WO2022211544A1 - 조절 t 세포 유도 펩타이드 및 이를 포함하는 자가면역 질환 예방 또는 치료용 조성물 - Google Patents

조절 t 세포 유도 펩타이드 및 이를 포함하는 자가면역 질환 예방 또는 치료용 조성물 Download PDF

Info

Publication number
WO2022211544A1
WO2022211544A1 PCT/KR2022/004634 KR2022004634W WO2022211544A1 WO 2022211544 A1 WO2022211544 A1 WO 2022211544A1 KR 2022004634 W KR2022004634 W KR 2022004634W WO 2022211544 A1 WO2022211544 A1 WO 2022211544A1
Authority
WO
WIPO (PCT)
Prior art keywords
regulatory
cell
dnp2
group
peptide
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/KR2022/004634
Other languages
English (en)
French (fr)
Inventor
최제민
김길란
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Industry University Cooperation Foundation IUCF HYU
Original Assignee
Industry University Cooperation Foundation IUCF HYU
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Industry University Cooperation Foundation IUCF HYU filed Critical Industry University Cooperation Foundation IUCF HYU
Priority to US18/283,112 priority Critical patent/US20240166687A1/en
Priority claimed from KR1020220040191A external-priority patent/KR20220136272A/ko
Publication of WO2022211544A1 publication Critical patent/WO2022211544A1/ko
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/04—Linear peptides containing only normal peptide links
    • C07K7/08—Linear peptides containing only normal peptide links having 12 to 20 amino acids
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00—Drugs for disorders of the nervous system
    • A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • A61P37/02—Immunomodulators
    • A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K1/00—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
    • C07K1/107—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length by chemical modification of precursor peptides
    • C07K1/1072—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length by chemical modification of precursor peptides by covalent attachment of residues or functional groups
    • C07K1/1077—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length by chemical modification of precursor peptides by covalent attachment of residues or functional groups by covalent attachment of residues other than amino acids or peptide residues, e.g. sugars, polyols, fatty acids
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/001—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof by chemical synthesis
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/04—Linear peptides containing only normal peptide links
    • C07K7/06—Linear peptides containing only normal peptide links having 5 to 11 amino acids
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides

