TCRpp65betaalpha, and a representative sequence is as follows:
  • TCRpp65betaalpha the corresponding component sequences are as follows, although these particular sequences or others may be utilized in this and/or other constructs: [0114] TCRb-extracellular domain:
  • CD 3 ze ta intracellular domain (Z-ICD ) :
  • TCRa-extracellular domain [0116]
  • CD3 zeta intracellular domain Z-ICD
  • IL-15 MRI SKPHLRS I S IQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVI SDLKKIED LIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVI SLESGDAS IHDTVENLI ILANNSLSS NGNVTESGCKECEELEEKNIKEFLQS FVHIVQMFINTS * ( SEQ ID NO : 48 )
  • Zl refers to full length CD3zeta, full length CD3 gamma, full length CD3 delta, and full length CD3 epsilon linked to IL15 (see FIGS. 2A and 2B), and it may also be referred to as CD3ZFLGDEFL15, and representative sequences may be as follows:
  • Z2 refers to full length CD3zeta, full length CD3 gamma, full length CD3 delta, and full length CD3 epsilon linked to membrane bound IL21 (with CD8 transmembrane domain for the membrane bound IL21), and it may also be referred to as
  • CD3ZGDEFLSP821CD28 CD3ZGDEFLSP821CD28, and a representative sequence is as follows:
  • CD3ZGDEFLSP821CD28 the corresponding component sequences are as follows, although these particular sequences or others may be utilized in this and/or other constructs:
  • HKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKS ANTGNNERI INVS IKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMI HQHLSSRTHGSEDS SEQ ID NO : 65
  • CD8 hinge [0126]
  • TTTPAPRPPTPAPT IASQPLSLRPEACRPAAGGAVHTRGLDFACD SEQ ID NO : 67
  • Z3 refers to full length CD3zeta, full length CD3 gamma, full length CD3 delta, and full length CD3 epsilon linked to membrane bound IL21 (with CD28 transmembrane domain for the membrane bound IL21), and it may also be referred to as CD3ZGDEFL8SP21CD8 with a representative sequence as follows: MLEMKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDG ILFIYGVILTALFLRVKFSRSA DAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAE AYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRQCTNYALLKLAGDVESNPG PMEQGKGLAVLILAIILLQGTLAQS IKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKM IGFLTEDKKKWNLGS
  • CD3ZGDEFL8SP21CD8 the corresponding component sequences are as follows, although these particular sequences or others may be utilized in this and/or other constructs:
  • MRICLTSDRLAPAAGLAAPRRQAV (SEQ ID NO: 63) atgcgcatttgcctgaccagcgatcgcctggcgccggcggcgggcctggcggcgccgcgccg ccaggcggtg (SEQ ID NO: 64)
  • CD8 hinge [0133] CD8 hinge:
  • TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD (SEQ ID NO: 67) ACCACGACGCCAGCGCCGCGACCACCAACACCGGCGCCCACCATCGCGTCGCAGCCCCTGTC CCTGCGCCCAGAGGCGTGCCGGCCAGCGGCGGGGGGCGCAGTGCACACGAGGGGGCTGGACT TCGCCTGTGAT (SEQ ID NO: 68)
  • CD3 constructs comprising a fusion with an intracellular co-stimulatory domain derived from CD 16, NKG2D, DAP 10, DAP 12, 2B4, 4- IBB, CD2, CD28, DNAM, or any combination thereof.
  • an intracellular co-stimulatory domain is fused to CD3 ⁇ , CD3 ⁇ , CD3y, and/or CD3 ⁇ .
  • such a CD3 fusion construct comprises a CD3 ⁇ fused to a DAP 10 intracellular co-stimulatory domain.
  • such a CD3 fusion construct comprises a CD3 ⁇ fused to a CD28 intracellular co-stimulatory domain.
  • such a CD3 fusion construct comprises a CD3 ⁇ fused to a DAP 10 intracellular co-stimulatory domain and a CD28 intracellular co-stimulatory domain.
  • a CD3 ⁇ fused to a DAP 10 intracellular co-stimulatory domain is represented by a nucleotide sequence that is at least, or exactly, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 106.
  • a CD3 ⁇ fused to a CD28 intracellular co-stimulatory domain is represented by a nucleotide sequence that is at least, or exactly, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 107.
  • a CD3 ⁇ fused to a DAP10 intracellular co-stimulatory domain and a CD28 intracellular co-stimulatory domain is represented by a nucleotide sequence that is at least, or exactly, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 108.
  • a CD3 ⁇ fused to a DAP10 intracellular co-stimulatory domain is represented by an amino acid sequence that is at least, or exactly, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 109.
  • a CD3 ⁇ fused to a CD28 intracellular co-stimulatory domain is represented by an amino acid sequence that is at least, or exactly, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 110.
  • a CD3 ⁇ fused to a DAP 10 intracellular co-stimulatory domain and a CD28 intracellular co stimulatory domain is represented by an amino acid sequence that is at least, or exactly, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 111.
  • a CD3 ⁇ fused to an intracellular domain may not comprise a C terminal 2A domain.
  • a CD3 ⁇ fused to an intracellular domain may not comprise an N terminal signal peptide domain.
  • a DAP 10 intracellular co-stimulatory domain is represented by a nucleotide sequence that is at least, or exactly, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 112.
  • a CD28 intracellular co-stimulatory domain is represented by a nucleotide sequence that is at least, or exactly, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 113.
  • a DAP10 intracellular co-stimulatory domain and CD28 intracellular co-stimulatory domain is represented by a nucleotide sequence that is at least, or exactly, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 114.
  • a DAP10 intracellular co-stimulatory domain is represented by an amino acid sequence that is at least, or exactly, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 115.
  • a CD28 intracellular co-stimulatory domain is represented by an amino acid sequence that is at least, or exactly, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 116.
  • a DAP10 intracellular co-stimulatory domain and CD28 intracellular co-stimulatory domain is represented by an amino acid sequence that is at least, or exactly, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 117.
  • CTTTGCGCACGCCCACGCCGCAGCCCCGCCCAAGAAGATGGCAAAGTCTACATCAACATGCC AGGCAGGGGC SEQ ID NO: 112
  • UTNK15-DAP 10 refers to full length CD3zeta comprising a fusion with an intracellular co- stimulatory domain derived from DAP 10, full length CD3 gamma, full length CD3 delta, and full length CD3 epsilon linked to IL15, it may be represented by a nucleotide sequence that is at least, or exactly, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 118.
  • a UTNK15-DAP10 amino acid sequence may be represented by an amino acid sequence that is at least, or exactly, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 119.
  • a UTNK 15-28 amino acid sequence may be represented by an amino acid sequence that is at least, or exactly, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 121
  • UTNK15-28-DAP10 refers to full length CD3zeta comprising a fusion with an intracellular co- stimulatory domain derived from DAP 10 and an intracellular co-stimulatory domain derived from CD28, full length CD3 gamma, full length CD3 delta, and full length CD3 epsilon linked to IL15, it may be represented by a nucleotide sequence that is at least, or exactly, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 122.
  • a UTNK15-28-DAP10 amino acid sequence may be represented by an amino acid sequence that is at least, or exactly, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 123.
  • the term “linked” refers to being present on the same polynucleotide vector and does not necessarily mean that the two polypeptides are expressed as one polypeptide.
  • a cytokine produced from a vector of the disclosure may ultimately be produced as a separate molecule from any one or more TCR/CD3 receptor complex components.
  • the term “fused” or “fusion” refers to two polypeptides that comprise a peptide bond conjoining the two molecules, i.e. that the two polypeptides are covalently bound by an amide bond and are not separated by a splitting element, such as a 2A element.
  • TCR One specific example of a TCR that may be utilized in the cells is NY-ESO TCR, and specific examples of sequences include at least the following:
  • a TCR may comprise a TCR alpha chain variable region encoded by a nucleotide sequence that is at least, or exactly, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 85.
  • a TCR may comprise a TCR alpha chain constant region encoded by a nucleotide sequence that is at least, or exactly, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 86.
  • a TCR may comprise a TCR alpha chain encoded by a nucleotide sequence that is at least, or exactly, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 87.
  • a TCR may comprise a TCR alpha chain variable region amino acid sequence that is at least, or exactly, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 88.
  • a TCR may comprise a TCR alpha chain constant region amino acid sequence that is at least, or exactly, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 89.
  • a TCR may comprise an alpha chain CDR1 amino acid sequence that is at least, or exactly, 80% or 100% identical to SEQ ID NO: 90.
  • a TCR may comprise an alpha chain CDR2 amino acid sequence that is at least, or exactly, 80% or 100% identical to SEQ ID NO: 91.
  • a TCR may comprise an alpha chain CDR3 amino acid sequence that is at least, or exactly, 80% or 100% identical to SEQ ID NO: 92.
  • a TCR may comprise a TCR beta chain variable encoded by a nucleotide sequence that is at least, or exactly, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 93.
  • a TCR may comprise a TCR beta chain constant region encoded by a nucleotide sequence that is at least, or exactly, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 94.
  • a TCR may comprise a TCR beta chain encoded by a nucleotide sequence that is at least, or exactly, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 95.
  • a TCR may comprise a TCR beta chain variable region amino acid sequence that is at least, or exactly, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 96.
  • a TCR may comprise a TCR beta chain constant region amino acid sequence that is at least, or exactly, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 97.
  • a TCR may comprise a beta chain CDR1 amino acid sequence that is at least, or exactly, 80% or 100% identical to SEQ ID NO: 98.
  • a TCR may comprise a beta chain CDR2 amino acid sequence that is at least, or exactly, 80% or 100% identical to SEQ ID NO: 99.
  • a TCR may comprise a beta chain CDR3 amino acid sequence that is at least, or exactly, 80% or 100% identical to SEQ ID NO: 100.
  • a TCR (e.g., a TCR alpha, beta, delta, and/or gamma) chain may comprise a signal peptide.
  • a signal peptide is encoded by a nucleic acid that is at least, or exactly 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%,
  • a signal peptide is at least, or exactly, 80%, 81%,
  • MSIGLLCCAALSLLWAGPVNA SEQ ID NO: 1044
  • a TCR recognizes a peptide corresponding to amino acid residues 157-165 of the human cancer testis Ag NY-ESO-1 in the context of the HLA-A*02 class I allele.
  • a TCR may target an epitope characterized by the amino acid sequence according to SEQ ID NO: 105.
  • TCRpp65alpha TCRpp65alpha
  • sequences include at least the following (underlining refers to signal peptide sequence):
  • MDSWTFCCVSLCILVAKHTDAGQQLNQSPQSMFIQEGEDVSMNCTSSS I FNTWLWYKQDPGE GPVLLIALYKAGELTSNGRLTAQFGI TRKDS FLNI SAS I PSDVGI YFCAGPMKTSYDKVI FG PGTSLSVI PNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYI TDKTVLDMR SMDFKSNSAVAWSNKSDFACANAFNNS I I PEDTFFPSPESSCDVKLVEKS FETDTNLNFQNL SVIGFRILLLKVAGFNLLMTLRLWSS ( SEQ ID NO : 28 )
  • TCRpp65beta One specific example of a TCR that may be utilized in the cells is TCRpp65beta, and specific examples of sequences include at least the following (underlining refers to signal peptide sequence):
  • MDSWTFCCVSLCILVAKHTDAGVIQSPRHEVTEMGQEVTLRCKP I S GHDYL FWYRQTMMRGL ELLI YFNNNVPIDDSGMPEDRFSAKMPNAS FSTLKIQPSEPRDSAVYFCASSSANYGYTFGS GTRLTWEDLNKVFPPEVAVFEPSEAE I SHTQKATLVCLATGFFPDHVELSWWVNGKEVHSG VSTDPQPLKEQPALNDSRYCLSSRLRVSAT FWQNPRNHFRCQVQFYGLSENDEWTQDRAKPV TQIVSAEAWGRADCGFTSVSYQQGVLSAT ILYE ILLGKATLYAVLVSALVLMAMVKRKDF ( SEQ ID NO : 30 )
  • TCRpp65ZFLGDEFL15 One representative sequence for such a construct is as follows:
  • TCR5 referred to TCRCgdZFLGDEFL15, is the constant region of TCR gamma and delta, linked to full length CD3zeta, full length CD3 gamma, full length CD3 delta, and full length CD3 epsilon; and IL-15.
  • Representative sequences are as follows:
  • TCR constant gamma-delta (TCRCgd)
  • TCR6 also referred to TCRCabZFLGDEFL15, is the constant region of TCR alpha and beta, linked to full length CD3zeta, full length CD3 gamma, full length CD3 delta, and full length CD3 epsilon; and IL-15. Representative sequences are as follows:
  • TCR constant alpha-beta (TCRCab)
  • a TCR construct comprises an NY-ESO-specific TCR and a CD8 alpha/beta co-receptor molecule.
  • such a construct can comprise a TCR alpha chain variable region signal peptide, a TCR alpha chain variable region, a TCR alpha chain constant region, a 2 A element (e.g., P2A element), a TCR beta chain variable region signal peptide, a TCR beta chain variable region, a TCR beta chain constant region, a 2A element (e.g., a E2A element), a CD8-beta polypeptide, a 2A element (e.g., a T2A element), and a CD8-alpha polypeptide.
  • a TCR construct comprising an NY-ESO- specific TCR and a CD8 alpha/beta co-receptor molecule nucleotide coding sequence is at least, or exactly, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, identical to SEQ ID NO: 124.
  • a TCR construct comprising an NY-ESO-specific TCR and a CD8 alpha/beta co-receptor molecule amino acid sequence is at least, or exactly, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, identical to SEQ ID NO: 125.
  • a CD8 alpha co-receptor molecule is transcriptionally linked to any TCR molecule disclosed herein.
  • a CD8 alpha co-receptor molecule nucleotide coding sequence is at least, or exactly, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, identical to SEQ ID NO: 126.
  • a CD8 beta co-receptor molecule nucleotide coding sequence is at least, or exactly, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, identical to SEQ ID NO: 127.
