WO2022170280A2 - Novel anti-cd24 antibodies - Google Patents

Novel anti-cd24 antibodies Download PDF

Info

Publication number
WO2022170280A2
WO2022170280A2 PCT/US2022/015711 US2022015711W WO2022170280A2 WO 2022170280 A2 WO2022170280 A2 WO 2022170280A2 US 2022015711 W US2022015711 W US 2022015711W WO 2022170280 A2 WO2022170280 A2 WO 2022170280A2
Authority
WO
WIPO (PCT)
Prior art keywords
seq
variable region
chain variable
light chain
heavy chain
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2022/015711
Other languages
English (en)
French (fr)
Other versions
WO2022170280A3 (en
Inventor
Peng Chen
Bing HOU
Min Deng
Yun Liu
Jiamei LUO
Hui YUWEN
Bo Shan
Jay Mei
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Antengene Hangzhou Biologics Co Ltd
Antengene Biologics Ltd
Original Assignee
Antengene Hangzhou Biologics Co Ltd
Antengene Biologics Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CN202280013601.9A priority Critical patent/CN117412770A/zh
Priority to AU2022217072A priority patent/AU2022217072A1/en
Priority to JP2023547592A priority patent/JP2024508672A/ja
Priority to CA3210934A priority patent/CA3210934A1/en
Priority to MX2023009238A priority patent/MX2023009238A/es
Priority to US18/264,436 priority patent/US20240052052A1/en
Priority to IL304898A priority patent/IL304898A/en
Priority to EP22750598.9A priority patent/EP4288099A4/en
Application filed by Antengene Hangzhou Biologics Co Ltd, Antengene Biologics Ltd filed Critical Antengene Hangzhou Biologics Co Ltd
Priority to KR1020237030578A priority patent/KR20230143177A/ko
Publication of WO2022170280A2 publication Critical patent/WO2022170280A2/en
Publication of WO2022170280A3 publication Critical patent/WO2022170280A3/en
Anticipated expiration legal-status Critical
Priority to CONC2023/0011463A priority patent/CO2023011463A2/es
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2896Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/7051T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/575Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • G01N33/5758Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumours, cancers or neoplasias, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides or metabolites
    • G01N33/5759Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumours, cancers or neoplasias, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides or metabolites involving compounds localised on the membrane of tumour or cancer cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • A61K2039/507Comprising a combination of two or more separate antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/732Antibody-dependent cellular cytotoxicity [ADCC]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/734Complement-dependent cytotoxicity [CDC]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/705Assays involving receptors, cell surface antigens or cell surface determinants
    • G01N2333/70596Molecules with a "CD"-designation not provided for elsewhere in G01N2333/705

Definitions

  • the present disclosure generally relates to novel ant.i-CD24 antibodies.
  • Cluster of differentiation 24 (CD24, UniProt: P25063), also known as Heat Stable Atigen (HSA) or Small Cell Lung Carcinoma Cluster 4 Antigen, is a 32-amino acid mucin-like glycosylphosphatidylinositol (GPI)-anchored molecule, which is heavily glycosylated and anchored via a GPI link to the cell surface.
  • CD24 can interact with Sialic Acid Binding Ig Like Lectin 10 (Siglec-10) expressed on innate immune cells (e.g., macrophages) so as to diminish damaging inflammatory responses to infection, sepsis, liver damage, and chronic graft versus host disease (Pirruccello el al., J.
  • Binding of CD24 to Siglec-10 induces an inhibitory signaling cascade mediated by SHP-1 and/or SHP-2 phosphatases associated with the two immunoreceptor tyrosine-based inhibition motifs (ITIMs) in the cytoplasmic tail of Siglec-10, thereby blocking toll-like receptor (TLR)-mediated inflammation and the cytoskeletal rearrangement required for cellular engulfment by macrophages (Crocker PR et al., Nature Reviews Immunology. 7, 255-266 (2007); Abram CL et al., J. Leuko.c Biol. 102(3), 657-675 (2017) and Dietrich J el al., J. Immunol. 166(4), 2514-2521 (2001) 12-14).