Definitions

  • the present invention relates to a composition for preventing or treating autoimmune diseases based on regulatory T cell inducing peptides.
  • Autoimmune diseases are abnormalities in the body's immune system.
  • the normal immune response acts to protect our body from external antigens such as pathogens, but the autoimmune response recognizes own cells as foreign antigens, and our immune system attacks its own organs and tissues, causing various diseases in the human body. causes
  • Rheumatoid arthritis and lupus are known autoimmune diseases as representative autoimmune diseases.
  • autoimmune diseases include systemic scleroderma, atopic dermatitis, multiple sclerosis, Graves disease, and Hashimoto's disease
  • rare diseases such as Crohn's disease, Behcet's disease, Sjogren's syndrome, and Guillain-Berre syndrome.
  • 'Th17 cells and regulatory T cells (Treg cells) of the immune system play an important role in breaking the tolerance of normal human immune response and generating an autoimmune response,' research on autoimmune diseases expanded and more active.
  • Systemic Autoimmune Diseases is a disease in which an abnormally activated immune system invades and attacks various organs of the body. Antibodies recognize various tissues and organs as self-antigens and destroy their own cells. Systemic autoimmune diseases, in particular, cause abnormalities in connective tissue and cause inflammation throughout the body, including rheumatoid arthritis, systemic lupus erythematosus, Sjogren's syndrome, mixed connective tissue disease), etc.
  • Organ-specific autoimmune diseases are diseases that can occur as the body's immune system attacks specific organs and damages normal cells. Organ-specific autoimmune diseases are It is caused by an abnormal immune response to a specific antigen and can occur in almost all organs of our body Organ damage caused by such autoimmune diseases can be caused by T cells or by autoantibodies. .
  • Multiple sclerosis is a chronic neuroimmunologic disorder that affects the central nervous system, including the brain, spinal cord, and optic nerve. Although the mechanism of this disease is not precisely known, it is an autoimmune disease caused by T-cells, which damages the myelin surrounding nerves and interferes with the transmission of nerve conduction from the brain to various parts of the body.
  • Demyelinating disease demyelinating disease; It corresponds to a disease in which the myelin, the insulating material surrounding the axon of a nerve cell, is lost).
  • Multiple sclerosis includes relapsing remitting multiple sclerosis (RRMS), secondary-progressive multiple sclerosis (SPMS), primary progressive multiple sclerosis (PPMS), and progressive relapsing multiple sclerosis. (progressive-relapsing multiple sclerosis: PRMS).
  • RRMS relapsing remitting multiple sclerosis
  • SPMS secondary-progressive multiple sclerosis
  • PPMS primary progressive multiple sclerosis
  • PRMS progressive relapsing multiple sclerosis
  • Crohn's disease is a chronic inflammatory bowel disease that can occur anywhere throughout the digestive tract, from the mouth to the anus. Unlike ulcerative colitis, inflammation invades all layers of the intestine, and the distribution of pathological changes is not continuous and often sparse. The disease most often occurs in the ileocecal region, which is the area where the large intestine and small intestine connect, followed by the large intestine, the distal end of the ileum, and the small intestine.
  • the two main autoimmune diseases of thyroiditis are Hashimoto's disease and Grave's disease.
  • Psoriasis is a non-communicable chronic skin disease that affects keratinocytes, a type that occupies a large portion of the skin epidermis.
  • the level of autoimmune disease treatment technology is to the extent of relieving symptoms or slowing the progression with anti-inflammatory drugs or steroids, etc. It is an approach that usually relies on empirical effects, and there is no fundamental treatment technology that eliminates the cause of the disease.
  • a method of weakening the immune function by administering an immunosuppressant is sometimes selected, but this treatment technique is fatal to infectious diseases because it also suppresses immunity against bacteria that can be blocked by healthy adults.
  • autoimmune diseases are known to have a reduced number and function of regulatory T cells, and inducing regulatory T cells in vivo has been considered as a major therapeutic strategy.
  • Another object of the present invention is to provide a pharmaceutical use for the treatment and prevention of autoimmune diseases containing the regulatory T cell inducing peptide as an active ingredient.
  • the present invention provides a regulatory T cell inducing peptide represented by the following sequence.
  • Xaa1, Xaa2, Xaa3 and Xaa4 are each independently, alanine (A), valine (V), isoleucine (I), leucine (L), methionine (M), phenylalanine F), tyrosine (Y), trypotophan (W), lysine (K), arginine (R), histidine (H), serine (S), threonine; T), asparagine (N), glutamine (Q), aspartate (D), glutamate (E), cysteine (C), glycine (G) and proline, P) is any one selected from amino acid residues consisting of, n is an integer of 2 to 3,
  • Any one or more amino acid residues selected from the above sequences are L-type or D-type amino acid residues.
  • Xaa1 is alanine (A), valine (V), isoleucine (I), leucine (L), methionine (M), phenylalanine (F), tyrosine ( It may be any one selected from hydrophobic amino acid residues consisting of tyrolsine (Y) and trypotophan (W).
  • Xaa2 and Xaa3 are each independently a basic amino acid consisting of lysine (K), arginine (R), and histidine (H); And it may be any one selected from alanine (alanine; A).
  • Xaa4 is a polar amino acid consisting of serine (S), threonine (T), asparagine (N), and glutamine (Q); And it may be any one selected from alanine (alanine; A).
  • Xaa1 may be methionine (M).
  • Xaa2 and Xaa3 may be lysine (K).
  • Xaa4 may be serine (S).
  • Any one or more amino acid residues selected from amino acid residues at the first, second, sixth and seventh positions in the sequence may be a D-type amino acid.
  • amino acid residues at the sixth and seventh positions in the sequence may be D-form amino acids.
  • the regulatory T cell inducing peptide may further include a linker.
  • a fatty acid may be additionally bound to the N or C terminus of the regulatory T cell inducing peptide.
  • the fatty acid may be bound to the N-terminus of the regulatory T cell-inducing peptide by an amide bond.
  • the fatty acid may be a saturated or unsaturated fatty acid having 10 to 20 carbon atoms.
  • the fatty acid is selected from the group consisting of Myristic acid, Stearic acid, Linoleic acid, Palmitic acid, Oleic acid and Lauric acid. It may be any one or more.
  • a cell penetrating peptide may be additionally bound to the N or C terminus of the regulatory T cell inducing peptide.
  • the cell-permeable peptide is dNP2 represented by SEQ ID NO: 18, AP represented by SEQ ID NO: 19, HIV 1 trans-activating protein (TAT), a polyarginine polypeptide having 6 to 8 arginines, and a polyarginine polypeptide having 7 to 11 lysines. It may be any one or more selected from the group consisting of lysine polypeptide and iRGD (internalizing RGD).
  • the regulatory T cell inducing peptide may be any one selected from the group consisting of SEQ ID NOs: 1 to 6, SEQ ID NOs: 11, SEQ ID NOs: 12, and SEQ ID NOs: 50 to 54.
  • the regulatory T cell-inducing peptide to which the cell-permeable peptide is bound may be any one selected from the group consisting of SEQ ID NOs: 7 to 10, SEQ ID NOs: 13 and SEQ ID NOs: 14.
  • the present invention provides a pharmaceutical composition for preventing or treating autoimmune diseases comprising a regulatory T cell-inducing peptide as an active ingredient.
  • the autoimmune disease is lupus (systemic lupus erythematosus), rheumatoid arthritis, Crohn disease (crohn disease), ulcerative colitis (ulcerative colitis), systemic scleroderma (Progressive systemic sclerosis, Scleroderma), atopic dermatitis, psoriasis, pemphigus , asthma, aphthous stomatitis, chronic thyroiditis, inflammatory enteritis, multiple sclerosis, mixed connective tissue disease, autoimmune hemolytic anemia, Behcet's disease, autoimmune encephalomyelitis , Myasthenia gravis, Autoimmune thyroiditis, Polyarteritis nodosa, Ankylosing spondylitis, Fibromyalgia syndrome, Sjogren's syndrome ), chronic inflammatory demyelinating polyneuropathy and temporal arteritis may be at least one selected from the group consisting of.
  • the composition may inhibit Th17 activity and activate Treg.
  • the present invention also provides the use of a pharmaceutical composition comprising the regulatory T cell-inducing peptide as an active ingredient for the manufacture of a medicament for the prevention or treatment of autoimmune diseases.
  • the present invention provides a method for treating autoimmune diseases comprising administering to a patient with an autoimmune disease a pharmaceutical composition comprising the regulatory T cell-inducing peptide as an active ingredient.
  • One aspect of the present invention relates to a regulatory T cell inducing peptide represented by the following sequence.
  • Xaa1, Xaa2, Xaa3 and Xaa4 are each independently alanine (A), valine (V), isoleucine (I), leucine (L), methionine (M) , phenylalanine (F), tyrosine (Y), trypotophan (W), lysine (K), arginine (R), histidine (H), serine (S), threonine (T), asparagine (N), glutamine (Q), aspartate (D), glutamate (E), cysteine (C), glycine (G) and Any one selected from amino acid residues consisting of proline (P), n is an integer of 2 to 3, and any one or more amino acid residues selected from the sequence are L-type or D-type amino acid residues.
  • 'peptide' refers to a polymer in the form of a chain formed by combining 2 to 1000 amino acid residues with each other by a peptide bond, and is interchangeable with 'polypeptide'.
  • the peptide preferably has the amino acid sequence, but is not limited thereto.
  • the proportion of the amino acids is 50% or more, preferably 60% or more, more preferably 70% or more, more preferably 80% or more, more preferably 90% or more. Above, most preferably, it is preferably as high as 100%.
  • the term 'polynucleotide' refers to a high molecular compound in which nucleotides, which are chemical monomers composed of three elements: a base, a sugar, and a phosphoric acid, are connected in a chain form through a plurality of phosphate ester bonds.
  • the regulatory T cell-inducing peptide of the present invention is a peptide derived from CTLA4 protein (Cytotoxic T Lymphocyte Antigen-4), and is a peptide consisting of 14 to 31 amino acids, and at least one selected from the amino acid residues is L- or D - may be amino acid residues.
  • CTLA4 protein Cytotoxic T Lymphocyte Antigen-4
  • Xaa1 is alanine (A), valine (V), isoleucine (I), leucine (L), methionine (M), phenylalanine (F) , may be any one selected from hydrophobic amino acids consisting of tyrolsine (Y), trypotophan (W), and preferably, in the sequence, Xaa1 may be methionine (M).
  • Xaa2 and Xaa3 may each independently be any one selected from basic amino acids consisting of lysine (K), arginine (R), and histidine (H), preferably
  • Xaa2 and Xaa3 may be the same amino acid, and more preferably, Xaa2 and Xaa3 may be lysine (K).
  • Xaa4 may be any one selected from polar amino acids consisting of serine (S), threonine (T), asparagine (N), and glutamine (Q), preferably Xaa4 may be serine (S).
  • the most preferred regulatory T cell-inducing peptide is, in the above sequence, Xaa1 is methionine (M), Xaa2 and Xaa3 are lysine (K), and Xaa4 may be serine (S), It can be expressed as in General Formula 2, which is distinguished from the 'sequence' described in claim 1, and is not used interchangeably with the 'sequence' of the present invention. Unless otherwise stated in Formula 2, 'sequence' in the present invention means '[Lys-Xaa1-Leu-Xaa2-Xaa3-Arg-Xaa4] n ' of claim 1.
  • any one or more amino acid residues selected from amino acid residues at the first, second, sixth and seventh positions in the sequence may be a D-type amino acid.
  • Any one or more amino acid residues selected from a lysine residue at the first position, a methionine residue at the second position, an arginine residue at the 6th position and a serine residue at the 7th position in the sequence may be a D-type amino acid.
  • amino acid residues at the 6th and 7th positions in the sequence may be D-type amino acids.
  • the arginine residue at the 6th position and the serine at the 7th position in the sequence are D-type amino acids.
  • n is an integer of 3 in the sequence, based on the entire sequence, a lysine residue at the first position, a methionine residue at the second position, an arginine residue at the 6th position, an arginine residue at the 13th position, and an arginine at the 20th position
  • the residue, the serine residue at the 7th position, the serine residue at the 14th position, and the serine residue at the 21st position may be D-type amino acids.
  • the regulatory T cell-inducing peptide according to the present invention is not bound to the cell-penetrating peptide, it has excellent regulatory T cell induction and activation efficacy, has a function of inducing differentiation into regulatory T cells (Treg cells), and simultaneously inhibits Th17 differentiation. have efficacy. Therefore, unlike CTLA4, it is easy to synthesize, has improved stability, and maintains excellent therapeutic effects in vivo as well as excellent pharmacological properties. Since modification at the C-terminus is useful, the utility is significantly superior to that of CTLA4 having a conventional long chain.
  • the stability is higher than that of the L-type amino acid residue, and it can be confirmed that the ability to regulate immune function is greatly improved when symptoms are induced by Treg cells, that is, an excessive immune response. .
  • the peptide can be obtained by various methods well known in the art. Specifically, it can be prepared by using a gene recombination and protein expression system, or by a method of synthesizing in vitro through chemical synthesis such as peptide synthesis, and a cell-free protein synthesis method.
  • CTLA4 is a receptor present on cytotoxic T cells, and it is known that it can block the activation signal of T cells by binding to antigen marker B7 and mediate negative signal transduction. In addition, it is known to play an important role in the immunosuppressive mechanism of regulatory T cells. Although the function of the CTLA4 protein or CTLA4 cytoplasmic domain has been revealed, there is a limitation that it can be delivered into the cell only through binding with a cell-permeable peptide to exert its effect. For the treatment of more fundamental autoimmune diseases, a new therapeutic agent is needed.
  • the regulatory T cell inducing peptide may further include a linker.
  • the term 'linker' is provided in the middle of the regulatory T cell-inducing peptide, thereby providing flexibility.
  • the linker may be located anywhere in the regulatory T cell inducing peptide, but may be located between the repeating units of the sequence represented by the [Lys-Met-Leu-Lys-Lys-Arg-Ser]. That is, it may be located at a site where the serine residue and the lysine residue are connected.
  • (GGGGS)m may be a repeating arrangement of 4 glycines and 1 serine
  • (GG)m may be a repeating arrangement of 2 glycines
  • (GSSGGS)m is glycine-serine-serine-glycine-glycine- It may be composed of a repeating array of serines.
  • PAPAP PAPAP
  • (AP) m (m 1 to 4)
  • (RR) m (m 1 to 4)
  • GFLG where P is proline, A is alanine, R is arginine, F is phenylalanine, and L is lysine).
  • the peptide may also include a targeting sequence, a tag, a labeled residue, a half-life or an additional amino acid sequence designed for a specific purpose to increase the stability of the peptide.
  • the peptides of the present invention may be linked to coupling partners such as effectors, drugs, prodrugs, toxins, peptides, and delivery molecules.
  • the regulatory T cell inducing peptide of the present invention may additionally bind a fatty acid to the N or C terminus for the purpose of ensuring in vivo stability.
  • the fatty acid may be bound to the N-terminus of the regulatory T cell-inducing peptide by an amide bond. Specifically, it may be linked by an amide bond between a carboxyl group of a fatty acid and an amino group of a peptide.
  • the fatty acid may be a saturated or unsaturated fatty acid having 10 to 20 carbon atoms, preferably myristic acid, stearic acid, linoleic acid, palmitic acid, oleic acid ( Oleic acid) and lauric acid may be at least one selected from the group consisting of, and most preferably, myristic acid (also expressed as 'Myr') or palmitic acid (Palmitic acid, 'Pal') also expressed as ') can be
  • the regulatory T cell-inducing peptide of the present invention does not lose or deteriorate its original function even when combined with fatty acids, but rather can provide a high therapeutic effect.
  • a cell penetrating peptide may be additionally bound to the N or C terminus of the regulatory T cell inducing peptide in order to enhance cell penetrating activity.
  • 'cell penetrating peptide refers to a peptide having the ability to deliver a cargo to be transported into cells in vitro or in vivo, The meaning is interchangeable with 'cell membrane penetrating domain' or 'cell membrane penetrating peptide'.
  • the cell-permeable peptide is dNP2 represented by SEQ ID NO: 18, AP represented by SEQ ID NO: 19, HIV 1 trans-activating protein (TAT), a polyarginine polypeptide having 6 to 8 arginines, and a polyarginine polypeptide having 7 to 11 lysines. It may be any one or more selected from the group consisting of lysine polypeptide and iRGD (internalizing RGD), and specifically, it may be any one or more selected from the sequences shown in SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 33 to SEQ ID NO: 41, , More preferably, it may be a linker represented by SEQ ID NO: 18 or SEQ ID NO: 19.
  • the regulatory T cell-inducing peptide and the fatty acid or cell-penetrating peptide may be directly linked, or may be linked indirectly by further including a linker peptide therebetween.
  • a linker peptide a peptide comprising amino acids or a combination thereof known in the art may be used without limitation.
  • the regulatory T cell inducing peptide may be linked to a fatty acid or a cell penetrating peptide, respectively, and both a fatty acid and a cell penetrating peptide may be linked, and the regulatory T cell inducing peptide and the cell penetrating peptide are first After binding, it is preferably linked with a fatty acid, but is not limited to the above synthesis sequence.
  • the function of each motif of CTLA4 was investigated, and it was confirmed that the K motif of CTLA4 protein plays a major role.
  • the K motif motif
  • the K motif when two or three linked regulatory T cell-inducing peptides, it was confirmed that they had Th17 inhibitory activity as well as regulatory T cell-inducing effect, and it was confirmed that they had an excellent symptom relief effect even when applied in vivo.
  • the regulatory T cell-inducing peptide of the present invention may be any one selected from the group consisting of SEQ ID NO: 1 to 6, SEQ ID NO: 11, SEQ ID NO: 12 and SEQ ID NO: 50 to 54, more Preferably, the regulatory T cell inducing peptide may be any one selected from the group consisting of SEQ ID NO: 1 to 6, SEQ ID NO: 11 and SEQ ID NO: 12.
  • a fatty acid or a cell-penetrating peptide is linked to the regulatory T cell-inducing peptide of the present invention, it may be any one selected from the group consisting of SEQ ID NOs: 7 to 10, SEQ ID NOs: 13 and SEQ ID NOs: 14.
  • the present invention confirmed that the K motif is involved in the suppression of the immune response in the CTLA4 protein whose function is not specifically known in the past. As it was confirmed that it did not lead to, it was confirmed that the regulatory T cell-inducing peptide according to the present invention exhibits a preventive, therapeutic or ameliorating effect on autoimmune diseases through numerous experiments in order to exhibit their effects.
  • the regulatory T cell-inducing peptide according to the present invention can have excellent autoimmune disease prevention or treatment effect even when a carrier for intracellular penetration, such as a cell-penetrating peptide, is not bound, as well as targeting Th17 and Treg Because it works effectively to suppress the immune response, it can be dramatically applied to the treatment of autoimmune diseases.
  • the regulatory T cell-inducing peptide according to the present invention remarkably alleviates symptoms of autoimmune disease in vivo, and even if it has D-type amino acid to improve stability, the survival rate of the multiple sclerosis animal model is not affected at all. Not only does it significantly improve symptoms while preventing Th17 activation, it not only effectively inhibits IL-17 production, but also increases the activation of Treg cells that suppress immune responses, and negatively regulates IFN-gamma production such as Th1. confirmed that
  • the regulatory T cell-inducing peptide of the present invention can be usefully used as a pharmaceutical for preventing or treating autoimmune diseases.
  • the present invention relates to a pharmaceutical composition for preventing or treating autoimmune diseases using the regulatory T cell-inducing peptide as an active ingredient.
  • the pharmaceutical composition of the present invention may further include a pharmaceutically acceptable carrier.
  • the pharmaceutically acceptable carriers are those commonly used for presentation, and include lactose, dextrose, sucrose, sorbitol, mannitol, starch, acacia gum, calcium phosphate, alginate, gelatin, calcium silicate, microcrystalline cellulose, poly vinylpyrrolidone, cellulose, water, syrup, methyl cellulose, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate and mineral oil, and the like.
  • the pharmaceutical composition of the present invention may further include a lubricant, a wetting agent, a sweetening agent, a flavoring agent, an emulsifying agent, a suspending agent, a preservative, and the like, in addition to the above components.
  • a lubricant e.g., a talc, a kaolin, a kaolin, a kaolin, a kaolin, kaolin, kaolin, kaolin, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, a talct, a talct, a talct, a stevia, glycerin, glycerin, glycerin,
  • prevention refers to any act of inhibiting or delaying autoimmune diseases by administering a composition comprising the regulatory T cell-inducing peptide of the present invention as an active ingredient.
  • treatment refers to any action that improves or benefits autoimmune diseases by administration of a composition comprising the regulatory T cell-inducing peptide of the present invention as an active ingredient.
  • 'autoimmune disease' refers to a disease caused by an abnormality in immune cells that are supposed to protect the body from external invaders such as bacteria, viruses, and foreign substances, recognizing their own cells as foreign antigens and attacking them.
  • the autoimmune disease is lupus (systemic lupus erythematosus), rheumatoid arthritis, Crohn disease (crohn disease), ulcerative colitis (ulcerative colitis), systemic scleroderma (Progressive systemic sclerosis, Scleroderma), atopic dermatitis, psoriasis, pemphigus , asthma, aphthous stomatitis, chronic thyroiditis, inflammatory enteritis, multiple sclerosis, mixed connective tissue disease, autoimmune hemolytic anemia, Behcet's disease, autoimmune encephalomyelitis , Myasthenia gravis, Autoimmune thyroiditis, Polyarteritis nodosa, Ankylosing spondylitis, Fibromyalgia syndrome, Sjogren's syndrome ), chronic inflammatory demyelinating polyneuropathy and temporal arteritis may be at least one selected from the group consisting of.
  • Th17 cells are formed through a process similar to the differentiation of Treg cells in the differentiation process of undifferentiated T cells. Differentiated Th17 cells secrete IL-17, which is known to be involved in the inflammatory response seen in autoimmune diseases to maximize the signal of the inflammatory response, thereby accelerating the disease progression. Based on this, most autoimmune disease treatments have been developed to target inhibition of Th1 and Th17 cell activity, but drugs targeting Treg cells have not been approved.
  • the present inventors have tried to overcome the limitations in the conventional prevention or treatment of autoimmune diseases and to develop effective substances that can replace them. As a result, it was confirmed that the K motif has an effect among the motifs present in CTLA4, but cannot exert a sufficient effect alone. The present invention was completed by confirming that it can be treated.
  • composition according to the present invention can inhibit the activity of Th17 and induce Treg activation at the same time despite containing the regulatory T cell-inducing peptide as a single active ingredient. Immune diseases can be prevented or treated.
  • composition for preventing and treating autoimmune diseases of the present invention may include a pharmaceutically acceptable carrier.
  • the pharmaceutically acceptable carrier may further include, for example, a carrier for oral administration or a carrier for parenteral administration.
  • Carriers for oral administration may include lactose, starch, cellulose derivatives, magnesium stearate, stearic acid, and the like.
  • Carriers for parenteral administration may also include water, suitable oils, saline, aqueous glucose and glycols, and the like.
  • it may further include a stabilizer and a preservative. Suitable stabilizers include antioxidants such as sodium hydrogen sulfite, sodium sulfite or ascorbic acid.
  • Suitable preservatives include benzalkonium chloride, methyl- or propyl-paraben and chlorobutanol.
  • reference may be made to those described in the following literature Remington's Pharmaceutical Sciences, 19th ed., Mack Publishing Company, Easton, PA, 1995).
  • the pharmaceutical composition of the present invention may be administered to mammals including humans by any method.
  • it can be administered orally or parenterally, and parenteral administration methods include, but are not limited to, intravenous, intramuscular, intraarterial, intramedullary, intrathecal, intracardiac, transdermal, subcutaneous, intraperitoneal. , intranasal, enteral, topical, sublingual or rectal administration.
  • the pharmaceutical composition of the present invention may be formulated as a formulation for oral administration or parenteral administration according to the administration route as described above.
  • one or more buffers eg, saline or PBS
  • antioxidants e.g, bacteriostatic agents, chelating agents (eg, EDTA or glutathione), fillers, bulking agents, binders, adjuvants (eg, aluminum hydroxide) side), suspending agents, thickening agents, wetting agents, disintegrating agents or surfactants, diluents or excipients.
  • bacteriostatic agents eg, EDTA or glutathione
  • fillers eg, bulking agents, binders, adjuvants (eg, aluminum hydroxide) side), suspending agents, thickening agents, wetting agents, disintegrating agents or surfactants, diluents or excipients.
  • Solid preparations for oral administration include tablets, pills, powders, granules, liquids, gels, syrups, slurries, suspensions or capsules, and such solid preparations are at least one excipient, for example, in the pharmaceutical composition of the present invention.
  • starch including corn starch, wheat starch, rice starch, potato starch, etc.
  • calcium carbonate sucrose, lactose, dextrose, sorbitol, mannitol, xylitol, erythritol maltitol, cellulose , methyl cellulose, sodium carboxymethyl cellulose, and hydroxypropylmethyl-cellulose or gelatin may be mixed and prepared.
  • tablets or sugar tablets can be obtained by blending the active ingredient with a solid excipient, grinding it, adding suitable adjuvants, and processing it into a granule mixture.
  • Liquid formulations for oral use include suspensions, solutions, emulsions or syrups, and various excipients, such as wetting agents, sweetening agents, fragrances, or preservatives, in addition to water or liquid paraffin, which are commonly used simple diluents, may be included. .
  • cross-linked polyvinylpyrrolidone, agar, alginic acid or sodium alginate may be added as a disintegrant, and an anti-aggregating agent, a lubricant, a wetting agent, a flavoring agent, an emulsifier and a preservative may be further included.
  • the pharmaceutical composition of the present invention may be formulated according to methods known in the art in the form of injections, transdermal administrations and nasal inhalants together with suitable parenteral carriers.
  • suitable parenteral carriers include, but are not limited to, solvents or dispersion media containing water, ethanol, polyols (eg, glycerol, propylene glycol and liquid polyethylene glycol, etc.), mixtures thereof and/or vegetable oils.
  • suitable carriers include Hanks' solution, Ringer's solution, PBS (phosphate buffered saline) with triethanolamine or isotonic solutions such as sterile water for injection, 10% ethanol, 40% propylene glycol and 5% dextrose. etc. can be used.
  • PBS phosphate buffered saline
  • isotonic solutions such as sterile water for injection, 10% ethanol, 40% propylene glycol and 5% dextrose. etc.
  • it may further include various antibacterial and antifungal agents such as parabens, chlorobutanol, phenol, sorbic acid, thimerosal, and the like.
  • the injection may further contain an isotonic agent such as sugar or sodium chloride.
  • transdermal administration forms such as ointment, cream, lotion, gel, external solution, pasta, liniment, and air are included.
  • 'transdermal administration' means that an effective amount of the active ingredient contained in the pharmaceutical composition is delivered into the skin by topically administering the pharmaceutical composition to the skin.
  • the compounds for use according to the invention can be administered in pressurized packs or using a suitable propellant, for example, dichlorofluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas. It can be conveniently delivered in the form of an aerosol spray from the nebulizer.
  • the dosage unit may be determined by providing a valve to deliver a metered amount.
  • gelatin capsules and cartridges for use in inhalers or insufflators may be formulated to contain a powder mixture of the compound and a suitable powder base such as lactose or starch. Formulations for parenteral administration are described in Remington's Pharmaceutical Science, 15th Edition, 1975. Mack Publishing Company, Easton, Pennsylvania 18042, Chapter 87: Blaug, Seymour, a recipe commonly known to all pharmaceutical chemistry.
  • the pharmaceutical composition for preventing and treating autoimmune diseases of the present invention contains the regulatory T cell-inducing peptide in an effective amount, it is possible to provide a desirable effect of preventing and treating autoimmune diseases.
  • the term 'effective amount' refers to an amount that exhibits a higher response than that of a negative control group, and preferably refers to an amount sufficient to prevent or treat autoimmune diseases.
  • the pharmaceutical composition of the present invention may contain 0.01 to 99.99% of the regulatory T cell inducing peptide, and the remaining amount may be occupied by a pharmaceutically acceptable carrier.
  • the effective amount of the regulatory T cell inducing peptide contained in the pharmaceutical composition of the present invention will vary depending on the form in which the composition is commercialized.
  • the total effective amount of the pharmaceutical composition of the present invention may be administered to a patient as a single dose, and may be administered by a fractionated treatment protocol in which multiple doses are administered for a long period of time.
  • the pharmaceutical composition of the present invention may vary the content of the active ingredient depending on the severity of the disease.
  • the regulatory T cell inducing peptide When administered parenterally, is preferably administered in an amount of 0.0001 to 50 mg, more preferably 0.001 to 30 mg per kg body weight per day based on the regulatory T cell inducing peptide, and when administered orally, the regulatory T cell inducing peptide is administered in an amount Based on the inducing peptide, it may be administered in one to several divided doses to be administered in an amount of preferably 0.0001 to 100 mg, more preferably 0.001 to 50 mg per 1 kg of body weight per day.
  • the dose of the regulatory T cell-inducing peptide is effective administration to the patient in consideration of various factors such as the age, weight, health status, sex, disease severity, diet and excretion rate of the patient, as well as the administration route and number of treatments of the pharmaceutical composition. Since the amount is determined, those of ordinary skill in the art will be able to determine an appropriate effective dosage according to the specific use of the regulatory T cell-inducing peptide for the prevention and treatment of autoimmune diseases in consideration of this point.
  • the pharmaceutical composition according to the present invention is not particularly limited in its formulation, administration route and administration method as long as the effect of the present invention is exhibited.
  • the pharmaceutical composition for preventing and treating autoimmune diseases of the present invention can be used alone or in combination with methods using surgery, radiation therapy, hormone therapy, chemotherapy, biological response modifiers or therapeutic agents for autoimmune diseases.
  • autoimmune disease therapeutic agents alone do not show any effect or side effects, but the regulatory T cell-inducing peptide of the present invention increases Treg activity and inhibits Th17 activity at the same time, Not only can it effectively control the immune response, but it can also exhibit excellent effects with a short amino acid sequence of 14 to 31, so it has high performance, low side effects, and easy manufacturing, so it can be used as a new therapeutic agent for the prevention or treatment of autoimmune diseases.
  • the regulatory T cell-inducing peptide of the present invention increases Treg activity and inhibits Th17 activity at the same time, Not only can it effectively control the immune response, but it can also exhibit excellent effects with a short amino acid sequence of 14 to 31, so it has high performance, low side effects, and easy manufacturing, so it can be used as a new therapeutic agent for the prevention or treatment of autoimmune diseases.
  • the pharmaceutical composition for preventing and treating autoimmune diseases of the present invention can also be provided in the form of an external preparation containing the regulatory T cell-inducing peptide as an active ingredient.
  • the pharmaceutical composition for preventing and treating autoimmune diseases of the present invention is used as an external preparation for skin, additionally, fatty substances, organic solvents, solubilizers, thickeners and gelling agents, emollients, antioxidants, suspending agents, stabilizers, and foaming agents (foaming agents) agent), fragrance, surfactant, water, ionic emulsifier, nonionic emulsifier, filler, sequestering agent, chelating agent, preservative, vitamin, blocker, wetting agent, essential oil, dye, pigment, hydrophilic active agent, lipophilic It may contain adjuvants commonly used in the field of dermatology, such as active agents or any other ingredients commonly used in external preparations for skin, such as lipid vesicles. In addition, the above ingredients may be introduced in an amount generally used in the field of dermatology.
  • the pharmaceutical composition for preventing and treating autoimmune diseases of the present invention is provided as an external preparation for skin, it may be in the form of, but not limited to, an ointment, a patch, a gel, a cream, or a spray.
  • composition of the present invention may be added to a feed additive or a feed composition comprising the same for the purpose of preventing or improving autoimmune diseases.
  • feed additive refers to a substance added to feed for various effects, such as nutrient supplementation and weight loss prevention, enhancement of digestibility of fiber in feed, oil quality improvement, reproductive disorder prevention and fertility improvement, and prevention of high temperature stress in summer.
  • the feed additive of the present invention corresponds to an auxiliary feed under the Feed Management Act, and mineral preparations such as sodium bicarbonate, bentonite, magnesium oxide, and complex minerals, and trace minerals such as zinc, copper, cobalt, selenium, and kerotene.
  • Vitamins such as vitamins A, D, E, nicotinic acid, and vitamin B complex, protective amino acids such as methionine and lysine, protective fatty acids such as fatty acid calcium salts, probiotics (lactic acid bacteria), yeast cultures, live bacteria such as mold fermented products, Yeast agents and the like may be further included.
  • feed refers to any natural or artificial diet, one-meal meal, etc. or a component of the one-meal meal for animals to eat, ingest, and digest, or to prevent or use autoimmune disease according to the present invention.
  • Feed containing the composition for improvement as an active ingredient can be prepared in various types of feed known in the art, and preferably may include a concentrated feed, roughage and / or special feed, but is not limited thereto.
  • seed fruits containing grains such as wheat, oats and corn, bran containing rice bran, bran, barley bran, etc.
  • Fish Soluble is a concentrated fish meal, fish waste, and fresh liquid obtained from fish, fish meal, fish waste, and residual starch, which is the main component of starch residue, which is the remainder of starch residue obtained by subtracting starch from sweet potatoes and potatoes.
  • animal feeds such as dried whey, yeast, chlorella, and seaweed, which are dried whey, which is the remainder of the production of soluble), meat meal, blood meal, feather flour, powdered skim milk, cheese from skim milk, and casein from skim milk. It is not limited thereto.
  • raw grass feed such as wild grasses, grasses, and green cuttings, turnips for feed, beets for feed, root vegetables such as a turnip rooter bearger, raw herbs, green crops, and grains are placed in a silo.
  • silage which is stored feed fermented with lactic acid after filling, wild grasses, hay obtained by cutting and drying grasses, straw from breeding crops, and leaves of legumes.
  • mineral feed such as oyster shell and rock salt
  • urea feed such as urea or its derivative diureide isobutane
  • natural feed ingredients are added to the formulated feed to supplement the ingredients that are likely to be lacking when only natural feed ingredients are mixed, or to increase the storability of the feed.
  • feed additives and dietary supplements which are substances added in trace amounts, but are not limited thereto.
  • the feed additive for preventing or improving the autoimmune disease according to the present invention can be prepared by adding the regulatory T cell inducing peptide in an appropriate effective concentration range according to various feed preparation methods known in the art.
  • the feed additive according to the present invention can be applied without limitation as long as it is an individual for the purpose of preventing or improving autoimmune diseases.
  • non-human animals such as cattle, horses, pigs, goats, sheep, dogs, cats, rabbits, etc., birds and fish can be applied to any individual.
  • the present invention provides a method for preventing or treating an autoimmune disease, comprising administering the pharmaceutical composition.
  • the animal is applicable without limitation to animals such as chickens, pigs, monkeys, dogs, cats, rabbits, guinea pigs, rats, mice, cattle, sheep, goats, and the like. Preferably, it is not particularly limited as long as it is an animal other than humans.