  • a CD8 alpha co-receptor amino acid sequence is at least, or exactly, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, identical to SEQ ID NO: 128.
  • a CD8 beta co-receptor amino acid sequence is at least, or exactly, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, identical to SEQ ID NO: 129.
  • a TCR construct comprises PRAME-specific TCR chains.
  • a TCR construct comprising PRAME-specific TCR chains comprises TCR alpha and TCR beta chains found in PRAME-specific TCR clone 46, clone 54, and/or clone DSK3.
  • a TCR construct comprising PRAME-specific TCR chains comprises TCR alpha and TCR beta chains that target PRAME epitopes SLLQHLIGL (SEQ ID NO: 131) and/or QLLALLPSL (SEQ ID NO: 132).
  • a TCR construct comprising PRAME-specific TCR chains comprises a nucleotide coding sequence that is at least, or exactly, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, identical to SEQ ID NO: 133 (e.g., TCR clone 46 TCR alpha) and/or 134 (e.g., TCR clone 46 TCR beta).
  • SEQ ID NO: 133 e.g., TCR clone 46 TCR alpha
  • 134 e.g., TCR clone 46 TCR beta
  • a TCR construct comprising PRAME-specific TCR chains comprises an amino acid sequence that is at least, or exactly, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, identical to SEQ ID NO: 135 (e.g., TCR clone 46 TCR alpha) and/or 136 (e.g., TCR clone 46 TCR beta).
  • SEQ ID NO: 135 e.g., TCR clone 46 TCR alpha
  • 136 e.g., TCR clone 46 TCR beta
  • a TCR construct comprising PRAME-specific TCR chains comprises a nucleotide coding sequence that is at least, or exactly, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, identical to SEQ ID NO: 137 (e.g., TCR clone 54 TCR alpha) and/or 138 (e.g., TCR clone 54 TCR beta).
  • SEQ ID NO: 137 e.g., TCR clone 54 TCR alpha
  • 138 e.g., TCR clone 54 TCR beta
  • a TCR construct comprising PRAME-specific TCR chains comprises an amino acid sequence that is at least, or exactly, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, identical to SEQ ID NO: 139 (e.g., TCR clone 54 TCR alpha) and/or 140 (e.g., TCR clone 54 TCR beta).
  • SEQ ID NO: 139 e.g., TCR clone 54 TCR alpha
  • 140 e.g., TCR clone 54 TCR beta
  • a TCR construct comprising PRAME-specific TCR chains comprises a nucleotide coding sequence that is at least, or exactly, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, identical to SEQ ID NO: 141 (e.g., TCR clone DSK3 TCR alpha) and/or 142 (e.g., TCR clone DSK3 TCRbeta).
  • SEQ ID NO: 141 e.g., TCR clone DSK3 TCR alpha
  • 142 e.g., TCR clone DSK3 TCRbeta
  • a TCR construct comprising PRAME-specific TCR chains comprises an amino acid sequence that is at least, or exactly, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, identical to SEQ ID NO: 143 (e.g., TCR clone DSK3 TCR alpha) and/or 144 (e.g., TCR clone DSK3 TCR beta).
  • SEQ ID NO: 143 e.g., TCR clone DSK3 TCR alpha
  • 144 e.g., TCR clone DSK3 TCR beta
  • a TCR construct comprising PRAME-specific TCR chains comprises a nucleotide coding sequence that is at least, or exactly, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, identical to one or more of SEQ ID NOs: 145-152.
  • a TCR construct comprising PRAME-specific TCR chains comprises TCR alpha and TCR beta chains found in PRAME-specific TCR clone T116-49 and/or T402-93 and/or modified versions thereof.
  • a TCR construct comprising PRAME-specific TCR chains comprises TCR alpha and TCR beta chains that target PRAME epitope LYVDSLFFL (SEQ ID NO: 167).
  • PRAME-specific TCR sequences, TCR variable domain sequences, CDR sequences, and/or TCR constant domain sequences are described in international patent application publication WO 2022/063966 Al, which is incorporated herein by reference for the purpose described herein.
  • a TCR construct comprising PRAME-specific TCR chains comprises an amino acid sequence that is at least, or exactly, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, identical to one or more of SEQ ID NOs: 153-166.
  • a TCR construct comprises gp 100-specific TCR chains.
  • a TCR construct comprising gp 100-specific TCR chains comprises TCR alpha and TCR beta chains found in gp 100-specific TCR clone Sp(0.01)A and/or modified versions thereof.
  • a TCR construct comprising gp 100-specific TCR chains comprises TCR alpha and TCR beta chains that target gplOO epitope KTWGQYWQV (SEQ ID NO: 168).
  • gplOO-specific TCR sequences TCR variable domain sequences, CDR sequences, and/or TCR constant domain sequences, are described in patent publication US 8,216,565 B2, which is incorporated herein by reference for the purpose described herein.
  • a TCR construct comprising gplOO-specific TCR chains comprises a nucleotide coding sequence that is at least, or exactly, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, identical to one or more of SEQ ID NOs: 169 and/or 170.
  • a TCR construct comprising gplOO- specific TCR chains comprises an amino acid sequence that is at least, or exactly, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, identical to one or more of SEQ ID NOs: 171-174.
  • a TCR construct comprises MART- 1 -specific TCR chains.
  • a TCR construct comprising MART- 1 -specific TCR chains comprises TCR alpha and TCR beta chains found in MART- 1 -specific TCR clones F4 and/or F5 and/or modified versions thereof.
  • a TCR construct comprising MART-1- specific TCR chains comprises TCR alpha and TCR beta chains that target MART-1 epitope AAGIGILTV (SEQ ID NO: 175).
  • MART- 1 -specific TCR sequences, TCR variable domain sequences, CDR sequences, and/or TCR constant domain sequences are described in patent publication US 9,128,080 B2, which is incorporated herein by reference for the purpose described herein.
  • a TCR construct comprising MART- 1 -specific TCR chains comprises a nucleotide coding sequence that is at least, or exactly, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, identical to one or more of SEQ ID NOs: 176-179.
  • a TCR construct comprising MART- 1 -specific TCR chains comprises an amino acid sequence that is at least, or exactly, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, identical to one or more of SEQ ID NOs: 180-183.
  • GQQLNQSPQSMFIQEGEDVSMNCTSSS I FNTWLWYKQDPGEGPVLLIALYKAGELTSNGRLT AQFGITRKDSFLNISAS IPSDVGIYFCAGGTGNQFYFGTGTSLTVIPNIQNPDPAVYQLRDS KSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAF NNS I IPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIGFRILLLKVAGFNLLMTLRLW SS ( SEQ ID NO : 180 )
  • a TCR construct comprises Tyrosinase-specific TCR chains.
  • a TCR construct comprising Tyrosinase-specific TCR chains comprises TCR alpha and TCR beta chains found in Tyrosinase-specific TCR clone TIL 13831 and/or modified versions thereof.
  • a TCR construct comprising Tyrosinase- specific TCR chains comprises TCR alpha and TCR beta chains that target Tyrosinase epitope represented by amino acids 368-376 of tyrosinase (reactive against a class I MHC (HLA-A2)- restricted epitope (368-376) of tyrosinase).
  • Tyrosinase-specific TCR sequences are described in publication Roszkowski et al, Cancer Res. 65(4): 1570-6 (2005), which is incorporated herein by reference for the purpose described herein.
  • a TCR construct comprises MAGE- A3 -specific TCR chains.
  • a TCR construct comprising MAGE- A3 -specific TCR chains comprises TCR alpha and TCR beta chains that target amino acids 271-279 of MAGE-A3, e.g., the epitope FLWGPRALV (SEQ ID NO: 184).
  • a TCR construct comprising MAGE- A3 -specific TCR chains comprises TCR alpha and TCR beta chains that target amino acids 112-120 of MAGE-A3, e.g., the epitope KVAELVHFL (SEQ ID NO: 185).
  • MAGE- A3 -specific TCR sequences, TCR variable domain sequences, CDR sequences, and/or TCR constant domain sequences are described in international patent application publication WO 2012/054825 Al, which is incorporated herein by reference for the purpose described herein.
  • an anti-MAGE-A3 112-120 TCR comprise an A118T substitution relative to wild type (wherein the 118 position in the alpha chain is threonine).
  • an anti-MAGE-A3 112-120 TCR comprises an A118V substitution relative to wild type (wherein the 118 position in the alpha chain is valine).
  • a TCR construct comprising MAGE- A3 -specific TCR chains comprises a nucleotide coding sequence that is at least, or exactly, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, identical to one or more of SEQ ID NOs: 186-193.
  • a TCR construct comprising MAGE- A3-specific TCR chains comprises an amino acid sequence that is at least, or exactly, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, identical to one or more of SEQ ID NOs: 194-201.
  • a TCR construct comprises MAGE-A4-specific TCR chains.
  • a TCR construct comprising MAGE-A4-specific TCR chains comprises TCR alpha and TCR beta chains that target the epitope GVYDGREHTV (SEQ ID NO: 202).
  • a TCR construct comprising MAGE-A4-specific TCR chains comprises TCR alpha and TCR beta chains that target the epitope FMNKFIYE I (SEQ ID NO: 203).
  • MAGE-A4-specific TCR sequences, TCR variable domain sequences, CDR sequences, and/or TCR constant domain sequences are described in international patent application publications WO 2017/174824 A1 and WO 2021/229212 Al, each of which are incorporated herein by reference for the purpose described herein.
  • an anti-MAGE-A4 TCR alpha chain variable domain may have an M4V or an M4L amino acid substitution.
  • an anti-MAGE-A4 TCR beta chain variable domain may have a N10E amino acid substitution.
  • a TCR construct comprising MAGE-A4-specific TCR chains comprises a nucleotide coding sequence that is at least, or exactly, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, identical to one or more of SEQ ID NOs: 204-205.
  • a TCR construct comprising MAGE- A4-specific TCR chains comprises an amino acid sequence that is at least, or exactly, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, identical to one or more of SEQ ID NOs: 206-214.
  • a TCR construct comprises Wilms' tumor antigen (WT1) WTl-specific TCR chains.
  • WT1 WTl-specific TCR chains comprises TCR alpha and TCR beta chains that target the epitope VLDFAPPGA (SEQ ID NO: 215).
  • a TCR construct comprising WTl-specific TCR chains comprises TCR alpha and TCR beta chains that target the epitope RMFPNAPYL (SEQ ID NO: 216).
  • WTl-specific TCR sequences, TCR variable domain sequences, CDR sequences, and/or TCR constant domain sequences are described in international patent application publications WO 2020/185796 A1 and WO 2021/034976 Al, each of which are incorporated herein by reference for the purpose described herein.
  • a leader sequence and/or signal peptide may be removed from a TCR amino acid sequence, and percentage sequence identity may be calculated based on the TCR amino acid sequence without the leader sequence and/or signal peptide.
  • a TCR construct comprising WT1 -specific TCR chains comprises a nucleotide coding sequence that is at least, or exactly, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, identical to one or more of SEQ ID NOs: 217-256.
  • a TCR construct comprising WTl-specific TCR chains comprises an amino acid sequence that is at least, or exactly, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, identical to one or more of SEQ ID NOs: 257-291.
  • a TCR construct comprises Human papilloma virus (HPV)- specific TCR chains.
  • a TCR construct comprising an HPV-specific TCR chains comprises TCR alpha and TCR beta chains that target the HPV 18 E6 protein, and/or HPV 18 E7 protein.
  • an HPV 18 E6 epitope is amino acids 121-135 and/or amino acids 77-91 of the HPV 18 E6 protein.
  • a TCR construct comprising an HPV-specific TCR chains comprises TCR alpha and TCR beta chains that target the HPV 18 E7 protein.
  • an HPV 18 E7 epitope is amino acids 11-19.
  • HPV-specific TCR sequences, TCR variable domain sequences, CDR sequences, and/or TCR constant domain sequences are described in international patent application publications WO 2015/009604 Al, which is incorporated herein by reference for the purpose described herein.
  • NK cells that are modified to express the TCR/CD3 receptor complex may be obtained from any suitable source, including fresh or frozen.
  • NK cells are derived from human peripheral blood mononuclear cells (PBMC), unstimulated leukapheresis products (PBSC), NK cell lines (e.g ., NK-92), human embryonic stem cells (hESCs), induced pluripotent stem cells (iPSCs), bone marrow, or umbilical cord blood by methods well known in the art.
  • PBMC peripheral blood mononuclear cells
  • PBSC unstimulated leukapheresis products
  • NK cell lines e.g ., NK-92
  • human embryonic stem cells hESCs
  • iPSCs induced pluripotent stem cells
  • bone marrow or umbilical cord blood by methods well known in the art.
  • the NK cells may be isolated from cord blood (CB), peripheral blood (PB), bone marrow, stem cells, NK cell lines, or
  • the NK cells are isolated from pooled CB.
  • the CB may be pooled from 2, 3, 4, 5, 6, 7, 8, 9, 10, or more units.
  • the NK cells may be autologous or allogeneic with respect to a recipient individual.
  • the isolated NK cells may or may not be haplotype matched for the subject to be administered the cell therapy.
  • NK cells can be detected by specific surface markers, such as CD 16 and CD56 in humans, for example.
  • the source of the NK cells is cord blood and the NK cells may be in the cord blood in a heterogeneous mixture of cells and may be depleted of certain cells expressing CD3.
  • umbilical CB is used to derive NK cells by the isolation of CD34+ cells.
  • the NK cells may be pre-activated with one or more inflammatory cytokines, and they may be expanded or non-expanded. In some cases, the NK cells are pre-activated either prior to modification to express CD3 ⁇ TCR or following modification to express CD3 ⁇ TCR complex. In specific embodiments, pre-activation of the NK cells may comprise culturing the isolated NK cells in the presence of one or more cytokines. The NK cells may be stimulated with IL-2, or other cytokines that bind the common gamma-chain (e.g., IL-7, IL-12, IL-15, IL- 18, IL-21, and others).
  • IL-7 common gamma-chain
  • the pre-activation cytokines may be selected from the group consisting of IL-12, IL-15, IL-18, and a combination thereof.
  • One or more additional cytokines may be used for the pre-activation step.
