Classifications

• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K38/00—Medicinal preparations containing peptides
  • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
  • A61K38/43—Enzymes; Proenzymes; Derivatives thereof
  • A61K38/46—Hydrolases (3)
  • A61K38/465—Hydrolases (3) acting on ester bonds (3.1), e.g. lipases, ribonucleases
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P11/00—Drugs for disorders of the respiratory system
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P17/00—Drugs for dermatological disorders
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P17/00—Drugs for dermatological disorders
  • A61P17/02—Drugs for dermatological disorders for treating wounds, ulcers, burns, scars, keloids, or the like
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P17/00—Drugs for dermatological disorders
  • A61P17/06—Antipsoriatics
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P17/00—Drugs for dermatological disorders
  • A61P17/10—Anti-acne agents
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P27/00—Drugs for disorders of the senses
  • A61P27/02—Ophthalmic agents
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P27/00—Drugs for disorders of the senses
  • A61P27/16—Otologicals
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
  • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
  • C07K14/76—Albumins
  • C07K14/765—Serum albumin, e.g. HSA
• • C—CHEMISTRY; METALLURGY
  • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
  • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
  • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
  • C12N15/09—Recombinant DNA-technology
  • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
  • C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
  • C12N15/80—Vectors or expression systems specially adapted for eukaryotic hosts for fungi
  • C12N15/81—Vectors or expression systems specially adapted for eukaryotic hosts for fungi for yeasts
  • C12N15/815—Vectors or expression systems specially adapted for eukaryotic hosts for fungi for yeasts for yeasts other than Saccharomyces
• • C—CHEMISTRY; METALLURGY
  • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
  • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
  • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
  • C12N9/14—Hydrolases (3)
  • C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
  • C12N9/22—Ribonucleases [RNase]; Deoxyribonucleases [DNase]
• • C—CHEMISTRY; METALLURGY
  • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
  • C12Y—ENZYMES
  • C12Y301/00—Hydrolases acting on ester bonds (3.1)
  • C12Y301/21—Endodeoxyribonucleases producing 5'-phosphomonoesters (3.1.21)
• • C—CHEMISTRY; METALLURGY
  • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
  • C12Y—ENZYMES
  • C12Y301/00—Hydrolases acting on ester bonds (3.1)
  • C12Y301/21—Endodeoxyribonucleases producing 5'-phosphomonoesters (3.1.21)
  • C12Y301/21001—Deoxyribonuclease I (3.1.21.1)
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K38/00—Medicinal preparations containing peptides
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2319/00—Fusion polypeptide
  • C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
  • C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2319/00—Fusion polypeptide
  • C07K2319/31—Fusion polypeptide fusions, other than Fc, for prolonged plasma life, e.g. albumin