  • the administration may be administered by any administration means known in the art.
  • the administration may be administered directly to a subject intravenously, intramuscularly, intraperitoneally, orally, transdermally, mucosally, intranasal, intratracheal or subcutaneously.
  • the administration may be systemically or locally.
  • the composition of the present invention may be administered in a therapeutically or prophylactically effective amount.
  • the "therapeutically or prophylactically effective amount” can be appropriately selected by those skilled in the art in consideration of the severity of symptoms, the sex, age, and weight of the individual.
  • the therapeutically or prophylactically effective amount may be, for example, 0.0001-100 mg of the regulatory T cell inducing peptide per 1 kg of the administered individual.
  • the present invention relates to a CTLA4-derived regulatory T cell-inducing peptide, which has excellent effects of inhibiting differentiation into cytotoxic Th17 cells that produce and secreting inflammatory cytokines and increasing differentiation into immunoregulatory T cells (Tregs). It can be usefully used as a pharmaceutical composition capable of preventing or treating autoimmune diseases caused by abnormality of immune response.
  • the regulatory T cell-inducing peptide of the present invention can effectively suppress and alleviate the disease severity of autoimmune diseases even in vivo, and has an excellent autoimmune disease treatment or prevention effect by inhibiting Th17 activity and activating Treg.
  • 1 is a diagram showing the structure of dNP2-ctCTLA-4, dNP2-ctCTLA-4 variants (KA, PA, YF).
  • Th17, WT, KA, PA, YF a flow cytometric analysis result of IL-17A and foxp3 in five groups (Th17, WT, KA, PA, YF) treated with Th17 cells differentiated from splenocytes isolated from mice.
  • CD4 + IL-17A + T cells for five groups (Th17, WT, KA, PA, YF) prepared with dNP2-ctCTLA-4 and dNP2-ctCTLA-4 variants (KA, PA, YF); Flow cytometry results of CD4 + foxp3 + T cells.
  • Figure 4 is dNP2-ctCTLA-4, dNP2-ctCTLA-4 mutants (KA, PA, YF) for five groups (PBS, WT, KA, PA, YF) for the clinical symptom evaluation results of multiple sclerosis animal models is a graph showing
  • FIG. 5 shows immune cells (Th1, Th17, Treg) against five groups (PBS, WT, KA, PA, YF) prepared with dNP2-ctCTLA-4 and dNP2-ctCTLA-4 variants (KA, PA, YF). It is a graph showing the analysis of the number of
  • FIG. 6 is a histology of multiple sclerosis animal model spinal cord administered with five groups (PBS, WT, KA, PA, YF) prepared with dNP2-ctCTLA-4 and dNP2-ctCTLA-4 variants (KA, PA, YF); analysis result.
  • FIG. 7 is a diagram showing the structures of dNP2-ctCTLA-4, dNP2, and deletion mutants (KSYPQ, KSYP, KSY, KS, K) of dNP2-ctCTLA-4.
  • FIG. 8 is a flow cytometric analysis result of IL-17A and foxp3 in eight groups (Th17, dNP2, dNP2-ctCTLA4, KSYPQ, KSYP, KSY, KS, K) treated with Th17 cells differentiated from splenocytes isolated from mice. .
  • FIG. 9 is a flow cytometric analysis result of CD4 + IL-17A + T cells and CD4 + foxp3 + T cells for eight groups (Th17, dNP2, dNP2-ctCTLA4, KSYPQ, KSYP, KSY, KS, K).
  • 10 is a graph showing clinical symptoms evaluation results of multiple sclerosis animal models for five groups (PBS, dNP2-ctCTLA-4, TAT-ctCTLA-4, KSY, K).
  • 11 is a graph showing the analysis of the number of immune cells (Th1, Th17, Treg) for the five groups (PBS, dNP2-ctCTLA-4, TAT-ctCTLA-4, KSY, K).
  • FIG. 12 is a diagram showing structures of dNP2-ctCTLA-4 (WT), dNP2, and dNP2-ctCTLA-4 variants (K, S, Y1, P, Y2).
  • FIG. 13 shows IL-17A and foxp3 for eight groups (Th17, dNP2, dNP2-ctCTLA-4 (WT), K, S, Y1, P, Y2) treated with Th17 cells differentiated from splenocytes isolated from mice. is the result of flow cytometry.
  • 15 is a diagram showing structures for dNP2-ctCTLA-4 (WT), K1, K2 (G4S), K3 (G4S), K3 (GG), and K3 (no linker).
  • Figure 17 shows CD4 + for eight groups (Th17, dNP2-ctCTLA-4 (WT), AP-ctCTLA-4, K1, K2 (G4S), K3 (G4S), K3 (GG), K3 (no linker)).
  • Th17 dNP2-ctCTLA-4 (WT)
  • AP-ctCTLA-4 K1, K2 (G4S), K3 (G4S), K3 (GG), K3 (no linker)
  • 18 is a graph showing clinical symptoms evaluation results of multiple sclerosis animal models for five groups (PBS, dNP2-ctCTLA-4 (WT), K1, K2 (G4S), K3 (no linker)).
  • FIG. 19 is a graph showing the analysis of the number of immune cells (Th1, Th17, Treg) for the five groups (PBS, dNP2-ctCTLA-4 (WT), K1, K2 (G4S), K3 (no linker)).
  • FIG. 20 is a diagram showing the structures of dNP2-ctCTLA-4 (WT), the K2 peptide of SEQ ID NO: 1, the K3 peptide of SEQ ID NO: 4, the AP-K2 peptide of SEQ ID NO: 9, and the AP-K3 peptide of SEQ ID NO: 10. .
  • Figure 21 shows IL- for six groups (Th17 (control), dNP2-ctCTLA-4 (WT), K2, K3, AP-K2, AP-K3) treated with Th17 cells differentiated from splenocytes isolated from mice. 17A and flow cytometry results of foxp3.
  • FIG. 22 is a graph showing clinical symptoms evaluation results of multiple sclerosis animal models for six groups (PBS (control), dNP2-ctCTLA-4, dNP2, AP, AP-K2, AP-K3).
  • FIG. 23 is a graph showing the analysis of the number of infiltrated lymphocytes and immune cells (Treg) for six groups (PBS (control), dNP2-ctCTLA-4, dNP2, AP, AP-K2, AP-K3).
  • FIG. 24 is a diagram showing the structures of dNP2-ctCTLA-4 (WT), the K2 peptide of SEQ ID NO: 1, the K3 peptide of SEQ ID NO: 4, the AP-K2 peptide of Example 15, and the AP-K3 peptide of Example 16. .
  • 25 shows IL-17A and foxp3 for six groups (Th17 (control), dNP2-ctCTLA-4, K2, K3, Myr-K2, Myr-K3) treated with Th17 cells differentiated from splenocytes isolated from mice. is the result of flow cytometry.
  • 26 is a graph showing clinical symptoms evaluation results of multiple sclerosis animal models for six groups (Th17, dNP2-ctCTLA-4, K2, AP-K2, Myr-K2, Myr-K3).
  • 27 is a graph showing the analysis of the number of infiltrated lymphocytes and immune cells (Treg) for six groups (Th17, dNP2-ctCTLA-4, K2, AP-K2, Myr-K2, Myr-K3).
  • Th17 shows eleven groups (Th17, AP-K2, AP, AP-K2 KA, AP-K2 IKA, AP-K2 MA, AP-K2 LA, AP-) treated with Th17 cells differentiated from splenocytes isolated from mice.
  • FIG. 30 shows eleven groups (Th17, AP-K2, AP, AP-K2 KA, AP-K2 IKA, AP-K2 MA, AP-K2 LA, AP-K2 2KA, AP-K2 3KA, AP-K2 RA, AP; Flow cytometry results of CD4 + IL-17A + T cells (a) and CD4 + foxp3 + T cells (b) against -K2 SA).
  • the peptides of SEQ ID NOs: 1 to 14 were designed as shown in Table 1 below, and were commissioned by AnyGen (Kwangju, Korea) and prepared by solid-phase peptide synthesis (SPPS). The manufacturing process was brief, amino acids protected by Fmoc were sequentially conjugated to trityl chloride resin, and then the protecting groups and amino acid residues of the resin were removed through a global cleavage method, Crude peptide was obtained under acidic conditions. The crude peptide was purified by high performance liquid chromatography (HPLC; Shimadzu, Kyoto, Japan). The synthetic peptide finally obtained was lyophilized and stored, and it was confirmed that the purity was 95% or more (AnyGen, Kwangju, Korea). The 14 specific sequences prepared in this experiment are as follows.
  • a lowercase letter of the alphabet in Table 1 means a D-type amino acid.
  • a fatty acid and a reaction reagent (HOBt, DIC, DMF) were mixed in a peptide resin, and then reacted at room temperature for one day to form a fatty acid-modified peptide.
  • the crude peptide was purified by high performance liquid chromatography (HPLC; Shimadzu, Kyoto, Japan).
  • HPLC high performance liquid chromatography
  • the synthetic peptide finally obtained was lyophilized and stored, and it was confirmed that the purity was 95% or more (AnyGen, Kwangju, Korea).
  • Th17 cells are one of the subsets of CD4 T cells, and Th17 cells are known to cause inflammation by secreting a cytokine called IL-17. It is a major factor in causing autoimmune diseases. Treg cells (regulatory T cells) are known to suppress and regulate inflammation by expressing a transcription factor called Foxp3. Therefore, if it inhibits Th17 (IL-17) and increases Treg (Foxp3) cells to control inflammation, it can be considered to have the effect of preventing and treating autoimmune diseases. It was confirmed that it has
  • Undifferentiated CD4 T cells from splenocytes of 6-8 week-old C57BL/6 mice were isolated.
  • undifferentiated CD4 T cells from Foxp3-GFP mice were purified and differentiated into Th17, followed by FACS Aria cell sorter III (BD Biosciences, Franklin Lakes, NJ). , USA) were used to classify the Foxp3+ and Foxp3- populations.
  • Purified undifferentiated CD4 T cells were prepared from plate-bound anti-CD3 (2 or 5 ⁇ g/ml; 553057; BD Pharmingen, La Jolla, CA) and anti-CD28 (2 or 5 ⁇ g/ml).
  • Th0 Recombinant human TGF- ⁇ (R&D Systems) 0.25 ng/ml.
  • Th1 Anti-IL-4 (11B11; 16-7041-85; eBioscience) 5 g/ml, IL-2 (212-12; Peprotech, Rocky Hill, NJ) 50 U/ml, recombinant murine IL- 12 (212-12; Peprotech) 2 ng/ml, recombinant human TGF- ⁇ against Th1 (R&D Systems) 0.25 ng/ml.
  • mice 8-week-old female C57BL/6 mice were purchased from Orient Bio (Daejeon, Korea) and used. All animal experiments were performed in compliance with the Animal Experimental Operational Regulations of the Institutional Animal Care and Use Committee of Hanyang University. Before the experiment, the mice were acclimatized for 2 weeks. Mice were bred on a free diet in a breeding room maintained at a temperature of 22 ⁇ 2 °C and a humidity of 40-60% during the experiment, and the light and dark cycle was adjusted at intervals of 12 hours.
  • Multiple sclerosis was induced by subcutaneous immunization using the MOG 35-55 /CFA Emulsion PTX kit (Hooke Labs, Lawrence, MA, USA) according to the manufacturer's protocol. Mice were anesthetized with isoflurane, and MOG 35-55 /CFA was injected bilaterally (subcutaneously), and 2 hours and 24 hours later, PTX (pertussis toxin) was injected intraperitoneally (intraperitoneal injection). The animal models were randomly assigned to each group after MOG immunization.
  • lymphocytes of the central nervous system, the spinal cord were isolated.
  • the isolated spinal cord was treated with 1 mg/ml of DNase 1 (10104159001; Sigma-Aldrich) and 1 mg/ml of collagenase D (11088866001; Sigma-Aldrich) at 37 °C, and 80 RPM on a shaker for 40 min. incubated with After enzymatic treatment, 500 mM EDTA was added and lymphocytes were isolated by Percoll (GE Healthcare, Little Chalfont, UK) density-gradient centrifugation.
  • the isolated infiltrated lymphocytes were restimulated with Cell Stimulation Cocktail (plus protein transport inhibitors) (ThermoFisher) at 37° C. for 4 hours and stained with anti-mouse CD4.
  • the cells were fixed, permeabilized using Foxp3/Transcription Factor Staining Buffer Set (eBioscience), and stained with anti-mouse IFN- ⁇ , anti-mouse IL-17 or anti-mouse Foxp3.
  • Cells were analyzed using a FACS Canto flow cytometer and FlowJo software version 10.7.1.
  • the paraffin block of the spinal cord tissue was deparaffinized and treated with Luxol fast blue.
  • hematoxylin and eosin were used (Dako).
  • Infiltrated cells in the white matter region of the spinal cord tissue were counted using Image J software version 2.0.0.
  • Th1 and Th17 immune cells in the spinal cord As the number of Th1 and Th17 immune cells in the spinal cord increases, the condition of multiple sclerosis becomes more severe. It means that the ability to prevent or treat immune diseases is improved.
  • This experiment is to confirm the function of the mutant in dNP2-ctCTLA-4, and dNP2-ctCTLA-4 and its variants were prepared and the degree of suppression of the immune response was analyzed.
  • dNP2-ctCTLA-4, dNP2-ctCTLA-4 variants were designed as shown in Table 3 below, and solid-phase peptide synthesis (SPPS; solid-phase peptide synthesis).
  • SPPS solid-phase peptide synthesis
  • the specific manufacturing process is the same as in Example 1, and the purity of the peptides prepared in this experiment was also confirmed to be 95% or more.
  • Th17 group (control): Anti-CD3 and anti-CD28-activated CD4 T cells were treated with PBS with a cytokine cocktail in the same volume as the positive control.
  • dNP2-ctCTLA-4 group (positive control): Anti-CD3 and anti-CD28-activated CD4 T cells were treated with dNP2-ctCTLA-4 (2 ⁇ M) of SEQ ID NO: 15 together with a cytokine cocktail.
  • KA group Anti-CD3 and anti-CD28 activated CD4 T cells were treated with dNP2-KA (2 ⁇ M) of SEQ ID NO: 20 with a cytokine cocktail.
  • PA group Anti-CD3 and anti-CD28 activated CD4 T cells were treated with dNP2-PA of SEQ ID NO: 21 (2 ⁇ M) with a cytokine cocktail.
  • YF group Anti-CD3 and anti-CD28 activated CD4 T cells were treated with dNP2-YF (2 ⁇ M) of SEQ ID NO: 22 with a cytokine cocktail.
  • Experimental Method 2 the efficacy in an animal model of multiple sclerosis was analyzed.
  • the samples were divided into five groups (PBS, WT, KA, PA, YF) using dNP2-ctCTLA-4 and dNP2-ctCTLA-4 variants (KA, PA, YF).
  • PBS group (control group): PTX was injected and 100 ⁇ g of PBS was injected intraperitoneally once daily from the 7th to the 14th day.
  • dNP2-ctCTLA-4 group (positive control group): intraperitoneal injection of (dNP2-ctCTLA-4)_WT (100 ⁇ g) of SEQ ID NO: 15 from 7 to 14 days after PTX injection once daily.
  • KA group intraperitoneal injection of the dNP2-KA peptide of SEQ ID NO: 20 (100 ⁇ g) once daily from the 7th to the 14th day after PTX injection.
  • PA group intraperitoneal injection of the dNP2-PA peptide (100 ⁇ g) of SEQ ID NO: 21 once daily from the 7th to the 14th day after PTX injection.
  • YF group PTX was injected and dNP2-YF peptide (100 ⁇ g) of SEQ ID NO: 22 was injected intraperitoneally once daily from the 7th to the 14th day.
  • FIG. 1 is a diagram showing the structures of dNP2-ctCTLA-4 and dNP2-ctCTLA-4 variants (KA, PA, YF), and FIG. 2 is five groups treated with Th17 cells differentiated from splenocytes isolated from mice. Flow cytometry results of IL-17A and foxp3 for (Th17, WT, KA, PA, YF), and FIG. 3 shows dNP2-ctCTLA-4 and dNP2-ctCTLA-4 mutants (KA, PA, YF) prepared Flow cytometry results of CD4 + IL-17A + T cells and CD4 + foxp3 + T cells for five groups (Th17, WT, KA, PA, YF).
  • the cytoplasmic region of CTLA4 was divided into 'K, S, Y, P, Q, Y' motifs, and the correlation with the immune response inhibitory effect was analyzed.
  • Figure 4 is dNP2-ctCTLA-4, dNP2-ctCTLA-4 mutants (KA, PA, YF) for five groups (PBS, WT, KA, PA, YF) for the clinical symptom evaluation results of multiple sclerosis animal models 5 is a graph showing dNP2-ctCTLA-4, dNP2-ctCTLA-4 mutants (KA, PA, YF) in five groups (PBS, WT, KA, PA, YF) in immune cells (Th1) , Th17, Treg) is a graph showing the number of analysis
  • Figure 6 is dNP2-ctCTLA-4, dNP2-ctCTLA-4 variants (KA, PA, YF) prepared in five groups (PBS, WT, KA, PA) , YF) is the result of histological analysis of the spinal cord in an animal model of multiple sclerosis administered.
  • dNP2-ctCTLA-4, dNP2, and dNP2-ctCTLA-4 deletion variants were designed as shown in Table 4 below, and AnyGen (AnyGen, Kwangju, Korea) was commissioned to It was prepared by solid-phase peptide synthesis (SPPS).
  • SPPS solid-phase peptide synthesis
  • dNP2-ctCTLA-4) WT 15 KIKKVKKKGRKGSKIKKVKKKGRKGGKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN (TAT-ctCTLA-4) WT 16 YGRKKRRRQRRRGSKIKKVKKKGRKGGKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN dNP2 18 KIKKVKKKGRKGSKIKKVKKKGRK dNP2-KSYPQ 23 KIKKVKKKGRKGSKIKKVKKKGRKGGKMLKKRSPLTTGVYVKMPPTEPECEKQFQP dNP2-KSYP 24 KIKKVKKKGRKGSKIKKVKKKGRKGGKMLKKRSPLTTGVYVKMPPTEPECE dNP2-KSY 25 KIKKVKKKGRKGSKIKKVKKKGRKGGKMLKKRSPLTTGVYVKM dNP2-KSY 25
  • Th17 group (Control 1): Anti-CD3 and anti-CD28-activated CD4 T cells were treated with PBS (2 ⁇ M) with cytokine cocktail.
  • dNP2 group (Control 2): Anti-CD3 and anti-CD28-activated CD4 T cells were treated with the dNP2 peptide of SEQ ID NO: 18 (2 ⁇ M) together with a cytokine cocktail.
  • dNP2-ctCTLA-4 group (positive control): Anti-CD3 and anti-CD28-activated CD4 T cells were treated with dNP2-ctCTLA-4 (2 ⁇ M) of SEQ ID NO: 15 together with a cytokine cocktail.
  • KSYPQ group anti-CD3 and anti-CD28 activated CD4 T cells were treated with dNP2-KSYPQ peptide (2 ⁇ M) of SEQ ID NO: 23 with a cytokine cocktail.
  • KSYP group Anti-CD3 and anti-CD28-activated CD4 T cells were treated with dNP2-KSYP peptide (2 ⁇ M) of SEQ ID NO: 24 with a cytokine cocktail.
  • KSY group Anti-CD3 and anti-CD28-activated CD4 T cells were treated with dNP2-KSY peptide (2 ⁇ M) of SEQ ID NO: 25 with a cytokine cocktail.
  • KS group Anti-CD3 and anti-CD28-activated CD4 T cells were treated with dNP2-KS peptide (2 ⁇ M) of SEQ ID NO: 26 together with a cytokine cocktail.
  • Group K Anti-CD3 and anti-CD28-activated CD4 T cells were treated with dNP2-K1 peptide (2 ⁇ M) of SEQ ID NO: 27 with a cytokine cocktail.
  • Experimental Method 2 the efficacy in an animal model of multiple sclerosis was analyzed.
  • a total of five groups PBS, dNP2-ctCTLA-4, TAT-ctCTLA
  • KSY, K dNP2-ctCTLA-4 deletion mutants
  • PBS group (control group): PTX was injected and 100 ⁇ g of PBS was injected intraperitoneally once daily from the 7th to the 15th day.
  • dNP2-ctCTLA-4 group (positive control group 1): PTX was injected and dNP2-ctCTLA-4_WT (100 ⁇ g) of SEQ ID NO: 15 was injected intraperitoneally once daily from the 7th to the 15th day.
  • TAT-ctCTLA-4 group (positive control group 2): PTX was injected and the TAT-ctCTLA-4 peptide (100 ⁇ g) of SEQ ID NO: 16 was injected intraperitoneally once daily from the 7th to the 15th day.
  • dNP2-KSY group intraperitoneal injection of the dNP2-KSY peptide (100 ⁇ g) of SEQ ID NO: 25 once daily from the 7th to the 15th day after PTX injection.
  • dNP2-K group intraperitoneal injection of the dNP2-K1 peptide of SEQ ID NO: 27 (100 ⁇ g) once daily from the 7th to the 15th day after PTX injection.
  • FIG. 7 is a diagram showing the structure of dNP2-ctCTLA-4 (WT), dNP2, and dNP2-ctCTLA-4 deletion mutants (KSYPQ, KSYP, KSY, KS, K), and FIG. 8 is splenocytes isolated from mice.
  • Flow cytometry results of IL-17A and foxp3 for eight groups (Th17, dNP2, dNP2-ctCTLA4, KSYPQ, KSYP, KSY, KS, K) treated with Th17 cells differentiated from Flow cytometry results of CD4 + IL-17A + T cells and CD4 + foxp3 + T cells against dNP2, dNP2-ctCTLA4, KSYPQ, KSYP, KSY, KS, K).
  • Figure 10 is a graph showing the clinical symptoms evaluation results of the multiple sclerosis animal model for five groups (PBS, dNP2-ctCTLA-4, TAT-ctCTLA-4, dNP2-KSY, dNP2-K),
  • Figure 11 is a graph showing the five groups ( It is a graph showing the analysis of the number of immune cells (Th1, Th17, Treg) against PBS, dNP2-ctCTLA-4, TAT-ctCTLA-4, dNP2-KSY, dNP2-K).
  • This experiment is to confirm the function of dNP2-ctCTLA-4, dNP2, and dNP2-ctCTLA-4 variants (K, S, Y1, P, Y2). The degree of suppression of immune response was analyzed.
  • dNP2-ctCTLA-4 WT
  • dNP2, dNP2-ctCTLA-4 variants K, S, Y1, P, Y2
  • AnyGen AnyGen, Kwangju, Korea
  • SPPS solid-phase peptide synthesis
  • Th17 group (control): Anti-CD3 and anti-CD28-activated CD4 T cells were treated with PBS (2 ⁇ M) with cytokine cocktail.
  • dNP2 group (Control 2): Anti-CD3 and anti-CD28-activated CD4 T cells were treated with the dNP2 peptide of SEQ ID NO: 18 (2 ⁇ M) together with a cytokine cocktail.
  • dNP2-ctCTLA-4 group (positive control group): Anti-CD3 and anti-CD28-activated CD4 T cells were treated with (dNP2-ctCTLA-4)_WT (2 ⁇ M) of SEQ ID NO: 15 together with a cytokine cocktail.
  • Group K Anti-CD3 and anti-CD28 activated CD4 T cells were treated with the K1 peptide of SEQ ID NO: 28 (2 ⁇ M) with a cytokine cocktail.
  • Anti-CD3 and anti-CD28 activated CD4 T cells were treated with the S peptide of SEQ ID NO: 29 (2 ⁇ M) with a cytokine cocktail.
  • Y1 group Anti-CD3 and anti-CD28 activated CD4 T cells were treated with Y1 peptide of SEQ ID NO: 30 (2 ⁇ M) with a cytokine cocktail.
  • Anti-CD3 and anti-CD28 activated CD4 T cells were treated with the P peptide of SEQ ID NO: 31 (2 ⁇ M) with a cytokine cocktail.
  • Y2 group Anti-CD3 and anti-CD28 activated CD4 T cells were treated with Y2 peptide of SEQ ID NO: 32 (2 ⁇ M) with a cytokine cocktail.
  • FIG. 12 is a view showing the structures of dNP2-ctCTLA-4, dNP2, dNP2-ctCTLA-4 variants (K, S, Y1, P, Y2)
  • FIG. 13 is Th17 differentiated from splenocytes isolated from mice.
  • Flow cytometry results of IL-17A and foxp3 for eight groups (Th17, dNP2, dNP2-ctCTLA-4, K, S, Y1, P, Y2) treated with cells
  • FIG. 14 shows the eight groups (Th17, dNP2, Flow cytometry results of CD4 + IL-17A + T cells and CD4 + foxp3 + T cells against dNP2-ctCTLA-4, K, S, Y1, P, Y2).
  • the K group consisting of only a K motif exhibited a similar level of immune response inhibitory activity to the dNP2-ctCTLA4 group. It was confirmed that the other S group, Y1 group, P group and Y2 group did not show a significant difference from the dNP2 group or the Th17 group. It was confirmed that the K motif plays a major role in suppressing the immune response.
  • This experiment was to confirm the function of the K motif of dNP2-ctCTLA-4, and the K motif of dNP2-ctCTLA-4 was prepared and the degree of suppression of the immune response was analyzed.
  • dNP2-ctCTLA-4, K1 peptide of SEQ ID NO: 28, K variants of SEQ ID NOs: 2, 4 to 6 were prepared as shown in Table 6 below. designed.
  • dNP2-ctCTLA-4 (WT), K1 peptide of SEQ ID NO: 28 was commissioned by AnyGen (Kwangju, Korea) and produced by solid-phase peptide synthesis (SPPS).
  • Example 2 The specific manufacturing process is the same as in Example 1, and the K variants (K2(G4S), K3(no linker), K3(G4S), K3(GG)) of SEQ ID NOs: 2, 4, 5, and 6 are in Example 2, Examples 4, 5 and 6 were used. The purity of the peptides prepared in this experiment was also confirmed to be 95% or more.
  • 'K1' is a peptide represented by pure SEQ ID NO: 28 without any modifications in which D-type or L-type amino acids are substituted, added, or deleted, and no additional materials such as fatty acids and linkers are attached to the terminal. Pure peptides were used.
  • KMLKKRS K2(G4S) (Example 2) 2 KMLKKRSGGGGSKMLKKRS K3 (no linker) (Example 4) 4 KMLKKRSKMLKKRSKMLKKRS K3 (G4S) (Example 5) 5 KMLKKRSGGGGSKMLKKRSGGGGSKMLKKRS K3(GG) (Example 6) 6 KMLKKRSGGKMLKKRSGGKMLKKRS
  • Th17 group (control): Anti-CD3 and anti-CD28-activated CD4 T cells were treated with PBS (2 ⁇ M) with cytokine cocktail.
  • dNP2-ctCTLA-4 group (positive control group 1): Anti-CD3 and anti-CD28-activated CD4 T cells were treated with dNP2-ctCTLA-4 (2 ⁇ M) of SEQ ID NO: 15 together with a cytokine cocktail.
  • AP-ctCTLA-4 group (positive control group 2): Anti-CD3 and anti-CD28-activated CD4 T cells were treated with AP-ctCTLA-4 (2 ⁇ M) of SEQ ID NO: 17 together with a cytokine cocktail.
  • K1 group Anti-CD3 and anti-CD28 activated CD4 T cells were treated with the K1 peptide of SEQ ID NO: 28 (2 ⁇ M) with a cytokine cocktail.
  • K2(G4S) group Anti-CD3 and anti-CD28 activated CD4 T cells were treated with the K2(G4S) peptide of SEQ ID NO: 2 (2 ⁇ M) with a cytokine cocktail.
  • K3 (no linker) group Anti-CD3 and anti-CD28-activated CD4 T cells were treated with the K3 (no linker) peptide of SEQ ID NO: 4 (2 ⁇ M) together with a cytokine cocktail.
  • K3(G4S) group Anti-CD3 and anti-CD28-activated CD4 T cells were treated with the K3(G4S) peptide of SEQ ID NO: 5 (2 ⁇ M) with a cytokine cocktail.
  • K3(GG) group Anti-CD3 and anti-CD28 activated CD4 T cells were treated with the K3(GG) peptide of SEQ ID NO: 6 (2 ⁇ M) with a cytokine cocktail.
  • Experimental Method 2 the efficacy in an animal model of multiple sclerosis was analyzed.
  • samples were prepared in five groups (Th17, dNP2-ctCTLA-4 , K1, K2 (G4S), K3 (no linker)).
  • PBS group (control group): PTX was injected and 100 ⁇ g of PBS was injected intraperitoneally once a day from the 7th to the 18th day.
  • dNP2-ctCTLA-4 group (positive control group 1): PTX was injected and dNP2-ctCTLA-4_WT (100 ⁇ g) of SEQ ID NO: 15 was injected intraperitoneally once daily from the 7th to the 18th day.
  • K1 group (positive control group 2): PTX was injected and the K1 peptide of SEQ ID NO: 28 (100 ⁇ g) was injected intraperitoneally once daily from the 7th to the 18th day.
  • K2(G4S) group intraperitoneal injection of the K2(G4S) peptide (100 ⁇ g) of SEQ ID NO: 2 once daily from the 7th to the 18th day after PTX injection.
  • K3 (no linker) group PTX was injected and the K3 peptide (100 ⁇ g) of SEQ ID NO: 4 was intraperitoneally injected once daily from the 7th to the 18th.
  • Figure 16 is a view showing the differentiation from splenocytes isolated from mice Flow cytometry analysis of IL-17A and foxp3 for seven groups (Th17, dNP2-ctCTLA-4, K1, K2(G4S), K3(G4S), K3(GG), K3(no linker)) treated with Th17 cells.
  • Figure 17 shows eight groups (Th17, dNP2-ctCTLA-4 (WT), AP-ctCTLA-4, K1, K2 (G4S), K3 (G4S), K3 (GG), K3 (no linker)) Flow cytometry results of CD4 + IL-17A + T cells and CD4 + foxp3 + T cells.
  • Example 2 when a cell-penetrating peptide (CPP) such as dNP2 is removed and a peptide linking two and three K motifs is used (Example 2, Example 4), It can be confirmed that the immune cell inhibitory activity is significantly superior to that of the K1 group. That is, unlike dNP2-ctCTLA4, it was confirmed that the K2 peptide and K3 peptide had a remarkably excellent inhibitory effect on the immune response even without CPP. On the other hand, it was confirmed that the K1 peptide did not show a significant difference from Th17 (control) without CPP.
  • CPP cell-penetrating peptide
  • FIG. 18 is a graph showing clinical symptoms evaluation results of multiple sclerosis animal models for five groups (PBS, dNP2-ctCTLA-4, K1, K2 (G4S), K3 (no linker)), and FIG. 19 is a graph showing five groups (PBS).
  • dNP2-ctCTLA-4, K1, K2 (G4S), K3 (no linker) is a graph showing the analysis of the number of immune cells (Th1, Th17, Treg).
  • the clinical sign evaluation in the K2 (G4S) group and the K3 (no linker) group was significantly significantly superior to that of the K1 group.
  • the number of lymphocytes infiltrating the spinal cord was significantly lower in the K2 (G4S) group and the K3 (no linker) group than in the K1 group.
  • the number of Treg cells in the K2 (G4S) group and the K3 (no linker) group is higher than that in the K1 group. That is, even if the K motif (motif) alone does not show a significant effect on the multiple sclerosis animal model, it can be seen that the K2, K3 peptides show a remarkably significant effect on the multiple sclerosis in vivo.
  • Th17 group (Control 1): Anti-CD3 and anti-CD28-activated CD4 T cells were treated with PBS (2 ⁇ M) with cytokine cocktail.
  • dNP2-ctCTLA-4 group (positive control): Anti-CD3 and anti-CD28-activated CD4 T cells were treated with dNP2-ctCTLA-4 (2 ⁇ M) of SEQ ID NO: 15 together with a cytokine cocktail.
  • K2 group Anti-CD3 and anti-CD28-activated CD4 T cells were treated with the K2 peptide of SEQ ID NO: 1 (2 ⁇ M) with a cytokine cocktail.
  • K3 group Anti-CD3 and anti-CD28 activated CD4 T cells were treated with the K3 peptide of SEQ ID NO: 4 (2 ⁇ M) with a cytokine cocktail.
  • AP-K2 group Anti-CD3 and anti-CD28 activated CD4 T cells were treated with the AP-K2 peptide of SEQ ID NO: 9 (2 ⁇ M) with a cytokine cocktail.
  • AP-K3 group Anti-CD3 and anti-CD28-activated CD4 T cells were treated with the AP-K3 peptide of SEQ ID NO: 10 (2 ⁇ M) with a cytokine cocktail.
  • PBS group (control group): PTX was injected and 100 ⁇ g of PBS was injected intraperitoneally once daily from the 7th to the 15th day.
  • dNP2-ctCTLA-4 group (positive control group 1): PTX was injected and dNP2-ctCTLA-4 (100 ⁇ g) of SEQ ID NO: 15 was injected intraperitoneally once daily from the 7th to the 15th day.
  • AP group PTX was injected and the AP peptide of SEQ ID NO: 19 (100 ⁇ g) was injected intraperitoneally once daily from the 7th to the 13th day.
  • dNP2 group intraperitoneal injection of dNP2 peptide of SEQ ID NO: 18 (100 ⁇ g) once daily from day 7 to day 13 after PTX injection.
  • AP-K2 group PTX was injected and the AP-K2 peptide of SEQ ID NO: 9 (100 ⁇ g) was intraperitoneally injected once daily from the 7th to the 13th day.
  • AP-K3 group PTX was injected and the AP-K3 peptide of SEQ ID NO: 10 (100 ⁇ g) was intraperitoneally injected once daily from the 7th to the 13th day.
  • FIG. 20 is a view showing the structures of dNP2-ctCTLA-4, K2 peptide of SEQ ID NO: 1, K3 peptide of SEQ ID NO: 4, AP-K2 peptide of SEQ ID NO: 9, and AP-K3 peptide of SEQ ID NO: 10;
  • FIG. flow cytometry of IL-17A and foxp3 for six groups (Th17 (control), dNP2-ctCTLA-4, K2, K3, AP-K2, AP-K3) treated with Th17 cells differentiated from splenocytes isolated from mice. analysis result.
  • the K2 group and the K3 group had a significantly superior immune response inhibitory effect than the PBS (control group).
  • the AP-K2 group and the AP-K3 group combined with a cell penetrating peptide (CPP) such as AP, it was confirmed that they had a significantly superior immune response inhibitory effect than the PBS (control group).
  • CPP cell penetrating peptide
  • AP-K2 group and the AP-K3 group Unlike the -ctCTLA-4 group, it was confirmed that they had an equivalent effect even though they did not contain CPP, and the AP-K2 group and AP-K3 group showed significantly superior IL-17 cytokine inhibitory effect than the dNP2-ctCTLA-4 group. You can check what you have.
  • Figure 22 is a graph showing the clinical symptoms evaluation results of the multiple sclerosis animal model for six groups (PBS (control), dNP2-ctCTLA-4, dNP2, AP, AP-K2, AP-K3)
  • Figure 23 is a graph showing the six groups (PBS (control), dNP2-ctCTLA-4, dNP2, AP, AP-K2, AP-K3) is a graph showing the analysis of the number of infiltrated lymphocytes and immune cells (Treg).
  • the number of lymphocytes infiltrating the spinal cord was significantly lower in the AP-K2 group and the AP-K3 group than in the PBS (control group), and it can be confirmed that the number of lymphocytes infiltrating the spinal cord was significantly lower than that of the dNP2 and AP groups.
  • Tregs regulatory T cells
  • PBS control group
  • K2 and K3 peptides alone have a preventive or therapeutic effect on autoimmune diseases, but complexes with cell-permeable peptides also have excellent therapeutic effects on autoimmune diseases.
  • This experiment analyzed the degree of suppression of immune response of K2 and K3 peptides modified with fatty acids.
  • dNP2-ctCTLA-4, K2, K3, Myr-K2, and Myr-K3 were designed as shown in Table 8 below, and prepared according to Examples 1, 4, 15, and 16.
  • Myr-K2 and Myr-K3 are fatty acid-modified peptides prepared in Examples 15 and 16. In this case, Myr means myristic acid.
  • Th17 group (control): Anti-CD3 and anti-CD28-activated CD4 T cells were treated with PBS (2 ⁇ M) with cytokine cocktail.
  • dNP2-ctCTLA-4 group (positive control group): Anti-CD3 and anti-CD28-activated CD4 T cells were treated with (dNP2-ctCTLA-4)_WT (2 ⁇ M) of SEQ ID NO: 15 together with a cytokine cocktail.
  • K2 group Anti-CD3 and anti-CD28-activated CD4 T cells were treated with the K2 peptide of SEQ ID NO: 1 (2 ⁇ M) with a cytokine cocktail.
  • K3 group Anti-CD3 and anti-CD28 activated CD4 T cells were treated with the K3 peptide of SEQ ID NO: 4 (2 ⁇ M) with a cytokine cocktail.
  • Myr-K2 group Anti-CD3 and anti-CD28 activated CD4 T cells were treated with Myr-K2 of Example 15 (2 ⁇ M) with a cytokine cocktail.
  • Myr-K3 group Anti-CD3 and anti-CD28-activated CD4 T cells were treated with Myr-K3 of Example 16 (2 ⁇ M) with a cytokine cocktail.
  • PBS group (control group): PTX was injected and 100 ⁇ g of PBS was injected intraperitoneally once daily from the 7th to the 13th day.
  • dNP2-ctCTLA-4 group (positive control group): intraperitoneal injection of (dNP2-ctCTLA-4)_WT (100 ⁇ g) of SEQ ID NO: 15 from 7 days to 13 days after PTX injection once daily.
  • K2 group PTX was injected and the K2 peptide of SEQ ID NO: 1 (100 ⁇ g) was intraperitoneally injected once daily from the 7th to the 13th day.
  • AP-K2 group PTX was injected and the AP-K2 peptide of SEQ ID NO: 9 (100 ⁇ g) was intraperitoneally injected once daily from the 7th to the 13th day.
  • Myr-K2 group PTX was injected and Myr-K2 (100 ⁇ g) of Example 15 was intraperitoneally injected once daily from the 7th to the 13th day.
  • Myr-K2 group PTX was injected and Myr-K3 (100 ⁇ g) of Example 16 was intraperitoneally injected once daily from the 7th to the 13th day.
  • FIG. 24 is a diagram showing the structures of dNP2-ctCTLA-4 (WT), the K2 peptide of SEQ ID NO: 1, the K3 peptide of SEQ ID NO: 4, the AP-K2 peptide of Example 15, and the AP-K3 peptide of Example 16;
  • FIG. 25 shows IL-17A and the six groups (Th17 (control), dNP2-ctCTLA-4, K2, K3, Myr-K2, Myr-K3) treated with Th17 cells differentiated from splenocytes isolated from mice. This is the result of flow cytometry analysis of foxp3.
  • the K2 group and the K3 group had a significantly superior immune response inhibitory effect than the PBS group. It was confirmed that Myr-K2 and Myr-K3, in which K2 and K3 peptides were bound with fatty acids as carriers, also had a significantly superior immune response inhibitory effect than the PBS group. It can be seen that the inhibitory effect is significantly and remarkably excellent.
  • Figure 26 is a graph showing the clinical symptoms evaluation results of the multiple sclerosis animal model for six groups (Th17, dNP2-ctCTLA-4, K2, AP-K2, Myr-K2, Myr-K3)
  • Figure 27 is a graph showing the six groups ( Th17, dNP2-ctCTLA-4, K2, AP-K2, Myr-K2, Myr-K3) for infiltrating lymphocytes and immune cells (Treg) is a graph showing the analysis of the number.
  • the number of lymphocytes infiltrating the spinal cord is significantly lower than that of PBS (control) in all groups using Myr-K2 and Myr-K3 as well as the K2 group and AP-K2 group.
  • the AP-K2 group and the Myr-K3 group had the most excellent effect, and in particular, it can be confirmed that the Myr-K3 group inhibited it at a lower level than the dNP2-ctCTLA-4 group.
  • the group using Myr-K2 and Myr-K3 suppressed the expression of Il-17 T cells and IFN- ⁇ T cells more than PBS (control), and induces an increase in Foxp3 T cells. that can be checked In particular, it can be confirmed that the group using Myr-K3 inhibited at a lower level than the dNP2-ctCTLA-4 group.
  • dNP2-ctCTLA-4, Myr-K3 , Myr-K3D, Pal-K3, Myr-Ap-K2D, Pal-Ap-K2D were prepared and experiments were performed.
  • dNP2-ctCTLA-4 was prepared in the same manner as in Experimental Example 1, and Myr-K3, Myr-K3D, Pal-K3, Myr-Ap-K2D, Pal-Ap-K2D was prepared in Examples 16 and 17. , Example 18, Example 19 and Example 20.
  • Th17 group (Control 1): Anti-CD3 and anti-CD28-activated CD4 T cells were treated with PBS (2 ⁇ M) with cytokine cocktail.
  • dNP2-ctCTLA-4 group (positive control group): Anti-CD3 and anti-CD28-activated CD4 T cells were treated with (dNP2-ctCTLA-4)_WT (2 ⁇ M) of SEQ ID NO: 15 together with a cytokine cocktail.
  • Myr-K3 group Anti-CD3 and anti-CD28-activated CD4 T cells were treated with Myr-K3 of Example 16 (2 ⁇ M) with a cytokine cocktail.
  • Myr-K3D group Anti-CD3 and anti-CD28-activated CD4 T cells were treated with Myr-K3D of Example 17 (2 ⁇ M) with a cytokine cocktail.
  • Pal-K3 group Anti-CD3 and anti-CD28 activated CD4 T cells were treated with Pal-K3 of Example 18 (2 ⁇ M) with a cytokine cocktail.
  • Myr-AP-K2D group Anti-CD3 and anti-CD28 activated CD4 T cells were treated with Myr-AP-K2D of Example 19 (2 ⁇ M) with a cytokine cocktail.
  • Pal-AP-K2D group Anti-CD3 and anti-CD28 activated CD4 T cells were treated with Pal-AP-K2D of Example 20 (2 ⁇ M) with a cytokine cocktail.
  • the Myr-K3D group, Myr-Ap-K2D group, and Pal-AP-K2D group having D-amino acid residues significantly increased the expression of Treg cells than the PBS group.
  • the K3 peptide has a remarkably excellent immune response inhibitory effect even when either myristic acid (Myr) or palmitic acid (Pal) is used. It was confirmed that palmitic acid is easy to mass-produce among fatty acids, but the effect does not disappear even when combined with palmitic acid, and excellent efficacy is maintained.
  • mutants in which some amino acid residues are substituted with alanine in the AP-K2 peptide of SEQ ID NO: 9 were designed as shown in SEQ ID NOs: 42 to 48, and It was commissioned by Gen (AnyGen, Kwangju, Korea) and produced by solid-phase peptide synthesis (SPPS). The specific manufacturing process is the same as in Example 1, and the purity of the peptides prepared in this experiment was also confirmed to be 95% or more.
  • both lysine residues and arginine residues which are expected to perform a major function in the AP-K2 peptide, are substituted with alanine (A) and used as a negative control.
  • tjdufqjsgh 19 was used as a comparison group (AP-K2 KA used in this experimental example is a different peptide from dNP2-KA of SEQ ID NO: 19).
  • SEQ ID NO: 9 AP-K2
  • SEQ ID NO: 42 AP-K2 KA
  • SEQ ID NO: 43 AP-K2 1KA
  • SEQ ID NO: 45 AP-K2 LA
  • SEQ ID NO: 46 AP-K2 2KA
  • SEQ ID NO: 47 AP-K2 3KA
  • SEQ ID NO: 48 AP-K2 RA
  • SEQ ID NO: 49 AP-K2 SA
  • Th17 group (PBS; control): Anti-CD3 and anti-CD28-activated CD4 T cells were treated with PBS with a cytokine cocktail in the same volume as the positive control group.
  • AP-K2 group (positive control group): Anti-CD3 and anti-CD28 activated CD4 T cells were treated with AP-K2 of SEQ ID NO: 9 (2 ⁇ M) together with a cytokine cocktail.
  • AP group anti-CD3 and anti-CD28 activated CD4 T cells were treated with the AP of SEQ ID NO: 19 (2 ⁇ M) with a cytokine cocktail.
  • AP-K2 KA group Anti-CD3 and anti-CD28 activated CD4 T cells were treated with AP-K2 KA of SEQ ID NO: 41 (2 ⁇ M) with a cytokine cocktail.
  • AP-K2 IKA group Anti-CD3 and anti-CD28 activated CD4 T cells were treated with AP-K2 IKA of SEQ ID NO: 42 (2 ⁇ M) with a cytokine cocktail.
  • AP-K2 MA group Anti-CD3 and anti-CD28 activated CD4 T cells were treated with AP-K2 MA of SEQ ID NO: 43 (2 ⁇ M) with a cytokine cocktail.
  • AP-K2 LA group Anti-CD3 and anti-CD28 activated CD4 T cells were treated with AP-K2 LA of SEQ ID NO: 44 (2 ⁇ M) with a cytokine cocktail.
  • AP-K2 2KA group Anti-CD3 and anti-CD28 activated CD4 T cells were treated with AP-K2 2KA of SEQ ID NO: 45 (2 ⁇ M) with a cytokine cocktail.
  • AP-K2 3KA group Anti-CD3 and anti-CD28 activated CD4 T cells were treated with AP-K2 3KA of SEQ ID NO: 46 (2 ⁇ M) with a cytokine cocktail.
  • AP-K2 RA group Anti-CD3 and anti-CD28 activated CD4 T cells were treated with AP-K2 RA of SEQ ID NO: 47 (2 ⁇ M) with a cytokine cocktail.
  • AP-K2 SA group Anti-CD3 and anti-CD28 activated CD4 T cells were treated with AP-K2 SA of SEQ ID NO: 48 (2 ⁇ M) with a cytokine cocktail.
  • FIG. 29 shows eleven groups (Th17, AP-K2, AP, AP-K2 KA, AP-K2 IKA, AP-K2 MA, AP-K2 LA, AP-) treated with Th17 cells differentiated from splenocytes isolated from mice.
  • Th17 Flow cytometry results of IL-17A and foxp3 against K2 2KA, AP-K2 3KA, AP-K2 RA, AP-K2 SA), and FIG.
  • FIG. 30 shows eleven groups (Th17, AP-K2, AP, AP-K2 KA, CD4 + IL-17A + T cells (a), CD4 against AP-K2 IKA, AP-K2 MA, AP-K2 LA, AP-K2 2KA, AP-K2 3KA, AP-K2 RA, AP-K2 SA) + foxp3 + T cells (b) are the result of flow cytometry.
  • the AP-K2 group increases Foxp3 by about 5 times or more and IL-17 decreases by half or less, so the AP-K2 peptide of the present invention ( SEQ ID NO: 9) can be confirmed to exhibit an excellent effect on suppressing the immune response.
  • the AP-K2 function is slightly decreased in the AP-K2 KA group, and since the AP-K2 function was significantly decreased in the AP-K2 1KA and AP-K2 RA groups, it was the first among AP-K2 It can be seen that the th lysine residue and arginine residue play a major role in suppressing the immune response.
  • the AP-K2 LA group also slightly decreases the AP-L2 function, and thus it can be confirmed that the leucine residue in the AP-K2 also performs a major function.
  • the AP-K2 SA group, the AP-K2 2KA group, the AP-K2 3KA group and the AP-K2 MA group show IL-17 reduction and Foxp3 increase activity in the order, serine residues in the K2 motif, the second and three It can be confirmed that the second lysine residue and the methionine residue are involved in the suppression of the immune response in the order.