  • SHP-1 and/or SHP-2 phosphatases associated with the two immunoreceptor tyrosine-based inhibition motifs (ITIMs) in the cytoplasmic tail of Siglec-10, thereby blocking toll-like receptor (TLR
  • CD24 Overexpression of CD24 has been observed in various cancer cells based on immunohistochemical studies, including without limitation, breast cancer (85%), rectal cancer (84%), ovarian cancer (83%), pancreatic cancer (72%), bladder cancer (62%), cholangiocarcinoma (51%), prostatic cancer (48%), and small cell lung cancer (45%).
  • an antibody means one antibody or more than one antibody.
  • T he present disclosure provides novel anti-CD24 antibody molecules, amino acid and nucleotide sequences thereof, and uses thereof.
  • the present disclosure provides an isolated antibody or an antigen-binding fragment thereof, comprising 1, 2, or 3 heavy chain complementarity determining region (CDR) sequences selected from the group consisting of SEQ ID NOs: 1, 3, 5, 7, 9, 11, 14, 16, 17, 18, 19, 21, 23, 25, 27, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 95, 96, 97, 104, 105, 106, 113, 114, 115, 126, 127, 128, 136, 137, 150, 151, 152, 160, 161, 162, 168, 169 170, 222, 223 and 224 and/or 1, 2, or 3 light chain CDR sequences selected from the group consisting of: SEQ ID NOs: 2, 4, 6, 8, 10, 12, 13, 15, 20, 22, 24, 26, 29, 31, 33, 35, 37, 39, 41, 43, 45, 47, 49, 98, 99, 100, 107, 108, 116, 117, 129, 130, 131, 138, 139,
  • the antibody or antigen-binding fragment thereof provided herein comprises a heavy chain variable region selected from the group consisting of: a) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 1, SEQ ID NO: 3, and SEQ ID NO: 5; b) a heavy chain variable region comprising 1 , 2, or 3 CDR sequences selected from SEQ ID NO: 7, SEQ ID NO: 9, and SEQ ID NO: 11; c) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 7, SEQ ID NO: 14, and SEQ ID NO: 1 1 ; d) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 16, SEQ ID NO: 17, and SEQ ID NO: 18; e) a heavy chain variable region comprising 1 , 2, or 3 CDR sequences selected from SEQ ID NO: 19, SEQ ID NO: 21, and SEQ ID NO: 23; f) a heavy chain variable region selected from the group consisting
  • the antibody or antigen-binding fragment thereof provided herein comprises a light chain variable region selected from the group consisting of: a) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 2, SEQ ID NO: 4, and SEQ ID NO: 6; b) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 8, SEQ ID NO: 10, and SEQ ID NO: 12; c) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 13, SEQ ID NO: 10 and SEQ ID NO: 15; d) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 20, SEQ ID NO: 22, and SEQ ID NO: 24; e) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 26, SEQ ID NO: 22, and SEQ ID NO:24; f) a light chain variable region comprising 1, 2,
  • the antibody or antigen-binding fragment thereof provided herein comprises: a) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 1, SEQ ID NO: 3, and SEQ ID NO: 5; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 2, SEQ ID NO: 4, and SEQ ID NO: 6; b) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 7, SEQ ID NO: 9, and SEQ ID NO: 11; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 8, SEQ ID NO: 10, and SEQ ID NO: 12; c) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 7, SEQ ID NO: 14, and SEQ ID NO: 11; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 13, SEQ ID NO:
  • SEQ ID NO: 22, and SEQ ID NO:24 g) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO:25, SEQ ID NO: 30, and SEQ ID NO: 28; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 29, SEQ ID NO: 22, and SEQ ID NO: 31; h) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 32, SEQ ID NO: 34, and SEQ ID NO: 36; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID SEQ ID NO: 33, SEQ ID NO: 35, and SEQ ID NO: 37, i) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 38, SEQ ID NO: 40, and SEQ ID NO: 42; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 39,