  • the pre-activation may be for a short period of time such as 5-72 hours, such as 10-50 hours, particularly 10-20 hours, such as 12, 13, 14, 15, 16, 17, 18, 19, or 20 hours, specifically about 16 hours.
  • the pre-activation culture may comprise IL-12 at a concentration of 0.1-150 ng/mL, such as 0.5-50 ng/mL, particularly 1-20 ng/mL, such as 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 ng/mL, specifically about lO ng/mL.
  • the pre-activation culture may comprise IL-18 and/or IL-15 at a concentration of 10-100 ng/mL, such as 40-60 ng/mL, particular 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, or 55 ng/mL, specifically about 50 ng/mL.
  • the NK cells are expanded either prior to modification to express CD3 ⁇ TCR complex or following modification to express CD3 ⁇ TCR complex.
  • Pre-activated NK cells may be expanded in the presence of artificial antigen presenting cells (aAPCs).
  • the pre-activated NK cells may be washed prior to expansion, such as 2, 3, 4, or 5 times, specifically 3 times.
  • the aAPCs may be engineered to express CD137 ligand and/or a membrane-bound cytokine.
  • the membrane-bound cytokine may be membrane-bound IL-21 (mIL-21) or membrane-bound IL-15 (mIL-15).
  • the aAPCs are engineered to express CD137 ligand and mIL-21.
  • the aAPCs may be derived from cancer cells, such as leukemia cells.
  • the aAPCs may not express endogenous HLA class I, II, or CD Id molecules. They may express ICAM-1 (CD54) and LFA-3 (CD58).
  • the aAPCs may be K562 cells, such as K562 cells engineered to express CD137 ligand and mIL-21.
  • the aAPCs may be irradiated.
  • the engineering may be by any method known in the art, such as retroviral transduction.
  • the expansion may be for about 2-30 days, such as 3-20 days, particularly 12-16 days, such as 12, 13, 14, 15, 16, 17, 18, or 19 days, specifically about 14 days.
  • the pre-activated NK cells and aAPCs may be present at a ratio of about 3: 1-1:3, such as 2:1, 1:1, 1:2, specifically about 1:2.
  • the expansion culture may further comprise cytokines to promote expansion, such as IL-2.
  • the IL-2 may be present at a concentration of about 10- 500 U/mL, such as 100-300 U/mL, particularly about 200 U/mL.
  • the IL-2 may be replenished in the expansion culture, such as every 2-3 days.
  • the aAPCs may be added to the culture at least a second time, such as at about 7 days of expansion.
  • the NK cells are transfected or transduced with one or more membrane bound cytokines, including IL-21, IL-12, IL-18, IL-23, IL-7, or IL-15, either secreted by NK cells or tethered to the NK cell membrane.
  • the membrane bound cytokine may be tethered to the NK cell membrane with a particular transmembrane domain, such as the transmembrane domain of CD8, CD28, CD27, B7H3, IgGl, IgG4, CD4, DAPIO, DAP 12, for example.
  • the modified NK cells may be immediately infused (including with an effective amount of one or more bispecific or multi-specific antibodies, or the NK cells may be stored, such as by cryopreservation.
  • the cells may be propagated for days, weeks, or months ex vivo as a bulk population within about 1, 2, 3, 4, or 5 days.
  • the NK cells are modified not only to express one or more components of the TCR/CD3 complex, but they are also modified to express one or more other heterologous proteins.
  • the heterologous proteins may facilitate activity of the NK cells in any manner, including at least their activation, persistence, expansion, homing, and/or cytotoxicity.
  • the NK cells are modified to express one or more bispecific or multi-specific antibodies, although in other cases the NK cells do not express the antibodies but the antibodies are utilized in conjunction with the NK cells.
  • the antibodies may be engagers that bridge a particular immune effector cell with a particular target cell for destruction of the target cell.
  • the present disclosure allows the modified NK cells to be used with standard T-cell engagers (BiTEs) because they have been modified to express CD3 that in many cases is the T cell antigen to which the BiTE engager binds.
  • the BiTE used in the invention may also target a cancer or viral antigen that may be tailored to the medical condition of an intended recipient individual.
  • the BiTE may be tailored to bind a cancer antigen that is characteristic of the cancer cells of a cancer of the individual.
  • the anti-CD3 antibody of the BiTE may target the CD3y chain, CD3 ⁇ chain, CD3 ⁇ chain, or CD3 ⁇ chain.
  • the NK cells may be modified to express (or not to express but instead used in conjunction with) one or more bispecific NK engagers (BiKEs).
  • the BiKE comprises an antibody that binds a surface protein on the NK cell, including a naturally expressed surface protein on NK cells, and also comprises an antibody that binds a desired target antigen.
  • the BiKE may target the NK cells through an antibody an NK surface protein such as CD 16, CS1, CD56, NKG2D, NKG2C, DNAM, 2B4, CD2, an NCR, or KIR, for example.
  • the BiKE used in the invention may also target a cancer or viral antigen that may be tailored to the medical condition of an intended recipient individual.
  • the BiKE may be tailored to bind a cancer antigen that is characteristic of the cancer cells of a cancer of the individual.
  • an NK cell expresses the CD3 complex (with or without TCR) and one or more BiKEs
  • one or more vectors may be utilized to transfect or transduce the cells with the CD3 complex components (with or without TCR) and one or more BiKEs.
  • one or more of the CD3 complex components (with or without TCR) and the BiKE may or may not be on the same multi cistronic vector.
  • the NK cells are engineered to express one or more engineered receptors.
  • the engineered receptors are engineered antigen receptors that target a cancer or viral antigen of any kind.
  • the receptor may be tailored to target a desired antigen based on a medical condition of an intended recipient individual.
  • the engineered antigen receptor is a chimeric antigen receptor (CAR).
  • the NK cells may be modified to encode at least one CAR, and the CAR may be first generation, second generation, or third or a subsequent generation, for example.
  • the CAR may or may not be bispecific for two or more different antigens.
  • the CAR may comprise one or more costimulatory domains.
  • Each costimulatory domain may comprise the costimulatory domain of any one or more of, for example, members of the TNFR superfamily, CD28, CD137 (4-1BB), CD134 (0X40), DAPIO, DAP 12, CD27, CD2, CD5, ICAM-1, LFA- 1 (CD 11 a/CD 18), Lck, TNFR-I, TNFR-II, Fas, CD30, CD27, NKG2D, 2B4M, CD40 or combinations thereof, for example.
  • the CAR comprises CD3zeta.
  • the CAR lacks one or more specific costimulatory domains; for example, the CAR may lack 4-1BB and/or lack CD28.
  • the CAR polypeptide in the cells comprises an extracellular spacer domain that links the antigen binding domain and the transmembrane domain, and this may be referred to as a hinge.
  • Extracellular spacer domains may include, but are not limited to, Fc fragments of antibodies or fragments or derivatives thereof, hinge regions of antibodies or fragments or derivatives thereof, CH2 regions of antibodies, CH3 regions antibodies, artificial spacer sequences or combinations thereof.
  • Examples of extracellular spacer domains include but are not limited to CD8-alpha hinge, CD28, artificial spacers made of polypeptides such as Gly3, or CHI, CH3 domains of IgGs (such as human IgGl or IgG4).
  • the extracellular spacer domain may comprise (i) a hinge, CH2 and CH3 regions of IgG4, (ii) a hinge region of IgG4, (iii) a hinge and CH2 of IgG4, (iv) a hinge region of CD8-alpha or CD4, (v) a hinge, CH2 and CH3 regions of IgGl, (vi) a hinge region of IgGl or (vii) a hinge and CH2 of IgGl, (viii) a hinge region of CD28, or a combination thereof.
  • the hinge is from IgGl and in certain aspects the CAR polypeptide comprises a particular IgGl hinge amino acid sequence or is encoded by a particular IgGl hinge nucleic acid sequence.
  • the transmembrane domain in the CAR may be derived either from a natural or from a synthetic source. Where the source is natural, the domain in some aspects is derived from any membrane-bound or transmembrane protein.
  • Transmembrane regions include those derived from (i.e., comprise at least the transmembrane region(s) of) the alpha, beta or zeta chain of the T- cell receptor, CD28, CD3 zeta, CD3 epsilon, CD3 gamma, CD3 delta, CD45, CD4, CD5, CD8, CD9, CD 16, CD22, CD33, CD37, CD64, CD80, CD86, CD 134, CD137, CD 154, ICOS/CD278, GITR/CD357, NKG2D, and DAP molecules, such as DAP 10 or DAP12.
  • the transmembrane domain in some embodiments is synthetic.
  • the synthetic transmembrane domain comprises predominantly hydrophobic residues such as leucine and valine.
  • a triplet of phenylalanine, tryptophan and valine may be found at each end of a synthetic transmembrane domain.
  • the engineered receptors utilize one or more homing receptors (that can home to a target not necessarily because of a signal release, such as in the event that they utilize adhesion molecules) and/or one or more chemokine receptors.
  • chemokine receptors include CXC chemokine receptors, CC chemokine receptors, CX3C chemokine receptors and XC chemokine receptors.
  • the chemokine receptor is a receptor for CCR2, CCR3, CCR5, CCR8, CCR7, CXCR3, L-selectin (CD62L) CXCR1, CXCR2, or CX3CR1.
  • the cells expressing the NK cells are engineered to express one or more heterologous cytokines and/or are engineered to upregulate normal expression of one or more heterologous cytokines.
  • the cells may or may not be transduced or transfected for one or more cytokines on the same vector as other genes.
  • cytokines may be co-expressed from a vector, including as a separate polypeptide from any component of the TCR/CD3 complex.
  • Interleukin- 15 IL-15
  • IL-15 is tissue restricted and only under pathologic conditions is it observed at any level in the serum, or systemically.
  • IL-15 possesses several attributes that are desirable for adoptive therapy.
  • IL-15 is a homeostatic cytokine that induces development and cell proliferation of natural killer cells, promotes the eradication of established tumors via alleviating functional suppression of tumor-resident cells, and inhibits activation-induced cell death (AICD).
  • AICD activation-induced cell death
  • other cytokines are envisioned.
  • cytokines include, but are not limited to, cytokines, chemokines, and other molecules that contribute to the activation and proliferation of cells used for human application.
  • NK cells expressing IL-15 are capable of continued supportive cytokine signaling, which is useful for their survival post-infusion.
  • the cells express one or more exogenously provided cytokines.
  • the cytokine is IL-15, IL-12, IL-2, IL-18, IL-21, IL-23, GMCSF, or a combination thereof.
  • the cytokine may be exogenously provided to the NK cells because it is expressed from an expression vector within the cell.
  • an endogenous cytokine in the cell is upregulated upon manipulation of regulation of expression of the endogenous cytokine, such as genetic recombination at the promoter site(s) of the cytokine.
  • the cytokine may be encoded from the same vector as one or more components of the CD3 complex with or without the TCR complex.
  • IL-15 a specific sequence of IL-15 is utilized, such as those that follow (underlining refers to signal peptide sequence):
  • the modified NK cells of the disclosure are utilized with bispecific or multi-specific antibodies that target one or more particular antigens.
  • the NK cells may be modified with engineered antigen receptors that target one or more particular antigens.
  • the antigen targeted by the bispecific or multi-specific antibody, and the antigen targeted by the one or more engineered antigen receptors may or may not be the same antigen.
  • the antigen targeted by the bispecific or multi-specific antibody, and the antigen targeted by the one or more engineered antigen receptors are different antigens but are associated with the same type of cancer.
  • the antigens targeted by the antibodies and/or engineered antigen receptors are those expressed in the context of a disease, condition, or cell type to be targeted via the adoptive cell therapy.
  • diseases and conditions are proliferative, neoplastic, and malignant diseases and disorders, including cancers and tumors, including hematologic cancers, cancers of the immune system, such as lymphomas, leukemias, and/or myelomas, such as B, T, and myeloid leukemias, lymphomas, and multiple myelomas.
  • the antigen is selectively expressed or overexpressed on cells of the disease or condition, e.g ., the tumor or pathogenic cells, as compared to normal or non-targeted cells or tissues. In other embodiments, the antigen is expressed on normal cells and/or is expressed on the engineered cells.
  • antigen may be targeted in the present method.
  • the antigen may be associated with certain cancer cells but not associated with non-cancerous cells, in some cases.
  • exemplary antigens include, but are not limited to, antigenic molecules from infectious agents, auto-/self-antigens, tumor-/cancer-associated antigens, and tumor neoantigens (Linnemann el al. , 2015).
  • the antigens include NY-ESO, CD 19, EBNA, CD 123, HER2, CA-125, TRAIL/DR4, CD20, CD22, CD70, CD38, CD123, CLL1, carcinoembryonic antigen, alphafetoprotein, CD56, ART, Her3, epithelial tumor antigen, CD319 (CS1), ROR1, folate binding protein, HIV-1 envelope glycoprotein gpl20, HIV-1 envelope glycoprotein gp41, CD5, CD23, CD30, HERV-K, IL-1 IRalpha, kappa chain, lambda chain, CSPG4, CD33, CD47, CLL-1, U5snRNP200, CD200, BAFF-R, BCMA, CD99, p53, mutated p53, Ras, mutated ras, c-Myc, cytoplasmic serine/threonine kinases (e.g, A-Raf, B-Raf, and C-R
  • sequences for antigens are known in the art, for example, in the GENBANK® database: CD19 (Accession No. NG_007275.1), EBNA (Accession No. NG_002392.2), WT1 (Accession No. NG_009272.1), CD123 (Accession No. NC_000023.11), NY-ESO (Accession No. NC_000023.11), EGFRvIII (Accession No. NG_007726.3), MUC1 (Accession No. NG_029383.1), HER2 (Accession No. NG_007503.1), CA-125 (Accession No. NG_055257.1), WT1 (Accession No.