Landscapes

  • Chemical & Material Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Immunology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Veterinary Medicine (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Analytical Chemistry (AREA)
  • Transplantation (AREA)
  • Neurology (AREA)
  • Biomedical Technology (AREA)
  • Neurosurgery (AREA)
  • Hospice & Palliative Care (AREA)
  • Psychiatry (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)

Abstract

본 발명은 CTLA4 유래 조절 T 세포 유도 펩타이드를 기반으로 하는 자가면역 질환 예방 또는 치료용 조성물에 관한 것으로서 염증성 사이토카인을 생성 및 분비하는 세포 독성 Th17 세포로의 분화를 억제하고, 면역조절 T 세포(Treg)로의 분화를 증가시키는 효과가 우수하여 각종 면역반응의 조절 이상으로 유발되는 자가면역 질환을 예방 또는 치료할 수 있는 약학 조성물로 유용하게 활용될 수 있다.

Description

조절 T 세포 유도 펩타이드 및 이를 포함하는 자가면역 질환 예방 또는 치료용 조성물
본 발명은 조절 T 세포 유도 펩타이드를 기반으로 하는 자가면역 질환 예방 또는 치료용 조성물에 관한 것이다.
자가면역 질환은 인체의 면역계가 이상을 일으키는 것이다. 정상적인 면역 반응은 병원체와 같은 외부 항원으로부터 우리 몸을 보호하는 작용을 나타내지만, 자가 면역반응은 자기 세포를 외부 항원으로 인식하여 우리면역계가 스스로의 기관이나 조직을 공격하게 되어 인체에 여러 가지 질병을 일으킨다.
자가면역 질환은 류마티스 관절염, 루푸스가 대표적인 자가면역질환으로 알려져 있으며, 전신성 경피증, 아토피 피부염, 다발성 경화증, 그레이브스병, 하시모토병 외에도 크론병, 베체트병, 쇼그렌증후군, 굴랑베레증후군 등의 희귀병으로 알려진 질병들이 자가면역질환으로 진단받고 있다. 현재 미국국립보건원은 자가면역질환의 종류가 80가지라고 보고하고 있으며, 대체로 남성보다는 여성에게서 많이 나타난다고 보고되고 있다. 최근 '면역계의 Th17 세포 및 조절 T 세포 (Treg 세포)가 정상적인 인체 면역반응의 관용성(tolerance)을 깨고 자가 면역반응을 일으키는데 중요한 역할을 나타낸다.'는 연구가 발표되면서, 자가면역 질환에 관한 연구가 더욱 확대되고 활발해졌다.
전신성 자가면역 질환(Systemic Autoimmune Diseases)은 비정상적으로 활성화된 면역체계가 신체의 다양한 기관을 침범하여 공격하는 질환으로 항체가 여러 조직 및 기관을 자기항원으로 인식하여 자기 세포를 파괴하는 특징을 가진다. 전신성 자가면역 질환은 특히 결합조직의 이상을 초래하여 전신에 염증을 일으키는데, 류마티스 관절염(rheumatoid arthritis), 전신성 홍반성 낭창(systemic lupus erythematosus), 쇼그렌 증후군(Sjogren's syndrome), 혼합결합조직병(mixed connective tissue disease) 등이 여기에 속한다.
국소성 자가면역 질환((Localized Autoimmune Diseases)(또는 장기특이성 자가면역질환)은 체내 면역 시스템이 특정 장기를 공격하여 정상 세포를 손상시킴에 따라 발생할 수 있는 질병을 말한다. 장기특이성 자가면역 질환은 장기의 특이 항원에 대하여 비정상적인 면역반응이 일어남으로써 생기며, 우리 몸의 거의 모든 장기에서 생길 수 있다. 이와 같은 자가면역 질환에 의한 장기손상은 T세포에 의하여 일어날 수도 있고 자가항체(autoantibodies)에 의하여 일어날 수도 있다.
다발성 경화증은 뇌, 척수, 그리고 시신경을 포함하는 중추신경계에 발생하는 만성 신경면역계 질환(chronic neuroimmunologic disorder)이다. 이 질환의 기전은 정확하게 알려지지는 않았지만 T세포에 의한 자가면역질환으로 신경을 둘러싸고 있는 수초가 손상되어 뇌로부터 신체의 여러 부분으로 신경전도 전달이 방해되면서 나타나는 다양한 증상으로, 탈수초성질환(demyelinating disease; 신경세포의 축삭을 둘러싸고 있는 절연물질인 수초가 탈락되는 질병)에 해당된다.
다발성 경화증은 재발완화형 다발성 경화증(relapsing remitting multiple sclerosis: RRMS), 2차 진행형 다발성 경화증(secondary-progressive multiple sclerosis: SPMS), 원발성 진행형 다발성 경화증(primary progressive multiple sclerosis: PPMS), 진행성 재발형 다발성 경화증(progressive-relapsing multiple sclerosis: PRMS)으로 구분될 수 있다.
크론병(Crohn's Disease)은 입에서 항문까지 소화관 전체에 걸쳐 어느 부위에서든지 발생할 수 있는 만성 염증성 장 질환이다. 궤양성 대장염과 달리 염증이 장의 모든 층을 침범하며, 병적인 변화가 분포하는 양상이 연속적이지 않고 드문드문 나타나는 경우가 많다. 대장과 소장이 연결되는 부위인 회맹부에 질환이 발행하는 경우가 가장 흔하며 그 다음으로 대장, 회장 말단부, 소장 등에서 흔히 발생한다.
갑상선염의 두 개의 주요 자가면역질환에는 하시모토병(Hashimoto's disease)과 그레이브스병(Grave's disease)이 있다.
건선(Psoriasis)은 피부 상피(epidermis)의 많은 부분을 차지하는 형태의 각질형성세포(keratinocyte)에 영향을 미치는 비전염성 만성 피부질환이다.
현재 자가면역질환 치료기술 수준은 항염증제나 스테로이드제제 등으로 증상을 완화시키거나 진행을 늦추는 정도로서 대개 경험적인 효과에 의존하는 접근 방식으로, 발병 원인을 없애는 근본 치료 기술은 없는 실정이다. 자가 면역질환이 심한 경우에는 면역억제제를 투여하여 면역기능을 약화시키는 방법이 선택되기도 하지만, 이와 같은 치료 기술은 건강한 성인이 막아낼 수 있는 세균 등에 대해 방어하는 면역성도 함께 억제되기 때문에 감염성 질환에 치명적인 결과를 가져오는 부작용이 있어 장기간 사용하는데 문제가 있다.
이러한 자가면역질환은 조절 T 세포의 수 및 기능이 감소되어 있는 것으로 알려져 있으며, 생체 내에서 조절 T 세포를 유도하는 것이 주요한 치료 전략으로 여겨져 왔다.
본 발명의 목적은 조절 T 세포 유도 펩타이드를 제공하는데 있다.
또한 본 발명의 다른 목적은 조절 T 세포 유도 펩타이드를 유효성분으로 함유하는 자가면역 질환 치료 및 예방을 위한 약학적 용도를 제공하는데 있다.
상기 목적을 달성하기 위하여, 본 발명은 하기 서열로 표시되는 조절 T 세포 유도 펩타이드를 제공한다.
[Lys-Xaa1-Leu-Xaa2-Xaa3-Arg-Xaa4]n
상기 서열에서,
Xaa1, Xaa2, Xaa3 및 Xaa4는 각각 독립적으로, 알라닌(alanine; A), 발린(Valine; V), 이소류신(isoleucine; I), 류신(leucine; L), 메티오닌(methionine; M), 페닐알라닌(phenylalanine; F), 티로신(tyrolsine; Y), 트립토판(trypotophan; W), 리신(lysine; K), 아르기닌(arginine; R), 히스티딘(histidine; H), 세린(serine; S), 트레오닌(threonine; T), 아스파라긴(asparagine, N), 글루타민(glutamine; Q), 아스파르트산(aspartate, D), 글루탐산(glutamate, E), 시스테인(cysteine, C), 글리신(glycine, G) 및 프롤린(proline, P)로 이루어진 아미노산 잔기 중에서 선택되는 어느 하나이고, n은 2 내지 3의 정수이고,
상기 서열 중에서 선택되는 어느 하나 이상의 아미노산 잔기는 L 형 또는 D 형 아미노산 잔기이다.
상기 서열에서, Xaa1은 알라닌(alanine; A), 발린(Valine; V), 이소류신(isoleucine; I), 류신(leucine; L), 메티오닌(methionine; M), 페닐알라닌(phenylalanine; F), 티로신(tyrolsine; Y), 트립토판(trypotophan; W)로 이루어진 소수성 아미노산 잔기 중에서 선택되는 어느 하나일 수 있다.
상기 서열에서, Xaa2 및 Xaa3은 각각 독립적으로 리신(lysine; K), 아르기닌(arginine; R), 히스티딘(histidine; H)로 이루어진 염기성 아미노산; 및 알라닌(alanine; A)중에서 선택되는 어느 하나일 수 있다.
상기 서열에서, Xaa4는 세린(serine; S), 트레오닌(threonine; T), 아스파라긴(asparagine, N), 글루타민(glutamine; Q)로 이루어진 극성 아미노산; 및 알라닌(alanine; A) 중에서 선택되는 어느 하나일 수 있다.
상기 서열에서, Xaa1은 메티오닌(methionine; M)일 수 있다.
상기 서열에서, Xaa2 및 Xaa3은 리신(lysine; K)일 수 있다.
상기 서열에서 Xaa4는 세린(serine; S)일 수 있다.
상기 서열에서 첫 번째 위치, 두 번째 위치, 여섯 번째 위치 및 일곱 번째 위치의 아미노산 잔기 중에서 선택되는 어느 하나 이상의 아미노산 잔기는 D형 아미노산일 수 있다.
상기 서열에서 여섯 번째 위치 및 일곱 번째 위치의 아미노산 잔기는 D형 아미노산일 수 있다.
상기 조절 T 세포 유도 펩타이드는 링커를 더 포함하는 것일 수 있다.
상기 링커는 (GGGGS)m(m=1~4), (GG)m(m=1~4), (GSSGGS)m(m=1~4), (EAAAK)m(m=1~4), PAPAP, (AP)m(m=1~4), A(EAAAK)m(m=1~4), (RR)m(m=1~4) 및 GFLG로 이루어진 군으로부터 선택되는 어느 하나 이상일 수 있다.
상기 조절 T 세포 유도 펩타이드의 N 또는 C 말단에 지방산이 추가적으로 결합되어 있는 것일 수 있다.
상기 지방산은 상기 조절 T 세포 유도 펩타이드의 N 말단에 아마이드 결합으로 결합되어 있는 것일 수 있다.
상기 지방산은 탄소수 10 내지 20의 포화 또는 불포화 지방산일 수 있다.
상기 지방산은 미리스트산(Myristic acid), 스테아르산(Stearic acid), 리놀레산(Linoleic acid), 팔미트산(Palmitic acid), 올레산(Oleic acid) 및 라우르산(Lauric acid)으로 이루어진 군에서 선택되는 어느 하나 이상인 것일 수 있다.
상기 조절 T 세포 유도 펩타이드의 N 또는 C 말단에 세포투과성 펩타이드(cell penetrating peptide, CPP)가 추가적으로 결합되어 있는 것일 수 있다.
상기 세포투과성 펩타이드는 서열번호 18로 표시되는 dNP2, 서열번호 19로 표시되는 AP, TAT(HIV 1 trans-activating protein), 6 내지 8개 아르기닌을 갖는 폴리아르기닌 폴리펩티드, 7 내지 11개의 리신을 갖는 폴리리신 폴리펩티드 및 iRGD(internalizing RGD)로 이루어진 군에서 선택되는 어느 하나 이상일 수 있다.
상기 조절 T 세포 유도 펩타이드는 서열번호 1 내지 6, 서열번호 11, 서열번호 12 및 서열번호 50 내지 54로 이루어진 군으로부터 선택되는 어느 하나인 것일 수 있다.
상기 세포투과성 펩타이드가 결합된 조절 T 세포 유도 펩타이드는 서열번호 7 내지 10, 서열번호 13 및 서열번호 14로 이루어진 군으로부터 선택되는 어느 하나일 수 있다.
또한 본 발명은 조절 T 세포 유도 펩타이드를 유효성분으로 하는 자가면역 질환 예방 또는 치료용 약학 조성물을 제공한다.
상기 자가면역 질환은 루푸스(systemic lupus erythematosus), 류머티스 관절염(rheumatoid arthritis), 크론병(crohn disease), 궤양성 대장염(ulcerative colitis), 전신성 경피증(Progressive systemic sclerosis, Scleroderma), 아토피 피부염, 건선, 천포창, 천식, 아프타구내염, 만성 갑상선염, 염증성 장염, 다발성 경화증(multiple sclerosis), 혼합결합조직병(mixed connective tissue disease), 자가면역성 용혈성 빈혈(Autoimmune hemolytic anemia), 베체트병(Behcet's disease), 자가면역성 뇌척수염, 중증 근무력증(Myasthenia gravis), 자가면역성 갑상선염(Autoimmune thyroiditis), 결절성 다발성 동맥염(Polyarteritis nodosa), 강직성 척추염(Ankylosing spondylitis), 섬유조직염(Fibromyalgia syndrome), 쇼그렌 증후군(Sjogren's　syndrome), 자가면역성 포도막염(autoimmuneuveitis), 만성 염증성 탈수초성 다발신경병증(chronic inflammatory demyelinating polyneuropathy) 및 측두동맥염(Temporal arteritis)으로 이루어진 군으로부터 선택되는 어느 하나 이상일 수 있다.
상기 조성물은 Th17의 활성을 저해하고 Treg를 활성화시키는 것일 수 있다.
또한 본 발명은 자가면역 질환 예방 또는 치료용 의약 제조를 위한 상기 조절 T 세포 유도 펩타이드를 유효성분으로 포함하는 약학 조성물의 용도를 제공한다.
또한 본 발명은 자가면역 질환 환자에게 상기 조절 T 세포 유도 펩타이드를 유효성분으로 포함하는 약학 조성물을 투여하는 것을 포함하는 자가면역 질환의 치료방법을 제공한다.
이하에서는 첨부한 도면을 참조하여 본 발명을 설명하기로 한다. 그러나 본 발명은 여러 가지 상이한 형태로 구현될 수 있으며, 따라서 여기에서 설명하는 실시예로 한정되는 것은 아니다. 그리고 도면에서 본 발명을 명확하게 설명하기 위해서 설명과 관계없는 부분은 생략하였으며, 명세서 전체를 통하여 유사한 부분에 대해서는 유사한 도면 부호를 붙였다.
명세서 전체에서, 어떤 부분이 다른 부분과 "연결(접속, 접촉, 결합)"되어 있다고 할 때, 이는 "직접적으로 연결"되어 있는 경우 뿐 아니라, 그 중간에 다른 부재를 사이에 두고 "간접적으로 연결"되어 있는 경우도 포함한다. 또한 어떤 부분이 어떤 구성요소를 "포함"한다고 할 때, 이는 특별히 반대되는 기재가 없는 한 다른 구성요소를 제외하는 것이 아니라 다른 구성요소를 더 구비할 수 있다는 것을 의미한다.
본 명세서에서 사용한 용어는 단지 특정한 실시예를 설명하기 위해 사용된 것으로, 본 발명을 한정하려는 의도가 아니다. 단수의 표현은 문맥상 명백하게 다르게 뜻하지 않는 한, 복수의 표현을 포함한다. 본 명세서에서, "포함하다" 또는 "가지다" 등의 용어는 명세서상에 기재된 특징, 숫자, 단계, 동작, 구성요소, 부품 또는 이들을 조합한 것이 존재함을 지정하려는 것이지, 하나 또는 그 이상의 다른 특징들이나 숫자, 단계, 동작, 구성요소, 부품 또는 이들을 조합한 것들의 존재 또는 부가 가능성을 미리 배제하지 않는 것으로 이해되어야 한다.
본 발명의 일 측면은 하기 서열로 표시되는 조절 T 세포 유도 펩타이드에 관한 것이다.
[Lys-Xaa1-Leu-Xaa2-Xaa3-Arg-Xaa4]n
상기 서열에서, Xaa1, Xaa2, Xaa3 및 Xaa4는 각각 독립적으로, 알라닌(alanine; A), 발린(Valine; V), 이소류신(isoleucine; I), 류신(leucine; L), 메티오닌(methionine; M), 페닐알라닌(phenylalanine; F), 티로신(tyrolsine; Y), 트립토판(trypotophan; W), 리신(lysine; K), 아르기닌(arginine; R), 히스티딘(histidine; H), 세린(serine; S), 트레오닌(threonine; T), 아스파라긴(asparagine, N), 글루타민(glutamine; Q), 아스파르트산(aspartate, D), 글루탐산(glutamate, E), 시스테인(cysteine, C), 글리신(glycine, G) 및 프롤린(proline, P)로 이루어진 아미노산 잔기 중에서 선택되는 어느 하나이고, n은 2 내지 3의 정수이고, 상기 서열 중에서 선택되는 어느 하나 이상의 아미노산 잔기는 L 형 또는 D 형 아미노산 잔기이다.
본 발명에서 용어 '펩타이드(peptide)'는 펩타이드 결합에 의해 2개 내지 1000개의 아미노산 잔기들이 서로 결합되어 형성된 사슬 형태의 고분자를 의미하며, '폴리펩타이드'와 상호 혼용 가능한 의미이다.
본 발명에 있어서, 상기 펩타이드는 상기 아미노산 서열을 갖는 것이 바람직하지만 이에 한정되는 것은 아니다. 본 발명의 바람직한 구현예에 따르면, 상기 펩타이드는 상기 아미노산의 비율이 50% 이상, 바람직하게는 60% 이상, 보다 바람직하게는 70% 이상, 보다 바람직하게는 80% 이상, 보다 바람직하게는 90% 이상, 가장 바람직하게는 100%로 높은 것이 바람직하다.
또한, 본 발명에서 용어 '폴리뉴클레오티드(polynucleotide)'는 염기, 당, 인산의 세 가지 요소로 구성된 화학적 단량체인 뉴클레오티드가 다수의 인산에스테르 결합을 매개로 사슬 형태로 이어진 고분자 화합물을 의미한다.
본 발명의 조절 T 세포 유도 펩타이드는 CTLA4 단백질(Cytotoxic T Lymphocyte Antigen-4)에서 유래된 펩타이드로, 14개 내지 31개의 아미노산으로 구성된 펩타이드이며, 상기 아미노산 잔기 중에서 선택되는 어느 하나 이상이 L- 또는 D- 아미노산 잔기일 수 있다.
구체적으로, 상기 서열에서, Xaa1은 알라닌(alanine; A), 발린(Valine; V), 이소류신(isoleucine; I), 류신(leucine; L), 메티오닌(methionine; M), 페닐알라닌(phenylalanine; F), 티로신(tyrolsine; Y), 트립토판(trypotophan; W)로 이루어진 소수성 아미노산 중에서 선택되는 어느 하나일 수 있고, 바람직하게는 상기 서열에서, Xaa1는 메티오닌(methionine; M)인 것일 수 있다.
구체적으로, 상기 서열에서, Xaa2 및 Xaa3은 각각 독립적으로 리신(lysine; K), 아르기닌(arginine; R), 히스티딘(histidine; H)로 이루어진 염기성 아미노산 중에서 선택되는 어느 하나일 수 있고, 바람직하게는 상기 서열에서 Xaa2 및 Xaa3은 서로 동일한 아미노산일 수 있으며, 보다 바람직하게 상기 Xaa2 및 Xaa3은 리신(lysine; K)인 것일 수 있다.
또한, 상기 서열에서, Xaa4는 세린(serine; S), 트레오닌(threonine; T), 아스파라긴(asparagine, N), 글루타민(glutamine; Q)로 이루어진 극성 아미노산 중에서 선택되는 어느 하나일 수 있고, 바람직하게 Xaa4는 세린(serine; S)인 것일 수 있다.
구체적으로 가장 바람직한 조절 T 세포 유도 펩타이드는 상기 서열에서, Xaa1은 메티오닌(methionine; M)이고, Xaa2 및 Xaa3은 리신(lysine; K)이며, Xaa4는 세린(serine; S)인 것일 수 있으며, 다음 일반식 2와 같이 표시할 수 있으며, 이는 청구항 1에 기재된 '서열'과 구별되는 것으로, 본 발명의 '서열'과 혼용하여 사용되지 않는다. 일반식 2라는 별도의 언급이 없는 한, 본 발명에서 '서열'은 청구항 1의 '[Lys-Xaa1-Leu-Xaa2-Xaa3-Arg-Xaa4]n'을 의미한다.
[일반식 2]
[Lys-Met-Leu-Lys-Lys-Arg-Ser]n(n=2~3)
구체적으로, 상기 서열에서 첫 번째 위치, 두 번째 위치, 여섯 번째 위치 및 일곱 번째 위치의 아미노산 잔기 중에서 선택되는 어느 하나 이상의 아미노산 잔기는 D형 아미노산일 수 있는데, 상기 가장 바람직한 서열일 때를 예로 들면 상기 서열에서 첫 번째 위치의 리신 잔기, 두 번째 위치의 메티오닌 잔기, 여섯 번째 위치의 아르기닌 잔기 및 일곱 번째 위치의 세린 잔기 중에서 선택되는 어느 하나 이상의 아미노산 잔기는 D형 아미노산일 수 있다.
상기 서열에서 여섯 번째 위치 및 일곱 번째 위치의 아미노산 잔기는 D형 아미노산일 수 있는데, 상기 가장 바람직한 서열일 때를 예로 들면 상기 서열에서 여섯 번째 위치의 아르기닌 잔기 및 일곱 번째 위치의 세린은 D형 아미노산일 수 있다.
다만 상기 서열에서 n이 3의 정수인 경우에는, 전체 서열을 기준으로 첫 번째 위치의 리신 잔기, 두 번째 위치의 메티오닌 잔기, 여섯 번째 위치의 아르기닌 잔기, 열세 번째 위치의 아르기닌 잔기, 스물 번째 위치의 아르기닌 잔기, 일곱 번째 위치의 세린 잔기, 열네 번째 위치의 세린 잔기 및 스물한 번째 위치의 세린 잔기가 D형 아미노산인 것일 수 있다.
본 발명에 따른 조절 T 세포 유도 펩타이드는 세포투과성 펩타이드와 결합되지 않더라도, 조절 T 세포 유도 및 활성화 효능이 우수하고, 조절 T 세포(Treg 세포)로의 분화 유도 기능을 가질 뿐만 아니라 동시에 Th17 분화를 억제하는 효능을 갖는다. 이에 CTLA4와 달리 합성에 용이하고, 향상된 안정성을 가져 생체 내에서도 우수한 치료 효과를 유지할 뿐만 아니라, 뛰어난 약리 특성을 달성할 수 있으며, 이외에 사용되는 제형이나 필요한 특성을 획득하기 위하여 펩타이드의 N- 및/또는 C- 말단에 수식(modification)이 유용하므로, 종래 긴 사슬을 갖는 CTLA4보다 활용성이 현저히 우수하다.
또한, D 형 아미노산 잔기를 갖는 경우, L 형 아미노산 잔기보다 안정성(stability)이 높아지고, Treg 세포, 즉 과도한 면역반응에 의해 증상이 유도된 경우 면역기능을 조절하는 능력은 크게 향상되는 것을 확인할 수 있다.
본 발명에 있어서, 상기 펩타이드는 당 분야에 널리 공지된 다양한 방법으로 획득할 수 있다. 상세하게는 유전자 재조합과 단백질 발현 시스템을 이용하여 제조하거나 펩타이드 합성과 같은 화학적 합성을 통하여 시험관 내에서 합성하는 방법, 및 무세포 단백질 합성법 등으로 제조될 수 있다.
CTLA4는 세포독성 T 세포에 존재하는 수용체로 항원표지세포 B7과 결합하여 T 세포의 활성화 신호를 차단할 수 있고, 음성신호전달을 매개할 수 있는 것으로 알려져 있다. 또한 조절 T 세포의 면역억제기전에 중요한 역할을 하는 것으로 알려져 있다, CTLA4 단백질 또는 CTLA4 세포질 도메인은 기능은 밝혀졌으나, 세포투과성 펩타이드와의 결합을 통해야만 세포내로 전달되어 효과를 발휘할 수 있다는 한계점이 있으므로, 보다 근본적인 자가면역 질환의 치료를 위해서는 새로운 구조의 치료제가 필요하다.
상기 조절 T 세포 유도 펩타이드는 링커를 더 포함할 수 있다.
또한, 본 발명에서 용어 '링커(linker)'는, 상기 조절 T 세포 유도 펩타이드 중간에 구비되어, 유연성을 제공할 수 있다. 구체적으로 상기 링커는 조절 T 세포 유도 펩타이드의 어디든 위치할 수 있으나, 상기 [Lys-Met-Leu-Lys-Lys-Arg-Ser]로 표시되는 서열의 반복단위 사이에 위치할 수 있다. 즉 상기 세린 잔기와 리신 잔기가 연결되는 부위에 위치할 수 있다. 상기 링커는 일반적으로 아미노산으로 구성되지만, 그 종류와 길이가 특별히 제한되는 것은 아니며, 본 발명의 하나의 실시예에서와 같이 flexible한 성질을 가진 (GGGGS)m(m=1~4), (GG)m(m=1~4), (GSSGGS)m(m=1~4), (EAAAK)m(m=1~4), PAPAP, (AP)m(m=1~4), A(EAAAK)m(m=1~4), (RR)m(m=1~4) 및 GFLG로 이루어진 군으로부터 선택되는 어느 하나 이상일 수 있다. 상기 (GGGGS)m는 glycine 4개와 serine 1개가 반복적으로 배열될 수 있고, (GG)m는 glycine 2개가 반복적으로 배열된 것일 수 있으며, (GSSGGS)m는 glycine-serine-serine-glycine-glycine-serine의 반복적 배열로 구성된 것일 수 있다. rigid 한 성질을 가진 alpha-helix linker, 즉 (EAAAK)m 또는 A(EAAAK)m(m=1~4) (여기서 E는 glutamate, A 는 alanine, K는 lysine, G는 glycine, S는 serine 이며, 상기 m 은 일반적으로 1 이상 정수이고, 바람직하게는 1 내지 4의 정수일 수 있다. 이외에도 PAPAP, (AP)m(m=1~4), (RR)m(m=1~4) 및 GFLG을 사용할 수 있다(여기서 P는 proline, A는 alanine, R은 arginine, F는 phenylalanine, L은 lysine이다).
본 발명에 있어서, 상기 펩타이드는 표적화 서열, 태그(tag), 표지된 잔기, 반감기 또는 펩타이드의 안정성을 증가시키기 위한 특정 목적으로 고안된 추가의 아미노산 서열도 포함할 수 있다. 또한, 본 발명의 펩타이드는 이펙터(effectors), 약물, 프로드럭, 독소, 펩타이드, 전달 분자 등의 커플링 파트너와 연결될 수 있다.
본 발명의 상기 조절 T 세포 유도 펩타이드는, 생체 내 안정성을 확보할 목적으로 N 또는 C 말단에 지방산을 추가적으로 결합할 수 있다.
상기 지방산은 상기 조절 T 세포 유도 펩타이드의 N 말단에 아마이드 결합으로 결합되어 있을 수 있다. 구체적으로 지방산의 카복실기 및 펩타이드의 아미노기 간의 아마이드 결합에 의해 연결될 수 있다.
상기 지방산은 탄소수 10 내지 20의 포화 또는 불포화 지방산일 수 있고, 바람직하게는 미리스트산(Myristic acid), 스테아르산(Stearic acid), 리놀레산(Linoleic acid), 팔미트산(Palmitic acid), 올레산(Oleic acid) 및 라우르산(Lauric acid)으로 이루어진 군에서 선택되는 어느 하나 이상일 수 있으며, 가장 바람직하게는 미리스트산(Myristic acid, 'Myr'로도 표현됨) 또는 팔미트산(Palmitic acid, 'Pal'로도 표현됨)일 수 있다,
본 발명의 조절 T 세포 유도 펩타이드는 지방산과 결합하더라도 본래의 기능을 잃거나 저하되지 않고 오히려, 높은 치료 효과를 제공할 수 있다는 것을 확인할 수 있다.
또한, 본 발명은 세포 투과 활성의 증진을 위하여 상기 조절 T 세포 유도 펩타이드의 N 또는 C 말단에 세포투과성 펩타이드(cell penetrating peptide, CPP)가 추가적으로 결합할 수 있다.
또한, 본 발명에서 용어 '세포투과성 펩타이드(cell penetrating peptide, CPP)'는 인 비트로(in vitro) 또는 인 비보(in vivo) 상에서 운반 대상인 카고를 세포 내로 전달할 수 있는 능력을 가진 펩타이드를 의미하며, '세포막 투과 도메인' 또는 '세포막 투과 펩타이드'와 상호 혼용가능한 의미이다.
상기 세포투과성 펩타이드는 서열번호 18로 표시되는 dNP2, 서열번호 19로 표시되는 AP, TAT(HIV 1 trans-activating protein), 6 내지 8개 아르기닌을 갖는 폴리아르기닌 폴리펩티드, 7 내지 11개의 리신을 갖는 폴리리신 폴리펩티드 및 iRGD(internalizing RGD)로 이루어진 군에서 선택되는 어느 하나 이상일 수 있고, 구체적으로 서열번호 18, 서열번호 19, 서열번호 33 내지 서열번호 41로 표시되는 서열 중에서 선택되는 어느 하나 이상의 것일 수 있으며, 보다 바람직하게는 서열번호 18 또는 서열번호 19로 표시되는 링커일 수 있다.
상기 조절 T 세포 유도 펩타이드와 지방산 또는 세포 투과성 펩타이드는 직접 연결되거나, 이들 사이에 링커 펩타이드를 더 포함하여 간접적으로 연결될 수 있다. 상기 링커 펩타이드는 당업계에 알려진 아미노산 또는 이들의 조합으로 이루어지는 펩타이드가 제한없이 사용될 수 있다. 구체적으로 상기 링커 펩타이드는 (GGGGS)m(m=1~4), (GG)m(m=1~4), (GSSGGS)m(m=1~4), (EAAAK)m(m=1~4), PAPAP, (AP)m(m=1~4), A(EAAAK)m(m=1~4), (RR)m(m=1~4) 및 GFLG로 이루어진 군으로부터 선택되는 어느 하나 이상일 수 있다.
본 발명의 다른 일 구체예에서, 상기 조절 T 세포 유도 펩타이드는 지방산 또는 세포 투과성 펩타이드와 각각 연결될 수 있고, 지방산과 세포 투과성 펩타이드가 모두 연결될 수 있으며, 상기 조절 T 세포 유도 펩타이드와 세포 투과성 펩타이드가 먼저 결합된 후, 지방산과 연결되는 것이 바람직하나, 상기 합성 순서에 한정되는 것은 아니다.
본 발명에서는 CTLA4의 각 모티프(motif)에 대한 기능을 규명하고, CTLA4 단백질의 K 모티프(motif)가 주요한 역할을 하고 있음을 확인하였다. 그러나 K 모티프(motif)만으로는 조절 T 세포 유도 효과만 얻을 수 있고, Th17 억제활성에 대해서는 효과가 미미하며, 실제 생체 내 적용시 증상완화 효과를 얻을 수 없다는 것을 확인한 바, 본 발명에서 K 모티프(motif)의 2, 3개가 연결된 조절 T 세포 유도 펩타이드일 때, 조절 T 세포 유도 효과뿐만 아니라 Th17 억제활성을 동시에 가지는 것을 확인하였고, 생체 내 적용시에도 우수한 증상완화 효과를 가지는 것을 확인하였다.
본 발명의 조절 T 세포 유도 펩타이드는 바람직하게 상기 조절 T 세포 유도 펩타이드는 서열번호 1 내지 6, 서열번호 11, 서열번호 12 및 서열번호 50 내지 54로 이루어진 군으로부터 선택되는 어느 하나일 수 있고, 보다 바람직하게 상기 조절 T 세포 유도 펩타이드는 서열번호 1 내지 6, 서열번호 11 및 서열번호 12로 이루어진 군으로부터 선택되는 어느 하나일 수 있다.
본 발명의 조절 T 세포 유도 펩타이드에 지방산 또는 세포투과성 펩타이드가 연결될 경우에는 서열번호 7 내지 10, 서열번호 13 및 서열번호 14로 이루어진 군으로부터 선택되는 어느 하나일 수 있다.
본 발명은 종래 그 기능이 구체적으로 알려지지 않은 CTLA4 단백질에서 K 모티프(motif)가 면역반응 억제에 관여한다는 것을 확인하였고, K 모티프(motif)만으로는 충분한 효과를 얻을 수 없을 뿐만 아니라 생체 내에서 치료 효과로 이어지지 못하는 것을 확인한 바, 이들의 효과를 나타내도록 하기 위해 수 많은 실험을 통해 본 발명에 따른 조절 T 세포 유도 펩타이드인 경우, 자가면역 질환에 대한 예방, 치료 또는 개선 효과를 나타내는 것을 확인하였다.
본 발명에 따른 조절 T 세포 유도 펩타이드는 종래 CTLA4 단백질과 달리 세포투과성 펩타이드 등 세포 내 투과를 위한 담체가 결합되지 않은 상태에서도 우수한 자가면역 질환 예방 또는 치료 효과를 가질 수 있을 뿐만 아니라 Th17 및 Treg를 타겟으로 하여 면역반응을 억제하도록 효율적으로 작용하므로, 자가면역 질환의 치료제에 획기적으로 적용될 수 있다.
본 발명에 따른 조절 T 세포 유도 펩타이드는 생체 내에서 자가면역 질환의 증상 완화를 눈에 띄게 완화 시키는 것을 확인하였고, 안정성 향상을 위해 D 형 아미노산을 갖더라도 다발성 경화증 동물모델의 생존율에는 전혀 영향을 미치지 않으면서 증상만을 유의적으로 개선하며, Th17 활성화를 방지하여 IL-17 생성을 효율적으로 억제하였을 뿐만 아니라 면역반응을 억제하는 Treg 세포의 활성화를 증가시키며, Th1과 같은 IFN-gamma 생산을 부정적으로 조절하는 것을 확인하였다.