Definitions

• Inflammation is an essential host response to control invading microbes and heal damaged tissues. Uncontrolled and persistent inflammation causes tissue injury in a plethora of inflammatory disorders. Neutrophils are the predominant leukocytes in acute inflammation. During infections neutrophils generate neutrophil extracellular traps (NETs), lattices of DNA-fil aments decorated with toxic histones and enzymes that immobilize and neutralize bacteria. However, excessive NET formation may harm host cells due to their cytotoxic, proinflammatory, prothrombotic activity, and pro-tumorigenic activity.
• NETs neutrophil extracellular traps
• DNASE1-LIKE 2 (also referred to herein as DNASE1L2 or D1L2), belongs to the DNASE1 protein family, a homologous group of secreted endonuclease enzymes that can degrade extracellular DNA.
• D1L2 is the only divalent cation-dependent acidic DNase in mammals. Thus, D1L2 has unique features that are likely physiologically and therapeutically relevant. While D1L2 may have desirable enzymatic properties for treating or controlling inflammatory conditions or infection of various tissues, e.g., by degrading extracellular DNA, D1L2 has not been described as suitable for manufacturing using conventional recombinant systems.
• the invention provides recombinant D1L2 enzymes with improvements for manufacturing and therapy, as well as methods for producing the recombinant D1L2 enzyme and using the recombinant D1L2 enzyme for therapy.
• the present disclosure demonstrates that the recombinant D1L2 enzyme has high chromatin-degrading activity, particularly at acidic pH.
• the present disclosure is based, in part, on the discovery that a D1L2 enzyme lacking a proline-rich domain (PRD) and/or lacking the C-terminal Arg residue is efficiently produced in microbial expression systems and has high activity for degrading chromatin at acidic pH.
• PRD proline-rich domain
• the disclosure provides a recombinant D1L2 enzyme lacking a PRD domain, and/or lacking a C-terminal Arginine that is naturally present in D1L2 isoform 1 and isoform 2.
• the D1L2 enzyme according to this aspect has high recombinant expression properties, including in non-mammalian expression systems such as Pichia pastoris.
• a method is provided for producing recombinant D1L2 enzyme lacking a PRD and/or a C-terminal Arginine. The method comprises culturing a non-mammalian host cell encoding the D1L2 enzyme and recovering the enzyme from the culture.
• An exemplary D1L2 enzyme in accordance with the disclosure is represented by SEQ ID NO: 7.
• the D1L2 gene that is expressed in the expression system encodes signal peptide that is essentially native to a wild-type human DNase.
• the signal peptide is from human D1 (SEQ ID NO: 13), D1L2 (SEQ ID NO: 8), DILI (SEQ ID NO: 14), or D1L3 (SEQ ID NO: 15).
• the signal peptide is a non-native (to the D1L2 enzyme) signal peptide suitable for secretion from host cells of the non-mammalian expression system.
• An exemplary non-native signal peptide is a-Mating Factor (SEQ ID NO: 9), which may be used for example, with yeast expression systems such as Pichia pastoris.
• the D1L2 enzyme is fused to a carrier protein, optionally by means of an amino acid linker.
• the carrier protein can be an albumin amino acid sequence. Such fusion to a carrier protein can provide benefits in in vivo persistence, as well as in recombinant expression.
• the recombinant D1L2 enzyme is not glycosylated.
• the D1L2 enzyme produced according to this disclosure is substantially non-immunogenic.
• the D1L2 enzyme is engineered to have physical, pharmacodynamics, and/or enzymatic properties suitable for therapy, including therapy using topical or locally administered compositions.
• the engineered D1L2 enzyme may have the same or higher protein-free DNA (naked DNA) degrading activity, the same or higher chromosomal DNA (chromatin) degrading activity, similar or improved protease resistance, and higher production levels in non-mammalian expression systems (such as Pichia pastoris) than D1L2 isoform 1 (defined by SEQ ID NO: 1 or SEQ ID NO: 4).
• the D1L2 enzyme contains one or more polyethylene glycol (PEG) moieties or other conjugates (e.g., fatty acid or acyl groups).
• PEG polyethylene glycol
• one or more PEGylated amino acids are selected from lysine, cysteine, histidine, arginine, aspartic acid, glutamic acid, serine, threonine and tyrosine.
• one or more amino acids suitable for PEGylation are introduced by substitution of one or more amino acids in D1L2 (e.g., in SEQ ID NO: 7).
• one or more PEGylated amino acids are cysteine (Cys or C) and PEGylation is conducted via thiol conjugation.
• NHS-PEG reagent can be used to PEGylate primary amines in D1L2.
• the D1L2 enzyme is encoded by a polynucleotide, which can be codon optimized for expression in the non-mammalian expression system.
• the polynucleotide comprises a plasmid vector.
• the plasmid vector comprises a nucleic acid encoding the D1L2 enzyme or variant described herein, operably linked to an expression control region that is functional in the host cell.
• the expression control region is capable of driving expression of the operably linked encoding nucleic acid such that the enzyme is produced in a cell transformed with the expression vector.
• the disclosure provides a non-mammalian expression cell (a “host cell”), which comprises the expression vector encoding the D1L2 enzyme described herein.
• a host cell which comprises the expression vector encoding the D1L2 enzyme described herein.
• the cell is a yeast cell, such as Pichia pastoris.
• compositions for topical or local administration comprise recombinant D1L2 enzyme described herein, or as produced according to this disclosure, and a pharmaceutically acceptable carrier.
• the pharmaceutical composition is formulated for topical administration, such as a cream, lotion, gel, solution, foam, spray, ointment, mouthwash, shampoo or soap.
• the pharmaceutical composition is for local or topical treatment of a tissue having an acidic environment and/or biolfilms.
• the acidic environment may have a pH of about 6.0 or less, about 5.5 or less, or about 5.0 or less, or about 4.5 or less, or about 4.0 or less.
• the composition is a skin care composition for maintaining healthy skin and attractive appearance of skin. In these embodiments, the composition is useful in a method of treating or preventing infection and/or inflammation of the skin.
• the subject may have a condition that impacts the appearance or health of skin, hair, or nails.
• the subject has a condition such as psoriasis, dermatitis, epidermolysis bullosa, or an allergic reaction (e.g., comprising hives or rash).
• the subject has dry skin, such as xeroderma.
• the subject has acne vulgaris.
• the subject’s skin may be characterized by overgrowth of Staphylococcus aureus , which can be associated with atopic dermatitis.
• the subject has psoriasis, and the composition is applied to psoriatic lesions.
• the composition is formulated for administration to one or more of the eyes, ears, nasal or sinus cavity, and oral cavity.
• Compositions according to these embodiments can be useful in a method for treating or preventing inflammation or infection of the eyes of a subject, for example, where the composition is formulated as an eye drop or eye wash (including an eye lid cleaner).
• the subject may have dry eye disease, or may have allergic, bacterial, or viral conjunctivitis. Bacterial conjunctivitis can be exacerbated by biofilm formation.
• the subject has inflamed ducts of the eye, as may manifest as blepharitis or related condition (e.g., chalazion).
• the composition can be useful for treating or preventing inflammation or infection of the ears of a subject, for example, where the composition formulated as an ear drop.
• the composition can be useful in a method for treating or preventing of nasal or sinus inflammation or infection of a subject, for example, where the composition is formulated as a nasal spray.
• the subject has a sinus infection or recurring sinus infection.
• the subject has an infection or inflammation of the oral cavity, including gingivitis and dental abscess.