  • the antibody or antigen-binding fragment thereof provided herein comprises a heavy chain variable region selected from the group consisting of: SEQ ID NO: 50, SEQ ID NO: 54, SEQ ID NO: 58, SEQ ID NO: 62, SEQ ID NO: 66, SEQ ID NO: 70, SEQ ID NO: 74, SEQ ID NO: 78, SEQ ID NO: 82, SEQ ID NO: 86, SEQ ID NO: 101, SEQ ID NO: 109, SEQ ID NO: 118, SEQ ID NO: 122, SEQ ID NO: 132, SEQ ID NO: 141, SEQ ID NO: 146, SEQ ID NO: 156, SEQ ID NO: 164, SEQ ID NO: 174, SEQ ID NO: 177, SEQ ID NO: 178, SEQ ID NO: 179, SEQ ID NO: 189, SEQ ID NO: 190, SEQ ID NO: 191, SEQ ID NO: 192, SEQ ID NO: 193,
  • the antibody or antigen-binding fragment thereof provided herein comprises a light chain variable region selected from the group consisting of: SEQ ID NO: 52, SEQ ID NO: 56, SEQ ID NO: 64, SEQ ID NO: 68, SEQ ID NO: 72, SEQ ID NO: 76, SEQ ID NO: 80, SEQ ID NO: 84, SEQ ID NO: 88, SE Q ID NO: 103, SEQ ID NO: 111, SEQ ID NO: 120, SEQ ID NO: 124, SEQ ID NO: 134, SEQ ID NO: 143, SEQ ID NO: 148, SEQ ID NO: 158, SEQ ID NO: 166, SEQ ID NO: 176, SEQ ID NO: 180, SEQ ID NO: 181, SEQ ID NO: 182, SEQ ID NO: 183, SEQ ID NO: 195, SEQ ID NO: 196, SEQ ID NO: 197, SEQ ID NO: 198, SEQ ID NO: 199, SEQ ID NO: 52, SEQ ID NO
  • the antibody or antigen-binding fragment thereof provided herein comprises: a) a heavy chain variable region comprising SEQ ID NO: 50 and a light chain variable region comprising SEQ ID NO: 52; b) a heavy chain variable region comprising SEQ ID NO: 54 and a iight chain variable region comprising SEQ ID NO: 56; c) a heavy chain variable region comprising SEQ ID NO: 58 and a light chain variable region comprising SEQ ID NO: 64; d) a heavy chain variable region comprising SEQ ID NO: 62 and a light chain variable region comprising SEQ ID NO: 64; e) a heavy chain variable region comprising SEQ ID NO: 66 and a iight chain variable region comprising SEQ ID NO: 68, f) a heavy chain variable region comprising SEQ ID NO: 70 and a light chain variable region comprising SEQ ID NO: 72; g) a heavy chain variable region comprising SEQ ID NO: 74 and a light chain variable region
  • the antibody or antigen-binding fragment thereof provided herein further comprises one or more amino acid residue substitutions or modifications yet retains specific binding affinity to human CD24 or cynomolgus monkey CD24.
  • the substitution is in one or more CDR sequences, and/or in one or more of the VH or VL sequences but not in any of the CDR sequences.
  • the antibody or antigen-binding fragment thereof provided herein further comprises an immunoglobulin constant region, optionally a constant region of human Ig, or optionally a constant region of human IgG.
  • the constant region comprises a constant region of human IgGl, IgG2, IgG3, or IgG4.
  • the antibody or antigen-binding fragment thereof provided herein is a chimeric or humanized.
  • the antibody or antigen-binding fragment thereof provided herein is a diabody, a Fab, a Fab ' , a F(ab') 2 , a Fd, an Fv fragment, a disulfide stabilized Fv fragment (dsFv), a (dsFv) 2 , a bispecific dsFv (dsFv-dsFv'), a disulfide stabilized diabody (ds diabody), a single-chain antibody molecule (scFv), an scFv dimer (bivalent diabody), a multispecific antibody, a camelized single domain antibody, a nanobody, a domain antibody, and a bivalent domain antibody.
  • the antibody or antigen-binding fragment thereof provided herein is bispecific.
  • the antibody or antigen-binding fragment thereof provided herein capable of specifically binding to a first and a second epitope of CD24, or capable of specifically binding to CD24 and a second antigen.
  • the antibody or antigen-binding fragment thereof provided herein binds the second antigen via a Fab or a scFv, optionally, binds CD24 via a Fab and binds the second antigen via a scFv.