  • Tumor-associated antigens may be derived from prostate, breast, colorectal, lung, pancreatic, renal, mesothelioma, ovarian, liver, brain, bone, stomach, spleen, testicular, cervical, anal, gall bladder, thyroid, or melanoma cancers, as examples.
  • Exemplary tumor- associated antigens or tumor cell-derived antigens include MAGE 1, 3, and MAGE 4 (or other MAGE antigens such as those disclosed in International Patent Publication No. WO 99/40188); PRAME; BAGE; RAGE, Lü (also known as NY ESO 1); SAGE; and HAGE or GAGE.
  • tumor antigens are expressed in a wide range of tumor types such as melanoma, lung carcinoma, sarcoma, and bladder carcinoma. See, e.g, U.S. Patent No. 6,544,518.
  • Prostate cancer tumor-associated antigens include, for example, prostate specific membrane antigen (PSMA), prostate-specific antigen (PSA), prostatic acid phosphates, NKX3.1, and six-transmembrane epithelial antigen of the prostate (STEAP).
  • tumor associated antigens include Plu-1, HASH-1, HasH-2, Cripto and Criptin.
  • a tumor antigen may be a self-peptide hormone, such as whole length gonadotrophin hormone releasing hormone (GnRH), a short 10 amino acid long peptide, useful in the treatment of many cancers.
  • GnRH gonadotrophin hormone releasing hormone
  • Antigens may include epitopic regions or epitopic peptides derived from genes mutated in tumor cells or from genes transcribed at different levels in tumor cells compared to normal cells, such as telomerase enzyme, survivin, mesothelin, mutated ras, bcr/abl rearrangement, Her2/neu, mutated or wild-type p53, cytochrome P450 1B1, and abnormally expressed intron sequences such as N-acetylglucosaminyltransferase-V; clonal rearrangements of immunoglobulin genes generating unique idiotypes in myeloma and B-cell lymphomas; tumor antigens that include epitopic regions or epitopic peptides derived from oncoviral processes, such as human papilloma virus proteins E6 and E7; Epstein bar virus protein LMP2; nonmutated oncofetal proteins with a tumor-selective expression, such as carcinoembryonic antigen and
  • a suicide gene is utilized in conjunction with the NK cell therapy to control its use and allow for termination of the cell therapy at a desired event and/or time.
  • the suicide gene is employed in transduced cells for the purpose of eliciting death for the transduced cells when needed.
  • the cells of the present disclosure that have been modified to harbor one or more vectors encompassed by the disclosure that may comprise one or more suicide genes.
  • the term “suicide gene” as used herein is defined as a gene which, upon administration of a prodrug or other agent, effects transition of a gene product to a compound which kills its host cell.
  • a suicide gene encodes a gene product that is, when desired, targeted by an agent (such as an antibody) that targets the suicide gene product.
  • the cell therapy may be subject to utilization of one or more suicide genes of any kind when an individual receiving the cell therapy and/or having received the cell therapy shows one or more symptoms of one or more adverse events, such as cytokine release syndrome, neurotoxicity, anaphylaxis/allergy, and/or on-target/off tumor toxicities (as examples) or is considered at risk for having the one or more symptoms, including imminently.
  • the use of the suicide gene may be part of a planned protocol for a therapy or may be used only upon a recognized need for its use.
  • the cell therapy is terminated by use of agent(s) that targets the suicide gene or a gene product therefrom because the therapy is no longer required.
  • Utilization of the suicide gene may be instigated upon onset of at least one adverse event for the individual, and that adverse event may be recognized by any means, including upon routine monitoring that may or may not be continuous from the beginning of the cell therapy.
  • the adverse event(s) may be detected upon examination and/or testing.
  • the individual may have elevated inflammatory cytokine(s) (merely as examples: interferon-gamma, granulocyte macrophage colony-stimulating factor, IL-10, IL-6 and TNF-alpha); fever; fatigue; hypotension; hypoxia, tachycardia; nausea; capillary leak; cardiac/renal/hepatic dysfunction; or a combination thereof, for example.
  • cytokine release syndrome which may also be referred to as cytokine storm
  • the individual may have elevated inflammatory cytokine(s) (merely as examples: interferon-gamma, granulocyte macrophage colony-stimulating factor, IL-10, IL-6 and TNF-alpha); fever; fatigue; hypotension; hypoxia, tachycardia; nausea; capillary leak; cardiac/renal/hepatic dysfunction; or a combination thereof, for example.
  • the individual may have confusion, delirium, aplasia, and/or seizures.
  • the individual is tested for a marker
  • suicide genes include engineered nonsecretable (including membrane bound) tumor necrosis factor (TNF)-alpha mutant polypeptides (see PCT/US19/62009, which is incorporated by reference herein in its entirety), and they may be affected by delivery of an antibody that binds the TNF-alpha mutant.
  • TNF tumor necrosis factor
  • suicide gene/prodrug combinations examples include Herpes Simplex Virus-thymidine kinase (HSV-tk) and ganciclovir, acyclovir, or FIAU; oxidoreductase and cycloheximide; cytosine deaminase and 5- fluorocytosine; thymidine kinase thymidylate kinase (Tdk::Tmk) and AZT; and deoxycytidine kinase and cytosine arabinoside.
  • HSV-tk Herpes Simplex Virus-thymidine kinase
  • FIAU oxidoreductase and cycloheximide
  • cytosine deaminase and 5- fluorocytosine thymidine kinase thymidylate kinase (Tdk::Tmk) and AZT
  • the E.coli purine nucleoside phosphorylase a so-called suicide gene that converts the prodrug 6-methylpurine deoxyriboside to toxic purine 6- methylpurine, may be utilized.
  • Other suicide genes include CD20, CD52, inducible caspase 9, purine nucleoside phosphorylase (PNP), Cytochrome p450 enzymes (CYP), Carboxypeptidases (CP), Carboxyl esterase (CE), Nitroreductase (NTR), Guanine Ribosyltransferase (XGRTP), Glycosidase enzymes, Methionine- ⁇ -lyase (MET), EGFRv3, and Thymidine phosphorylase (TP), as examples. IV. Administration of Therapeutic Compositions
  • the CD3 -expressing NK cells and the bispecific or multi-specific antibodies are administered to an individual in need thereof, including in such a way as to be in proximity for the anti-CD3 antibody of the bispecific or multi-specific antibody to be able to bind CD3 on the CD3 -expressing NK cells.
  • the two components are administered separately to an individual, whereas in other cases the two components are complexed together prior to administration, such as in an ex vivo manner.
  • the NK cells express the antibodies.
  • the two components are not pre-complexed prior to administration, but are co-administered by any suitable route of administration, such as by co-infusion to the patient.
  • Embodiments of the present disclosure concern methods for the use of the compositions comprising NK cells and antibodies provided herein for treating or preventing a medical disease or disorder.
  • the method includes administering to the subject a therapeutically effective amount of the CD3 ( ⁇ TCR)-modified NK cells with the antibodies, thereby treating or preventing the disease in the subject, including reducing the risk of, reducing the severity of, and/or delaying the onset of the disease.
  • cancer or infection is treated by transfer of a composition comprising the NK cell population and corresponding antibodies.
  • NK cells may reverse the anti-inflammatory tumor microenvironment and increase adaptive immune responses by promoting differentiation, activation, and/or recruitment of accessory immune cell to sites of malignancy.
  • Cancers for which the present treatment methods are useful include any malignant cell type, such as those found in a solid tumor or a hematological tumor.
  • Exemplary solid tumors can include, but are not limited to, a tumor of an organ selected from the group consisting of pancreas, colon, cecum, stomach, brain, head, neck, ovary, kidney, larynx, sarcoma, lung, bladder, melanoma, prostate, and breast.
  • Exemplary hematological tumors include tumors of the bone marrow, T or B cell malignancies, leukemias, lymphomas, blastomas, myelomas, and the like.
  • cancers that may be treated using the methods provided herein include, but are not limited to, lung cancer (including small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, and squamous carcinoma of the lung), cancer of the peritoneum, gastric or stomach cancer (including gastrointestinal cancer and gastrointestinal stromal cancer), pancreatic cancer, cervical cancer, ovarian cancer, liver cancer, bladder cancer, breast cancer, colon cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney or renal cancer, prostate cancer, vulval cancer, thyroid cancer, various types of head and neck cancer, and melanoma.
  • lung cancer including small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, and squamous carcinoma of the lung
  • cancer of the peritoneum gastric or stomach cancer (including gastrointestinal cancer and gastrointestinal stromal cancer)
  • pancreatic cancer cervical cancer, ovarian cancer, liver cancer, bladder cancer, breast cancer, colon
  • the cancer may specifically be of the following histological type, though it is not limited to these: neoplasm, malignant; carcinoma; carcinoma, undifferentiated; giant and spindle cell carcinoma; small cell carcinoma; papillary carcinoma; squamous cell carcinoma; lymphoepithelial carcinoma; basal cell carcinoma; pilomatrix carcinoma; transitional cell carcinoma; papillary transitional cell carcinoma; adenocarcinoma; gastrinoma, malignant; cholangiocarcinoma; hepatocellular carcinoma; combined hepatocellular carcinoma and cholangiocarcinoma; trabecular adenocarcinoma; adenoid cystic carcinoma; adenocarcinoma in adenomatous polyp; adenocarcinoma, familial polyposis coli; solid carcinoma; carcinoid tumor, malignant; branchiolo-alveolar adenocarcinoma; papillary adenocarcinoma; chromophobe carcinoma;
  • the therapy provided herein may comprise administration of a combination of therapeutic agents, such as a first cancer therapy and a second cancer therapy.
  • the therapies may be administered in any suitable manner known in the art.
  • the first and second cancer treatment may be administered sequentially (at different times) or concurrently (at the same time).
  • the first and second cancer treatments are administered in a separate composition.
  • the first and second cancer treatments are in the same composition.
  • Embodiments of the disclosure relate to compositions and methods comprising therapeutic compositions.
  • the different therapies may be administered in one composition or in more than one composition, such as 2 compositions, 3 compositions, or 4 compositions.
  • Various combinations of the agents may be employed. Examples of therapies other than those of the present disclosure include surgery, chemotherapy, drug therapy, radiation, hormone therapy, immunotherapy (other than that of the present disclosure), or a combination thereof.
  • the therapeutic agents of the disclosure may be administered by the same route of administration or by different routes of administration.
  • the cancer therapy is administered intravenously, intramuscularly, subcutaneously, topically, orally, transdermally, intraperitoneally, intraorbitally, by implantation, by inhalation, intrathecally, intraventricularly, or intranasally.
  • the antibiotic is administered intravenously, intramuscularly, subcutaneously, topically, orally, transdermally, intraperitoneally, intraorbitally, by implantation, by inhalation, intrathecally, intraventricularly, or intranasally.
  • the appropriate dosage may be determined based on the type of disease to be treated, severity and course of the disease, the clinical condition of the individual, the individual's clinical history and response to the treatment, and the discretion of the attending physician.
  • the treatments may include various “unit doses.”
  • Unit dose is defined as containing a predetermined-quantity of the therapeutic composition.
  • the quantity to be administered, and the particular route and formulation, is within the skill of determination of those in the clinical arts.
  • a unit dose need not be administered as a single injection but may comprise continuous infusion over a set period of time.
  • a unit dose comprises a single administrable dose.
  • doses include doses of about 0.1, 0.5, 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, 150, 155, 160, 165, 170, 175, 180, 185, 190, 195, and 200, 300, 400,
  • Such doses can be administered at multiple times during a day, and/or on multiple days, weeks, or months.
  • the effective dose of the pharmaceutical composition is one which can provide a blood level of about 1 mM to 150 mM.
  • the effective dose provides a blood level of about 4 ⁇ M to 100 ⁇ M.; or about 1 ⁇ M to 100 ⁇ M; or about 1 ⁇ M to 50 ⁇ M; or about 1 ⁇ M to 40 ⁇ M; or about 1 ⁇ M to 30 ⁇ M; or about 1 ⁇ M to 20 ⁇ M; or about 1 ⁇ M to 10 ⁇ M; or about 10 ⁇ M to 150 ⁇ M; or about 10 ⁇ M to 100 ⁇ M; or about 10 ⁇ M to 50 ⁇ M; or about 25 ⁇ M to 150 ⁇ M; or about 25 ⁇ M to 100 ⁇ M; or about 25 ⁇ M to 50 ⁇ M; or about 50 ⁇ M to 150 ⁇ M; or about 50 ⁇ M to 100 ⁇ M (or any range derivable therein).
  • the dose can provide the following blood level of the agent that results from a therapeutic agent being administered to a subject: about, at least about, or at most about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100 ⁇ M or any range derivable therein.
  • the therapeutic agent that is administered to a subject is metabolized in the body to a metabolized therapeutic agent, in which case the blood levels may refer to the amount of that agent.
  • the blood levels discussed herein may refer to the unmetabolized therapeutic agent.
  • Precise amounts of the therapeutic composition also depend on the judgment of the practitioner and are peculiar to each individual. Factors affecting dose include physical and clinical state of the patient, the route of administration, the intended goal of treatment (alleviation of symptoms versus cure) and the potency, stability and toxicity of the particular therapeutic substance or other therapies a subject may be undergoing.