• the composition is useful in a method for the treatment of a nucleic acid-related eye disease.
• diseases include dry eye disease, lamellar keratitis, contact lens-associated keratitis, endophthalmitis, infectious crystalline keratopathy, ocular cicatricial pemphigoid (OCP), keratoconjunctivitis sicca (KCS), Sjogren syndrome (SS), Sjogren syndrome associated keratoconjunctivitis sicca, non-Sjogren syndrome associated keratoconjunctivitis sicca, keratitis sicca, sicca syndrome, xerophthalmia, tear film disorder, decreased tear production, aqueous tear deficiency (ATD), and meibomian gland dysfunction (MGD).
• OCP ocular cicatricial pemphigoid
• KCS keratoconjunctivitis sicca
• SS Sjogren syndrome associated keratoconjunctivitis sicca
• the composition is formulated for pulmonary delivery, such as a powder or solution aerosol. In some embodiments, the composition is formulated for delivery by nebulizer. In various embodiments, the composition is useful in a method for treating or preventing inflammation or infection of the lungs of a patient.
• the subject has cystic fibrosis, pneumonia, bronchitis, asthma, lower respiratory tract infection, acute respiratory distress syndrome (ARDS), acute lung injury (ALI), transfusion-induced lung injury (TRALI), or chronic obstructive pulmonary disease (COPD).
• ARDS acute respiratory distress syndrome
• ALI acute lung injury
• TRALI transfusion-induced lung injury
• COPD chronic obstructive pulmonary disease
• the subject has pulmonary fibrosis (e.g., idiopathic pulmonary fibrosis, or IPF).
• the subject has a chronic or recurring pulmonary infection.
• the D1L2 enzyme in accordance with this disclosure, for example, by nebulizer, it may be possible to control Pseudomonas infection in cystic fibrosis patients and relieve some overuse of antibiotics.
• the D1L2 enzyme provided herein has higher activity in CF lung secretions than PULMOZYME (domase alfa).
• the patient may have an indwelling medical device, which tend to favor microbial colonization and biofilm formation.
• the D1L2 enzyme or composition comprising the D1L2 enzyme is administered to a patient on mechanical ventilation to avoid or reduce biofilm formation.
• FIG. 1 shows an amino acid sequence alignment of human DNASE1L2 isoform 1 (DNASE 1L2-L, SEQ ID NO: 1, Uniprot identifier: Q92874-1) and the human DNASE 1L2 isoform 2 (DNASE1L2-S; SEQ ID NO: 2, Uniprot identifier: Q92874-2).
• the secretory signal peptide (SEQ ID NO: 8) and proline rich domain (PRD, SEQ ID NO: 3) are highlighted. Sequence rulers indicate the amino acid position.
• the mature forms of isoform 1 DNASE 1L2-L, SEQ ID NO: 1, Uniprot identifier: Q92874-1
• the secretory signal peptide SEQ ID NO: 8
• proline rich domain PRD, SEQ ID NO: 3
• FIG. 2 shows that deletion of the proline-rich domain increases DNASE1L2 expression in Pichia pastoris. Shown are the estimated protein concentrations in supernatants of the three best performing strains, calculated by peak area for bovine serum albumin diluted in mock strain matrix at known concentrations.
• Expression constructs include (a) isoform 1 (SEQ ID NO: 4) with native signal peptide (SP, SEQ ID NO: 8), (b) isoform 1 (SEQ ID NO: 4) with alpha mating factor (aMF, SEQ ID NO: 9), and (c) isoform
• alpha mating factor SEQ ID NO: 9
• FIG. 3 shows that purified proline-rich domain deleted DNASE1L2 (PRDD- DNASE1L2) degrades chromatin at acidic pH.
• Nuclei as a source of high molecular weight chromatin, were incubated with purified PRDD-DNASE1L2 at pH levels ranging from 3.5 to 7.5. Degradation of high molecular weight to low molecular weight was observed at acidic pH 3.5 to 5.5.
• Basic-domain deleted (BDD)-DNASE1L3 which served as a control, showed degradation at neutral pH 6.5 and 7.5.
• FIG. 4 shows an alignment of DNASE1L2 amino acid sequences of different species extracted from the Uniprot database. The alignment indicates that only DNASE1L2 from humans, chimpanzees, and baboons features a C-terminal arginine residue.
• FIG. 5 shows that deletion of the C-terminal arginine residue increases DNASE1L2 isoform 2 expression in Pichia pastoris. Shown are the estimated protein concentrations in supernatants of the three best performing strains, calculated by peak area for bovine serum albumin diluted in mock strain matrix at known concentrations.
• Expression constructs include (a) isoform 1 (SEQ ID NO: 4), (b) isoform 2 (SEQ ID NO: 6), and (c) isoform 2 lacking the C-terminal arginine residue (del278R in SEQ ID NO: 6) generating a new variant (SEQ ID NO: 7). All constructs employed the alpha mating factor (aMF, SEQ ID NO: 9) as a secretory signal peptide.
• aMF alpha mating factor
• FIG. 6 shows D1L2 (PRDD) expressed in Pichia pastoris as a fusion with albumin at the N-terminus.
• the present disclosure is based, in part, on the discovery that a D1L2 enzyme lacking a proline-rich domain (PRD), and/or lacking the C-terminal Arg residue, is efficiently produced in microbial strains and has high activity for degrading chromatin at acidic pH.
• PRD proline-rich domain
• DNASE1L2 (or D1L2) is expressed and secreted in two isoforms, SEQ ID NO: 1 and SEQ ID NO: 2, which differ in the presence or absence of the PRD, respectively.
• the isoform 1 is expressed in terminally differentiated keratinocytes of the human epidermis, hair follicles and the nail matrix.
• Knockdown of D1L2 in a human in vitro skin model suppressed the degradation of nuclear DNA and caused retention of nuclei in the stratum corneum, a condition known as parakeratosis.
• Fischer H. et ak DNASE 1L2 degrades nuclear DNA during comeocvte formation. J Invest Dermatol. 2007 Jan; 127(l):24-30.
• D1L2 can suppress biofilm formation of pathogens such as Pseudomonas aeruginosa and Staphylococcus aureus , among others.
• Eckhart L, et ak, DNASE1L2 suppresses biofilm formation by Pseudomonas aerusinosa and Staphylococcus aureus.
• Isoform 2 is expressed in leukocytes under inflammatory conditions, but the functions are poorly characterized.
• D1L2 may have desirable enzymatic properties for treating or controlling inflammatory conditions or infection of various tissues, e.g., by degrading extracellular DNA
• D1L2 has not been described as suitable for manufacturing using conventional recombinant systems. Accordingly, the present disclosure, in the various aspects and embodiments, provides recombinant D1L2 enzymes and methods for producing recombinant D1L2 enzymes, including for use in therapy.
• the invention provides for high expression of the D1L2 enzyme in non-mammalian expression systems, such as yeast expression systems (e.g., Pichia pastoris ), the D1L2 enzyme having robust activity for therapeutic applications.
• yeast expression systems e.g., Pichia pastoris
• the D1L2 enzyme has robust activity at acidic pH (e.g., ⁇ about 6.0).
• the disclosure provides a method for producing recombinant D1L2 enzyme.
• the method comprises culturing a non-mammalian host cell encoding a D1L2 enzyme substantially lacking the Proline Rich Domain (PRD) defined by SEQ ID NO: 3.
• PRD Proline Rich Domain
• the D1L2 produced by the host cell will comprise a signal peptide directing secretion from the cell, which is generally removed during secretion.
• the method further comprises recovering the D1L2 enzyme from the culture media.
• Human DlL2-isoform 1 contains a 21-amino acid PRD, as illustrated in FIG. 1. Removal of this PRD (as in isoform 2) substantially improves expression in non-mammalian expression systems.
• Exemplary expression systems include eukaryotic expression systems such as yeast expression systems, as well as insect cell or plant cell expression systems.
• An exemplary non-mammalian expression system is Pichia pastoris.
• Suitable non-mammalian expression systems include, but are not limited to, as insect cell-based expression systems such as Sf9 cells and baculovirus-based vectors; bacterial expression systems such as Escherichia coli , Lactoccocus lactis , Pseudomonas fluorescens and Bacillus subtilis; yeast and filamentous fungal expression systems such as Aspergillus spp., Saccharomyces cerevisiae , Pichia pastoris and Yarrowia lipolytica ; plant-based expression systems such as Nicotiana benthamiana and Nicotiana tabacum. See e.g., U.S. Patent Nos.