  • the bispecific antibody molecule comprises a heavy chain in the format of VH(anti-CD24)-CHl-Hinge-CH2-CH3-spacer-second antigenbinding scFv, associated with a light chain in the format of VL(anti-CD24)-CL.
  • the second antigen is an immune related target, optionally selected from the group consisting of PD-L1, PD-L2, PD-1, CLTA-4, TIM-3, LAG3, CD160, 2B4, TGF ⁇ , VISTA, BTLA, TIGIT, LAIR1, 0X40, CD2, CD27, AM - 1, NKG2C, SLAMF7, NKp80, CD160, B7-H3, LFA-1, ICOS, 4-1BB, GITR, CD30, CD40, BAFFR, HVEM, CD7, LIGHT, IL-2, IL-15, CD3, CD 16 , SIRPa, Siglec 10, LILRB2, Clever-1, Macro, LILRB4, Siglecl5, CSF1R, PSGL-1, VSIG-4, B2M and CD83.
  • an immune related target optionally selected from the group consisting of PD-L1, PD-L2, PD-1, CLTA-4, TIM-3, LAG3, CD160, 2B4, TGF
  • the second antigen comprises a tumor antigen.
  • the tumor antigen comprises CA-125, gangliosides G(D2), G(M2) and G(D3), CD19, CD20, CD33, ( 1)47. CD52, Ep-CAM, CEA, CLDN18.2, bombesin-like peptides, PSA, HER2/neu, epidermal growth factor receptor (EGFR), erbB2, erbB3/HER3, erbB4, CD44v6, CD44v9, Ki-67, cancer- associated mucin, VEGF, VEGFRs (e.g., VEGFR3), estrogen receptors, Lewis-Y antigen, TGFpl , IGF-1 receptor, EGFa, c-Kit receptor, transferrin receptor, IL-2R, CDH6, CEA, FOLR1, TROP2, PTK7, SLITRK6, CD 142, NEC TIN-4, ROR1, ROR2, CD142, CD123, CD22, CD79b, DLL3, SEC family or CO17-1A
  • the second antigen is an immunoinhibitory molecule selected from the group consisting of PD-L1, SIRPa, CD47 and B2M.
  • the tumor antigen is CD47.
  • the antibody or antigen-binding fragment is linked to one or more conjugates, optionally, wherein the conjugate is covalently attached either directly or via a linker.
  • the conjugate comprises a clearance-modifying agent, a chemotherapeutic agent, a toxin, a radioactive isotope, a lanthanide, a luminescent label, a fluorescent label, an enzyme-substrate label, a DNA-alkylators, a topoisomerase inhibitor, a tubulin-binders, or other anticancer drugs.
  • the antibody or antigen-binding fragment is capable of specifically binding to CD24, and optionally wherein the CD24 are derived from human or cynomolgus monkey, and optionally wherein the CD24 is a recombinant CD24 or a CD24 expressed on a cell surface.
  • the present disclosure provides an antibody or antigenbinding fragment thereof, which competes for the same epitope with the antibody or antigen-binding fragment thereof provided herein.
  • the antibody or antigen-binding fragment thereof provided herein completes for the same epitope with the antibody or antigen-binding fragment thereof comprising: a heavy chain variable region comprising HCDR1, HCDR2, and HCDR3 of SEQ ID NO: 104, SEQ ID NO: 105, and SEQ ID NO: 106 respectively, and a light chain variable region comprising LCDRl, LCDR2, and LCDR3, wherein the LCDR1 comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 107, 184, 185, 186, 187 and 188, the LCDR2 comprises an amino acid sequence of SEQ ID NO: 108, and the LCDR3 comprises an amino acid sequence of SEQ ID NO: 37.
  • the antibody or antigen-binding fragment thereof provided herein may comprise: a heavy chain variable region comprising HCDR1, HCDR2, and HCDR3 of SEQ ID NO: 95, SEQ ID NO: 96, and SEQ ID NO: 97 respectively; and a light chain variable region comprising LCDR1, LCDR2, and LCDR3 of SEQ ID NO: 98, SEQ ID NO: 99, and SEQ ID NO: 100 respectively.