  • kits comprising compositions of the invention or compositions to implement methods of the invention.
  • the kit comprises NK cells, fresh or frozen, and that may or may not have been pre-activated or expanded.
  • the NK cells may or may not already express one or more components of the TCR/CD3 complex.
  • the kit may comprise reagents for corresponding transfection or transduction of the NK cells, including reagents such as vectors that express the component(s), primers for amplification of the component(s), and so forth.
  • Kits may comprise components which may be individually packaged or placed in a container, such as a tube, bottle, vial, syringe, or other suitable container means. Individual components may also be provided in a kit in concentrated amounts; in some embodiments, a component is provided individually in the same concentration as it would be in a solution with other components. Concentrations of components may be provided as 1x, 2x, 5x, 10x, or 20x or more.
  • EXAMPLE 1 PREPARATION AND EFFECTIVE USE OF CD3-EXPRESSING NK CELLS
  • the present example concerns cancer immunotherapeutics as a strategy to redirect the specificity of NK cells against one or more target antigens by ‘arming’ or pre-complexing them with bispecific or multi-specific antibodies, such as either prior to infusion or by co- infusing the two products separately.
  • the NK cells are transduced with one or multiple CD3 chains, including CD3 ⁇ , CD3 ⁇ , CD3 ⁇ and CD3 ⁇ chains and can be from any source.
  • the cells can be expanded or non-expanded, they can be pre-activated with one or more inflammatory cytokines, such as IL12/15/18, and/or they can be genetically modified to express one or more heterologous proteins, including, for example, engineered antigen receptors, such as chimeric antigen receptor or a TCR, and/or a cytokine gene and/or a homing/chemokine receptor.
  • inflammatory cytokines such as IL12/15/18
  • heterologous proteins including, for example, engineered antigen receptors, such as chimeric antigen receptor or a TCR, and/or a cytokine gene and/or a homing/chemokine receptor.
  • FIG. 1 A and IB illustrate different embodiments of NK cells engineered to be utilized with bispecific or multi-specific antibodies.
  • the cells are engineered to express CD3 that may be activated with a bispecific or multi-specific antibody, including a bispecific T cell engager (BiTE) that comprises an anti- CD3 antibody that binds heterologous CD3 expressed on the surface of the NK cells.
  • BiTE bispecific T cell engager
  • CD3 -expressing NK cells are able to be bound by a BiTE that comprises an anti- CD3 antibody, and the NK cells are also expressing one or more particular cytokines (e.g ., IL- 15 and/or IL-21), resulting in increased efficacy and potency that are particularly useful for treating solid tumors.
  • cytokines e.g ., IL- 15 and/or IL-21
  • the NK cells are engineered to express not only CD3 to be able to be activated by a BiTE that comprises an anti-CD3 antibody but also are utilized with a bispecific or multi-specific antibody (e.g., bispecific NK cell engager, or BiKE) that comprises an antibody that binds a surface antigen naturally present on NK cells, such as CD16, CS1, CD56, NKG2D, NKG2C, DNAM, 2B4, CD2, an NCR, or KIR, for example.
  • a surface antigen naturally present on NK cells such as CD16, CS1, CD56, NKG2D, NKG2C, DNAM, 2B4, CD2, an NCR, or KIR, for example.
  • the NK cells respond to both NK engagers and T cell engagers.
  • the NK cells in addition to expressing CD3 to engage with T cell engagers also express an engineered antigen receptor, such as a CAR or engineered TCR.
  • FIG. IB illustrates different embodiments wherein the NK cells are modified to express both CD3 and a TCR.
  • T cell TCR is illustrated having a and b chains with an antigen binding site wherein the TCR is complexed with CD3 ⁇ to effect signal transduction.
  • the T cell TCR is co-complexed with two CD3 ⁇ chains, a CD3 ⁇ chain, and a CD3y chain.
  • the NK cells express a TCR in which one or more of the cytoplasmic domains of any of the CD3 molecules is a heterologous intracellular domain, such as one from CD 16, NKG2D, DAP 10, DAP 12, NCR, and DNAM-1.
  • a heterologous intracellular domain such as one from CD 16, NKG2D, DAP 10, DAP 12, NCR, and DNAM-1.
  • the NK cells are configured to express a CD3 co-receptor component, and in one example the CD3 component is CD3 ⁇ .
  • a standard BiTE top left that comprises an antibody against a tumor antigen and an antibody against CD3 normally utilized with T cells that naturally express CD3 may be utilized in conjunction with the CD3 -expressing NK cells.
  • the NK cells express a polypeptide that comprises the extracellular domain of CD3 ⁇ (although the extracellular domains of other CD3 components may be utilized) and the extracellular domain of CD3 ⁇ is linked to a transmembrane domain and/or cytoplasmic domain of another molecule, such as the transmembrane domain and/or cytoplasmic domain of CD3C, CD16, NKG2D, DAP10, DAP 12, NCR, or DNAM-1, for example.
  • FIG. 1C schematically depicts the generation of surface- expressible single chimeric CD3 constructs that can be used in conjunction with anti-CD3 BiTEs.
  • the CD3 epsilon extracellular domain (ECD) is fused with CD28, CD 16, or NKG2D transmembrane (TM), and CD28, CD 16, or NKG2D intracellular domain (ICD), with or without CD3 zeta and/or DAP 10 intracellular domains.
  • the constructs are encompassed within the Moloney murine virus-derived SFG retroviral vector backbone, which may be used with packing plasmids for viral production.
  • the antibody will bind the extracellular domain of CD3 ⁇ accordingly.
  • Embodiments of the disclosure utilize part or all of the CD3 receptor complex.
  • the NK cells may be transfected or transduced with full length CD3zeta, CD3 gamma, CD3 delta, and CD3 epsilon.
  • the full length of each of CD3zeta, CD3 gamma, CD3 delta, and CD3 epsilon include the extracellular domain, the transmembrane domain, and the intracellular domain.
  • the different components of the receptor are expressed from the same vector, they may be configured to be produced as separate polypeptides, such as utilizing IRES or 2A elements.
  • any expression construct may be configured to express one or more cytokines, including at least IL-15.
  • FIG. 4 demonstrates CD3 expression on NK cells after CMV TCR complex transduction, at day 4.
  • the figure provides FACS plots showing CD3 expression on NK cells 4 days after CMV TCR complex transduction.
  • Non transduced (NT) NK cells CD56+ CD3-
  • T cells CD3+ CD56-
  • FIG. 5 demonstrates TCR expression on NK cells after CMV TCR complex transduction of NK, day 4.
  • FACS plots showing TCRa/b expression on NK cells 4 days after CMV TCR complex transduction.
  • Non transduced (NT) NK cells CD56+ CD3-TCRa/b-
  • T cells CD3+TCRa/b+ CD56-
  • FIG. 6 shows TCR/CD3 expression on NK after CMV TCR complex transduction, day 6.
  • FACS plots show dual CD3 and TCRa/b expression on NK cells 6 days after CMV TCR complex transduction.
  • Non transduced (NT) NK cells CD56+ CD3-TCRa/b-
  • T cells CD3+TCRa/b+ CD56-
  • FIG. 7 shown are the binding of CD3-CD19 BiTE on NK cells through the CD3/TCR at different concentrations.
  • NT non-transduced
  • T cells T cells
  • NK-TCR cells T cells
  • NK-TCR cells three different NK-TCR cells
  • blinatumomab a CD3- CD19 bispecific engager
  • a biotin-labeled CD19 antigen CD19 CAR Detection Reagent from Miltenyi
  • CD19 CAR Detection Reagent from Miltenyi
  • FIG. 7 shows the level of CD19 binding to CD3-CD19 bispecific engager (BiTe) that correlates with CD3 expression on NK-TCR and T cells.
  • FIG. 8 shows NK-TCR cytokine production after stimulation with a plate-bound CD3 antibody.
  • CD3-OKT3 clone 20 ⁇ g/ml was incubated overnight in flat bottom 96-well plates at 4°C to form a plate-bound antigen.
  • T cells or NK cells were added to the wells for 4 hrs and with Brefeldin A (that prevents the cytokine from being released, trapping it in the cytoplasm such that it can be detected by intracellular cytokine staining). They were then harvested for surface and intracellular staining to assess cytokine production and degranulation (TNF ⁇ and CD107a). FACS plots in FIG. 8 show TNF ⁇ and CD107a double-positive populations in NK cells transduced with TCR.
  • Non- transduced (NT) NK cells CD56+ CD3-
  • T cells CD3+ CD56-
  • NK TCR/CD3 cells demonstrates phosphorylation of CD3 ⁇ in NK TCR/CD3 cells after crosslinking CD3.
  • the various cells tested included non-transduced (NT) NK cells; non- transduced (NT) T cells, or three different CD3-TCR transduced NK cells (where CD1, CD2, or CD3 represent different donors).
  • NT non-transduced
  • NT non-transduced
  • CD3-TCR transduced NK cells where CD1, CD2, or CD3 represent different donors.
  • CD3ZFLGDEFL15 see FIGS. 2A and 2B.
  • the NK cells were incubated with CD3 OKT3 clone (Miltenyi, 130-093-387) at 20 ⁇ g/ml concentration for 20 min on ice.
  • NK cells were then cross-linked with Fab2 IgG1 antibody for various time points and stained to check for CD3z phosphorylation.
  • This analysis of CD3 ⁇ is useful because, as an internalization signal from the surface, it would only be able to be crosslinked with a CD3 monoclonal antibody if the NK cells expressed it.
  • NK cells that are not transduced with CD3 will not show any phosphorylation or activation after the stimulation.
  • NK cells transduced with CD3-TCR also show basal level of tonic signaling, which increases upon stimulation with CD3 OKT3 and is similar to T cells, while non-transduced NK cells did not show any CD3 ⁇ phosphorylation neither at basal nor upon CD3 OKT3 stimulation.
  • FIG. 10 shows that pre-culturing CD3-CD19 BiTEs with TCR/CD3-expressing NK cells increased its killing activity against Raji cells.
  • NK cells were either transduced with CD3- TCR#1 (CD3ZFLGDEFL 15 (see FIGS. 2A and 2B)) or CD3-TCR#2 (Z2, also called CD3ZGDEFL8SP21CD8, that includes full length CD3 ⁇ , full length CD3y, full length CD3 ⁇ , and full length CD3 e linked to membrane bound IL21 (with CD8 transmembrane domain for the membrane bound IL21).
  • NK cells transduced with the CD3/TCR constructs or non- transduced NK cells were loaded with Blinatumumab and incubated for 1 hour and washed with PBS. They were then co-cultured with CD 19+ B cell lymphoma cells at different Effector celkTarget cell ratios (FIG. 10A is a 1:1 ratio, and FIG. 10B is a 1:5 ratio) for various time points.
  • Effector cells are the CD-3-TCRNK Cells
  • Target cells are the Raji cells.
  • Blinatumumab-loaded CD3-TCR transduced NK cells showed enhanced anti-tumor activity compared to Blinatumumab-loaded non-transduced NK cells or CD3/TCR transduced NK cells, but not loaded with Blinatumomab at both E:T ratios.
  • the present examples concern generation and use of NY-ESO TCRs in NK cells.
  • FIG. 11 there is one example for production of the cells.
  • the schematic overview shows one case wherein the NK cells are first transduced with the uTNK 15 construct that incorporates signaling domains from the CD3 complex, NK costimulatory molecules and IL-15, followed by a second transduction step that introduces the TCR molecule, thus generating NK cells that co-express CD3 andNK signaling molecules, IL-15, and a TCR complex.
  • NK cells were derived from cord blood and were expanded with irradiated (100 Gy) universal antigen presenting cells (uAPC) feeder cells (2: 1 feeder celkNK ratio) and recombinant human IL-2 (200 U/ml) in complete media.
  • uAPC universal antigen presenting cells
  • IL-2 human IL-2
  • NK cells were purified and transduced with a retroviral construct containing a CD3 complex with NK co-stimulatory molecules and an IL-15 gene 4 days after isolation. Forty-eight hours after the initial transduction, NK cells expressing uTNK15 were then transduced with a TCR targeting an antigen of choice.
  • NK cells were derived from cord blood and were expanded with irradiated (100 Gy) universal antigen presenting cells (uAPC) feeder cells (2:1 feeder celkNK ratio) and recombinant human IL-2 (200 U/ml) in complete media.
  • uAPC universal antigen presenting cells
  • IL-2 human IL-2
  • FIG.14 demonstrates NY-ESO TCR expression on non-transduced and transduced T cells.
  • T cells were isolated from cord blood (the same donor as NK cells to serve as a paired positive control) and were activated with CD3/CD28 microbeads at a concentration of 25 ⁇ l/ 1 million for 48 hours in RPMI complete media. T cells were then transduced with a retroviral construct containing NY-ESO TCR. Forty-eight hours after transduction, flow cytometry revealed that NY-ESO TCR was highly expressed on transduced T cells compared to non- transduced T cells. [0255] NK cells transduced with NY-ESO TCR kill NY-ESO peptide-pulsed target cells in a dose-dependent manner (FIG. 15).
  • Chromium 51 CR killing assay was performed 7 days following TCR transduction to determine the killing capacity of TCR-engineered NK and T cells against LCL cells loaded with different concentrations of NY-ESO peptide for 2 hours.
  • NY-ESO TCR transduced uTNK15 cells show enhanced killing of peptide-pulsed LCL cells compared to non-transduced NK cells.
  • NY-ESO TCR transduced T cells show enhanced killing of peptide-pulsed LCL cells compared to non-transduced T cells.
  • FIG.16 shows that NY-ESO is expressed endogenously on myeloma, sarcoma, and melanoma cell lines.
  • Flow cytometry was used to determine the expression of NY-ESO on U266 (myeloma), Saos-2 (Sarcoma), and A375 (melanoma) cell lines.
  • U266, Saos-2, and A375 cell lines showed higher levels of NY-ESO expression compared to the Raji cell line which served as negative control.
  • NY-ESO TCR-transduced T cells kill NY-ESO expressing tumor targets at higher E:T ratios (FIG. 17).
  • Chromium 51 CR killing assay was performed 7 days following TCR transduction to determine the killing capacity of NY-ESO TCR-engineered T cells against NY- ESO expressing myeloma, osteosarcoma and melanoma cell lines.
  • NY-ESO TCR transduced T cells show enhanced killing of NY-ESO positive cell lines compared to non-transduced T cells.