• the D1L2 enzyme lacks at least about 10 amino acids of the PRD (SEQ ID NO: 3). In some embodiments, the D1L2 enzyme lacks at least about 15 amino acids, or at least about 18 amino acids of the PRD (SEQ ID NO: 3), or lacks the full PRD.
• the PRD is replaced with an alternative sequence that has low or no more than minimal homology to the PRD, such as less than about 8 or less than about 5 identical amino acids that align at a corresponding position.
• the alternative sequence has no more than about three, or no more than about two, or no more than one proline residue.
• the D1L2 enzyme having a deleted or modified PRD comprises an amino acid sequence having at least about 80% sequence identity to the enzyme defined by SEQ ID NO: 4 (Isoform 1) or SEQ ID NO: 6 (Isoform 2).
• the D1L2 enzyme comprises an amino acid sequence having at least about 85% sequence identity, or at least about 90% sequence identity to the enzyme defined by SEQ ID NO: 4 or SEQ ID NO: 6, or at least about 95% sequence identity to the enzyme defined by SEQ ID NO: 4 or SEQ ID NO: 6, or at least about 97% sequence identity to the enzyme defined by SEQ ID NO: 4 or SEQ ID NO: 6.
• the D1L2 enzyme comprises an amino acid sequence having at least about 85% sequence identity, or at least about 90% sequence identity to the enzyme defined by SEQ ID NO: 6, or at least about 95% sequence identity to the enzyme defined by SEQ ID NO: 6, or at least about 97% sequence identity to the enzyme defined by SEQ ID SEQ ID NO: 6.
• the disclosure provides a recombinant D1L2 enzyme lacking a C-terminal Arginine that is naturally present in D1L2 isoform 1 and isoform 2.
• the D1L2 enzyme according to this aspect has high recombinant expression properties, including in non-mammalian expression systems such as Pichia pastoris.
• a method is provided for producing recombinant D1L2 enzyme lacking a C- terminal Arginine. The method comprises culturing a non-mammalian host cell encoding a D1L2 enzyme lacking the C-terminal Arg residue.
• Non-limiting examples of D1L2 enzymes lacking the C-terminal Arg residue are SEQ ID NO: 5 and SEQ ID NO: 7.
• the D1L2 enzyme that lacks the C-terminal Arg residue comprises an amino acid sequence having at least about 80% sequence identity to the enzyme defined by SEQ ID NO: 5 or SEQ ID NO: 7.
• the D1L2 enzyme that lacks the C- terminal Arg residue comprises an amino acid sequence having at least about 85% sequence identity, or at least about 90% sequence identity to the enzyme defined by SEQ ID NO: 5 or SEQ ID NO: 7, or at least about 95% sequence identity to the enzyme defined by SEQ ID NO: 5 or SEQ ID NO: 7, or at least about 97% sequence identity to the enzyme defined by SEQ ID NO: 5 or SEQ ID NO: 7.
• the D1L2 enzyme produced by the host cell will comprise a signal peptide directing secretion from the cell, which is generally removed during secretion. The method further comprises recovering the D1L2 enzyme from the culture media.
• the D1L2 enzyme has a deleted or modified PRD (as described), as well as a truncation of the C-terminal Arg.
• the D1L2 enzyme that substantially lacks the Proline Rich Domain (PRD) and lacks the C-terminal Arg residue comprises an amino acid sequence having at least about 80% sequence identity to the enzyme defined by SEQ ID NO: 7.
• the D1L2 that substantially lacks the Proline Rich Domain (PRD) and lacks the C-terminal Arg residue comprises an amino acid sequence having at least about 85% sequence identity, or at least about 90% sequence identity to the enzyme defined by SEQ ID NO: 7, or at least about 95% sequence identity to the enzyme defined by SEQ ID NO: 7, or at least about 97% sequence identity to the enzyme defined by SEQ ID NO: 7.
• sequences refer to mature enzymes lacking the signal peptide. Further, unless stated otherwise, amino acid positions are numbered with respect to the full translated DNase sequence, including signal peptide, for clarity.
• the similarity of nucleotide and amino acid sequences can be determined via sequence alignments as known in the art.
• sequence alignments can be carried out with several art-known algorithms, such as with the mathematical algorithm of Karlin and Altschul (Karlin & Altschul (1993) Proc. Natl. Acad. Sci. USA 90: 5873-5877), with hmmalign (HMMER package, http://hmmer.wustl.edu/) or with the CLUSTAL algorithm (Thompson, J. D., Higgins, D. G. & Gibson, T. J. (1994) Nucleic Acids Res. 22, 4673-80).
• Exemplary algorithms are incorporated into the BLASTN and BLASTP programs of Altschul et al (1990) J Mol. Biol. 215: 403-410. When using BLAST programs, the default parameters of the respective programs are used.
• the encoded signal peptide is essentially native to a wild- type human DNase.
• the signal peptide is from human D1 (SEQ ID NO: 13), D1L2 (SEQ ID NO: 8), DILI (SEQ ID NO: 14), or D1L3 (SEQ ID NO: 15).
• one, two, or three amino acid substitutions are made to the wild-type signal sequence to enhance production or secretion from the non-mammalian expression system.
• the signal peptide is a non-native (to the D1L2 enzyme) signal peptide suitable for secretion from host cells of the non-mammalian expression system.
• An exemplary non-native signal peptide is a-Mating Factor (SEQ ID NO: 9), which may be used for example, with yeast expression systems such as Pichia pastoris.
• the D1L2 enzyme is expressed using an albumin secretory signal peptide as exemplified by SEQ ID NO: 10.
• the non-mammalian expression system e.g., Pichia pastoris co-expresses or overexpresses one or more genes that facilitate signal peptide processing.
• the gene encodes a protease having an activity for cleavage of signal peptide from secreted proteins.
• An exemplary protease is KEX2.
• the D1L2 enzyme is fused to a carrier protein, optionally by means of an amino acid linker.
• the carrier protein can be a polypeptide, such as albumin, transferrin, an Fc domain, XTEN (see US 8,492,530 which is hereby incorporated by reference in its entirety), or elastin-like protein. See, e.g., US 9,458,218, which is hereby incorporated by reference in its entirety.
• Such fusion can provide benefits in in vivo persistence, as well as in recombinant expression.
• the carrier protein is an albumin amino acid sequence
• the albumin amino acid sequence is fused at the N-terminus of the D1L2, optionally with an interposed linker.
• An exemplary albumin amino acid sequence is provided by SEQ ID NO: 11.
• the albumin amino acid sequence or domain of the fusion protein has at least about 75%, or at least about 80%, or at least about 85%, at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% sequence identity to the reference albumin sequence defined by SEQ ID NO: 11.
• the albumin amino acid sequence or domain comprises or consists of the reference albumin sequence defined by SEQ ID NO: 11.
• the albumin amino acid sequence binds to the neonatal Fc receptor (FcRn), e.g., human FcRn.
• the albumin amino acid sequence may be a variant of wild-type HSA (e.g., as represented by SEQ ID NO: 11).
• albumin variants may have from one to twenty, or from one to ten amino acid modifications independently selected from deletions, substitutions, and insertions with respect to SEQ ID NO: 11.
• the albumin amino acid sequence is any mammalian albumin amino acid sequence.
• Various modification to the albumin sequence that enhance its ability to serve as a carrier are known, and such modifications can be employed with the present invention.
• Exemplary modifications to the albumin amino acid sequence are described in US 8,748,380, US 10,233,228, US 10,208,102, and US 10,501,524, which are each hereby incorporated by reference in their entireties. Exemplary modifications include one or more (or all) of E505Q, T527M, and K573P as described therein.
• the albumin amino acid sequence or domain is a fragment of full-length albumin, as represented by SEQ ID NO: 11.
• a fragment of an albumin can refer to an amino acid sequence comprising a fusion of multiple domains of albumin (see, e.g., WO2011/124718), such as domains I and III, and domains II and III.