  • the antibody or antigen-binding fragment thereof provided herein selectively binds to CD24 expressed in a cancer cell over a noncancer cell.
  • the present disclosure provides a pharmaceutical composition comprising the antibody or antigen-binding fragment thereof provided herein, and a pharmaceutically acceptable carrier.
  • the pharmaceutical composition provided herein further comprises a second therapeutic agent.
  • the second therapeutic agent is an antagonist against one or more molecules.
  • the second therapeutic agent is a CD47 antagonist.
  • the CD47 antagonist is a SIRPa-Fc fusion protein or variant thereof, or an anti-CD47 antibody or antigen-binding fragment thereof.
  • the present disclosure provides an isolated polynucleotide encoding the antibody or antigen-binding fragment thereof provided herein.
  • the isolated polynucleotide provided herein comprises a nucleotide sequence selecting from a group consisting of SEQ ID NO: 51, 53, 55, 57, 59, 61, 63, 65, 67, 69, 71, 73, 75, 77, 79, 81, 83, 85, 87, 89, 102, 110, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219 and 220.
  • the present disclosure provides a vector comprising the isolated polynucleotide provided herein.
  • the present disclosure provides a host cell comprising the vector provided herein.
  • the present disclosure provides a method of expressing the antibody or antigen-binding fragment thereof provided herein, comprising culturing the host cell provided herein under the condition at which the vector provided herein is expressed
  • the present disclosure provides a method of treating a disease or condition in a subject that would benefit from modulation of CD24 activity, comprising administering to the subject a therapeutically effective amount of the antibody or antigen-binding fragment thereof provided herein or the pharmaceutical composition provided herein.
  • the disease or condition is a CD24 related disease or condition.
  • the disease or condition is cancer, adaptive immune disease, autoimmune disease, inflammatory disease, or infectious disease.
  • the cancer is lung cancer, bronchial cancer, bone cancer, liver and bile duct cancer, pancreatic cancer, breast cancer, liver cancer, ovarian cancer, testicle cancer, kidney cancer, bladder cancer, head and neck cancer, spine cancer, brain cancer, cervix cancer, uterine cancer, endometrial cancer, colon cancer, colorectal cancer, rectal cancer, anal cancer, esophageal cancer, gastrointestinal cancer, skin cancer, prostate cancer, pituitary cancer, stomach cancer, vagina cancer, thyroid cancer, glioblastoma, astrocytoma, melanoma, myelodysplastic syndrome, sarcoma, teratoma, adenocarcinoma, leukemia, myeloma and lymphoma.
  • the cancer is chemoresistant cancer.
  • the disease or condition is hematological cancer chosen from B-cell lymphomas, such as Hodgkin's lymphoma, non-Hodgkin’s lymphoma (NHL), acute lymphocytic leukemia (ALL), acute myeloid leukemia (AML), chronic lymphocytic leukemia (('LL), chronic myelogenous leukemia (CML), multiple myeloma (MM), diffuse large B cell lymphoma (DLBCL), Marginal zone B- cell lymphoma (MZL), Mantle cell lymphoma (MCL), Richter's syndrome, Burkitt's lymphoma or follicular lymphoma.
  • B-cell lymphomas such as Hodgkin's lymphoma, non-Hodgkin’s lymphoma (NHL), acute lymphocytic leukemia (ALL), acute myeloid leukemia (AML), chronic lymphocytic leukemia (('LL), chronic myelogenous leuk
  • the subject is human.
  • the method provided herein comprises administering to the subject a therapeutically effective amount of a second therapeutic agent.
  • the second therapeutic agent is an antagonist against one or more immunoinhibitory molecules.
  • the second therapeutic agent is a CD47 antagonist.
  • the CD47 antagonist is a SIRP ⁇ -Fc fusion protein or variant thereof, or an anti-CD47 antibody or antigen-binding fragment thereof.
  • the administration is via oral, nasal, intravenous, subcutaneous, sublingual, or intramuscular administration.
  • the present disclosure provides a method of modulating CD24 activity in a CD24-expressing cell, comprising exposing the CD24-expressing cell to the antibody or antigen-binding fragment thereof provided herein.