따라서 본 발명의 조절 T 세포 유도 펩타이드는 자가면역 질환 예방 또는 치료할 수 있는 의약품으로 유용하게 사용될 수 있다.
본 발명은 상기 조절 T 세포 유도 펩타이드를 유효성분으로 하는 자가면역 질환 예방 또는 치료용 약학 조성물에 관한 것이다.
본 발명의 약학 조성물은 약제학적으로 허용되는 담체를 더 포함할 수 있다. 상기 약제학적으로 허용되는 담체는 제시에 통상적으로 이용되는 것으로서, 락토스, 덱스트로스, 수크로스, 솔비톨, 만니톨, 전분, 아카시아 고무, 인산 칼슘, 알기네이트, 젤라틴, 규산 칼슘, 미세결정성 셀룰로스, 폴리비닐피롤리돈, 셀룰로스, 물, 시럽, 메틸 셀룰로스, 메틸히드록시벤조에이트, 프로필히드록시벤조에이트, 활석, 스테아르산 마그네슘 및 미네랄 오일 등을 포함하나, 이에 한정되는 것은 아니다. 본 발명의 약제학적 조성물은 상기 성분들 이외에 윤활제, 습윤제, 감미제, 향미제, 유화제, 현탁제, 보존제 등을 추가로 포함할 수 있다. 적합한 약제학적으로 허용되는 담체 및 제제는 Remington's Pharmaceutical Sciences(19th ed., 1995)에 상세히 기재되어 있다.
본 발명에서 용어, "예방"은 본 발명의 상기 조절 T 세포 유도 펩타이드를 유효성분으로 하는 조성물의 투여로 자가면역 질환을 억제 또는 지연시키는 모든 행위를 말한다.
본 발명에서 용어, "치료"는 본 발명의 상기 조절 T 세포 유도 펩타이드를 유효성분으로 하는 조성물의 투여로 자가면역 질환이 호전되거나 이롭게 되는 모든 행위를 말한다.
또한, 본 발명에서 '자가면역 질환(autoimmune disease)'은 세균, 바이러스, 이물질 등 외부 침입자로부터 내 몸을 지켜주어야 할 면역세포가 이상을 일으켜 자기 세포를 외부 항원으로 인식하여 공격함으로써 발생하는 질환을 말한다.
상기 자가면역 질환은 루푸스(systemic lupus erythematosus), 류머티스 관절염(rheumatoid arthritis), 크론병(crohn disease), 궤양성 대장염(ulcerative colitis), 전신성 경피증(Progressive systemic sclerosis, Scleroderma), 아토피 피부염, 건선, 천포창, 천식, 아프타구내염, 만성 갑상선염, 염증성 장염, 다발성 경화증(multiple sclerosis), 혼합결합조직병(mixed connective tissue disease), 자가면역성 용혈성 빈혈(Autoimmune hemolytic anemia), 베체트병(Behcet's disease), 자가면역성 뇌척수염, 중증 근무력증(Myasthenia gravis), 자가면역성 갑상선염(Autoimmune thyroiditis), 결절성 다발성 동맥염(Polyarteritis nodosa), 강직성 척추염(Ankylosing spondylitis), 섬유조직염(Fibromyalgia syndrome), 쇼그렌 증후군(Sjogren's　syndrome), 자가면역성 포도막염(autoimmuneuveitis), 만성 염증성 탈수초성 다발신경병증(chronic inflammatory demyelinating polyneuropathy) 및 측두동맥염(Temporal arteritis)으로 이루어진 군으로부터 선택되는 어느 하나 이상일 수 있다.
자가면역 질환의 대부분은 Th1 세포의 활성이 비정상적으로 증가하여, Th1, Th2 면역세포의 불균형에 의해 유도된다. 조절 T 세포(Treg)는 비정상적으로 활성화된 면역세포의 기능을 억제하여 염증반응을 제어하는 특성이 있다. 이외에 분화 과정에서 만들어지는 Th17 세포가 있는데, Th17 세포는 미분화 T 세포의 분화과정에서 Treg 세포의 분화와 유사한 과정을 거쳐 형성된다. 분화된 Th17 세포는 IL-17을 분비하는데, 이는 자가면역 질환에서 보이는 염증반응에 관여하여 염증 반응의 신호를 최대화시켜 질병의 진행을 가속화시키는 것으로 알려져 있다. 이에 착안하여 대부분의 자가면역 질환 치료제들은, Th1, Th17 세포 활성의 억제를 표적으로 개발되고 있을 뿐, Treg 세포를 표적으로 하는 약물은 승인된 바 없다. 종래 자가면역 질환 치료제로 사용되는 면역억제제들은 독성, 감염, 임파종, 당뇨병, 진전(tremor), 두통, 설사, 고혈압, 오심, 신기능 장애 등의 부작용이 발생하는 문제점이 있다. 따라서 부작용이 없고 저렴하면서도 치료 효과가 우수한 치료제의 개발이 필요한 실정이다.
이에 본 발명자들은 종래 자가면역 질환의 예방 또는 치료에 있어서, 한계를 극복하고 이를 대체할 수 있는 효율적인 물질을 개발하고자 노력하였다. 그 결과, CTLA4에 존재하는 모티프(motif)들 중에서 K 모티브(motif)가 효과를 가지나, 단독으로는 충분한 효과를 발휘할 수 없다는 것을 확인하고, 이를 2~3개 연결한 경우 매우 효과적으로 자가면역 질환을 치료할 수 있다는 것을 확인함으로써 본 발명을 완성하였다.
즉 본 발명에 따른 조성물은 조절 T 세포 유도 펩타이드를 단일 유효성분으로 함유함에도 불구하고, Th17의 활성을 저해하고 Treg를 활성화를 동시에 유도할 수 있으므로, 자가면역 질환의 면역반응을 억제함으로써 효율적으로 자가면역 질환을 예방 또는 치료할 수 있다.
또한, 본 발명의 자가면역 질환 예방 및 치료용 약학 조성물은 약학적으로 허용 가능한 담체를 포함할 수 있다.
약학적으로 허용되는 담체로는 예컨대, 경구 투여용 담체 또는 비경구 투여용 담체를 추가로 포함할 수 있다. 경구 투여용 담체는 락토스, 전분, 셀룰로스 유도체, 마그네슘 스테아레이트, 스테아르산 등을 포함할 수 있다. 또한 비경구 투여용 담체는 물, 적합한 오일, 식염수, 수성 글루코스 및 글리콜 등을 포함할 수 있다. 또한, 안정화제 및 보존제를 추가로 포함할 수 있다. 적합한 안정화제로는 아황산수소나트륨, 아황산나트륨 또는 아스코르브산과 같은 항산화제가 있다. 적합한 보존제로는 벤즈알코늄 클로라이드, 메틸- 또는 프로필-파라벤 및 클로로부탄올이 있다. 그 밖의 약학적으로 허용되는 담체로는 다음의 문헌에 기재되어 있는 것을 참고로 할 수 있다(Remington's Pharmaceutical Sciences, 19th ed., Mack Publishing Company, Easton, PA, 1995).
본 발명의 약학 조성물은 인간을 비롯한 포유동물에 어떠한 방법으로도 투여할 수 있다. 예를 들어, 경구 또는 비경구로 투여할 수 있으며, 비경구적인 투여방법으로는 이에 제한되는 것은 아니나, 정맥내, 근육내, 동맥내, 골수내, 경막내, 심장내, 경피, 피하, 복강내, 비강내, 장관, 국소, 설하 또는 직장내 투여일 수 있다.
본 발명의 약학 조성물은 상술한 바와 같은 투여 경로에 따라 경구 투여용 또는 비경구 투여용 제제로 제형화 할 수 있다. 제형화할 경우에는 하나 이상의 완충제(예를 들어, 식염수 또는 PBS), 항산화제, 정균제, 킬레이트화제(예를 들어, EDTA 또는 글루타치온), 충진제, 증량제, 결합제, 아쥬반트(예를 들어, 알루미늄 하이드록사이드), 현탁제, 농후제 습윤제, 붕해제 또는 계면활성제, 희석제 또는 부형제를 사용하여 조제될 수 있다.
경구투여를 위한 고형제제에는 정제, 환제, 산제, 과립제, 액제, 겔제, 시럽제, 슬러리제, 현탁액 또는 캡슐제 등이 포함되며, 이러한 고형제제는 본 발명의 약학 조성물에 적어도 하나 이상의 부형제 예를 들면, 전분(옥수수 전분, 밀 전분, 쌀 전분, 감자 전분 등 포함), 칼슘카보네이트(calcium carbonate), 수크로스(sucrose), 락토오스(lactose), 덱스트로오스, 솔비톨, 만니톨, 자일리톨, 에리스리톨 말티톨, 셀룰로즈, 메틸 셀룰로즈, 나트륨 카르복시메틸셀룰로오즈 및 하이드록시프로필메틸-셀룰로즈 또는 젤라틴 등을 섞어 조제될 수 있다. 예컨대, 활성성분을 고체 부형제와 배합한 다음 이를 분쇄하고 적합한 보조제를 첨가한 후 과립 혼합물로 가공함으로써 정제 또는 당의 정제를 수득할 수 있다.
단순한 부형제 이외에 마그네슘 스티레이트 탈크 같은 윤활제들도 사용된다. 경구를 위한 액상 제제로는 현탁제, 내용액제, 유제 또는 시럽제 등이 해당되는데 흔히 사용되는 단순 희석제인 물 또는 리퀴드 파라핀 이외에 여러 가지 부형제, 예를 들면 습윤제, 감미제, 방향제 또는 보존제 등이 포함될 수 있다.
또한, 경우에 따라 가교결합 폴리비닐피롤리돈, 한천, 알긴산 또는 나트륨 알기네이트 등을 붕해제로 첨가할 수 있으며, 항응집제, 윤활제, 습윤제, 향료, 유화제 및 방부제 등을 추가로 포함할 수 있다.
비경구적으로 투여하는 경우 본 발명의 약학 조성물은 적합한 비경구용 담체와 함께 주사제, 경피 투여제 및 비강 흡입제의 형태로 당 업계에 공지된 방법에 따라 제형화될 수 있다. 상기 주사제의 경우에는 반드시 멸균되어야 하며 박테리아 및 진균과 같은 미생물의 오염으로부터 보호되어야 한다. 주사제의 경우 적합한 담체의 예로는 이에 한정되지는 않으나, 물, 에탄올, 폴리올(예를 들어, 글리세롤, 프로필렌 글리콜 및 액체 폴리에틸렌 글리콜 등), 이들의 혼합물 및/또는 식물유를 함유하는 용매 또는 분산매질일 수 있다. 보다 바람직하게는, 적합한 담체로는 행크스 용액, 링거 용액, 트리에탄올 아민이 함유된 PBS (phosphate buffered saline) 또는 주사용 멸균수, 10% 에탄올, 40% 프로필렌 글리콜 및 5% 덱스트로즈와 같은 등장 용액 등을 사용할 수 있다. 상기 주사제를 미생물 오염으로부터 보호하기 위해서는 파라벤, 클로로부탄올, 페놀, 소르빈산, 티메로살 등과 같은 다양한 항균제 및 항진균제를 추가로 포함할 수 있다. 또한, 상기 주사제는 대부분의 경우 당 또는 나트륨 클로라이드와 같은 등장화제를 추가로 포함할 수 있다.
경피 투여제의 경우 연고제, 크림제, 로션제, 겔제, 외용액제, 파스타제, 리니멘트제, 에어롤제 등의 형태가 포함된다. 상기에서 '경피 투여'는 약학 조성물을 국소적으로 피부에 투여하여 약학 조성물에 함유된 유효한 양의 활성성분이 피부 내로 전달되는 것을 의미한다.
흡입 투여제의 경우, 본 발명에 따라 사용되는 화합물은 적합한 추진제, 예를 들면, 디클로로플루오로메탄, 트리클로로플루오로메탄, 디클로로테트라플루오로에탄, 이산화탄소 또는 다른 적합한 기체를 사용하여, 가압 팩 또는 연무기로부터 에어로졸 스프레이 형태로 편리하게 전달 할 수 있다. 가압 에어로졸의 경우, 투약 단위는 계량된 양을 전달하는 밸브를 제공하여 결정할 수 있다. 예를 들면, 흡입기 또는 취입기에 사용되는 젤라틴 캡슐 및 카트리지는 화합물, 및 락토즈 또는 전분과 같은 적합한 분말 기제의 분말 혼합물을 함유하도록 제형화할 수 있다. 비경구 투여용 제형은 모든 제약 화학에 일반적으로 공지된 처방서인 문헌(Remington's Pharmaceutical Science, 15th Edition, 1975. Mack Publishing Company, Easton, Pennsylvania 18042, Chapter 87: Blaug, Seymour)에 기재되어 있다.
본 발명의 자가면역 질환 예방 및 치료용 약학 조성물은 상기 조절 T 세포 유도 펩타이드를 유효량으로 포함할 때 바람직한 자가면역 질환 예방 및 치료 효과를 제공할 수 있다. 본 명세서에서, '유효량'이라 함은 음성 대조군에 비해 그 이상의 반응을 나타내는 양을 말하며 바람직하게는 자가면역 질환을 예방 또는 치료하기에 충분한 양을 말한다. 본 발명의 약학 조성물에 상기 조절 T 세포 유도 펩타이드가 0.01 내지 99.99% 포함될 수 있으며, 잔량은 약학적으로 허용 가능한 담체가 차지할 수 있다. 본 발명의 약학 조성물에 포함되는 상기 조절 T 세포 유도 펩타이드의 유효량은 조성물이 제품화되는 형태 등에 따라 달라질 것이다.
본 발명의 약학 조성물의 총 유효량은 단일 투여량(single dose)으로 환자에게 투여될 수 있으며, 다중 투여량(multiple dose)으로 장기간 투여되는 분할 치료 방법(fractionated treatment protocol)에 의해 투여될 수 있다. 본 발명의 약학 조성물은 질환의 정도에 따라 유효성분의 함량을 달리할 수 있다. 비경구 투여시는 상기 조절 T 세포 유도 펩타이드를 기준으로 하루에 체중 1 kg당 바람직하게 0.0001 내지 50 mg, 더 바람직하게는 0.001 내지 30 mg의 양으로 투여되도록, 그리고 경구 투여시는 상기 조절 T 세포 유도 펩타이드를 기준으로 하루에 체중 1 kg당 바람직하게 0.0001 내지 100 mg, 더 바람직하게는 0.001 내지 50 mg의 양으로 투여되도록 1 내지 수회에 나누어 투여할 수 있다. 그러나 상기 조절 T 세포 유도 펩타이드의 용량은 약학 조성물의 투여 경로 및 치료 횟수뿐만 아니라 환자의 연령, 체중, 건강 상태, 성별, 질환의 중증도, 식이 및 배설율 등 다양한 요인들을 고려하여 환자에 대한 유효 투여량이 결정되는 것이므로, 이러한 점을 고려할 때 당 분야의 통상적인 지식을 가진 자라면 상기 조절 T 세포 유도 펩타이드를 자가면역 질환 예방 및 치료를 위한 특정한 용도에 따른 적절한 유효 투여량을 결정할 수 있을 것이다. 본 발명에 따른 약학 조성물은 본 발명의 효과를 보이는 한 그 제형, 투여 경로 및 투여 방법에 특별히 제한되지 아니한다.
본 발명의 자가면역 질환 예방 및 치료용 약학 조성물은 단독으로, 또는 수술, 방사선 치료, 호르몬 치료, 화학 치료, 생물학적 반응조절제 또는 자가면역 질환 치료제를 사용하는 방법들과 병용하여 사용할 수 있다.
앞서 살펴본 바와 같이, 종래 자가면역 질환 치료제는 단독으로는 전혀 효과를 나타내지 못하거나, 부작용을 나타내었으나, 본 발명의 조절 T 세포 유도 펩타이드는 Treg의 활성을 증가시키는 것과 동시에 Th17의 활성을 억제하여, 면역반응을 효과적으로 제어할 수 있을 뿐만 아니라, 14 내지 31개의 짧은 아미노산 서열로 우수한 효과를 발휘할 수 있으므로, 성능은 높고 부작용은 낮으며 제조가 용이하여 자가면역 질환 예방 또는 치료를 위한 새로운 치료제로써 활용될 수 있다.
본 발명의 자가면역 질환 예방 및 치료용 약학 조성물은 또한 상기 조절 T 세포 유도 펩타이드를 유효성분으로 함유하는 외용제의 제형으로 제공할 수 있다.
본 발명의 자가면역 질환 예방 및 치료용 약학 조성물을 피부외용제로 사용하는 경우, 추가로 지방 물질, 유기 용매, 용해제, 농축제 및 겔화제, 연화제, 항산화제, 현탁화제, 안정화제, 발포제(foaming agent), 방향제, 계면활성제, 물, 이온형 유화제, 비이온형 유화제, 충전제, 금속이온봉쇄제, 킬레이트화제, 보존제, 비타민, 차단제, 습윤화제, 필수 오일, 염료, 안료, 친수성 활성제, 친유성 활성제 또는 지질 소낭 등 피부 외용제에 통상적으로 사용되는 임의의 다른 성분과 같은 피부 과학 분야에서 통상적으로 사용되는 보조제를 함유할 수 있다. 또한 상기 성분들은 피부 과학 분야에서 일반적으로 사용되는 양으로 도입될 수 있다.
본 발명의 자가면역 질환 예방 및 치료용 약학 조성물이 피부 외용제로 제공될 경우, 이에 제한되는 것은 아니나, 연고, 패취, 겔, 크림 또는 분무제 등의 제형일 수 있다.
본 발명의 조성물은 자가면역 질환 예방 또는 개선을 목적으로 사료첨가제 또는 이를 포함하는 사료 조성물에 첨가할 수 있다.
본 발명에서 용어, "사료첨가제"는 영양소 보충 및 체중감소 예방, 사료 내 섬유소의 소화 이용성 증진, 유질개선, 번식장애 예방 및 수태율 향상, 하절기 고온 스트레스 예방 등 다양한 효과를 목적으로 사료에 첨가하는 물질을 포함한다. 본 발명의 사료첨가제는 사료관리법상의 보조사료에 해당하며, 탄산수소나트륨, 벤토나이트(bentonite), 산화마그네슘, 복합광물질 등의 광물질제제, 아연, 구리, 코발트, 셀레늄 등의 미량 광물질인 미네랄제제, 케로틴, 비타민 A D, E, 니코틴산, 비타민 B 복합체 등의 비타민제, 메티오닌, 리신 등의 보호아미노산제, 지방산 칼슘염 등의 보호지방산제, 생균제(유산균제), 효모배양물, 곰팡이 발효물 등의 생균, 효모제 등이 추가로 포함될 수 있다.
본 발명에서 용어 "사료"는, 동물이 먹고, 섭취하며, 소화시키기 위한 또는 이에 적당한 임의의 천연 또는 인공 규정식, 한끼식 등 또는 상기 한끼식의 성분으로, 본 발명에 따른 자가면역 질환 예방 또는 개선용 조성물을 유효성분으로 포함하는 사료는 당업계에 공지된 다양한 형태의 사료로 제조가능하며, 바람직하게는 농후 사료, 조사료 및/또는 특수사료가 포함될 수 있으나, 이로 한정되지 않는다.
농후사료에는 밀, 귀리, 옥수수 등의 곡류를 포함하는 종자열매류, 곡물을 정제하고 얻는 부산물로서 쌀겨, 밀기울, 보릿겨 등을 포함하는 겨류, 콩, 유체, 깨, 아마인, 코코야자 등을 채유하고 얻는 부산물인 깻묵류와 고구마, 감자 등에서 녹말을 뺀 나머지인 녹말찌꺼기의 주성분인 잔존녹말질류 등의 찌꺼기류, 어분, 물고기찌꺼기, 어류에서 얻은 신선한 액상물을 농축시킨 것인 피시솔루블(fish soluble), 육분(肉粉), 혈분, 우모분, 탈지분유, 우유에서 치즈, 탈지유에서 카제인을 제조할 때의 잔액인 훼이(whey)를 건조한 건조훼이 등의 동물질사료, 효모, 클로렐라, 해조류가 있으나 이에 제한되지 않는다.
조사료에는 야초, 목초, 풋베기 등의 생초(生草)사료, 사료용 순무, 사료용 비트, 순무의 일종인 루터베어거 등의 뿌리채소류, 생초, 풋베기작물, 곡실(穀實) 등을 사일로에 채워 놓고 젖산발효시킨 저장사료인 사일리지(silage), 야초, 목초를 베어 건조시킨 건초, 종축용(種畜用) 작물의 짚, 콩과 식물의 나뭇잎이 있으며, 이에 제한되지 않는다. 특수사료에는 굴껍데기, 암염 등의 미네랄 사료, 요소나 그 유도체인 디우레이드이소부탄 등의 요소사료, 천연사료원료만을 배합했을 때 부족하기 쉬운 성분을 보충하거나, 사료의 저장성을 높이기 위해서 배합사료에 미량으로 첨가하는 물질인 사료첨가물, 식이보조제가 있으나 이에 제한되지 않는다.
본 발명에 따른 상기 자가면역 질환의 예방 또는 개선용 사료 첨가제는 당업계에 공지된 다양한 사료 제조방법에 따라 적절한 유효 농도 범위에서 상기 조절 T 세포 유도 펩타이드를 첨가하여 제조 가능하다.
본 발명에 따른 사료 첨가제는 자가면역 질환의 예방 또는 개선을 목적으로 하는 개체이면 제한 없이 적용가능하다. 예를 들면, 소, 말, 돼지, 염소, 양, 개, 고양이, 토끼 등과 같은 비인간동물, 조류 및 어류 등 어느 개체에도 적용이 가능하다.
본 발명은 상기 약학 조성물을 투여하는 단계를 포함하는, 자가면역 질환을 예방 또는 치료하는 방법을 제공한다.
본 발명의 방법에 있어서, 상기 동물은 닭, 돼지, 원숭이, 개, 고양이, 토끼, 모르모트, 래트, 마우스, 소, 양, 염소 등과 같은 동물에 제한없이 적용가능하다. 바람직하게는 인간을 제외한 동물이라면 특별히 제한되지 않는다.
본 발명에서, 상기 투여는 당업계에 알려져 있는 임의의 투여 수단에 의하여 투여될 수 있다. 예를 들면, 상기 투여는 정맥내, 근육내, 복강내, 경구, 경피(transdermal), 점막, 코안(intranasal), 기관내(intratracheal) 또는 피하로 개체로 직접적으로 투여될 수 있다. 상기 투여는 전신적으로 또는 국부적으로 투여되는 것일 수 있다.
본 발명의 방법에 있어서, 상기 본 발명의 조성물은 치료학적으로 또는 예방학적으로 유효한 양으로 투여되는 것일 수 있다. 상기 "치료학적으로 또는 예방학적으로 유효한 양"은 당업자라면, 증상의 경중, 개체의 성별, 나이 및 체중 등을 고려하여 적절하게 선택할 수 있다. 상기 치료학적으로 또는 예방학적으로 유효한 양은, 예를 들면 투여되는 개체 1kg 당 0.0001-100 ㎎의 상기 조절 T 세포 유도 펩타이드일 수 있다.
본 발명은 CTLA4 유래 조절 T 세포 유도 펩타이드에 관한 것으로, 염증성 사이토카인을 생성 및 분비하는 세포 독성 Th17 세포로의 분화를 억제하고, 면역조절 T 세포(Treg)로의 분화를 증가시키는 효과가 우수하여 각종 면역반응의 조절 이상으로 유발되는 자가면역 질환을 예방 또는 치료할 수 있는 약학 조성물로 유용하게 활용될 수 있다.
본 발명의 조절 T 세포 유도 펩타이드는 생체 내에서도 자가면역 질환의 질병 중증도를 효과적으로 억제 및 완화시킬 수 있고, Th17의 활성을 저해하고 Treg를 활성화시키는 우수한 자가면역 질환 치료 또는 예방 효과를 갖는다.
도 1은 dNP2-ctCTLA-4, dNP2-ctCTLA-4의 변이체(KA, PA, YF)에 대한 구조를 나타낸 도면이다.
도 2는 마우스로부터 분리한 비장세포로부터 분화된 Th17 세포에 처리된 다섯 그룹(Th17, WT, KA, PA, YF)에 대한 IL-17A 및 foxp3의 유세포 분석 결과이다.
도 3은 dNP2-ctCTLA-4, dNP2-ctCTLA-4의 변이체(KA, PA, YF)로 제조된 다섯 그룹(Th17, WT, KA, PA, YF)에 대한 CD4+IL-17A+ T 세포, CD4+foxp3+ T 세포의 유세포 분석 결과이다.
도 4는 dNP2-ctCTLA-4, dNP2-ctCTLA-4의 변이체(KA, PA, YF)로 제조된 다섯 그룹(PBS, WT, KA, PA, YF)에 대한 다발성 경화증 동물모델의 임상 증후 평가 결과를 나타낸 그래프이다.
도 5는 dNP2-ctCTLA-4, dNP2-ctCTLA-4의 변이체(KA, PA, YF)로 제조된 다섯 그룹(PBS, WT, KA, PA, YF)에 대한 면역세포(Th1, Th17, Treg)의 수를 분석하여 나타낸 그래프이다.
도 6은 dNP2-ctCTLA-4, dNP2-ctCTLA-4의 변이체(KA, PA, YF)로 제조된 다섯 그룹(PBS, WT, KA, PA, YF)을 투여한 다발성경화증 동물모델 척수의 조직학적 분석결과이다.
도 7은 dNP2-ctCTLA-4, dNP2, dNP2-ctCTLA-4의 결손 변이체(KSYPQ, KSYP, KSY, KS, K)에 대한 구조를 나타낸 도면이다.
도 8은 마우스로부터 분리한 비장세포로부터 분화된 Th17 세포에 처리된 여덟 그룹(Th17, dNP2, dNP2-ctCTLA4, KSYPQ, KSYP, KSY, KS, K)에 대한 IL-17A 및 foxp3의 유세포 분석 결과이다.
도 9는 여덟 그룹(Th17, dNP2, dNP2-ctCTLA4, KSYPQ, KSYP, KSY, KS, K)에 대한 CD4+IL-17A+ T 세포, CD4+foxp3+ T 세포의 유세포 분석 결과이다.
도 10은 다섯 그룹(PBS, dNP2-ctCTLA-4, TAT-ctCTLA-4, KSY, K)에 대한 다발성 경화증 동물모델의 임상 증후 평가 결과를 나타낸 그래프이다.
도 11은 다섯 그룹(PBS, dNP2-ctCTLA-4, TAT-ctCTLA-4, KSY, K)에 대한 면역세포(Th1, Th17, Treg)의 수를 분석하여 나타낸 그래프이다.
도 12는 dNP2-ctCTLA-4(WT), dNP2, dNP2-ctCTLA-4의 변이체(K, S, Y1, P, Y2)에 대한 구조를 나타낸 도면이다.
도 13은 마우스로부터 분리한 비장세포로부터 분화된 Th17 세포에 처리된 여덟 그룹(Th17, dNP2, dNP2-ctCTLA-4(WT), K, S, Y1, P, Y2)에 대한 IL-17A 및 foxp3의 유세포 분석 결과이다.
도 14는 여덟 그룹(Th17, dNP2, dNP2-ctCTLA-4, K, S, Y1, P, Y2)에 대한 CD4+IL-17A+ T 세포, CD4+foxp3+ T 세포의 유세포 분석 결과이다. F는 Y2를 의미한다.
도 15는 dNP2-ctCTLA-4(WT), K1, K2(G4S), K3(G4S), K3(GG), K3(no linker)에 대한 구조를 나타낸 도면이다.
도 16은 마우스로부터 분리한 비장세포로부터 분화된 Th17 세포에 처리된 일곱 그룹(Th17, dNP2-ctCTLA-4(WT), K1, K2(G4S), K3(G4S), K3(GG), K3(no linker))에 대한 IL-17A 및 foxp3의 유세포 분석 결과이다.
도 17은 여덟 그룹(Th17, dNP2-ctCTLA-4(WT), AP-ctCTLA-4, K1, K2(G4S), K3(G4S), K3(GG), K3(no linker))에 대한 CD4+IL-17A+ T 세포, CD4+foxp3+ T 세포의 유세포 분석 결과이다.
도 18은 다섯 그룹(PBS, dNP2-ctCTLA-4(WT), K1, K2(G4S), K3(no linker))에 대한 다발성 경화증 동물모델의 임상 증후 평가 결과를 나타낸 그래프이다.
도 19는 다섯 그룹(PBS, dNP2-ctCTLA-4(WT), K1, K2(G4S), K3(no linker))에 대한 면역세포(Th1, Th17, Treg)의 수를 분석하여 나타낸 그래프이다.
도 20은 dNP2-ctCTLA-4(WT), 서열번호 1의 K2 펩타이드, 서열번호 4의 K3 펩타이드, 서열번호 9의 AP-K2 펩타이드 및 서열번호 10의 AP-K3 펩타이드에 대한 구조를 나타낸 도면이다.
도 21은 마우스로부터 분리한 비장세포로부터 분화된 Th17 세포에 처리된 여섯 그룹(Th17(대조군), dNP2-ctCTLA-4(WT), K2, K3, AP-K2, AP-K3)에 대한 IL-17A 및 foxp3의 유세포 분석 결과이다.
도 22는 여섯 그룹(PBS(대조군), dNP2-ctCTLA-4, dNP2, AP, AP-K2, AP-K3)에 대한 다발성 경화증 동물모델의 임상 증후 평가 결과를 나타낸 그래프이다.
도 23은 여섯 그룹(PBS(대조군), dNP2-ctCTLA-4, dNP2, AP, AP-K2, AP-K3)에 대한 침윤된 림프구와 면역세포(Treg)의 수를 분석하여 나타낸 그래프이다.
도 24는 dNP2-ctCTLA-4(WT), 서열번호 1의 K2 펩타이드, 서열번호 4의 K3 펩타이드, 실시예 15의 AP-K2 펩타이드 및 실시예 16의 AP-K3 펩타이드에 대한 구조를 나타낸 도면이다.
도 25는 마우스로부터 분리한 비장세포로부터 분화된 Th17 세포에 처리된 여섯 그룹(Th17(대조군), dNP2-ctCTLA-4, K2, K3, Myr-K2, Myr-K3)에 대한 IL-17A 및 foxp3의 유세포 분석 결과이다.
도 26은 여섯 그룹(Th17, dNP2-ctCTLA-4, K2, AP-K2, Myr-K2, Myr-K3)에 대한 다발성 경화증 동물모델의 임상 증후 평가 결과를 나타낸 그래프이다.
도 27은 여섯 그룹(Th17, dNP2-ctCTLA-4, K2, AP-K2, Myr-K2, Myr-K3)에 대한 침윤된 림프구와 면역세포(Treg)의 수를 분석하여 나타낸 그래프이다.
도 28은 마우스로부터 분리한 비장세포로부터 분화된 Th17 세포에 처리된 일곱 그룹(Th17, dNP2-ctCTLA-4, Myr-K3, Myr-K3D, Pal-K3, Myr-Ap-K2D, Pal-Ap-K2D)에 대한 IL-17A 및 foxp3의 유세포 분석 결과이다.
도 29는 마우스로부터 분리한 비장세포로부터 분화된 Th17 세포에 처리된 열한 그룹(Th17, AP-K2, AP, AP-K2 KA, AP-K2 IKA, AP-K2 MA, AP-K2 LA, AP-K2 2KA, AP-K2 3KA, AP-K2 RA, AP-K2 SA)에 대한 IL-17A 및 foxp3의 유세포 분석 결과이다.
도 30은 열한 그룹(Th17, AP-K2, AP, AP-K2 KA, AP-K2 IKA, AP-K2 MA, AP-K2 LA, AP-K2 2KA, AP-K2 3KA, AP-K2 RA, AP-K2 SA)에에 대한 CD4+IL-17A+ T 세포(a), CD4+foxp3+ T 세포(b)의 유세포 분석 결과이다.
이하, 실시예를 통하여 본 발명을 더욱 상세히 설명하고자 한다. 이들 실시 예는 오로지 본 발명을 보다 구체적으로 설명하기 위한 것으로, 본 발명의 요지에 따라 본 발명의 범위가 이들 실시예에 의해 제한되지 않는다는 것은 당업계에서 통상의 지식을 가진 자에 있어서 자명할 것이다.
실시예 1 내지 14. 펩타이드 합성
서열번호 1 내지 14의 펩타이드를 하기 표 1에서와 같이 설계하고, 애니젠(AnyGen, Kwangju, Korea)에 의뢰하여 고체상 펩티드 합성(SPPS; solid-phase peptide synthesis)으로 제작하였다. 제조과정은 간략하게 Fmoc에 의해 보호된 아미노산은 트리틸클로라이드 수지(trityl chloride resin)에 순차적으로 접합되었고, 그 다음, 수지의 보호기 및 아미노산 잔기를 전체 절단법(global cleavage method)을 통해 제거하였고, 산성 조건 하에서 조(crude) 펩타이드를 얻었다. 상기 조(crude) 펩타이드는 고성능 액체 크로마토그래피(HPLC; Shimadzu, Kyoto, Japan)로 정제하였다. 최종적으로 얻어진 합성 펩타이드는 동결건조하여 보관하였고, 순도는 95% 이상인 것으로 확인하였다(AnyGen, Kwangju, Korea). 본 실험에서 제조된 14개의 구체적인 서열은 다음과 같다.
구분 명칭 서열
번호		 서열
실시예 1 K2 1 KMLKKRSKMLKKRS
실시예 2 K2(G4S) 2 KMLKKRSGGGGSKMLKKRS
실시예 3 K2(GG) 3 KMLKKRSGGKMLKKRS
실시예 4 K3 4 KMLKKRSKMLKKRSKMLKKRS
실시예 5 K3(G4S) 5 KMLKKRSGGGGSKMLKKRSGGGGSKMLKKRS
실시예 6 K3(GG) 6 KMLKKRSGGKMLKKRSGGKMLKKRS
실시예 7 dNP2-K2 7 KIKKVKKKGRKGSKIKKVKKKGRKKMLKKRSKMLKKRS
실시예 8 dNP2-K3 8 KIKKVKKKGRKGSKIKKVKKKGRKKMLKKRSKMLKKRSKMLKKRS
실시예 9 AP-K2 9 RRRWCKRRRGGKMLKKRSKMLKKRS
실시예 10 AP-K3 10 RRRWCKRRRGGKMLKKRSKMLKKRSKMLKKRS
실시예 11 KD2 11 kmLKKrsKMLKKrs
실시예 12 KD3 12 kmLKKrsKMLKKrsKMLKKrs
실시예 13 AP-KD2 13 rrRWCKRRRGGKMLKKrsKMLKKrs
실시예 14 AP-KD3 14 rrRWCKRRRGGKMLKKrsKMLKKrsKMLKKrs
상기 표 1에서의 알파벳 소문자는 D형 아미노산을 의미한다.
실시예 15 내지 20. 지방산으로 수식된 펩타이드 합성
서열번호 3, 4, 11, 12, 13의 펩타이드를 지방산으로 수식된 펩타이드(Myr-K2, Myr-K3, Myr-K3D, Pal-K3, Myr-AP-K2D, Pal-AP-K2D)로 제조하였다. 제조과정은 간략하게 Fmoc에 의해 보호된 아미노산은 트리틸클로라이드 수지(trityl chloride resin)에 순차적으로 접합되었고, 그 다음, 수지의 보호기 및 아미노산 잔기를 전체 절단법(global cleavage method)을 통해 제거하였고, 산성 조건 하에서 조(crude) 펩타이드를 얻었다. 펩타이드 레진(resin)에 지방산과 반응 시약(HOBt, DIC, DMF)을 섞은 후, 하루 동안 상온에서 반응시켜 지방산으로 수식된 펩타이드를 형성하였다. 상기 조(crude) 펩타이드는 고성능 액체 크로마토그래피(HPLC; Shimadzu, Kyoto, Japan)로 정제하였다. 최종적으로 얻어진 합성 펩타이드는 동결건조하여 보관하였고, 순도는 95% 이상인 것으로 확인하였다(AnyGen, Kwangju, Korea).