• a fragment of albumin has at least about 100 amino acids or at least about 200 or at least about 300 amino acids of the full-length sequence.
• the albumin fragment maintains the ability to bind human FcRn.
• the D1L2 enzyme is fused to a carrier polypeptide (such as an albumin amino acid sequence) through a peptide linker.
• the peptide linker may be a flexible linker, a rigid linker, or in some embodiments a physiologically-cleavable linker (e.g., a protease-cleavable linker).
• the linker is 5 to 100 amino acids in length, or is 5 to 50 amino acids in length.
• the linker is from about 10 to about 35 amino acids in length, or from about 15 to about 35 amino acids.
• the linker is a flexible linker of from 20 to 40 amino acids. Flexible linkers can comprise predominately (or consist of) Gly and Ser amino acid residues.
• the D1L2 enzyme is fused to an Fc domain. See, for example, WO 2005047334A1, WO 2004074455A2, US 20070269449, which are hereby incorporated by reference in their entirety.
• the human Fc domain is selected from IgGl, IgG2, IgG3, and IgG4.
• the human Fc domain is a human IgG Fc domain.
• the Fc domain has at least two heavy chain constant region domains (CH2 and CH3) and a hinge region. Fc domain can be joined to the D1L2, optionally with an interposed linker, at the N-terminus and/or the C-terminus of the D1L2 enzyme.
• the D1L2 enzyme comprises an Fc domain sequence fused to the N-terminus of the mature D1L2 enzyme with an interposed amino acid linker.
• the peptide linker may be a flexible linker, a rigid linker, or in some embodiments a physiologically-cleavable linker.
• the D1L2 enzyme comprises an Fc domain sequence fused to the C-terminus of the D1L2 enzyme, optionally through a linker (e.g., a flexible linker).
• Flexible linkers are predominately or entirely composed of small, non-polar or polar residues such as Gly, Ser and Thr.
• An exemplary flexible linker comprises (Gly y Ser) n S z linkers, where y is from 1 to 10 (e.g., from 1 to 5), n is from 1 to about 10, and z is 0 or 1. In some embodiments, n is from 3 to about 8, or from 3 to about 6. In exemplary embodiments, y is from 2 to 4, and n is from 3 to 8. Due to their flexibility, these linkers are unstructured. More rigid linkers include polyproline or poly Pro-Ala motifs and a-helical linkers.
• An exemplary a-helical linker is A(EAAAK) n A, where n is as defined above (e.g., from 1 to 10, or 3 to 6).
• linkers can be predominately composed of amino acids selected from Gly, Ser, Thr, Ala, and Pro.
• Exemplary linker sequences contain at least 10 amino acids, and may be in the range of 10 to about 50 amino acids, or about 15 to about 40 amino acids, or about 15 to about 35 amino acids.
• An exemplary linker design is provided as SEQ ID NO: 12
• the D1L2 enzyme comprises a linker, wherein the amino acid sequence of the linker is predominately glycine and serine residues, or consists essentially of glycine and serine residues.
• the ratio of Ser and Gly in the linker is, respectively, from about 1:1 to about 1:10, from about 1:2 to about 1:6, or about 1:4.
• Exemplary linker sequences comprise or consist of S(GGS)4GSS, S(GGS)9GSS, (GGS)9GSS.
• the linker has at least 10 amino acids, or at least 15 amino acids, or at least 20 amino acids, or at least 25 amino acids, or at least 30 amino acids.
• the linker may have a length of from 15 to 40 amino acids. In various embodiments, longer linkers of at least 15 amino acids can provide improvements in yield upon expression in Pichia pastoris.
• the linker is a physiologically-cleavable linker, such as a protease-cleavable linker.
• the protease may be a coagulation pathway protease, such as activated Factor XII.
• the linker comprises the amino acid sequence of Factor XI and/or prekallikrein or a physiologically cleavable fragment thereof.
• the linker includes a peptide sequence that is targeted for cleavage by a neutrophil specific protease, such as neutrophil elastase, cathepsin G, and proteinase 3.
• production of the D1L2 enzyme is conducted with large scale (e.g., batch) fermentation of at least about 1000 L, or at least about 5000 L, or at least about 10,000 L, or at least about 50,000 L.
• the fermentation results in at least about 200 mg/L of the D1L2 enzyme.
• the fermentation results in at least about 300 mg/L of the D1L2 enzyme, at least about 400 mg/L of the D1L2 enzyme, at least about 600 mg/L of the D1L2 enzyme, or at least about 800 mg/L of the D1L2 enzyme, or at least about 1 g/L of the D1L2 enzyme, or at least about 1.2 g/L of the D1L2 enzyme.
• the fermentation results in at least about 1.5 g/L of the D1L2, or at least about 2 g/L of the D1L2 enzyme, or at least about 5 g/L, or at least about 10 g/L of the D1L2 enzyme.
• the recombinant D1L2 enzyme is not glycosylated.
• the D1L2 enzyme produced according to this disclosure is substantially non-immunogenic.
• this disclosure provides a recombinant D1L2 enzyme produced according to the method described herein.
• the D1L2 enzyme is engineered to have physical, pharmacodynamics, and/or enzymatic properties suitable for therapy, including therapy using topical compositions.
• the engineered D1L2 enzyme may have the same or higher protein-free DNA (naked DNA) degrading activity, the same or higher chromosomal DNA (chromatin) degrading activity, similar or improved protease resistance, and higher production levels in non-mammalian expression systems (such as Pichia pastoris) than D1L2 isoform 1 (defined by SEQ ID NO: 1 or SEQ ID NO: 4).
• the invention employs a D1L2 enzyme produced by transfer of a single amino acid or multiple-adjacent amino acids, termed “building block”, between two members of the DNase 1 -protein family, to thereby generate enzymatically active variants of D1L2.
• a “building block” is defined by amino acids that are variable between two or more members of the DNase 1 -protein family. These variable amino acids are flanked by amino acids that are conserved between two or more members of the DNase 1 -protein family (“anchors”).
• anchors The variable single amino acid or multiple contiguous amino acids (“building blocks”) are exchanged between members of the DNase 1 -protein family by implanting them between conserved single amino acid or multiple contiguous amino acids (“anchors”). See US Patent 10,696,956, which is hereby incorporated by reference in its entirety.
• amino acids may be transferred, up to 1/3 of the amino acids may be further substituted.
• three or six amino acids are transferred as a building block, one or up to two resides may be further substituted, respectively.
• four or more amino acids are transferred as a building block substitution, and up to 25% of the transferred amino acids are further substituted, e.g., with conservative or non-conservative amino acid modifications.
• four, eight, or twelve amino acids are transferred, one, two, or three amino acids (respectively) may be further substituted in the building block substitution.
• the building block substitutions to D1L2 are selected from (e.g., 1, 2, 3, 4, or 5 selected from) non-human D1L2 proteins and which result in variants of human D1L2 that feature one or more of the following mutations corresponding to SEQ ID NO: 1: L22K, I24V, I29V, S35N, S35H, S35R, S35T, V37A, S38L, A41D, A41V, A41G, G43I, S44G, S44i, I45V, K48Q, L55I, L55V, A56T, A56M, P64A, S70D, S70T, A71T, A71L, A71S, A71V, M73L, E74Q, N77H, S78R, E81K, E81R, E83N, S85G, S85N, Q90E, Q90K, Q96H, F103Y, VI 041, K107D, A109V, A109T, A109K
• the engineered variants of D1L2 enzyme may comprise one or more amino acid substitutions, additions (insertions), deletions, or truncations in the amino acid sequence of human D1L2 (SEQ ID NO: 7).
• Amino acid substitutions may include conservative and/or non-conservative substitutions.
• conservative substitutions may be made, for instance, on the basis of similarity in polarity, charge, size, solubility, hydrophobicity, hydrophilicity, and/or the amphipathic nature of the amino acid residues involved.
• the 20 naturally occurring amino acids can be grouped into the following six standard amino acid groups: (1) hydrophobic: Met, Ala, Val, Leu, He; (2) neutral hydrophilic: Cys, Ser, Thr; Asn, Gin; (3) acidic: Asp, Glu; (4) basic: His, Lys, Arg; (5) residues that influence chain orientation: Gly, Pro; and (6) aromatic: Trp, Tyr, Phe.