  • the present disclosure provides a method of detecting presence or amount of CD24 in a sample, comprising contacting the sample with the antibody or antigen-binding fragment thereof provided herein, and determining the presence or the amount, of CD 24 in the sample.
  • the present disclosure provides a method of diagnosing a CD24 related disease or condition in a subject, comprising: a) obtaining a sample from the subject, b) contacting the sample obtained from the subject with the antibody or antigen-binding fragment thereof provided herein; c) determining presence or amount of CD24 in the sample; and d) correlating the presence or the amount of CD24 to existence or status of the CD24 related disease or condition in the subject.
  • the present disclosure provides an use of the antibody or antigen-binding fragment thereof provided herein in the manufacture of a medicament for treating a CD24 related disease or condition in a subject.
  • the medicament further comprises a second therapeutic agent.
  • the second therapeutic agent is an antagonist against one or more immunoinhibitory molecules.
  • the second therapeutic agent is a CD47 antagonist.
  • the CD47 antagonist comprises a SIRPa-Fc fusion protein or variant thereof, and an anti-CD47 antibody or antigen-binding fragment thereof.
  • the present disclosure provides an use of the antibody or antigen-binding fragment thereof provided herein in the manufacture of a diagnostic reagent for diagnosing a CD24 related disease or condition.
  • the present disclosure provides a kit comprising the antibody or antigen-binding fragment thereof provided herein, usefol in detecting CD24, optionally recombinant CD24, CD24 expressed on cell surface, or CD24-expresing cells.
  • the present disclosure provides a chimeric antigen receptor (CAR) comprising an antigen binding domain, a transmembrane domain, a costimulatory signaling region, and a TCR signaling domain, wherein the antigen binding domain specifically binds to CD24 and comprises an antigen binding fragment provided herein.
  • the antigen binding fragment is a Fab or a scFv.
  • the CAR provided herein is bispecific.
  • the CAR is capable of further specifically binding to a second antigen other than CD24, or a second epitope on CD24.
  • the second antigen is a tumor antigen.
  • the TCR signaling domain is selected from the group consisting of an intracellular signal regions sequence of CD28, CD137, CD134, MyD88, CD40, CD278, TLRs, or a combination thereof.
  • the transmembrane region comprises a transmembrane region of CDS, CD4, CD8 or CD28.
  • the present disclosure provides a nucleic acid sequence encoding the chimeric antigen receptor (CAR) provided herein.
  • the present disclosure provides a cell comprising the nucleic acid sequence provided herein.
  • the present disclosure provides a vector comprising the nucleic acid sequence provided herein.
  • the present disclosure provides a cell genetically modified to express the CAR provided herein.
  • the cell is immune cell, optionally, wherein the immune cell is T lymphocyte, NK cell, monocyte, macrophage or NKT lymphocyte.
  • the present disclosure provides a method for stimulating a T cell-mediated immune response to a CD24-expressing cell or tissue in a mammal, the method comprising administering to the mammal an effective amount of a cell genetically modified to express the CAR provided herein.
  • the present disclosure provides a method of treating a mammal having a CD24 related disease or condition, comprising administering to the mammal an effective amount of a cell provided herein, thereby treating the mammal.
  • the cell is an autologous T cell.
  • the CD24 related disease or condition is cancer.
  • the mammal is a human subject.
  • the present disclosure provides a method of treating cancer in a subject in need thereof, comprising administering an anti-CD24 antibody or antigenbinding fragment thereof that only binds to the glycosylated or sialylated CD24, preferably, only binds to the sialic acid of CD24.