  • FIG. 18 demonstrates that NY-ESO TCR transduced NK cells kill NY-ESO expressing tumor targets even at low E:T ratios. Chromium 51 CR killing assay was performed 7 days following TCR transduction to determine the killing capacity of NY-ESO TCR- engineered NK cells against NY-ESO-expressing myeloma, osteosarcoma and melanoma cell lines. NY-ESO TCR-transduced NK cells show enhanced killing of NY-ESO positive cell lines compared to non-transduced NK cells even at very low effector: target ratios.
  • FIG.19 shows that NY-ESO transduced NK cells have a similar phenotype to NT NK cells. CytoF imaging revealed that non-transduced NK cells and NY-ESO TCR transduced uTNK15 cells share a similar phenotype.
  • FIG.19A shows a u-map plot with similar clusters, and FIG. 19B shows a heat map with similar expression of various markers on NT and NY- ESO TCR transduced uTNK15 cells.
  • FIG.20 provides a table representing the percentage of CD3+ and CD3+TCR+ NK cells in each uTNK15 product.
  • Non transduced NK cells are comprised of less than 1% CD3+ and CD3+TCR+ NK cells, while the TCR transduced uTNK15 cell products are comprised of over 60% CD3+ and over 25% CD3+TCR+ NK cells.
  • FIG.21A provides FACS plots that show successful CD3 expression on NK cells 4 days after transduction with TCR constant alpha-beta (TCRCab; TCR6 construct).
  • TCRCab TCR constant alpha-beta
  • NT Non transduced (NT) NK cells (CD56+ CD3-) serve as negative control.
  • NT NK and uTNK15 NK cells were incubated with Blinatumumab, a CD3-CD19 bispecific engager (BiTe), for one hour at 37°C using 10 ⁇ g/ ⁇ l. Then, a biotin-labeled CD19 antigen (CD19 CAR Detection Reagent from Miltenyi) was added for 20 min, followed by an anti-biotin antibody for 15 min at room temperature. This strategy was used to detect any BiTe engaged with a CD3+ cell. The histograms in this figure are showing the level of CD19 binding to CD3-CD19 bispecific engager (BiTe) that correlates with CD3 expression on uTINK15 NK cells.
  • a biotin-labeled CD19 antigen CD19 CAR Detection Reagent from Miltenyi
  • CD3/TCR transduced or non-transduced NK cells were loaded with Blinatumumab and incubated for 1 hour and washed with PBS. They were then co-cultured with LCL cells at different E:T ratios (A.1:1,B.1:5) for various time points.
  • Blinatumumab-loaded CD3-TCR transduced NK cells showed enhanced anti-tumor activity compared to Blinatumumab-loaded non-transduced NK cells or CD3/TCR transduced NK cells but not loaded with Blinatumumab at both E:T ratios.
  • NK cells comprising constructs described herein were tested in-vivo and found to robustly inhibit tumor growth.
  • FIG. 22A is a schematic outlining the experimental procedure performed.
  • NSG mice were irradiated with 300 cGy on day -1, then on day 0 individual mice received tail vein injections of 0.5 x 10 6 U266- B1 cells (a myeloma cell line that expresses both HLA-A2 and NY-ESO antigens) that were transduced with FireFlyluciferase (FFluc), on day 3 mice were infused with 5 x 10 6 effector cells (NY-ESO TCR NK cells with WT, #A, or #B UT-NK15-NY ESO TCR constructs respectively; WT refers to wild type CD3 molecules with IL-15; #A refers to CD3-CD28 with IL-15 (e.g., UT-NK15-28); and #B refers to CD
  • FIG. 22B displays the results of the monitoring of the experiment described in FIG. 22A as a function of bioluminescent imaging over time (displayed are representative images from day 1, day 7, day 14, and day 21 respectively).
  • FIG. 22C is a graphical quantification of the bioluminescence average radiance displayed in FIG. 22B, the Y axis denotes average radiance in p/s/cm 2 /sr, while the X axis denotes time.
  • FIGS. 23A-B the in vitro activity of effector cells (e.g., NK cells or T cells) comprising NY-ESO targeted TCRs and UT-NK15 constructs was tested.
  • FIG 22A are images of spheroids formed by osteosarcoma tumor cell line Saos-2 that were used to test the activity of NY-ESOl -specific TCR expressing NK and T cells cytotoxicity. Saos-2 cells were stably transduced to express GFP; 10,000 of these cells were seeded per well in a 96 well plate overnight and 40,000 of NK or T cells were then added. Images of the coculture were scanned over time and analyzed by the IncuCyte cell analysis system. Shown in FIG.
  • NK cells were co-transduced with NY-ESO- TCR, and the UT-NK15 signaling complex co-expressing different co-stimulatory molecules fused to the CD3 ⁇ signaling chain (e.g., UTNK-15-28, orUTNK-15-DAP10). T cells were only transduced with NY-ESO TCR.
  • CD8 alpha/beta coreceptor did not significantly improve on the cytotoxicity of NK or T cells.
  • FIGS. 24A-D the in vivo activity of effector cells (e.g., NK cells or T cells) comprising NY-ESO targeted TCRs and UT-NK15 constructs was tested.
  • FIG. 24A depicts a plan for an in vivo study to test the activity of different NY ESO TCR transduced NK and T cells. The plan was performed, wherein ten week old NSG mice were irradiated (300 cGy) and the next day they were injected with 500,000 U266 cells (HLA-A2 positive, NY- ESO-expressing myeloma cell line) via the tail vein. Three days later, the mice received 5 million TCR transduced T or TCR-transduced NK cells.
  • effector cells e.g., NK cells or T cells
  • FIG. 24B are said BLI imaging results of the test outlined and performed according to FIG. 24 A. Mice were injected with U266 tumor cells only, or also with T cells transduced with NY-ESO-specific TCR, or also with NK cells co-transduced with NY-ESO TCR and UT-NK15 with CD3 ⁇ fused to CD28 (labelled as NY-ESO NK UT-NK15 CD28 or NY-ESO TCRUTNK-15 CD28 NK cells). Shown in FIG. 24C are quantifications of region of interest average radiance intensity for the animals tested according to FIG. 24A and imaged in FIG. 24B. Shown in FIG. 24D is a graph depicting the cohort survival curves for the aforementioned animals. The results showed that NY ESO TCR T and NY-ESO TCR UTNK- 15-CD28 NK cells mediated strong antitumor activity in vivo.
  • mice were irradiated (300 cGy) and the next day were injected with 500,000 U266 cells (HLA-A2 positive, NY- ESO-expressing myeloma cell line) via the tail vein. Three days later, mice received 5 million TCR transduced T or NK cells. Mice were monitored for tumor control by BLI imaging.
  • NK cells were transduced with NY-ESO-specific TCR, and co-transduced with CD3 complex without IL-15 or with UT-NK15 expressing CD3 ⁇ fused to CD28 (UT-NK15-28) or CD3 ⁇ fused to DAPIO (UT-NK15-DAP10) co-stimulatory molecules, with or without expression of CD8 alpha/beta co-receptors.
  • the results showed that absence of IL-15 resulted in a reduced anti-tumor activity in vivo.
  • effector cells e.g., NK cells
  • constructs described herein e.g., NY-ESO TCR constructs and/or CD3 constructs such as UT- NK15 or modified versions thereof, e.g., UT-NK-15-28 or UT-NK15-DAP10
  • UT-NK15 or modified versions thereof, e.g., UT-NK-15-28 or UT-NK15-DAP10
  • FIGS. 26A-C NK cells comprising constructs targeting Preferentially Expressed Antigen In Melanoma (PRAME) antigen described herein were tested in-vitro and found to robustly inhibit tumor cell growth.
  • FIG. 26 A shows the expression of both UT-NK15 (x-axis, CD3) and PRAME-specific TCRs (y-axis, TCR) in NK cells (TCR clones 46, 54, or DSK3 respectively), or the expression of PRAME-specific TCRs in T cells transduced with the same (TCR clones 46 or 54).
  • PRAME-specific TCR expression on NK cells was confirmed using antibodies against the TCR and against CD3.
  • FIG. 26B shows the in vitro cytotoxicity of NK cells expressing a PRAME-specific TCR against the U266 myeloma cell line. Incucyte live cell imaging was used to measure the cytotoxicity of T cells transduced with PRAME-specific TCR and NK cells transduced with UT-NK15 and PRAME-specific TCR against U266 myeloma cells.
  • GFP-expressing U266 cells were co cultured with PRAME-specific TCR expressing T cell or NK cells at 1:1 effector : target ratio (50,000 effector and 50,000 target cells were seeded in each well of a 96 well plate). A reduction in GFP expression indicated cell death. After 26 hours, a second round of 50,000 tumor cells was added (noted as “rechallenging”) to each well for the tumor rechallenge assay.
  • NK cells expressing UT-NK15 and PRAME-specific TCR clone 46 or PRAME-specific TCR clone 54 exerted the best anti-tumor activity upon rechallenge with U266 cells and displayed superior cytotoxicity when compared to control T cells transduced with PRAME-specific TCR clones 46 or 54 respectively.
  • FIG. 26C shows the in vitro cytotoxicity of NK cells expressing a PRAME-specific TCR against the UA375 melanoma cell line. Incucyte live cell imaging was used to measure the cytotoxicity of T cells transduced with PRAME-specific TCR and NK cells transduced with UT-NK15 and PRAME-specific TCR against UA375 melanoma cells.
  • NK cells expressing UT-NK15 and PRAME-specific TCR clone 46 (TCR-46), PRAME-specific TCR clone 54 (TCR-54), or PRAME-specific TCR clone DSK3 (DSK) exerted strong anti tumor activity upon rechallenge with UA375 cells, and displayed superior cytotoxicity when compared to control T cells transduced with PRAME-specific TCR clones 46, 54, or DSK3 respectively.
  • effector cells e.g., NK cells
  • constructs described herein e.g., PRAME-specific TCR constructs
  • PRAME-specific TCR constructs displayed increased cytotoxicity when compared to T cell control cells comprising the same TCR constructs, particularly in cases of continuous and/or rechallenge by tumor cells.
  • NK cells comprising constructs described herein are tested in-vivo and robustly inhibit tumor growth. Experiments are performed according to schematics and experimental procedures described herein. In brief, NSG mice are irradiated (e.g., with about 300 cGy) on day -1, then on day 0 individual mice receive tail vein injections of cancer cells (e.g., 0.5 x 10 6 cells e.g., cells expressing (naturally and/or transduced with) an antigen described herein) that are transduced with an appropriate marker (e.g., FireFlyluciferase (FFluc)), on day 3 mice are infused with effector cells transduced with a transgenic TCR (e.g., TCR constructs comprising gamma/delta TCR chains and/or alpha/beta TCR chains, e.g., targeting antigens described herein, e.g., NY-ESO, Tyrosinase, MAGE A3, MAGEA4, HPV
  • effector cells e.g., NK cells or T cells
  • TCR(s) e.g., TCR constructs comprising gamma/delta TCR chains and/or alpha/beta TCR chains, e.g., targeting antigens described herein, e.g., NY-ESO, Tyrosinase, MAGEA3, MAGEA4, HPV E7, WT1, PRAME, gplOO, MART-1, etc.
  • UT-NK15 constructs are tested.
  • Spheroids formed by an appropriate tumor cell line(s) comprising an antigen of interest are used to test the activity of specific TCR expressing NK and/or T cells cytotoxicity.
  • Cancer cells are stably transduced to express an appropriate marker (e.g., GFP, FFluc, etc.); a number of these cells (e.g., about 10,000) are seeded per well in a 96 well plate overnight and a number of effector cells (e.g., about 40,000) are then added.
  • an appropriate marker e.g., GFP, FFluc, etc.
  • NK cells are co-transduced with antigen targeting TCRs, and UT-NK15 signaling complex co-expressing different co stimulatory molecules fused to the CD3 ⁇ signaling chain (e.g., UTNK-15-28, or UTNK-15- DAP10).
  • Appropriate control cells are transduced with appropriate constructs described herein.
  • UTNK15 with CD28, or DAP10 costimulatory domains fused to CD3 ⁇ e.g., UTNK-15-28, or UTNK-15-DAP10; e.g., SEQ ID NO: 121 and SEQ ID NO: 119 respectively
  • UTNK-15-28 or UTNK-15-DAP10; e.g., SEQ ID NO: 121 and SEQ ID NO: 119 respectively
  • SEQ ID NO: 121 and SEQ ID NO: 119 respectively
  • effector cells e.g., NK cells or T cells
  • antigen specific TCRs e.g., TCR constructs comprising gamma/delta TCR chains and/or alpha/beta TCR chains, e.g., targeting antigens described herein, e.g., NY-ESO, Tyrosinase, MAGEA3, MAGEA4, HPV E7, WT1, PRAME, gplOO, MART-1, etc.
  • Assays for in vivo analysis of effector cells (e.g., NK cells or T cells) comprising engineered constructs are performed similar to experimental plans described in FIG. 24.
  • mice e.g., ten week old NSG mice
  • tumor cells comprising the target antigen of interest (e.g., about 500,000 cells; e.g., naturally expressing and/or transduced with an antigen described herein) via the tail vein.
  • the mice receive an effector cell bolus (e.g., about 5 million TCR transduced T and/or TCR-transduced NK cells). Mice are then monitored for tumor control (e.g., by BLI imaging).
  • mice comprising test constructs comprising TCRs targeting an antigen of interest and UT-NK15 constructs with or without CD3 fusions and/or IL-15 expression display improved survival relative to control animals and/or a reduction in average radiance.
  • the results show that TCR UTNK-15 NK cells mediate strong antitumor activity in vivo.
  • effector cells e.g., NK cells
  • TCR e.g., TCR constructs comprising gamma/delta TCR chains and/or alpha/beta TCR chains, e.g., targeting antigens described herein, e.g., NY-ESO, Tyrosinase, MAGEA3, MAGEA4, HPV E7, WT1, PRAME, gplOO, MART-1, etc.
  • CD3 complex with or without IL-15 are tested.
  • NSG mice are irradiated (e.g., with about 300 cGy) and the next day are injected with tumor cells expressing an antigen of (e.g., about 500,000 cells; e.g., naturally expressing and/or transduced with an antigen described herein) via the tail vein.
  • an antigen of e.g., about 500,000 cells; e.g., naturally expressing and/or transduced with an antigen described herein
  • mice receive an effector cell bolus (e.g., about 5 million TCR transduced T and/or TCR transduced NK cells). Mice are monitored for tumor control (e.g., by BLI imaging).
  • NK cells are transduced with antigen- specific TCR, and co-transduced with CD3 complex without IL-15 or with UT-NK15 expressing CD3C fused to CD28 (UT-NK15-28) or CD3C fused to DAPIO (UT -NK 15 -DAP 10) co-stimulatory molecules, with or without expression of CD8 alpha/beta co-receptors.
  • the results show that absence of IL-15 results in a reduced anti-tumor activity in vivo.
  • effector cells e.g., NK cells
  • constructs described herein e.g., TCR constructs and/or CD3 constructs such as UT-NK15 or modified versions thereof, e.g., UT-NK-15-28 or UT-NK15-DAP10
  • UT-NK15 or modified versions thereof, e.g., UT-NK-15-28 or UT-NK15-DAP10