• Constant substitutions are defined as exchanges of an amino acid by another amino acid listed within the same group of the six standard amino acid groups shown above. For example, the exchange of Asp by Glu retains one negative charge in the so modified polypeptide.
• glycine and proline may be substituted for one another based on their ability to disrupt a-helices.
• “non-conservative substitutions” are defined as exchanges of an amino acid by another amino acid listed in a different group of the six standard amino acid groups (1) to (6) shown above.
• DNA fragmentation of D1L2 and variants can be measured using methods known to those skilled in the art such as gel electrophoresis and DNase activity assays. Methods for quantifying DNA fragmentation activity are described in, for example, US 10,696,956, which is hereby incorporated by reference in its entirety.
• the D1L2 enzyme is encoded by a polynucleotide, which can be codon optimized for expression in the non-mammalian expression system (including but not limited to Pichia pastoris).
• the polynucleotide comprises a plasmid vector.
• the plasmid vector comprises a nucleic acid encoding the D1L2 enzyme or variant described herein, operably linked to an expression control region that is functional in the host cell.
• the expression control region is capable of driving expression of the operably linked encoding nucleic acid such that the enzyme is produced in a cell transformed with the expression vector.
• Expression control regions are regulatory polynucleotides (sometimes referred to herein as elements), such as promoters and enhancers, that influence expression of an operably linked nucleic acid.
• the expression control region confers regulatable expression to an operably linked nucleic acid.
• a signal (sometimes referred to as a stimulus) can increase or decrease expression of a nucleic acid operably linked to such an expression control region.
• Such expression control regions that increase expression in response to a signal are often referred to as inducible.
• Such expression control regions that decrease expression in response to a signal are often referred to as repressible.
• the amount of increase or decrease conferred by such elements is proportional to the amount of signal present; the greater the amount of signal, the greater the increase or decrease in expression.
• the disclosure provides a non-mammalian expression cell (i.e., a “host cell”), as described above, which comprises the expression vector encoding the D1L2 enzyme described herein.
• the cell is a yeast cell, such as Pichia pastoris.
• the D1L2 enzyme contains one or more polyethylene glycol (PEG) moieties or other conjugates such as fatty acid or acyl conjugates.
• PEG polyethylene glycol
• one or more PEGylated amino acids are selected from lysine, cysteine, histidine, arginine, aspartic acid, glutamic acid, serine, threonine and tyrosine.
• one or more amino acids suitable for PEGylation are introduced by substitution of one or more amino acids in D1L2.
• one or more PEGylated amino acids are lysine or arginine, and PEGylation is conducted via amine conjugation.
• one or more PEGylated amino acids are glutamine (Gin or Q) and PEGylation is conducted via transglutaminase (TGase) mediated enzymatic conjugation.
• one or more PEGylated amino acids are cysteine (Cys or C) and PEGylation is conducted via thiol conjugation.
• NHS-PEG reagent can be used to modify primary amines in D1L2.
• one or more PEGylated amino acids are conjugated with PEG moieties that are independently selected from a linear or branched PEG having molecular weights that are independently selected and in the range of about 2 kDa to about 60 kE ) a.
• the PEG moieties have molecular weights that are independently selected from the range of about 5 kE ) a to about 60 kE ) a, or about 5 kE ) a to about 40 kE ) a, or about 5 kE ) a to about 30 kE ) a, or about 10 kE ) a to about 60 kE ) a, or about 10 kE ) a to about 40 kE ) a, or about 10 kE ) a to about 30 kE ) a.
• the recombinant expression system has a deletion or inactivation of one or more proteases that cleave at paired basic amino acids.
• exemplary enzymes include Aspartic proteinase 3 (Yspl) and Kexin (Kex2) expressed by Pichia pastoris or other yeast systems. In some embodiments, these enzymes are not genetically deleted or inactivated, but their activity is inhibited with a protease inhibitor during recombinant protein production.
• the growth medium for the non-mammalian expression system is supplemented with polyanions such as dextran sulfate, heparins, ferric citrate, and EDTA.
• the growth medium is supplemented with dextran sulfate that has an average molecular weight of between 5 kE)a and 100 kE)a.
• the dextran sulfate has an average molecular weight that is about 10 kE ) a or less, or about 20 kE ) a or less, or about 30 kE ) a or less, or about 40 kE ) a or less, or about 50 kE ) a or less, or about 75 kE ) a or less, or about 100 kE ) a or less.
• the polyanion is added to the culture in an amount sufficient to complex with the recombinant protein produced.
• the recombinant D1L2 enzyme or variants thereof are purified from the culture medium through a method that includes the dissociation of the enzyme from polyanions such as dextran sulfate, heparins, EDTA.
• the purification method includes strong anion exchange resins such as triethylaminoethyl.
• compositions for topical or local administration comprise recombinant D1L2 enzyme described herein, or as produced according to this disclosure, and a pharmaceutically acceptable carrier.
• the pharmaceutical composition is formulated for topical administration, such as a cream, lotion, gel, solution, foam, spray, ointment, mouthwash, shampoo or soap.
• the pharmaceutical composition is for local or topical treatment of a tissue having an acidic environment and/or biolfilms.
• the acidic environment may have a pH of about 6.0 or less, about 5.5 or less, or about 5.0 or less, or about 4.5 or less, or about 4.0 or less.
• the composition is a skin care composition for maintaining healthy skin and attractive appearance of skin. In these embodiments, the composition is useful in a method of treating or preventing infection and/or inflammation of the skin.
• the composition is applied to skin comprising paraketotic lesions.
• Parakeratosis is a mode of keratinization characterized by the retention of nuclei in the stratum comeum. In the skin, this process leads to the abnormal replacement of annular squames with nucleated cells.
• Parakeratosis is associated with the thinning or loss of the granular layer and is usually seen in diseases of increased cell turnover, whether inflammatory or neoplastic. Parakeratosis is seen in the plaques of psoriasis and in dandruff.
• the subject may have a condition that impacts the appearance or health of skin, hair, or nails.
• the subject has a condition such as psoriasis, dermatitis, epidermolysis bullosa, or an allergic reaction (e.g., comprising hives or rash).
• the subject has dry skin, such as xeroderma.
• the subject has acne vulgaris.
• the subject’s skin may be characterized by overgrowth of Staphylococcus aureus , which can be associated with atopic dermatitis.
• the subject has psoriasis, and the composition is applied to psoriatic lesions.
• the topical composition can be employed in a method for facilitating wound healing and/or reducing or preventing fibrosis, as described for example in US 2018/0271953, which is hereby incorporated by reference in its entirety.
• the subject has a chronic wound, such as a diabetic ulcer, an amputation wound, or a skin or tissue graft (including a donor site).
• the wound is a bum, such as a first- or second-degree burn.
• the subject has a sun bum, which can be treated with a topical lotion, gel, or ointment according to this disclosure.
• the composition is formulated for administration to one or more of the eyes, ears, nasal or sinus cavity, and oral cavity.