실험방법 1. Th17 분화조건에서의 효능 분석
분화
CD4 T 세포의 subset 중 하나로 Th17 세포가 있고, Th17 세포는 IL-17이라는 사이토카인(cytokine)을 분비하며 염증을 일으키는 것으로 알려져 있다. 이는 자가면역 질환을 야기하는 주요 요인이다. Treg 세포(조절 T 세포)는 Foxp3라는 전사인자(transcription factor)를 발현하여 염증을 억제, 조절하는 것으로 알려져 있다. 따라서 Th17(IL-17)을 저해하며 Treg(Foxp3) 세포를 늘려 염증을 조절하는 효과를 갖는다면, 자가면역 질환을 예방 및 치료하는 효과를 갖는다고 여길 수 있으므로, 본 발명의 펩타이드가 상술한 효과를 갖는지 확인하였다.
제조업체의 프로토콜에 따라 마우스 미분화 CD4+ T 세포(naㅿve CD4 T cell) 분리 키트(Miltenyi Biotec, Auburn, CA, USA)를 사용하여 6 내지 8주령 C57BL/6 마우스의 비장세포에서 미분화 CD4 T 세포(naㅿve CD4 T cell)를 분리하였다. RNAseq를 위해, Foxp3-GFP 마우스의 미분화 CD4 T 세포(naㅿve CD4 T cell)를 정제하여 Th17 으로 분화시킨 후, FACS Aria 세포 분류기 III(FACS Aria cell sorter III)(BD Biosciences, Franklin Lakes, NJ, USA)를 사용하여 Foxp3+ 및 Foxp3- 개체군을 분류하였다. 정제된 미분화 CD4 T 세포(naㅿve CD4 T cell)는 플레이트와 결합된 항-CD3(2 또는 5 μg/ml; 553057; BD Pharmingen, La Jolla, CA) 및 항-CD28(2 또는 5 μg/ml; 553294; ????BD Pharmingen, La)로 활성화한 후, 3일 또는 4일 동안 96-웰 플레이트에서 다음의 사이토카인 칵테일(cytokine cocktails)을 처리하여 분화시켰다: Th0; 재조합 인간 TGF-β(R&D Systems) 0.25 ng/ml. Th1; 항-IL-4(11B11; 16-7041-85; eBioscience) 5 ㅅg/ml, IL-2(212-12; Peprotech, Rocky Hill, NJ) 50 U/ml, 재조합 뮤린(recombinant murine) IL-12(212-12; Peprotech) 2 ng/ml, Th1에 대한 재조합 인간 TGF-β(R&D Systems) 0.25 ng/ml. Th17; 항-IFN-γ(XMG1.2; 16-7311-85; eBioscience) 5 ㅅg/ml, 항-IL-4(11B11; 16-7041-85; eBioscience) 5 ㅅg/ml, 재조합 뮤린(recombinant murine) TGF-β(7666-MB; R&D Systems, Minneapolis, MN) 2 ng/mL, IL-6(216-16; Peprotech) 30 ng/mL, IL-23(1887-ML-101; R&D Systems) 20 ng/mL, IL-1β(401-ML-010; R&D Systems) 20 ng/mL, 및 IL-2(Peprotech) 50 U/ml. Tregs; IL-2(Peprotech) 50 U/ml 및 TGF-β(R&D Systems) 0.5 ng/mL.
사이토카인 칵테일과 함께 시료(2 μM)를 공동으로 처리하였다. 4일 후 IL-17, Foxp3 형광 항체를 이용하여 유세포 분석기(flow cytometry)로 분석을 하였다. 일부 실험에서 5 μM PKC-η 유사기질 억제제(sc-3096; Santa Cruz) 또는 5 μM ERK inhibitor(UO126; 662005; Sigma)를 추가로 첨가하였다.
유세포 분석
살아있는 세포에 대해서만 유세포 분석하기 위해 Zombie Aqua™ Fixable Viability Kit(Biolegend)를 사용하였으며, 상온에서 10분간 항체 염색을 수행하였다. 세척 후, 분화시킨 Th1, Th17, Treg 세포의 표면 단백질을 4 ℃에서 15분 동안 단일클론 항체로 염색하였다. 세포 내 사이토카인 수준을 결정하기 위해서는 세포를 37 ℃에서 4시간 동안 Cell Stimulation Cocktail(plus protein transport inhibitors)(ThermoFisher)로 재자극하고 표면 마커 항체로 염색하였다. 다음으로 세포를 고정하고 Foxp3/Transcription Factor Staining Buffer Set(eBioscience)를 사용하여 Permeabilization하고, 항-마우스 IFN-γ, 항-마우스 IL-17 및 항-마우스 Foxp3으로 염색하였다. 세포는 FACS Canto II 유세포 분석기와 FlowJo 소프트웨어 버전 10.7을 사용하여 분석하였다.
통계
통계적 분석은 PRISM 소프트웨어를 사용하여 t-test, two-way ANOVA로 분석하였다. P value < 0.5를 통계적 유의성이 있다고 판단하였다.
실험방법 2. 다발성경화증(MS; multiple sclerosis) 동물모델에서의 효능 분석
실험동물
8주령 암컷 C57BL/6 마우스는 Orient Bio(대전, 한국)에서 구입하여 사용하였다. 모든 동물실험은 한양대학교 동물실험윤리위원회(Institutional Animal Care and Use Committee of Hanyang University)의 동물실험운영규정을 준수하여 수행하였다. 실험전 마우스는 2주간 순화과정을 거쳤다. 마우스는 실험동안 온도 22 ㅁ 2 ℃, 습도는 40-60%로 유지되는 사육실에서 자유식이로 사육되었으며, 명암 주기(Light and dark cycle)는 12시간 간격으로 조절하였다.
다발성 경화증 유도
다발성 경화증은 제조사의 프로토콜에 따라 MOG35-55/CFA Emulsion PTX 키트(Hooke Labs, Lawrence, MA, USA)를 사용하여 피하 면역화(subcutaneous immunization)로 다발성 경화증을 유도하였다. 마우스를 이소플루란으로 마취하고 MOG35-55/CFA를 양측 피하 주사한 후(subcutaneously injected bilaterally), 2시간 및 24시간 후에 PTX(pertussis toxin)를 복강내 주사(intraperitoneal injection)하였다. 상기 동물모델은 MOG 면역화한 후, 각 그룹으로 무작위 배정하였다. PTX를 주사하고 7일째부터 면역반응에 의한 마비증상이 시작되므로, 7일째부터 본 발명에 따른 시료를 100 ㎍(5 mg/kg)을 매일 1회 복강내로 주사하여, 그룹을 제조하였다. 각 그룹은 다발성경화증 동물모델을 유도하고 난 후부터 매일 관찰하고 임상 징후를 점수를 매겨 기록하였다. 임상 징후 평가는 하기 제시된 표 2에 기재된 등급에 따라 점수를 매겼다. 임상 징후 평가 점수가 높을수록 질병이 심해지는 것을 의미한다.
점수 설명
0 정상적으로 거동하는 상태-신경학적 징후 없음
0.5 꼬리를 말지 못할 정도로 마비가 되어 있는 상태-부분적으로 꼬리가 늘어져 있음
1.0 꼬리를 전혀 움직이지 못하는 상태-완전히 늘어진 꼬리
1.5 절뚝거리고, 뒤뚱거리는 걸음걸이
2.0 기우뚱한 걸음-마우스가 걸을 때 뒷다리가 불안정한 상태(한쪽 뒷다리의 마비)
2.5 한쪽 뒷다리가 완전히 마비되고, 다른 뒷다리 부분 마비됨
3.0 두쪽 뒷다리가 완전히 마비된 상태-마우스가 뒷다리로 서는 것이 어려우나, 나머지 부분은 여전히 움직임
3.5 앞다리도 정상적으로 움직이지 못하는 상태(상행마비)
4.0 마우스의 사지가 모두 마비되어, 전혀 다리를 움직이지 못하고 얇아지고 여위어가는 상태(몸통의 마비)
4.5 빈사 상태
5.0 사망
유세포 분석과 조직학적 분석
실험이 종료된 후에 각 그룹의 실험동물을 안락사한 후, 중추신경계인 척수(spinal cord)의 림프구(lymphocyte)를 분리하였다. 분리된 척수를 37 ℃에서 1 mg/ml의 DNase 1(10104159001; Sigma-Aldrich) 및 1 mg/ml의 콜라게나제 D(11088866001; Sigma-Aldrich)로 처리하고, 40분 동안 진탕기에서 80 RPM으로 배양하였다. 효소처리 후, 500 mM EDTA를 첨가하고 림프구를 Percoll(GE Healthcare, Little Chalfont, UK) 밀도-구배 원심분리(density-gradient centrifugation)로 분리하였다. 분리된 침윤된 림프구(infiltrated lymphocytes)를 37 ℃에서 4시간 동안 Cell Stimulation Cocktail(plus protein transport inhibitors) (ThermoFisher)로 재자극하고 항-마우스 CD4로 염색하였다. 상기 세포를 고정하고, Foxp3/전사 인자 염색 버퍼 세트(eBioscience)를 사용하여 Permeabilization하고, 항-마우스 IFN-γ, 항-마우스 IL-17 또는 항-마우스 Foxp3로 염색하였다. FACS Canto 유세포 분석기(flow cytometer) 및 FlowJo 소프트웨어 버전 10.7.1을 사용하여 세포를 분석하였다.
조직학적 분석을 위해, 척수 조직의 파라핀 블록을 탈파라핀화하고, Luxol fast blue를 처리하였다. 공동염색을 위해, hematoxylin과 eosin을 사용하였다(Dako). Image J 소프트웨어 버전 2.0.0을 사용하여 척수 조직의 백질 영역(white matter region)에 침투된 세포(Infiltrated cells)를 계산하였다.
척수에서 Th1, Th17 면역세포의 수가 증가할수록 다발성 경화증의 병증이 심해지는 것을 의미하며, Treg 세포의 수가 증가하는 것은 자가항원에 대한 관용을 유지하고, 면역계에서의 과도한 반응을 막아 다발성 경화증과 같은 자가면역 질환을 예방 또는 치료하는 기능이 향상되는 것을 의미한다.
통계
통계적 분석은 PRISM 소프트웨어를 사용하여 t-test, two-way ANOVA로 분석하였다. P value < 0.5를 통계적 유의성이 있다고 판단하였다.
실험예 1. dNP2-ctCTLA-4의 변이체에 대한 기능 확인
시료의 준비
본 실험은 dNP2-ctCTLA-4에서 변이체의 기능을 확인하기 위한 것으로, dNP2-ctCTLA-4를 비롯하여 이의 변이체를 준비하여, 면역반응 억제정도를 분석하였다.
우선, dNP2-ctCTLA-4, dNP2-ctCTLA-4의 변이체(KA, PA, YF)를 하기 표 3에서와 같이 설계하고, 애니젠(AnyGen, Kwangju, Korea)에 의뢰하여 고체상 펩티드 합성(SPPS; solid-phase peptide synthesis)으로 제작하였다. 구체적인 제조과정은 실시예 1과 동일하며, 본 실험에서 제조된 펩타이드 역시 순도는 95% 이상인 것으로 확인되었다.
명칭 서열번호 아미노산 서열
dNP2-ctCTLA-4
WT		 15 KIKKVKKKGRKGSKIKKVKKKGRKGGKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
dNP2-KA 19 KIKKVKKKGRKGSKIKKVKKKGRKGGAML AAA SPLTTGVYVKMPPTEPECEKQFQPYFIPIN
dNP2-PA 20 KIKKVKKKGRKGSKIKKVKKKGRKGGKMLKKRSPLTTGVYVKM AA TE A ECEKQFQPYFIPIN
dNP2-YF 21 KIKKVKKKGRKGSKIKKVKKKGRKGGKMLKKRSPLTTGV F VKMPPTEPECEKQFQP FF IPIN
시료의 투여 및 샘플링-Th17 분화
상기 실험방법 1에 따라 Th17 분화조건에서의 효능 분석하고자 하였다. 시료를 dNP2-ctCTLA-4, dNP2-ctCTLA-4의 변이체(KA, PA, YF)를 사용한 것을 제외하고 모두 실험방법 1과 동일하게 수행하였다. 하기와 같이 총 다섯 그룹(Th17, dNP2-ctCTLA-4, KA, PA, YF)으로 나누어 진행하였다. 상기 그룹들은 4일 후 IL-17, Foxp3 형광 항체를 이용하여 유세포 분석(flow cytometry) 하였다.
Th17 그룹(대조군) : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 PBS를 양성대조군과 동일한 볼륨으로 처리.
dNP2-ctCTLA-4 그룹(양성대조군) : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 15의 dNP2-ctCTLA-4(2 μM)를 처리.
KA 그룹 : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 20의 dNP2-KA(2 μM)를 처리.
PA 그룹 : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 21의 dNP2-PA(2 μM)를 처리.
YF 그룹 : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 22의 dNP2-YF(2 μM)를 처리.
시료의 투여 및 샘플링-다발성경화증 동물모델
실험방법 2에 따라 다발성경화증 동물모델에서의 효능을 분석하고자 하였다. 실험방법 2에서 시료를 dNP2-ctCTLA-4, dNP2-ctCTLA-4의 변이체(KA, PA, YF)를 사용하여, 총 다섯 그룹(PBS, WT, KA, PA, YF)으로 나누어 진행하였다.
PBS 그룹(대조군) : PTX를 주사하고 7일째부터 14일까지 PBS 100 ㎍을 매일 1 회씩 복강내 주사.
dNP2-ctCTLA-4 그룹(양성대조군) : PTX를 주사하고 7일째부터 14일까지 서열번호 15의 (dNP2-ctCTLA-4)_WT(100 ㎍)을 매일 1 회씩 복강내 주사.
KA 그룹 : PTX를 주사하고 7일째부터 14일까지 서열번호 20의 dNP2-KA 펩타이드(100 ㎍)를 매일 1 회씩 복강내 주사.
PA 그룹 : PTX를 주사하고 7일째부터 14일까지 서열번호 21의 dNP2-PA 펩타이드(100 ㎍)를 매일 1 회씩 복강내 주사.
YF 그룹 : PTX를 주사하고 7일째부터 14일까지 서열번호 22의 dNP2-YF 펩타이드(100 ㎍)를 매일 1 회씩 복강내 주사.
각 그룹은 다발성경화증을 유도하고 난 후부터 실험방법 2와 같이 매일 관찰하고 임상 징후 점수를 매겨 기록하였고, 실험이 종료된 후 조직학적 분석을 통해 림프구, CD4+IL-17A+ T 세포, CD4+IFN-γ+ T 세포, Treg/Teff의 비율을 측정하였다.
도 1은 dNP2-ctCTLA-4, dNP2-ctCTLA-4의 변이체(KA, PA, YF)에 대한 구조를 나타낸 도면이고, 도 2는 마우스로부터 분리한 비장세포로부터 분화된 Th17 세포에 처리된 다섯 그룹(Th17, WT, KA, PA, YF)에 대한 IL-17A 및 foxp3의 유세포 분석 결과이며, 도 3은 dNP2-ctCTLA-4, dNP2-ctCTLA-4의 변이체(KA, PA, YF)로 제조된 다섯 그룹(Th17, WT, KA, PA, YF)에 대한 CD4+IL-17A+ T 세포, CD4+foxp3+ T 세포의 유세포 분석 결과이다.
도 1에 나타난 바와 같이, CTLA4의 세포질 영역을 'K, S, Y, P, Q, Y' 모티프(motif)로 나누어, 면역반응 억제 효과와의 관련성을 분석하였다.
도 2 및 3에 나타난 바와 같이, K 모티프(motif)의 일부 아미노산 잔기가 알라닌 잔기로 치환된 서열번호 20의 KA 펩타이드를 처리한 경우(KA 그룹), 다른 그룹과 달리 IL-17 감소 및 Foxp3 증가 기능이 소실되는 것을 확인하였다. 따라서 CTLA4에서 K 모티프(motif)가 면역반응 억제와 높은 관련성이 있다는 것을 확인하였다.
도 4는 dNP2-ctCTLA-4, dNP2-ctCTLA-4의 변이체(KA, PA, YF)로 제조된 다섯 그룹(PBS, WT, KA, PA, YF)에 대한 다발성 경화증 동물모델의 임상 증후 평가 결과를 나타낸 그래프이고, 도 5는 dNP2-ctCTLA-4, dNP2-ctCTLA-4의 변이체(KA, PA, YF)로 제조된 다섯 그룹(PBS, WT, KA, PA, YF)에서의 면역세포(Th1, Th17, Treg)의 수를 분석하여 나타낸 그래프이며, 도 6은 dNP2-ctCTLA-4, dNP2-ctCTLA-4의 변이체(KA, PA, YF)로 제조된 다섯 그룹(PBS, WT, KA, PA, YF)을 투여한 다발성경화증 동물모델 척수의 조직학적 분석결과이다.
도 4 및 도 5에 나타난 바와 같이, KA 그룹과 PA 그룹에서 임상징후 평가가 PBS 그룹(대조군)보다 유의적으로 낮다는 것을 확인하였다. 또한, KA 그룹과 PA 그룹은 척수에 침윤된 림프구의 숫자가 PBS 그룹(대조군)보다 유의적으로 높은 것을 확인하였다. 특히 KA 그룹은 Treg 세포의 수가 가장 낮은 것으로 확인되었다. 종합하면 CTLA4에서 K 모티프(motif)가 자가면역 질환의 면역반응 억제와 관련하여 주요한 역할을 수행하고 있다는 것을 알 수 있다.
도 6에 나타난 바와 같이, 다발성경화증 동물모델에서 다섯 그룹(PBS, WT, KA, PA, YF)의 척수를 조직학적으로 분석한 결과, KA 그룹에서 미엘린(myelin) 손상 억제 기능이 소실됨을 확인하여 K 모티프(motif)가 자가면역 질환에서 주요한 역할을 수행한다는 것을 확인하였다.
실험예 2. CTLA4의 결손 변이체에 대한 효능 분석
시료의 준비
본 실험은 dNP2-ctCTLA-4에서 K 모티프(motif)의 기능을 다시금 확인하기 위한 것으로, dNP2-ctCTLA-4으로부터 모티프(motif)를 하나씩 제거한 결손 변이체를 준비하여, 면역반응 억제정도를 분석하였다.
우선 dNP2-ctCTLA-4, dNP2, dNP2-ctCTLA-4의 결손 변이체(KSYPQ, KSYP, KSY, KS, K)를 하기 표 4에서와 같이 설계하고, 애니젠(AnyGen, Kwangju, Korea)에 의뢰하여 고체상 펩티드 합성(SPPS; solid-phase peptide synthesis)으로 제작하였다. 구체적인 제조과정은 실시예 1과 동일하며, 본 실험에서 제조된 펩타이드 역시 순도는 95% 이상인 것으로 확인되었다.
명칭 서열
번호		 아미노산 서열
(dNP2-ctCTLA-4)
WT		 15 KIKKVKKKGRKGSKIKKVKKKGRKGGKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
(TAT-ctCTLA-4)
WT		 16 YGRKKRRRQRRRGSKIKKVKKKGRKGGKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
dNP2 18 KIKKVKKKGRKGSKIKKVKKKGRK
dNP2-KSYPQ 23 KIKKVKKKGRKGSKIKKVKKKGRKGGKMLKKRSPLTTGVYVKMPPTEPECEKQFQP
dNP2-KSYP 24 KIKKVKKKGRKGSKIKKVKKKGRKGGKMLKKRSPLTTGVYVKMPPTEPECE
dNP2-KSY 25 KIKKVKKKGRKGSKIKKVKKKGRKGGKMLKKRSPLTTGVYVKM
dNP2-KS 26 KIKKVKKKGRKGSKIKKVKKKGRKGGKMLKKR SPLTTGV
dNP2-K1 27 KIKKVKKKGRKGSKIKKVKKKGRKKMLKKRS
시료의 투여 및 샘플링-Th17 분화조건
상기 실험방법 1에 따라 Th17 분화조건에서의 효능 분석하고자 하였다. 시료를 dNP2-ctCTLA-4, dNP2, dNP2-ctCTLA-4의 결손 변이체(KSYPQ, KSYP, KSY, KS, K)를 사용한 것을 제외하고 모두 실험방법 1과 동일하게 수행하였다. 하기와 같이 총 여덟 그룹(Th17, dNP2, dNP2-ctCTLA-4, KSYPQ, KSYP, KSY, KS, K)으로 나누어 진행하였다. 상기 그룹들은 4일 후 IL-17, Foxp3 형광 항체를 이용하여 유세포 분석(flow cytometry) 하였다.
Th17 그룹(대조군1) : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 PBS(2 μM)를 처리.
dNP2 그룹(대조군2) : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 18의 dNP2 펩타이드(2 μM)를 처리.
dNP2-ctCTLA-4 그룹(양성대조군) : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 15의 dNP2-ctCTLA-4(2 μM)를 처리.
KSYPQ 그룹 : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 23의 dNP2-KSYPQ 펩타이드(2 μM)를 처리.
KSYP 그룹 : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 24의 dNP2-KSYP 펩타이드(2 μM)를 처리.
KSY 그룹 : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 25의 dNP2-KSY 펩타이드(2 μM)를 처리.
KS 그룹 : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 26의 dNP2-KS 펩타이드(2 μM)를 처리.
K 그룹 : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 27의 dNP2-K1 펩타이드(2 μM)를 처리.
시료의 투여 및 샘플링-다발성경화증 동물모델
실험방법 2에 따라 다발성경화증 동물모델에서의 효능을 분석하고자 하였다. 실험방법 2에서 시료를 dNP2-ctCTLA-4, TAT-ctCTLA-4 및 dNP2-ctCTLA-4의 결손 변이체(KSY, K)를 사용하여, 총 다섯 그룹(PBS, dNP2-ctCTLA-4, TAT-ctCTLA-4, KSY, K)으로 나누어 진행하였다.
PBS 그룹(대조군) : PTX를 주사하고 7일째부터 15일까지 PBS 100 ㎍을 매일 1 회씩 복강내 주사.
dNP2-ctCTLA-4 그룹(양성대조군1) : PTX를 주사하고 7일째부터 15일까지 서열번호 15의 dNP2-ctCTLA-4_WT(100 ㎍)을 매일 1 회씩 복강내 주사.
TAT-ctCTLA-4 그룹(양성대조군2) : PTX를 주사하고 7일째부터 15일까지 서열번호 16의 TAT-ctCTLA-4 펩타이드(100 ㎍)를 매일 1 회씩 복강내 주사.
dNP2-KSY 그룹 : PTX를 주사하고 7일째부터 15일까지 서열번호 25의 dNP2-KSY 펩타이드(100 ㎍)를 매일 1 회씩 복강내 주사.
dNP2-K 그룹 : PTX를 주사하고 7일째부터 15일까지 서열번호 27의 dNP2-K1 펩타이드(100 ㎍)를 매일 1 회씩 복강내 주사.
각 그룹은 다발성경화증을 유도하고 난 후부터 실험방법 2와 같이 매일 관찰하고 임상 징후 점수를 매겨 기록하였고, 실험이 종료된 후 조직학적 분석을 통해 림프구, CD4+IL-17A+ T 세포, CD4+IFN-γ+ T 세포, Treg/Teff의 비율을 측정하였다.
도 7은 dNP2-ctCTLA-4(WT), dNP2, dNP2-ctCTLA-4의 결손 변이체(KSYPQ, KSYP, KSY, KS, K)에 대한 구조를 나타낸 도면이고, 도 8은 마우스로부터 분리한 비장세포로부터 분화된 Th17 세포에 처리된 여덟 그룹(Th17, dNP2, dNP2-ctCTLA4, KSYPQ, KSYP, KSY, KS, K)에 대한 IL-17A 및 foxp3의 유세포 분석 결과이며, 도 9는 여덟 그룹(Th17, dNP2, dNP2-ctCTLA4, KSYPQ, KSYP, KSY, KS, K)에 대한 CD4+IL-17A+ T 세포, CD4+foxp3+ T 세포의 유세포 분석 결과이다.
도 7에 나타난 바와 같이, 앞서 실험을 통해 확인된 K 모티프(motif)의 성능을 보다 정확하게 분석하기 위하여, 'K, S, Y, P, Q, Y' 모티프(motif)를 하나씩 제거하면서 면역반응 억제 효과를 분석하였다.
도 8 및 9에 나타난 바와 같이, dNP2-ctCTLA-4에서 K 모티프(motif)만 존재하는 서열번호 27의 dNP2-K1 펩타이드를 처리한 경우(K 그룹), 면역반응 억제활성을 나타내고 있으므로, 이를 통해 dNP2-ctCTLA-4 중에서 K 모티프(motif)가 면역반응 억제에 주요한 역할을 수행하고 있다는 것을 알 수 있다.
도 10은 다섯 그룹(PBS, dNP2-ctCTLA-4, TAT-ctCTLA-4, dNP2-KSY, dNP2-K)에 대한 다발성 경화증 동물모델의 임상 증후 평가 결과를 나타낸 그래프이고, 도 11은 다섯 그룹(PBS, dNP2-ctCTLA-4, TAT-ctCTLA-4, dNP2-KSY, dNP2-K)에 대한 면역세포(Th1, Th17, Treg)의 수를 분석하여 나타낸 그래프이다.
도 10 및 도 11에 나타난 바와 같이, KSY 그룹과 K 그룹에서 임상징후 평가가 TAT-ctCTLA-4 그룹과 PBS 그룹보다 유의적으로 우수한 것을 확인하였다. 또한, TAT-ctCTLA-4 그룹, PBS 그룹보다 dNP2-KSY 그룹과 dNP2-K 그룹에서 척수에 침윤된 림프구의 숫자가 유의적으로 낮은 것을 확인하였다. 즉, K 모티프(motif) 만 있어도 우수한 면역반응 억제 활성을 가진다는 것을 확인하였다.
실험예 3. CTLA4의 각 모티프(motif)별 효능 분석
시료의 준비
본 실험은 dNP2-ctCTLA-4, dNP2, dNP2-ctCTLA-4의 변이체(K, S, Y1, P, Y2)의 기능을 확인하기 위한 것으로, dNP2-ctCTLA-4를 비롯하여 이의 변이체를 준비하여, 면역반응 억제정도를 분석하였다.
우선, dNP2-ctCTLA-4(WT), dNP2, dNP2-ctCTLA-4의 변이체(K, S, Y1, P, Y2)를 하기 표 5에서와 같이 설계하고, 애니젠(AnyGen, Kwangju, Korea)에 의뢰하여 고체상 펩티드 합성(SPPS; solid-phase peptide synthesis)으로 제작하였다. 구체적인 제조과정은 실시예 1과 동일하며, 본 실험에서 제조된 펩타이드 역시 순도는 95% 이상인 것으로 확인되었다.
명칭 서열번호 아미노산 서열
dNP2-ctCTLA-4 15 KIKKVKKKGRKGSKIKKVKKKGRKGGKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
dNP2 18 KIKKVKKKGRKGSKIKKVKKKGRK
K1 28 KMLKKRS
S 29 SPLTTGV
Y1 30 YVKM
P 31 PPTEPECE
Y2 32 YFIPIN
시료의 투여 및 샘플링-Th17 분화조건
상기 실험방법 1에 따라 Th17 분화조건에서의 효능 분석하고자 하였다. 시료를 dNP2-ctCTLA-4, dNP2, dNP2-ctCTLA-4의 변이체(K, S, Y1, P, Y2)를 사용한 것을 제외하고 모두 실험방법 1과 동일하게 수행하였다. 하기와 같이 총 여덟 그룹(Th17, dNP2, dNP2-ctCTLA-4, K, S, Y1, P, Y2)으로 나누어 진행하였다. 상기 그룹들은 4일 후 IL-17, Foxp3 형광 항체를 이용하여 유세포 분석(flow cytometry) 하였다.
Th17 그룹(대조군) : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 PBS(2 μM)를 처리.
dNP2 그룹(대조군2) : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 18의 dNP2 펩타이드(2 μM)를 처리.
dNP2-ctCTLA-4 그룹(양성대조군) : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 15의 (dNP2-ctCTLA-4)_WT(2 μM)를 처리.
K 그룹 : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 28의 K1 펩타이드(2 μM)를 처리.
S 그룹 : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 29의 S 펩타이드(2 μM)를 처리.
Y1 그룹 : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 30의 Y1 펩타이드(2 μM)를 처리.
P 그룹 : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 31의 P 펩타이드(2 μM)를 처리.
Y2 그룹 : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 32의 Y2 펩타이드(2 μM)를 처리.
도 12는 dNP2-ctCTLA-4, dNP2, dNP2-ctCTLA-4의 변이체(K, S, Y1, P, Y2)에 대한 구조를 나타낸 도면이고, 도 13은 마우스로부터 분리한 비장세포로부터 분화된 Th17 세포에 처리된 여덟 그룹(Th17, dNP2, dNP2-ctCTLA-4, K, S, Y1, P, Y2)에 대한 IL-17A 및 foxp3의 유세포 분석 결과이며, 도 14는 여덟 그룹(Th17, dNP2, dNP2-ctCTLA-4, K, S, Y1, P, Y2)에 대한 CD4+IL-17A+ T 세포, CD4+foxp3+ T 세포의 유세포 분석 결과이다.
도 13 및 14에 나타난 바와 같이, K 모티프(motif)만으로 이루어진 K 그룹에서 dNP2-ctCTLA4 그룹과 유사한 정도의 면역반응 억제활성을 나타내는 것을 알 수 있었다. 다른 S 그룹, Y1 그룹, P 그룹 및 Y2 그룹은 dNP2 그룹 혹은 Th17 그룹과 유의미한 차이를 나타내지 못하는 것으로 확인되었다. K 모티프(motif)가 면역반응 억제에 주요한 역할을 수행하고 있다는 것을 확인하였다.
실험예 4. K, K2, K3 펩타이드에 대한 효능 분석
시료의 준비
본 실험은 dNP2-ctCTLA-4의 K 모티프(motif)에 대한 기능을 확인하기 위한 것으로, dNP2-ctCTLA-4의 K 모티프(motif)를 준비하여, 면역반응 억제정도를 분석하였다.
우선, dNP2-ctCTLA-4, 서열번호 28의 K1 펩타이드, 서열번호 2, 4 내지 6의 K 변이체(K2(G4S), K3(G4S), K3(GG), K3)를 하기 표 6에서와 같이 설계하였다. dNP2-ctCTLA-4(WT), 서열번호 28의 K1 펩타이드는 애니젠(AnyGen, Kwangju, Korea)에 의뢰하여 고체상 펩티드 합성(SPPS; solid-phase peptide synthesis)으로 제작하였다. 구체적인 제조과정은 실시예 1과 동일하며, 서열번호 2, 4, 5, 6의 K 변이체(K2(G4S), K3(no linker), K3(G4S), K3(GG))는 실시예 2, 실시예 4, 실시예 5, 실시예 6을 사용하였다. 본 실험에서 제조된 펩타이드 역시 순도는 95% 이상인 것으로 확인되었다.
본 발명에서 'K1'은 D 형 또는 L 형 아미노산이 치환 또는 추가되거나, 삭제되지 않은 어떠한 변형도 없는 순수 서열번호 28로 표시되는 펩타이드이며, 말단에도 지방산, 링커와 같은 어떠한 추가물질도 결합되지 않은 순수 펩타이드인 것을 사용하였다.
명칭 서열
번호		 아미노산 서열
dNP2-ctCTLA-4 15 KIKKVKKKGRKGSKIKKVKKKGRKGGKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
K1 28 KMLKKRS
K2(G4S)
(실시예 2)		 2 KMLKKRSGGGGSKMLKKRS
K3(no linker)
(실시예 4)		 4 KMLKKRSKMLKKRSKMLKKRS
K3(G4S)