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Genetics & Genomics (AREA)
  • Epidemiology (AREA)
  • Biochemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Zoology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Cell Biology (AREA)
  • Biomedical Technology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Toxicology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biotechnology (AREA)
  • Hematology (AREA)
  • Wood Science & Technology (AREA)
  • Microbiology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Developmental Biology & Embryology (AREA)
  • Mycology (AREA)
  • Oncology (AREA)
  • General Engineering & Computer Science (AREA)
  • Virology (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
PCT/US2022/074062 2021-07-23 2022-07-22 Cd3-expressing natural killer cells with enhanced function for adoptive immunotherapy Ceased WO2023004425A2 (en)

Priority Applications (14)

Application Number Priority Date Filing Date Title
JP2024503984A JP2024527879A (ja) 2021-07-23 2022-07-22 養子免疫療法のための機能が強化されたcd3発現ナチュラルキラー細胞
US18/290,898 US20240325443A1 (en) 2021-07-23 2022-07-22 Cd3-expressing natural killer cells with enhanced function for adoptive immunotherapy
CN202280061681.5A CN118055770A (zh) 2021-07-23 2022-07-22 用于过继免疫疗法的具有增强的功能的表达cd3的自然杀伤细胞
EP22846863.3A EP4373501A4 (en) 2021-07-23 2022-07-22 Cd3-expressing natural killer cells with enhanced function for adoptive immunotherapy
IL310307A IL310307A (en) 2021-07-23 2022-07-22 Cd3-expressing natural killer cells with enhanced function for adoptive immunotherapy
MX2024001073A MX2024001073A (es) 2021-07-23 2022-07-22 Celulas asesinas naturales que expresan cd3 con funcion mejorada para inmunoterapia adoptiva.
AU2022315301A AU2022315301A1 (en) 2021-07-23 2022-07-22 Cd3-expressing natural killer cells with enhanced function for adoptive immunotherapy
CA3227317A CA3227317A1 (en) 2021-07-23 2022-07-22 Cd3-expressing natural killer cells with enhanced function for adoptive immunotherapy
KR1020247006166A KR20240041964A (ko) 2021-07-23 2022-07-22 입양 면역요법을 위해 기능을 향상시킨 cd3-발현 자연 킬러 세포
PCT/US2023/070687 WO2024020537A2 (en) 2022-07-22 2023-07-21 Cd3-expressing natural killer cells with enhanced function for adoptive immunotherapy
US18/993,710 US20260021183A1 (en) 2022-07-22 2023-07-21 Cd3-expressing natural killer cells with enhanced function for adoptive immunotherapy
CN202380060899.3A CN119744173A (zh) 2022-07-22 2023-07-21 用于过继免疫疗法的具有增强功能的表达cd3的自然杀伤细胞
JP2025503087A JP2025524005A (ja) 2022-07-22 2023-07-21 養子免疫療法のための亢進された機能を有するcd3発現ナチュラルキラー細胞
EP23843917.8A EP4558152A2 (en) 2022-07-22 2023-07-21 Cd3-expressing natural killer cells with enhanced function for adoptive immunotherapy