• Compositions according to these embodiments can be useful in a method for treating or preventing inflammation or infection of the eyes of a subject, for example, where the composition is formulated as an eye drop or eye wash (including an eye lid cleaner).
• the subject may have dry eye disease, or may have allergic, bacterial, or viral conjunctivitis. Bacterial conjunctivitis can be exacerbated by biofilm formation.
• the subject has inflamed ducts of the eye, as may manifest as blepharitis or related condition (e.g., chalazion).
• the composition can be useful for treating or preventing inflammation or infection of the ears of a subject, for example, where the composition formulated as an ear drop.
• An exemplary condition is an ear infection, such as otitis media.
• the composition can be useful in a method for treating or preventing of nasal or sinus inflammation or infection of a subject, for example, where the composition is formulated as a nasal spray.
• Exemplary conditions include rhinitis, rhino sinusitis, and post-operative rhinoplasty.
• the subject has a sinus infection or recurring sinus infection.
• the subject has an infection or inflammation of the oral cavity, including gingivitis and dental abscess.
• the composition is useful in a method for the treatment of a nucleic acid-related eye disease, as described in US 9,867,871, which is hereby incorporated by reference in its entirety.
• diseases include dry eye disease, lamellar keratitis, contact lens-associated keratitis, endophthalmitis, infectious crystalline keratopathy, ocular cicatricial pemphigoid (OCP), keratoconjunctivitis sicca (KCS), Sjogren syndrome (SS), Sjogren syndrome associated keratoconjunctivitis sicca, non-Sjogren syndrome associated keratoconjunctivitis sicca, keratitis sicca, sicca syndrome, xerophthalmia, tear film disorder, decreased tear production, aqueous tear deficiency (ATD), and meibomian gland dysfunction (MGD).
• OCP ocular cicatricial pemphigoid
• KCS keratoconjunctivitis sicca
• the composition is formulated for pulmonary delivery, such as a powder or solution aerosol. In some embodiments, the composition is formulated for delivery by nebulizer. In various embodiments, the composition is useful in a method for treating or preventing inflammation or infection of the lungs of a patient.
• the subject has cystic fibrosis, pneumonia (including ventilator-associated pneumonia, or VAP), bronchitis, asthma, lower respiratory tract infection, acute respiratory distress syndrome (ARDS), acute lung injury (ALI), transfusion-induced lung injury (TRALI), or chronic obstructive pulmonary disease (COPD).
• the subject has pulmonary fibrosis (e.g., idiopathic pulmonary fibrosis, or IPF).
• the subject has a chronic or recurring pulmonary infection.
• the D1L2 enzyme in accordance with this disclosure, for example, by nebulizer, it may be possible to control Pseudomonas infection in cystic fibrosis patients and relieve some overuse of antibiotics.
• the D1L2 enzyme provided herein has higher activity in CF lung secretions than PULMOZYME (domase alfa).
• the patient may have an indwelling medical device, which tend to favor microbial colonization and biofilm formation.
• the D1L2 enzyme or composition comprising the D1L2 enzyme is administered to a patient on mechanical ventilation to avoid or reduce biofilm formation.
• compositions described herein are useful for treating or controlling infection and/or colonization by biofilm microorganisms, including on mammalian tissues as well as on the surface of indwelling medical devices.
• Pathogens and opportunists that form biofilms include Pseudomonas aeruginosa , Staphylococcus aureus , Staphylococcus epidermidis , Escherichia coli , Klebsiella pneumoniae , Proteus mirabilis , Enterococcus faecalis , Haemophilus influenzae , group A beta-hemolytic streptococci, enteric bacteria, mycobacteria (including non-tuberculous mycobacterium), and Streptococcus pneumoniae.
• Biofilm formation by these bacteria causes recalcitrance to antibiotics.
• pathogens cause the following infections (without limitation): native valve endocarditis (NVE), otitis media (OM), chronic bacterial prostatitis, cystic fibrosis (CF), bloodstream infections, urinary tract infections (optionally associated with biofilm on urinary catheters), prosthetic valve endocarditis (PVE), eye infections (optionally associated with biofilm on contact lenses), and pelvic inflammatory disease (optionally associated with biofilm on intrauterine devices (IUDs)).
• NVE native valve endocarditis
• OM otitis media
• CF cystic fibrosis
• PVE prosthetic valve endocarditis
• eye infections optionally associated with biofilm on contact lenses
• pelvic inflammatory disease optionally associated with biofilm on intrauterine devices (IUDs)).
• treatment refers to therapeutic treatment wherein the object is to slow (lessen) an undesired physiological condition, disorder or disease, or to obtain beneficial or desired clinical results.
• beneficial or desired clinical results include, but are not limited to, alleviation of symptoms; diminishment of the extent of the condition, disorder or disease; stabilization (i.e., not worsening) of the state of the condition, disorder or disease; delay in onset or slowing of the progression of the condition, disorder or disease; amelioration of the condition, disorder or disease state; and remission (whether partial or total), whether detectable or undetectable, or enhancement or improvement of the condition, disorder or disease.
• Treatment includes eliciting a clinically significant response without excessive levels of side effects.
• treatment refers to prophylactic measures, wherein the object is to delay onset of or reduce severity of an undesired physiological condition, disorder or disease, such as, for example is a person who is predisposed to a disease.
• DNASE1L2 isoform 1 and 2 identifies a proline-rich domain, GERAPPLPSRRALTPPPLPAA (SEQ ID NO: 3), in the center of DNASE1L2 isoform 1 (FIG. 1).
• DNASE1L2 isoform 1 (SEQ ID NO: 1) was cloned and expressed in Pichia pastoris using the native secretory signal peptide. Analysis of culture supernatants detected only negligible amount of DNASE1L2 protein, indicating that DNASE1L2 isoform 1 is not suitable for production in Pichia pastoris (FIG. 2).
• aMF alpha-mating factor pre-pro peptide
• PRDD-DNASE1L2 (SEQ ID NO: 2) was purified using affinity chromatography. The purified protein was tested for enzymatic activity. While previous reports have measured the degradation of purified DNA by DNASE1L2, high-molecular weight chromatin derived from intact nuclei of HEK293 cells was used in this Example as a substrate. A robust chromatin degrading activity of PRDD- DNASE1L2 was observed at pH levels below 6.5, whereas basic domain deleted DNASE1L3 showed optional chromatin degradation at neutral pH (FIG. 3). These data indicate that the deletion of the PRD in DNASE 1L2 enables large scale manufacturing of an enzyme that efficiently degrades chromatin in an acidic environment.
• PRDD-DNASE1L2 and variants thereof are particularly suitable for degrading extracellular chromatin, including neutrophil extracellular traps (NETs), under acidic conditions, e.g. in acidic sputum of patients with inflammatory lung diseases, such as cystic fibrosis and asthma (Kodric M, Shah AN, Fabbri LM, et al. An investigation of airway acidification in asthma using induced sputum: A study of feasibility and correlation.
• PRDD-DNASE1L2 Recombinant expression of PRDD-DNASE1L2 as a fusion with albumin was also achieved in Pichia pastoris.
• Albumin was fused at the N-terminus of PRDD-DNASE1L2 through a flexible linker composed of Gly and Ser.
• PRDD- DNASE1L2 fusion is secreted by virtue of the human albumin secretory signal peptide (SEQ ID NO: 10). This system likewise provides for good expression of PRDD-DNASE1L2.
• Human D1L2 isoform 1 Mature Protein, Proline-Rich Domain LRIGAFNIQSFGDSKVSDPACGSIIAKILAGYDLALVQEVRDPDLSAVSALMEQINSVSE HEYSFVSSQPLGRDQYKEMYLFVYRKDAVSW DTYLYPDPEDVFSREPFW KFSAPGTGE RAPPLPSRRALTPPPLPAAAQNLVLIPLHAAPHQAVAE IDALYDVYLDVIDKWGTDDMLF LGDFNADCSYVRAQDWAAIRLRSSEVFKWLIPDSADTTVGNSDCAYDRIVACGARLRRSL KPQSATVHDFQEEFGLDQTQALAISDHFPVEVTLKFHR