(실시예 5)		 5 KMLKKRSGGGGSKMLKKRSGGGGSKMLKKRS
K3(GG)
(실시예 6)		 6 KMLKKRSGGKMLKKRSGGKMLKKRS
시료의 투여 및 샘플링-Th17 분화조건
상기 실험방법 1에 따라 Th17 분화조건에서의 효능 분석하고자 하였다. 시료를 dNP2-ctCTLA-4, 서열번호 28의 K1 펩타이드, 서열번호 2, 4 내지 6의 K1 변이체(K2(G4S), K3(G4S), K3(GG), K3)를 사용한 것을 제외하고 모두 실험방법 1과 동일하게 수행하였다. 하기와 같이 총 여덟 그룹(Th17, dNP2-ctCTLA-4, K1, K2(G4S), K3(G4S), K3(GG), K3(no linker))으로 나누어 진행하였다. 상기 그룹들은 4일 후 IL-17, Foxp3 형광 항체를 이용하여 유세포 분석(flow cytometry) 하였다.
Th17 그룹(대조군) : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 PBS(2 μM)를 처리.
dNP2-ctCTLA-4 그룹(양성대조군1) : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 15의 dNP2-ctCTLA-4(2 μM)를 처리.
AP-ctCTLA-4 그룹(양성대조군2) : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 17의 AP-ctCTLA-4(2 μM)를 처리.
K1 그룹 : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 28의 K1 펩타이드(2 μM)를 처리.
K2(G4S) 그룹 : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 2의 K2(G4S) 펩타이드(2 μM)를 처리.
K3(no linker) 그룹 : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 4의 K3(no linker) 펩타이드(2 μM)를 처리.
K3(G4S) 그룹 : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 5의 K3(G4S) 펩타이드(2 μM)를 처리.
K3(GG) 그룹 : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 6의 K3(GG) 펩타이드(2 μM)를 처리.
시료의 투여 및 샘플링-다발성 경화증 동물모델
실험방법 2에 따라 다발성경화증 동물모델에서의 효능을 분석하고자 하였다. 실험방법 2에서 시료를 dNP2-ctCTLA-4, 서열번호 28의 K1 펩타이드, 서열번호 2 K2 펩타이드, 서열번호 4의 K3(no linker) 펩타이드를 사용하여, 총 다섯 그룹(Th17, dNP2-ctCTLA-4, K1, K2(G4S), K3(no linker))으로 나누어 진행하였다.
PBS 그룹(대조군) : PTX를 주사하고 7일째부터 18일까지 PBS 100 ㎍을 매일 1 회씩 복강내 주사.
dNP2-ctCTLA-4 그룹(양성대조군1) : PTX를 주사하고 7일째부터 18일까지 서열번호 15의 dNP2-ctCTLA-4_WT(100 ㎍)을 매일 1 회씩 복강내 주사.
K1 그룹(양성대조군2) : PTX를 주사하고 7일째부터 18일까지 서열번호 28의 K1 펩타이드(100 ㎍)를 매일 1 회씩 복강내 주사.
K2(G4S) 그룹 : PTX를 주사하고 7일째부터 18일까지 서열번호 2의 K2(G4S) 펩타이드(100 ㎍)를 매일 1 회씩 복강내 주사.
K3(no linker) 그룹 : PTX를 주사하고 7일째부터 18일까지 서열번호 4의 K3 펩타이드(100 ㎍)를 매일 1 회씩 복강내 주사.
각 그룹은 다발성경화증을 유도하고 난 후부터 실험방법 2와 같이 매일 관찰하고 임상 징후 점수를 매겨 기록하였고, 실험이 종료된 후 조직학적 분석을 통해 림프구, CD4+IL-17A+ T 세포, CD4+IFN-γ+ T 세포, Treg/Teff의 비율을 측정하였다.
도 15는 dNP2-ctCTLA-4, K1, K2(G4S), K3(G4S), K3(GG), K3(no linker)에 대한 구조를 나타낸 도면이고, 도 16은 마우스로부터 분리한 비장세포로부터 분화된 Th17 세포에 처리된 일곱 그룹(Th17, dNP2-ctCTLA-4, K1, K2(G4S), K3(G4S), K3(GG), K3(no linker))에 대한 IL-17A 및 foxp3의 유세포 분석 결과이며, 도 17은 여덟 그룹(Th17, dNP2-ctCTLA-4(WT), AP-ctCTLA-4, K1, K2(G4S), K3(G4S), K3(GG), K3(no linker))에 대한 CD4+IL-17A+ T 세포, CD4+foxp3+ T 세포의 유세포 분석 결과이다.
도 16 및 도 17에 나타난 바와 같이, dNP2와 같은 세포투과성 펩타이드(CPP)를 제거하고 K 모티프(motif)를 두 개 및 세 개를 연결한 펩타이드를 사용한 경우(실시예 2, 실시예 4), K1 그룹보다 유의적으로 면역세포 억제 활성이 우수한 것을 확인할 수 있다. 즉 dNP2-ctCTLA4와 달리 K2 펩타이드와 K3 펩타이드는 CPP 없이도 현저히 우수한 면역반응 억제 효과가 있다는 것을 확인하였다. 반면 K1 펩타이드는 CPP없이는 Th17(대조군)과 유의적 차이가 나타나지 않은 것으로 확인되었다.
따라서 dNP2-ctCTLA4 유래라고 하더라도 K1 펩타이드로는 본원발명이 얻고자 하는 자가면역 질환 예방 또는 치료 효과를 얻을 수 없다는 것을 알 수 있다.
도 18은 다섯 그룹(PBS, dNP2-ctCTLA-4, K1, K2(G4S), K3(no linker))에 대한 다발성 경화증 동물모델의 임상 증후 평가 결과를 나타낸 그래프이고, 도 19는 다섯 그룹(PBS, dNP2-ctCTLA-4, K1, K2(G4S), K3(no linker))에 대한 면역세포(Th1, Th17, Treg)의 수를 분석하여 나타낸 그래프이다.
도 18 및 도 19에 나타난 바와 같이, K2(G4S) 그룹과 K3(no linker) 그룹에서 임상징후 평가가 K1 그룹보다 유의적으로 현저히 우수한 것을 확인할 수 있다. 또한, K2(G4S) 그룹과 K3(no linker) 그룹은 K1 그룹보다 척수에 침윤된 림프구의 숫자가 유의적으로 낮은 것을 확인하였다. 특히 K2(G4S) 그룹과 K3(no linker) 그룹에서 Treg 세포의 수가 K1 그룹 보다 높은 것을 확인할 수 있다. 즉, K 모티프(motif)라고 하더라도, 단독으로는 다발성 경화증 동물모델에 대해 유의적 효과를 나타내지 못하나, K2, K3 펩타이드는 생체 내에서 다발성 경화증에 대해 현저히 유의한 효과를 나타낸다는 것을 알 수 있다.
실험예 5. AP-K2 복합체, AP-K3 펩타이드의 효능 분석
시료의 준비
본 실험은 CPP와 결합한 K2, K3 펩타이드 복합체 효능을 분석한 것이다. 이를 위해 우선 dNP2-ctCTLA-4, K2, K3(no linker), AP-K2, AP-K3를 실시예 1, 실시예 4 및 실시예 9, 실시예 10과 같이 준비하였다. 각각의 서열은 다음 표 7과 같다.
서열번호 명칭 아미노산 서열
15 dNP2-ctCTLA-4 KIKKVKKKGRKGSKIKKVKKKGRKGGKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
18 dNP2 KIKKVKKKGRKGSKIKKVKKKGRK
19 AP RRRWCKRRR
1 K2 KMLKKRSKMLKKRS
4 K3 KMLKKRSKMLKKRSKMLKKRS
9 AP-K2 RRRWCKRRRGGKMLKKRSKMLKKRS
10 AP-K3 RRRWCKRRRGGKMLKKRSKMLKKRSKMLKKRS
시료의 투여 및 샘플링-Th17 분화조건
실험방법 1에 따라 Th17 분화조건에서의 효능 분석하고자 하였다. 시료를 dNP2-ctCTLA-4, 서열번호 1의 K2 펩타이드, 서열번호 4의 K3 펩타이드, 서열번호 9의 AP-K2 펩타이드 및 서열번호 10의 AP-K3 펩타이드를 사용하였다는 것을 제외하고는 모두 실험방법 1과 동일하게 하여 수행하였다. 총 여섯 그룹(Th17(대조군), dNP2-ctCTLA-4, K2, K3, AP-K2, AP-K3)으로 나누어 진행하였다.
Th17 그룹(대조군1) : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 PBS(2 μM)를 처리.
dNP2-ctCTLA-4 그룹(양성대조군) : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 15의 dNP2-ctCTLA-4(2 μM)를 처리.
K2 그룹 : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 1의 K2 펩타이드(2 μM)를 처리.
K3 그룹 : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 4의 K3 펩타이드(2 μM)를 처리.
AP-K2 그룹 : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 9의 AP-K2 펩타이드(2 μM)를 처리.
AP-K3 그룹 : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 10의 AP-K3 펩타이드(2 μM)를 처리.
시료의 투여 및 샘플링-다발성경화증 동물모델
실험방법 2에 따라 다발성경화증 동물모델에서의 효능을 분석하고자 하였다. 실험방법 2에서 시료를 dNP2-ctCTLA-4, AP, dNP2, AP-K2 및 AP-K3를 사용하여, 총 여섯 그룹(PBS, dNP2-ctCTLA-4, AP, dNP2, AP-K2 및 AP-K3)으로 나누어 진행하였다.
PBS 그룹(대조군) : PTX를 주사하고 7일째부터 15일까지 PBS 100 ㎍을 매일 1 회씩 복강내 주사.
dNP2-ctCTLA-4 그룹(양성대조군1) : PTX를 주사하고 7일째부터 15일까지 서열번호 15의 dNP2-ctCTLA-4(100 ㎍)을 매일 1 회씩 복강내 주사.
AP 그룹 : PTX를 주사하고 7일째부터 13일까지 서열번호 19의 AP 펩타이드(100 ㎍)를 매일 1 회씩 복강내 주사.
dNP2 그룹 : PTX를 주사하고 7일째부터 13일까지 서열번호 18의 dNP2 펩타이드(100 ㎍)를 매일 1 회씩 복강내 주사.
AP-K2 그룹 : PTX를 주사하고 7일째부터 13일까지 서열번호 9의 AP-K2 펩타이드(100 ㎍)를 매일 1 회씩 복강내 주사.
AP-K3 그룹 : PTX를 주사하고 7일째부터 13일까지 서열번호 10의 AP-K3 펩타이드(100 ㎍)를 매일 1 회씩 복강내 주사.
각 그룹은 다발성경화증을 유도하고 난 후부터 실험방법 2와 같이 매일 관찰하고 임상 징후 점수를 매겨 기록하였고, 실험이 종료된 후 조직학적 분석을 통해 림프구, CD4+IL-17A+ T 세포, CD4+IFN-γ+ T 세포, Treg/Teff의 비율을 측정하였다.
도 20은 dNP2-ctCTLA-4, 서열번호 1의 K2 펩타이드, 서열번호 4의 K3 펩타이드, 서열번호 9의 AP-K2 펩타이드 및 서열번호 10의 AP-K3 펩타이드에 대한 구조를 나타낸 도면이고, 도 21은 마우스로부터 분리한 비장세포로부터 분화된 Th17 세포에 처리된 여섯 그룹(Th17(대조군), dNP2-ctCTLA-4, K2, K3, AP-K2, AP-K3)에 대한 IL-17A 및 foxp3의 유세포 분석 결과이다.
도 21에 나타난 바와 같이, K2 그룹과 K3 그룹은 PBS(대조군) 보다 유의적으로 우수한 면역반응 억제 효과를 가지는 것을 확인하였다. AP와 같은 세포투과성 펩타이드(CPP)를 결합한 AP-K2 그룹, AP-K3 그룹의 경우, PBS(대조군) 보다 유의적으로 우수한 면역반응 억제 효과를 가지는 것을 확인하였으며, 특히 K2 그룹과 K3 그룹은 dNP2-ctCTLA-4 그룹과 달리 CPP를 포함하고 있지 않음에도, 동등한 효과를 가지는 것으로 확인되었고, AP-K2 그룹 및 AP-K3 그룹은 dNP2-ctCTLA-4 그룹보다 현저히 우수한 IL-17 사이토카인 억제 효과를 갖는 것을 확인할 수 있다.
도 22는 여섯 그룹(PBS(대조군), dNP2-ctCTLA-4, dNP2, AP, AP-K2, AP-K3)에 대한 다발성 경화증 동물모델의 임상 증후 평가 결과를 나타낸 그래프이고, 도 23은 여섯 그룹(PBS(대조군), dNP2-ctCTLA-4, dNP2, AP, AP-K2, AP-K3)에 대한 침윤된 림프구와 면역세포(Treg)의 수를 분석하여 나타낸 그래프이다.
도 22 및 도 23에 나타난 바와 같이, AP-K2 그룹과 AP-K3 그룹에서 임상징후 평가가 PBS(대조군)보다 유의적으로 개선된 것을 확인할 수 있다.
또한, AP-K2 그룹과 AP-K3 그룹은 PBS(대조군)보다 척수에 침윤된 림프구의 숫자가 현저히 낮았으며, dNP2, AP 그룹보다 유의적으로 낮다는 것을 확인할 수 있다.
또한, AP-K2 그룹과 AP-K3 그룹은 PBS(대조군)보다 면역세포인 조절 T 세포(Treg)의 숫자가 유의적으로 증가하는 것을 확인할 수 있는데, 특히 AP-K2 그룹은 dNP2-ctCTLA-4와 동등한 수준으로 증가하는 것을 확인할 수 있다.
종합하면 K2, K3 펩타이드는 단독으로도 자가면역 질환에 대한 예방 또는 치료효과를 가지나, 세포투과성 펩타이드와의 복합체 역시 자가면역 질환에 대한 우수한 치료효과를 갖는다는 것을 알 수 있다.
실험예 6. 지방산으로 수식된 펩타이드와의 효능 분석
시료의 준비
본 실험은 K2 펩타이드와 K3 펩타이드에 지방산을 수식한 펩타이드의 면역반응 억제정도를 분석한 것이다.
우선, dNP2-ctCTLA-4, K2, K3, Myr-K2, Myr-K3를 하기 표 8에서와 같이 설계하고, 실시예 1, 4, 15, 16에 따라 제조하였다. Myr-K2, Myr-K3는 실시예 15 및 16으로부터 제조된 지방산으로 수식된 펩타이드이다. 이때, Myr은 미리스트산을 의미한다.
서열번호 명칭 아미노산 서열
15 dNP2-ctCTLA-4 KIKKVKKKGRKGSKIKKVKKKGRKGGKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
1 K2 KMLKKRSKMLKKRS
4 K3 KMLKKRSKMLKKRSKMLKKRS
9 AP-K2 RRRWCKRRRGGKMLKKRSKMLKKRS
시료의 투여 및 샘플링-Th17 분화조건
상기 실험방법 1에 따라 Th17 분화조건에서의 효능 분석하고자 하였다. 시료를 dNP2-ctCTLA-4, K2, K3, Myr-K2, Myr-K3를 사용한 것을 제외하고 모두 실험방법 1과 동일하게 수행하였다. 하기와 같이 총 여섯 그룹(PBS, dNP2-ctCTLA-4, K2, K3, Myr-K2, Myr-K3)으로 나누어 진행하였다. 상기 그룹들은 4일 후 IL-17, Foxp3 형광 항체를 이용하여 유세포 분석(flow cytometry) 하였다.
Th17 그룹(대조군) : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 PBS(2 μM)를 처리.
dNP2-ctCTLA-4 그룹(양성대조군) : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 15의 (dNP2-ctCTLA-4)_WT(2 μM)를 처리.
K2 그룹 : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 1의 K2 펩타이드(2 μM)를 처리.
K3 그룹 : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 4의 K3 펩타이드(2 μM)를 처리.
Myr-K2 그룹 : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 실시예 15의 Myr-K2(2 μM)를 처리.
Myr-K3 그룹 : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 실시예 16의 Myr-K3(2 μM)를 처리.
시료의 투여 및 샘플링-다발성경화증 동물모델
실험방법 2에 따라 다발성경화증 동물모델에서의 효능을 분석하고자 하였다. 실험방법 2에서 시료를 dNP2-ctCTLA-4, K2, AP-K2, Myr-K2, Myr-K3을 사용하여, 총 여섯 그룹(PBS, dNP2-ctCTLA-4, K2, AP-K2, Myr-K2, Myr-K3)으로 나누어 진행하였다.
PBS 그룹(대조군) : PTX를 주사하고 7일째부터 13일까지 PBS 100 ㎍을 매일 1 회씩 복강내 주사.
dNP2-ctCTLA-4 그룹(양성대조군) : PTX를 주사하고 7일째부터 13일까지 서열번호 15의 (dNP2-ctCTLA-4)_WT(100 ㎍)을 매일 1 회씩 복강내 주사.
K2 그룹 : PTX를 주사하고 7일째부터 13일까지 서열번호 1의 K2 펩타이드(100 ㎍)를 매일 1 회씩 복강내 주사.
AP-K2 그룹 : PTX를 주사하고 7일째부터 13일까지 서열번호 9의 AP-K2 펩타이드(100 ㎍)를 매일 1 회씩 복강내 주사.
Myr-K2 그룹 : PTX를 주사하고 7일째부터 13일까지 실시예 15의 Myr-K2(100 ㎍)를 매일 1 회씩 복강내 주사.
Myr-K2 그룹 : PTX를 주사하고 7일째부터 13일까지 실시예 16의 Myr-K3(100 ㎍)를 매일 1 회씩 복강내 주사.
각 그룹은 다발성경화증을 유도하고 난 후부터 실험방법 2와 같이 매일 관찰하고 임상 징후 점수를 매겨 기록하였고, 실험이 종료된 후 조직학적 분석을 통해 림프구, CD4+IL-17A+ T 세포, CD4+IFN-γ+ T 세포, Treg/Teff의 비율을 측정하였다.
도 24는 dNP2-ctCTLA-4(WT), 서열번호 1의 K2 펩타이드, 서열번호 4의 K3 펩타이드, 실시예 15의 AP-K2 펩타이드 및 실시예 16의 AP-K3 펩타이드에 대한 구조를 나타낸 도면이고, 도 25는 마우스로부터 분리한 비장세포로부터 분화된 Th17 세포에 처리된 여섯 그룹(Th17(대조군), dNP2-ctCTLA-4, K2, K3, Myr-K2, Myr-K3)에 대한 IL-17A 및 foxp3의 유세포 분석 결과이다.
도 25에 나타난 바와 같이, K2 그룹 및 K3 그룹은 PBS 그룹보다 유의적으로 우수한 면역반응 억제 효과를 가지는 것을 확인하였다. K2 펩타이드 및 K3 펩타이드에 지방산을 담체로 결합한 Myr-K2 및 Myr-K3도 PBS 그룹보다 유의적으로 우수한 면역반응 억제 효과를 가지는 것을 확인하였으며, 특히 Myr-K3은 dNP2-ctCTLA-4 그룹보다 면역반응 억제 효과가 유의적으로 현저히 우수한 것을 확인할 수 있다.
도 26은 여섯 그룹(Th17, dNP2-ctCTLA-4, K2, AP-K2, Myr-K2, Myr-K3)에 대한 다발성 경화증 동물모델의 임상 증후 평가 결과를 나타낸 그래프이고, 도 27은 여섯 그룹(Th17, dNP2-ctCTLA-4, K2, AP-K2, Myr-K2, Myr-K3)에 대한 침윤된 림프구와 면역세포(Treg)의 수를 분석하여 나타낸 그래프이다.
도 26 및 도 27에 나타난 바와 같이, K2 그룹, AP-K2 그룹 뿐만 아니라, Myr-K2와 Myr-K3를 사용한 그룹 역시 임상징후 평가가 PBS 그룹보다 유의적으로 개선된 것을 확인할 수 있다. 특히 Myr-K3를 사용한 그룹은 dNP2-ctCTLA-4 그룹보다 현저히 유사한 정도로 증상이 완화되는 것을 확인할 수 있다.
또한, K2 그룹, AP-K2 그룹 뿐만 아니라, Myr-K2와 Myr-K3를 사용한 그룹 모두 PBS(대조군)보다 척수에 침윤된 림프구의 숫자가 유의적으로 낮은 것을 확인할 수 있다. 다만 이중에서 AP-K2 그룹과 Myr-K3 그룹이 가장 효과가 우수하였으며, 특히 Myr-K3 그룹은 dNP2-ctCTLA-4 그룹보다 더 낮은 수준으로 억제하는 것을 확인할 수 있다.
또한, AP-K2 그룹 뿐만 아니라, Myr-K2와 Myr-K3를 사용한 그룹 모두 PBS(대조군)보다 Il-17 T 세포 및 IFN-γ T 세포의 발현을 억제하였고, Foxp3 T 세포의 증가를 유도하는 것을 확인할 수 있다. 특히 Myr-K3를 사용한 그룹은 dNP2-ctCTLA-4 그룹보다 더 낮은 수준으로 억제하는 것을 확인할 수 있다.
종합하면 K2, K3 펩타이드 뿐만 아니라 Myr-K2, Myr-K3 역시 자가면역 질환에 대한 우수한 예방, 치료효과를 갖는다는 것을 알 수 있다.
실험예 7. D-아미노산을 갖는 조절 T 세포 유도 펩타이드에 대한 효능 분석
시료의 준비
본 실험은 서열번호 1 또는 서열번호 4의 조절 T 세포 유도 펩타이드의 일부 아미노산 잔기가 D-아미노산 잔기일 때 자가면역 질환에 대한 효과를 다시금 확인하기 위한 것으로, 우선 dNP2-ctCTLA-4, Myr-K3, Myr-K3D, Pal-K3, Myr-Ap-K2D, Pal-Ap-K2D를 준비하여 실험을 수행하였다. 구체적으로 dNP2-ctCTLA-4는 실험예 1과 동일하게 제조하여 준비하였고, Myr-K3, Myr-K3D, Pal-K3, Myr-Ap-K2D, Pal-Ap-K2D는 실시예 16, 실시예 17, 실시예 18, 실시예 19 및 실시예 20에 따라 제조하였다.
시료의 투여 및 샘플링-Th17 분화조건
상기 실험방법 1에 따라 Th17 분화조건에서의 효능 분석하고자 하였다. 시료를 dNP2-ctCTLA-4, Myr-K3, Myr-K3D, Pal-K3, Myr-Ap-K2D, Pal-Ap-K2D를 사용한 것을 제외하고 모두 실험방법 1과 동일하게 수행하였다. 하기와 같이 총 일곱 그룹(Th17, dNP2-ctCTLA-4, Myr-K3, Myr-K3D, Pal-K3, Myr-Ap-K2D, Pal-Ap-K2D)으로 나누어 진행하였다. 상기 그룹들은 4일 후 IL-17, Foxp3 형광 항체를 이용하여 유세포 분석(flow cytometry) 하였다.
Th17 그룹(대조군1) : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 PBS(2 μM)를 처리.
dNP2-ctCTLA-4 그룹(양성대조군) : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 15의 (dNP2-ctCTLA-4)_WT(2 μM)를 처리.
Myr-K3 그룹 : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 실시예 16의 Myr-K3(2 μM)를 처리.
Myr-K3D 그룹 : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 실시예 17의 Myr-K3D(2 μM)를 처리.
Pal-K3 그룹 : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 실시예 18의 Pal-K3(2 μM)를 처리.
Myr-AP-K2D 그룹 : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 실시예 19의 Myr-AP-K2D(2 μM)를 처리.
Pal-AP-K2D 그룹 : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 실시예 20의 Pal-AP-K2D(2 μM)를 처리.
도 28은 마우스로부터 분리한 비장세포로부터 분화된 Th17 세포에 처리된 일곱 그룹(Th17, dNP2-ctCTLA-4, Myr-K3, Myr-K3D, Pal-K3, Myr-AP-K2D, Pal-AP-K2D)에 대한 IL-17A 및 foxp3의 유세포 분석 결과이다.
도 28에 나타난 바와 같이, D-아미노산 잔기를 갖는 Myr-K3D 그룹, Myr-Ap-K2D 그룹, Pal-AP-K2D 그룹은 PBS 그룹보다 Treg 세포의 발현을 현저히 증가시키는 것을 확인할 수 있다. 특히 K3 펩타이드는 미리스티산(Myr)과 팔미트산(Pal) 중에 어느 것을 사용하더라도 현저히 우수한 면역반응 억제효과를 갖는 것을 알 수 있다. 지방산 중에서 대량생산에 팔미트산이 용이한데, 팔미트산으로 결합하였을 때에도 효과가 없어지지 않고, 우수한 효능을 유지하고 있는 것을 확인하였다.
K2 펩타이드와 K3 펩타이드의 경우 D 형 아미노산 잔기로 변경시, L 형 아미노산 잔기보다 안정성(stability)이 높아지고, Treg 세포, 즉 과도한 면역반응에 의해 증상이 유도된 경우 면역기능을 조절하는 능력은 크게 향상되는 것을 확인할 수 있다.
실험예 8. K2의 변이체에 대한 효능 분석
시료의 준비
본 실험은 AP-K2 펩타이드를 구성하는 아미노산 잔기의 역할을 확인하기 위하여, 서열번호 9의 AP-K2 펩타이드에서 일부 아미노산 잔기를 알라닌으로 치환한 변이체를 하기 서열번호 42 내지 48과 같이 설계하고, 애니젠(AnyGen, Kwangju, Korea)에 의뢰하여 고체상 펩티드 합성(SPPS; solid-phase peptide synthesis)으로 제작하였다. 구체적인 제조과정은 실시예 1과 동일하며, 본 실험에서 제조된 펩타이드 역시 순도는 95% 이상인 것으로 확인되었다.
특히 서열번호 42는 AP-K2 펩타이드에서 주요한 기능을 수행할 것으로 예상되는 리신(lysine) 잔기와 아르기닌(arginine) 잔기를 모두 알라닌(alanine; A)으로 치환한 것으로 음성 대조군(negative control)으로 사용하였고, tjdufqjsgh 19로 표시되는 AP 펩타이드를 비교군으로 사용하였다(본 실험예에서 사용한 AP-K2 KA는 서열번호 19의 dNP2-KA와는 다른 펩타이드이다).
구체적으로, 하기 서열번호 42 내지
서열번호 9 : AP-K2
RRRWCKRRRGGKMLKKRSKMLKKRS
서열번호 19 : AP-K2
RRRWCKRRR
서열번호 42 : AP-K2 KA
RRRWCKRRRGGAMLAAASAMLAAAS
서열번호 43 : AP-K2 1KA
RRRWCKRRRGGAMLKKRSAMLKKRS
서열번호 44 : AP-K2 MA
RRRWCKRRRGGKALKKRSKALKKRS
서열번호 45 : AP-K2 LA
RRRWCKRRRGGKMAKKRSKMAKKRS
서열번호 46 : AP-K2 2KA
RRRWCKRRRGGKMLAKRSKMLAKRS
서열번호 47 : AP-K2 3KA
RRRWCKRRRGGKMLKARSKMLKARS
서열번호 48 : AP-K2 RA
RRRWCKRRRGGKMLKKASKMLKKAS
서열번호 49 : AP-K2 SA
RRRWCKRRRGGKMLKKRAKMLKKRA
시료의 투여 및 샘플링-Th17 분화
상기 실험방법 1에 따라 Th17 분화조건에서의 효능 분석하고자 하였다. 시료를 AP-K2, AP-K2의 변이체(KA, IKA, MA, LA, 2KA, 3KA, RA, SA)를 사용한 것을 제외하고 모두 실험방법 1과 동일하게 수행하였다. 하기와 같이 그룹을 제조하여 실험을 수행하였고, 각 그룹들은 약물을 처리하고 4일 후 IL-17, Foxp3 형광 항체를 이용하여 유세포 분석(flow cytometry)하였다.
Th17 그룹(PBS; 대조군) : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 PBS를 양성대조군과 동일한 볼륨으로 처리함.
AP-K2 그룹(양성대조군) : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 9의 AP-K2(2 μM)를 처리함.
AP 그룹(AP; 비교군) : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 19의 AP(2 μM)을 처리함.
AP-K2 KA 그룹 : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 41의 AP-K2 KA(2 μM)를 처리함.
AP-K2 IKA 그룹 : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 42의 AP-K2 IKA(2 μM)를 처리함.
AP-K2 MA 그룹 : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 43의 AP-K2 MA(2 μM)를 처리함.
AP-K2 LA 그룹 : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 44의 AP-K2 LA(2 μM)를 처리함.
AP-K2 2KA 그룹 : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 45의 AP-K2 2KA(2 μM)를 처리함.
AP-K2 3KA 그룹 : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 46의 AP-K2 3KA(2 μM)를 처리함.
AP-K2 RA 그룹 : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 47의 AP-K2 RA(2 μM)를 처리함.
AP-K2 SA 그룹 : 항-CD3 및 항-CD28로 활성화된 CD4 T 세포에 사이토카인 칵테일과 함께 서열번호 48의 AP-K2 SA(2 μM)를 처리함.
도 29는 마우스로부터 분리한 비장세포로부터 분화된 Th17 세포에 처리된 열한 그룹(Th17, AP-K2, AP, AP-K2 KA, AP-K2 IKA, AP-K2 MA, AP-K2 LA, AP-K2 2KA, AP-K2 3KA, AP-K2 RA, AP-K2 SA)에 대한 IL-17A 및 foxp3의 유세포 분석 결과이며, 도 30은 열한 그룹(Th17, AP-K2, AP, AP-K2 KA, AP-K2 IKA, AP-K2 MA, AP-K2 LA, AP-K2 2KA, AP-K2 3KA, AP-K2 RA, AP-K2 SA)에에 대한 CD4+IL-17A+ T 세포(a), CD4+foxp3+ T 세포(b)의 유세포 분석 결과이다.
앞서 실험을 통해 확인된 K2 모티프(motif)에서 주요한 기능을 하는 아미노산 잔기를 보다 정확하게 분석하기 위하여, 각각의 아미노산 잔기를 치환한 변이체를 사용하여 면역반응 억제 효과를 분석하였다.
도 29 및 30에 나타난 바와 같이, 대조군에 비하여 AP-K2 그룹은 Foxp3을 약 5 배 이상 증가시키며, IL-17은 절반 이하로 감소시키는 효과를 나타내고 있으므로, 이를 통해 본 발명의 AP-K2 펩타이드(서열번호 9)는 면역반응 억제에 우수한 효과를 나타낸다는 것을 확인할 수 있다.
반면, AP-K2 KA 그룹은 AP-K2 기능이 다소 감소하는 것을 확인할 수 있으며, AP-K2 1KA, AP-K2 RA 그룹에서 AP-K2 기능이 유의적으로 감소하였으므로, 이를 통해 AP-K2 중에서 첫 번째 리신 잔기와 아르기닌 잔기가 면역반응 억제에 주요한 역할을 수행한다는 것을 알 수 있다.
또한 AP-K2 LA 그룹도 AP-L2 기능이 다소 감소하는 것을 확인할 수 있는 바, AP-K2 중에서 류신 잔기도 주요한 기능을 수행한다는 것을 확인할 수 있다.
다음으로, AP-K2 SA 그룹, AP-K2 2KA 그룹, AP-K2 3KA 그룹 및 AP-K2 MA 그룹 순으로 IL-17 감소 및 Foxp3 증가 활성을 나타내므로, K2 모티프에서 세린 잔기, 두 번째 및 세 번째 리신 잔기 및 메티오닌 잔기 순으로 면역반응 억제에 관여한다는 것을 확인할 수 있다.
이상으로 본 발명의 특정한 부분을 상세히 기술하였는바, 당업계의 통상의 지식을 가진 자에게 있어서 이러한 구체적인 기술은 단지 바람직한 구현예일 뿐이며, 이에 본 발명의 범위가 제한되는 것이 아닌 점은 명백하다. 따라서, 본 발명의 실질적인 범위는 첨부된 청구항과 그의 등가물에 의하여 정의된다고 할 것이다.