  • the anti-CD24 antibody or antigen-binding fragment thereof selectively binds to CD24 expressed in a cancer cell over a non-cancer cell
  • the anti-CD24 antibody or antigen-binding fragment thereof completes for the same epitope with the antibody or antigen-binding fragment thereof comprising: a heavy chain variable region comprising HCDR.1, HCDR.2, and HCDR3 of SEQ ID NO: 104, SEQ ID NO: 105, and SEQ ID NO: 106 respectively; and a light chain variable region comprising LCDR1, LCDR2, and LCDR3, wherein the LCDR1 comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 107, 184, 185, 186, 187 and 188, the LCDR2 comprises an amino acid sequence of SEQ ID NO: 108, and the LCDR3 comprises an amino acid sequence of SEQ ID NO: 37, or comprising: a heavy chain variable region comprising HCDR.1,
  • the anti-CD24 antibody or antigen-binding fragment thereof comprises: a heavy chain variable region comprising HCDR1, HCDR2, and HCDR3 of SEQ ID NO: 104, SEQ ID NO: 105, and SEQ ID NO: 106 respectively, and a light chain variable region comprising LCDR1, LCDR2, and LCDR3, wherein the LCDRl comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 107, 184, 185, 186, 187 and 188, the LCDR2 comprises an amino acid sequence of SEQ ID NO: 108, and the LCDR3 comprises an amino acid sequence of SEQ ID NO: 37, or comprising: a heavy chain variable region comprising HCDR1, HCDR2, and HCDR3 of SEQ ID NO: 95, SEQ ID NO: 96, and SEQ ID NO: 97 respectively; and a light chain variable region comprising LCDRl, LCDR2, and LCDR3 of SEQ ID NO: 98, SEQ ID NO: 99
  • FIG. 1A shows the MFI of the chimeric anti-CD24 antibodies provided herein and bench mark antibody SN3 on 293F blank cells.
  • FIG. 1B shows the MFI of the chimeric anti-CD24 antibodies provided herein and bench mark antibody SN3 on 293F-hCD24 cells.
  • FIG. 1C shows the MFI of the chimeric anti-CD24 antibodies provided herein and bench mark antibody SN3 on MCF7 cells.
  • FIG. ID shows the MFI of the chimeric anti-CD24 antibodies provided herein and bench mark antibody SN3 on MDA-MB-468 cells.
  • FIG. IE shows the MFI of the chimeric anti-CD24 antibodies provided herein and bench mark antibody SN3 on cells.
  • FIG. IF shows the MFI of the chimeric anti-CD24 antibodies provided herein and bench mark antibody SN3 on CHOKl-hCD24 cells.
  • FIG, 1G shows the MFI of the chimeric anti-CD24 antibodies provided herein and bench mark antibody SN3 on HT-29 cells.
  • FIG. 1H shows the MFI of the chimeric anti-CD24 antibodies provided herein and bench mark antibody SN3 on cells.
  • FIG. II shows the MFI of the chimeric anti-CD24 antibodies provided herein and bench mark antibody SN3 on A549 cells.
  • FIG. shows the MFI of the chimeric anti-CD24 antibodies provided herein on
  • FIG. IK show's the MFI of the chimeric anti-CD24 antibodies provided herein and bench mark antibody SN3 on SU-DHL6 cells.
  • FIG. shows the MFI of the chimeric anti-CD24 antibodies provided herein on human B cells.
  • FIG. IM shows the MFI of the chimeric anti-CD24 antibodies provided herein and bench mark antibody SN3 on DoHH2 cells.
  • FIG. IN shows the MFI of the chimeric anti-CD24 antibodies provided herein and bench mark antibody SN3 on HT29 cells.
  • FIG. IP shows the MFI of the chimeric anti-CD24 antibodies provided herein and bench mark antibody SN3 on MCF7 cells.
  • FIG, IQ shows the MFI of the chimeric anti-CD24 antibodies provided herein and bench mark antibody SN3 on a.549 cells.
  • FIG. 1R shows the MFI of the chimeric anti-CD24 antibodies provided herein and bench mark antibody SN3 on NCI-H1975 cells.
  • FIG, 2 A shows the phagocytosis index of chimeric anti-CD24 antibodies and reference antibody SN3 on 293F-11CD24 cells.
  • FIG. 2B shows the phagocytosis index of chimeric anti-CD24 antibodies and reference antibody SN3 on HT-29 cells.
  • FIG. 3 A shows the phagocytosis index of combination treatment of anti- CD47 antibody hu5F9 with chimeric anti-CD24 antibody on coleretal tumor cells.
  • FIG. 3B shows the phagocytosis index of combination treatment of anti- CD47 antibody hu5F9 with chimeric anti-CD24 antibody on HT29 coleretal tumor cells.