Landscapes

• Health & Medical Sciences (AREA)
• Life Sciences & Earth Sciences (AREA)
• Chemical & Material Sciences (AREA)
• Organic Chemistry (AREA)
• Engineering & Computer Science (AREA)
• Bioinformatics & Cheminformatics (AREA)
• General Health & Medical Sciences (AREA)
• Genetics & Genomics (AREA)
• Medicinal Chemistry (AREA)
• Zoology (AREA)
• Animal Behavior & Ethology (AREA)
• Pharmacology & Pharmacy (AREA)
• Public Health (AREA)
• Veterinary Medicine (AREA)
• Wood Science & Technology (AREA)
• Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
• General Chemical & Material Sciences (AREA)
• Chemical Kinetics & Catalysis (AREA)
• General Engineering & Computer Science (AREA)
• Molecular Biology (AREA)
• Biochemistry (AREA)
• Biotechnology (AREA)
• Biomedical Technology (AREA)
• Microbiology (AREA)
• Dermatology (AREA)
• Mycology (AREA)
• Proteomics, Peptides & Aminoacids (AREA)
• Biophysics (AREA)
• Gastroenterology & Hepatology (AREA)
• Plant Pathology (AREA)
• Immunology (AREA)
• Ophthalmology & Optometry (AREA)
• Epidemiology (AREA)
• Pulmonology (AREA)
• Physics & Mathematics (AREA)
• Toxicology (AREA)
• Oncology (AREA)
• Communicable Diseases (AREA)
• Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
• Enzymes And Modification Thereof (AREA)

Priority Applications (5)

Applications Claiming Priority (2)

Publications (2)

Family

ID=82932330

Family Applications (1)

Country Status (6)

Cited By (1)

Family Cites Families (5)

• 2022
  • 2022-02-17 KR KR1020237031177A patent/KR20240004247A/ko active Pending
  • 2022-02-17 CN CN202280029044.XA patent/CN117177990A/zh active Pending
  • 2022-02-17 WO PCT/US2022/016771 patent/WO2022178110A2/en not_active Ceased
  • 2022-02-17 JP JP2023549596A patent/JP2024508753A/ja active Pending
  • 2022-02-17 US US18/546,864 patent/US20240228995A9/en active Pending
  • 2022-02-17 EP EP22756915.9A patent/EP4294824A4/en active Pending

Also Published As

Similar Documents

Legal Events