Claims (22)

  1. 하기 서열로 표시되는 조절 T 세포 유도 펩타이드:
    [Lys-Xaa1-Leu-Xaa2-Xaa3-Arg-Xaa4]n
    상기 서열에서, Xaa1, Xaa2, Xaa3 및 Xaa4는 각각 독립적으로, 알라닌(alanine; A), 발린(Valine; V), 이소류신(isoleucine; I), 류신(leucine; L), 메티오닌(methionine; M), 페닐알라닌(phenylalanine; F), 티로신(tyrolsine; Y), 트립토판(trypotophan; W), 리신(lysine; K), 아르기닌(arginine; R), 히스티딘(histidine; H), 세린(serine; S), 트레오닌(threonine; T), 아스파라긴(asparagine, N), 글루타민(glutamine; Q), 아스파르트산(aspartate, D), 글루탐산(glutamate, E), 시스테인(cysteine, C), 글리신(glycine, G) 및 프롤린(proline, P)로 이루어진 아미노산 중에서 선택되는 어느 하나이고,
    n은 2 내지 3의 정수이며,
    상기 서열 중에서 선택되는 어느 하나 이상의 아미노산 잔기는 L 형 또는 D 형 아미노산 잔기이다.
  2. 제1항에 있어서,
    상기 서열에서, Xaa1은 알라닌(alanine; A), 발린(Valine; V), 이소류신(isoleucine; I), 류신(leucine; L), 메티오닌(methionine; M), 페닐알라닌(phenylalanine; F), 티로신(tyrolsine; Y), 트립토판(trypotophan; W)로 이루어진 소수성 아미노산 중에서 선택되는 어느 하나인 것을 특징으로 하는 조절 T 세포 유도 펩타이드.
  3. 제2항에 있어서,
    상기 서열에서, Xaa2 및 Xaa3은 각각 독립적으로 리신(lysine; K), 아르기닌(arginine; R), 히스티딘(histidine; H)로 이루어진 염기성 아미노산 중에서 선택되는 어느 하나인 것을 특징으로 하는 조절 T 세포 유도 펩타이드.
  4. 제3항에 있어서,
    상기 서열에서, Xaa4는 세린(serine; S), 트레오닌(threonine; T), 아스파라긴(asparagine, N), 글루타민(glutamine; Q)로 이루어진 극성 아미노산 중에서 선택되는 어느 하나인 것을 특징으로 하는 조절 T 세포 유도 펩타이드.
  5. 제1항에 있어서,
    상기 서열에서, Xaa1은 메티오닌(methionine; M)인 것을 특징으로 하는 조절 T 세포 유도 펩타이드.
  6. 제5항에 있어서,
    상기 서열에서, Xaa2 및 Xaa3은 리신(lysine; K)인 것을 특징으로 하는 조절 T 세포 유도 펩타이드.
  7. 제6항에 있어서,
    상기 서열에서, Xaa4는 세린(serine; S)인 것을 특징으로 하는 조절 T 세포 유도 펩타이드.
  8. 제1항에 있어서,
    상기 서열에서 첫 번째 위치, 두 번째 위치, 여섯 번째 위치 및 일곱 번째 위치의 아미노산 잔기 중에서 선택되는 어느 하나 이상의 아미노산 잔기는 D형 아미노산인 것을 특징으로 하는 조절 T 세포 유도 펩타이드.
  9. 제1항에 있어서,
    상기 서열에서 여섯 번째 위치 및 일곱 번째 위치의 아미노산 잔기는 D형 아미노산인 것을 특징으로 하는 조절 T 세포 유도 펩타이드.
  10. 제1항에 있어서,
    상기 조절 T 세포 유도 펩타이드는 링커를 더 포함하는 것을 특징으로 하는 조절 T 세포 유도 펩타이드.
  11. 제10항에 있어서,
    상기 링커는 (GGGGS)m(m=1~4), (GG)m(m=1~4), (GSSGGS)m(m=1~4), (EAAAK)m(m=1~4), PAPAP, (AP)m(m=1~4), A(EAAAK)m(m=1~4), (RR)m(m=1~4) 및 GFLG로 이루어진 군으로부터 선택되는 어느 하나 이상인 것을 특징으로 하는 조절 T 세포 유도 펩타이드.
  12. 제1항에 있어서,
    상기 조절 T 세포 유도 펩타이드의 N 또는 C 말단에 지방산이 추가적으로 결합되어 있는 것을 특징으로 하는 조절 T 세포 유도 펩타이드.
  13. 제12항에 있어서,
    상기 지방산은 상기 조절 T 세포 유도 펩타이드의 N 말단에 아마이드 결합으로 결합되어 있는 것을 특징으로 하는 조절 T 세포 유도 펩타이드.
  14. 제12항에 있어서,
    상기 지방산은 탄소수 10 내지 20의 포화 또는 불포화 지방산인 것을 특징으로 하는 조절 T 세포 유도 펩타이드.
  15. 제12항에 있어서,
    상기 지방산은 미리스트산(Myristic acid), 스테아르산(Stearic acid), 리놀레산(Linoleic acid), 팔미트산(Palmitic acid), 올레산(Oleic acid) 및 라우르산(Lauric acid)으로 이루어진 군에서 선택되는 어느 하나 이상인 것을 특징으로 하는 조절 T 세포 유도 펩타이드.
  16. 제1항에 있어서,
    상기 조절 T 세포 유도 펩타이드의 N 또는 C 말단에 세포투과성 펩타이드(cell penetrating peptide, CPP)가 추가적으로 결합되어 있는 것을 특징으로 하는 조절 T 세포 유도 펩타이드.
  17. 제16항에 있어서,
    상기 세포투과성 펩타이드는 서열번호 18로 표시되는 dNP2, 서열번호 19로 표시되는 AP, TAT(HIV 1 trans-activating protein), 6 내지 8개 아르기닌을 갖는 폴리아르기닌 폴리펩티드, 7 내지 11개의 리신을 갖는 폴리리신 폴리펩티드 및 iRGD(internalizing RGD)로 이루어진 군에서 선택되는 어느 하나 이상인 것을 특징으로 하는 조절 T 세포 유도 펩타이드.
  18. 제1항에 있어서,
    상기 조절 T 세포 유도 펩타이드는 서열번호 1 내지 6, 서열번호 11, 서열번호 12 및 서열번호 50 내지 54로 이루어진 군으로부터 선택되는 어느 하나인 것을 특징으로 하는 조절 T 세포 유도 펩타이드.
  19. 제16항에 있어서,
    상기 세포투과성 펩타이드가 결합된 조절 T 세포 유도 펩타이드는 서열번호 7 내지 10, 서열번호 13 및 서열번호 14로 이루어진 군으로부터 선택되는 어느 하나인 것을 특징으로 하는 조절 T 세포 유도 펩타이드.
  20. 제1항에 따른 조절 T 세포 유도 펩타이드를 유효성분으로 하는 자가면역 질환 예방 또는 치료용 약학 조성물.
  21. 제20항에 있어서,
    상기 자가면역 질환은 루푸스(systemic lupus erythematosus), 류머티스 관절염(rheumatoid arthritis), 크론병(crohn disease), 궤양성 대장염(ulcerative colitis), 전신성 경피증(Progressive systemic sclerosis, Scleroderma), 아토피 피부염, 건선, 천포창, 천식, 아프타구내염, 만성 갑상선염, 염증성 장염, 다발성 경화증(multiple sclerosis), 혼합결합조직병(mixed connective tissue disease), 자가면역성 용혈성 빈혈(Autoimmune hemolytic anemia), 베체트병(Behcet's disease), 자가면역성 뇌척수염, 중증 근무력증(Myasthenia gravis), 자가면역성 갑상선염(Autoimmune thyroiditis), 결절성 다발성 동맥염(Polyarteritis nodosa), 강직성 척추염(Ankylosing spondylitis), 섬유조직염(Fibromyalgia syndrome), 쇼그렌 증후군(Sjogren's　syndrome), 자가면역성 포도막염(autoimmuneuveitis), 만성 염증성 탈수초성 다발신경병증(chronic inflammatory demyelinating polyneuropathy) 및 측두동맥염(Temporal arteritis)으로 이루어진 군으로부터 선택되는 어느 하나 이상인 것을 특징으로 하는 자가면역 질환 예방 또는 치료용 약학 조성물.
  22. 제20항에 있어서,
    상기 조성물은 Th17의 활성을 저해하고 Treg를 활성화시키는 것을 특징으로 하는 자가면역 질환 예방 또는 치료용 약학 조성물.
PCT/KR2022/004634 2021-03-31 2022-03-31 조절 t 세포 유도 펩타이드 및 이를 포함하는 자가면역 질환 예방 또는 치료용 조성물 Ceased WO2022211544A1 (ko)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US18/283,112 US20240166687A1 (en) 2021-03-31 2022-03-31 Regulatory t cell-inducing peptide and composition including same for preventing or treating autoimmune disease

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
KR10-2021-0041584 2021-03-31
KR20210041584 2021-03-31
KR10-2021-0124034 2021-09-16
KR20210124034 2021-09-16
KR1020220040191A KR20220136272A (ko) 2021-03-31 2022-03-31 조절 t 세포 유도 펩타이드 및 이를 포함하는 자가면역 질환 예방 또는 치료용 조성물
KR10-2022-0040191 2022-03-31

Publications (1)

Publication Number Publication Date
WO2022211544A1 true WO2022211544A1 (ko) 2022-10-06

Family

ID=83459722

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2022/004634 Ceased WO2022211544A1 (ko) 2021-03-31 2022-03-31 조절 t 세포 유도 펩타이드 및 이를 포함하는 자가면역 질환 예방 또는 치료용 조성물

Country Status (2)

Country Link
US (1) US20240166687A1 (ko)
WO (1) WO2022211544A1 (ko)

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20100234302A1 (en) * 2007-10-17 2010-09-16 The Regents Of The University Of California Peptide for induction of immune tolerance as treatment for systemic lupus erythematosus

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20100234302A1 (en) * 2007-10-17 2010-09-16 The Regents Of The University Of California Peptide for induction of immune tolerance as treatment for systemic lupus erythematosus

Non-Patent Citations (4)

* Cited by examiner, † Cited by third party
Title
CHIKUMA, SHUNSUKE: "CTLA-4, an essential immune-checkpoint for T-cell activation", CURRENT TOPICS IN MICROBIOLOGY AND IMMUNOLOGY, vol. 410, 2017, pages 99 - 126 *
KOK-FAI KONG, GUO FU, YAOYANG ZHANG, TADASHI YOKOSUKA, JAVIER CASAS, ANN J CANONIGO-BALANCIO, STEPHANE BECART, GISEN KIM, JOHN R Y: "Protein kinase C-η controls CTLA-4–mediated regulatory T cell function", NATURE IMMULOGY, NATURE PUBLISHING GROUP US, NEW YORK, vol. 15, no. 5, New York , pages 465 - 472, XP055290520, ISSN: 1529-2908, DOI: 10.1038/ni.2866 *
LEE KYUNG-MI: "T cell costimulation by CD28, CTLA-4, and ICOS", IMMUNE NETWORK, vol. 1, no. 2, 1 January 2001 (2001-01-01), pages 95 - 103, XP055974468 *
LIM, SANGHO: "Role of the cytoplasmic domain of CTLA-4 in regulatory T cell conversion to inhibit autoimmunity", THESIS, HANYANG UNIVERSITY, KOREA, Korea, XP009542046, Retrieved from the Internet <URL:https://repository.hanyang.ac.kr/handle/20.500.11754/75694> *

Also Published As

Publication number Publication date
US20240166687A1 (en) 2024-05-23

Similar Documents

Publication Publication Date Title
WO2017116205A1 (ko) 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체의 지속형 결합체
WO2020130749A1 (ko) 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체 및 인슐린을 포함하는 약학 조성물
WO2017078440A1 (ko) 신경세포 손실 예방 및 재생 효능을 가지는 펩티드 및 이를 포함하는 조성물
WO2020235932A1 (ko) 신규한 펩타이드 화합물 또는 이의 약제학적으로 허용 가능한 염
WO2017222335A1 (ko) 그람음성 다제내성균에 대해 항생제와 상승적 항균 효과를 가지는 항생 펩타이드 및 이의 용도
WO2021066600A1 (ko) 글루카곤, 및 glp-1 수용체 및 gip 수용체 이중 작용제를 포함하는 조성물 및 이의 치료학적 용도
WO2020256392A1 (ko) 라이신 치환을 포함하는 romo1 유래 항균 펩타이드 및 그 변이체
WO2020263063A1 (ko) 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체 또는 이의 결합체의 간 질환에 대한 치료적 용도
WO2021145552A1 (ko) 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체의 지속형 결합체의 폐질환의 치료 용도
WO2023027402A1 (ko) 아프리카 돼지열병 바이러스 유래 항원 단백질을 포함하는 아프리카 돼지열병의 예방용 백신
WO2022211537A1 (ko) 신규한 면역 활성 인터루킨 2 아날로그 결합체 및 이의 제조 방법
WO2021215801A1 (ko) 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체 또는 이의 결합체를 포함하는 고지혈증 예방 또는 치료용 약학적 조성물 및 예방 또는 치료 방법
WO2020214013A1 (ko) 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체 또는 이의 결합체의 고지혈증에 대한 치료적 용도
WO2021201654A1 (ko) Glp-2 유도체 또는 이의 지속형 결합체를 포함하는 방사선요법, 화학요법, 또는 이들의 조합으로 유발된 점막염의 예방 또는 치료용 약학적 조성물
WO2021060927A1 (ko) 유청단백 가수분해물을 유효성분으로 함유하는 근감소증의 개선, 예방 또는 치료용 조성물
WO2022015082A1 (ko) 글루카곤 유도체 또는 이의 결합체의 간질환에 대한 치료적 용도
WO2022080989A1 (ko) 글루카곤/glp-1/gip 삼중작용제 또는 이의 지속형 결합체를 포함하는 루푸스-관련 질환의 예방 또는 치료용 약학적 조성물
WO2024136597A1 (ko) Glp-2 유도체 또는 이의 지속형 결합체를 포함하는 이식편대숙주질환의 예방 또는 치료용 약학적 조성물
WO2020013527A1 (ko) 항균 활성, 용혈 안정성 및 혈청 내 안정성이 증진된 항균 펩타이드 유도체
WO2020130751A1 (ko) 인슐린 및 글루카곤을 포함하는 약학 조성물
WO2022260367A1 (ko) 급성 염증성 질환 예방 또는 치료용 비바이러스성 유전자/전달체 복합체
WO2024167324A1 (ko) 미토콘드리아 특이적 펩타이드를 포함하는 신장 또는 간 질환의 예방 또는 치료용 조성물
WO2023277620A1 (ko) 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체를 포함하는 조합물의 치료학적 용도
WO2022065897A1 (ko) 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체 또는 이의 결합체의 신경퇴행성 질환의 치료 용도
WO2021133087A1 (ko) Glp-2 또는 이의 결합체를 포함하는 골 대사성 질환에 대한 예방 또는 치료용 약학적 조성물

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22781663

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 18283112

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 22781663

Country of ref document: EP

Kind code of ref document: A1