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
US202163225281P 2021-07-23 2021-07-23
US63/225,281 2021-07-23
US202263310526P 2022-02-15 2022-02-15
US63/310,526 2022-02-15
US202263344931P 2022-05-23 2022-05-23
US63/344,931 2022-05-23

Publications (2)

Publication Number Publication Date
WO2023004425A2 true WO2023004425A2 (en) 2023-01-26
WO2023004425A3 WO2023004425A3 (en) 2023-03-02

Family

ID=84978775

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2022/074062 Ceased WO2023004425A2 (en) 2021-07-23 2022-07-22 Cd3-expressing natural killer cells with enhanced function for adoptive immunotherapy

Country Status (9)

Country Link
US (1) US20240325443A1 (https=)
EP (1) EP4373501A4 (https=)
JP (1) JP2024527879A (https=)
KR (1) KR20240041964A (https=)
AU (1) AU2022315301A1 (https=)
CA (1) CA3227317A1 (https=)
IL (1) IL310307A (https=)
MX (1) MX2024001073A (https=)
WO (1) WO2023004425A2 (https=)

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024232948A1 (en) * 2023-05-05 2024-11-14 Board Of Regents, The University Of Texas System Multi-receptor natural killer cells
WO2024233299A3 (en) * 2023-05-05 2024-12-26 Board Of Regents, The University Of Texas System Multi-receptor natural killer cells
WO2024206152A3 (en) * 2023-03-24 2025-01-16 Board Of Regents, The University Of Texas System Engineered natural killer cells with enhanced antitumor memory responses
US12398187B2 (en) 2019-03-05 2025-08-26 Nkarta, Inc. CD19-directed chimeric antigen receptors and uses thereof in immunotherapy
WO2026077446A1 (en) * 2024-10-12 2026-04-16 Nanjing Legend Biotech Co., Ltd. Engineered il-15 constructs and uses thereof

Family Cites Families (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA2854233C (en) * 2011-11-04 2020-05-12 Zymeworks Inc. Stable heterodimeric antibody design with mutations in the fc domain
WO2016054520A2 (en) * 2014-10-03 2016-04-07 The California Institute For Biomedical Research Engineered cell surface proteins and uses thereof
EP3331913A1 (en) * 2015-08-07 2018-06-13 Novartis AG Treatment of cancer using chimeric cd3 receptor proteins
WO2017192536A1 (en) * 2016-05-02 2017-11-09 University Of Kansas Eliminating mhc restriction from the t cell receptor as a strategy for immunotherapy
US11752172B2 (en) * 2017-01-04 2023-09-12 Nova Southeastern University Natural killer (NK) cells expressing an antigen-specific functional T cell receptor (TCR) complex, methods for production thereof, and methods for therapeutic use thereof
WO2019071009A2 (en) * 2017-10-05 2019-04-11 Nantcell, Inc. LIPID ANTIGENS AND L-CELL RECEPTORS ON NK CELLS
CN109777778B (zh) * 2017-11-14 2023-07-18 中国科学院广州生物医药与健康研究院 一种基因改造的γδT细胞
WO2020205359A1 (en) * 2019-03-29 2020-10-08 Board Of Regents, The University Of Texas System Methods for production of car-nk cells and use thereof
EP3750547A1 (en) * 2019-06-13 2020-12-16 Universitätsmedizin der Johannes Gutenberg-Universität Mainz Modified nk-92 cells, and therapeutic and diagnostic uses thereof
EP4003374A4 (en) * 2019-07-23 2023-08-30 Wen Yang COMPOSITION AND METHODS OF ADOPTIVE IMMUNOTHERAPY

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12398187B2 (en) 2019-03-05 2025-08-26 Nkarta, Inc. CD19-directed chimeric antigen receptors and uses thereof in immunotherapy
WO2024206152A3 (en) * 2023-03-24 2025-01-16 Board Of Regents, The University Of Texas System Engineered natural killer cells with enhanced antitumor memory responses
WO2024232948A1 (en) * 2023-05-05 2024-11-14 Board Of Regents, The University Of Texas System Multi-receptor natural killer cells
WO2024233299A3 (en) * 2023-05-05 2024-12-26 Board Of Regents, The University Of Texas System Multi-receptor natural killer cells
WO2026077446A1 (en) * 2024-10-12 2026-04-16 Nanjing Legend Biotech Co., Ltd. Engineered il-15 constructs and uses thereof

Also Published As

Publication number Publication date
MX2024001073A (es) 2024-05-15
AU2022315301A1 (en) 2024-02-29
WO2023004425A3 (en) 2023-03-02
US20240325443A1 (en) 2024-10-03
JP2024527879A (ja) 2024-07-26
EP4373501A4 (en) 2025-06-04
EP4373501A2 (en) 2024-05-29
CA3227317A1 (en) 2023-01-26
KR20240041964A (ko) 2024-04-01
IL310307A (en) 2024-03-01

Similar Documents

Publication Publication Date Title
US20240325443A1 (en) Cd3-expressing natural killer cells with enhanced function for adoptive immunotherapy
US20230212319A1 (en) Novel antigen binding domains and synthetic antigen receptors incorporating the same
CA3125302A1 (en) Methods and compositions to improve the safety and efficacy of cellular therapies
BR112020005938A2 (pt) célula imune ou população de células imunes da mesma, célula efetora imune ou célula-tronco, célula que apresenta antígeno, polinucleotídeo recombinante, vetor, composição que compreende uma célula imune efetora ou uma célula-tronco, métodos para produzir uma célula efetora imune que expressa receptor imune de ocorrência não natural, para gerar uma população de células manipuladas por rna, para fornecer imunidade antidoença em um indivíduo, para tratar ou prevenir uma doença associada à expressão de um antígeno, e, uso
JP2020521479A (ja) キメラ抗原受容体細胞の作製及びその使用
US12427181B2 (en) T-cell therapy method
WO2020151752A1 (zh) Cd20组合靶向的工程化免疫细胞
US20230226181A1 (en) GENETIC ENGINEERING OF gamma delta T CELLS FOR IMMUNOTHERAPY
CN121358761A (zh) 用于基因转导及调控合成与免疫受体活性的方法和组合物
US20250235478A1 (en) Chimeric antigen receptor modified regulatory t cells for treating cancer
JP2023511443A (ja) 普遍的免疫受容体を発現する操作された細胞の活性の量的制御
US20260021183A1 (en) Cd3-expressing natural killer cells with enhanced function for adoptive immunotherapy
IL324321A (en) Multi-receptor natural killer cells
CN118055770A (zh) 用于过继免疫疗法的具有增强的功能的表达cd3的自然杀伤细胞
EP4580641A2 (en) Modulation of b-cell translocation gene 1 (btg1) for use in adoptive cell therapy
IL310308A (en) Apparatuses, systems and methods for plunger-stopper depth measurement in pre-filled syringes
EP4637792A2 (en) Cd3 and itcr expressing engineered natural killer cells with enhanced function for adoptive immunotherapy
HK40127002A (en) Novel antigen binding domains and synthetic antigen receptors incorporating the same
HK40121866A (zh) 用於在过继细胞疗法中使用的b-细胞易位基因1(btg1)的调节
WO2025064779A1 (en) Synthetic tgf-beta redirectors and uses thereof in chimeric antigen receptor-mediated cell therapy and others
CN116732068A (zh) 一种编码嵌合抗原受体的基因及其载体、修饰细胞和应用
HK40015632B (zh) 改进的t细胞治疗方法
HK40049717A (en) Improved t-cell therapy method

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22846863

Country of ref document: EP

Kind code of ref document: A2

WWE Wipo information: entry into national phase

Ref document number: 310307

Country of ref document: IL

ENP Entry into the national phase

Ref document number: 2024503984

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 18290898

Country of ref document: US

Ref document number: MX/A/2024/001073

Country of ref document: MX

Ref document number: 3227317

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: P6000170/2024

Country of ref document: AE

WWE Wipo information: entry into national phase

Ref document number: 202417005073

Country of ref document: IN

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112024001320

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: AU2022315301

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 1020247006166

Country of ref document: KR

WWE Wipo information: entry into national phase

Ref document number: 2022846863

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2022846863

Country of ref document: EP

Effective date: 20240223

ENP Entry into the national phase

Ref document number: 2022315301

Country of ref document: AU

Date of ref document: 20220722

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 11202400483U

Country of ref document: SG

WWE Wipo information: entry into national phase

Ref document number: 202280061681.5

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22846863

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 112024001320

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20240122