  • FIG. 3C shows the phagocytosis index of combination treatment of anti- CD47 antibody hu5F9 with chimeric anti-CD24 antibody on HT29 coleretal tumor cells.
  • FIG. 4A shows the alone, alone, bl specific antibody (ch81 AlF8-IgG4+Hu5F9 derived scFv) and bench mark antibody SN3 on HT29 cells.
  • FIG. 4B shows the phagocytosis index of alone, hu5F9 alone, alone, bispecific antibody as well as the combination of anti-CD24 antibody ch81AlF8-IgG4 and anti-CD47 antibody Hu5F9 (“Combo”) on HT29 cells.
  • FIG. 5 A shows the MFI of the chimeric anti-CD24 antibody 81A1F8 and the humanized 81A1F8 antibodies on HT-29.
  • FIG. 5B shows the MFI of the chimeric anti-CD24 antibody 81A1F8 and the humanized 81A1F8 antibodies on Nalm6.
  • FIG. 5C shows the MFI of the chimeric anti-CD24 antibody 101H9G9A2 and the humanized 101H9G9A2 antibodies on HT-29.
  • FIG. 5D show's the KD of the chimeric anti-CD24 antibody 81 A1F8 and the humanized 81 AIF8 antibodies as measured using the Gatorprime system.
  • FIGs. 6A-6D show' the MFI of the chimeric anti-CD24 antibodies provided herein and/or bench mark antibody SN3 on cells digested with neuraminidase or glycosylation.
  • FIG. 7A show's the KD of the chimeric anti-CD24 antibodies provided herein and reference antibody on mFc tagged human CD24 as measured by BIAcore.
  • FIG. 7B shows the KD of the chimeric anti-CD24 antibody 81A1F8 and the humanized 81A1F8 antibodies provided herein on mFc tagged human CD24 as measured by BIAcore,
  • FIG. 8 shows the normalized OD450 of the chimeric anti-CD24 antibody 81A1F8 of different concentrations on mFc tagged human CD24 as measured by ELISA.
  • FIG. 9A shows the phagocytosis index of the chimeric anti-CD24 antibodies, reference antibody SWA11, and anti-CD47 antibody hu5F9-IgG4 on HT-29 cells.
  • FIG. 9B shows the phagocytosis index of the chimeric anti-CD24 antibodies, reference antibody SWA11, and anti-CD47 antibody hu5F9-IgG4 on Nalm6 cells.
  • FIG. 9C shows the phagocytosis index of 81A1F8-LALAPG antibodies with rare Fc dependent functions, alone or in combination with Rituximab on SU- DHL-6 cells.
  • FIG. 9D shows the phagocytosis index of the anti-CD24 antibody 81 A1F8 alone, the anti-CD47 antibody Hu5F9 alone, as well as the comboniation of the anti- CD24 antibody 81 A1F8 and the anti-CD47 antibody Hu5F9 on HT-29 cells.
  • FIG 10A show's the ADCC effect induced by the chimeric anti-CD24 antibody 81A1F8 and the humanized 81 A1F8 antibodies on HT-29 cells.
  • FIG. 10B show's the CDC effect induced by the chimeric anti-CD24 antibody 81A1F8 and the humanized 81A1F8 antibodies on 11CD24-MCF7 cells.
  • FIG. 11A shows the tumor volumes after the administration of the chimeric anti-CD24 antibody 81A1F8 alone, Oxaliplatin alone, as well as the combination of the chimeric anti-CD24 antibody 81A1F8 and Oxaliplatin in C57BL/6J syngeneic mice model.
  • FIG. 1 IB show's the body weights after the administrion of the chimeric anti-CD24 antibody 81A1F8 alone, Oxaliplatin alone, as well as the combination of the chimeric anti-CD24 antibody 81A1F8 and Oxaliplatin in C57BL/6J syngeneic mice model.
  • FIG. 11C show's summary' of the in vivo efficacy test of the chimeric anti- CD24 antibody 81A1F8 alone, Oxaliplatin alone, as well as the combination of the chimeric anti-CD24 antibody 81A1F8 and Oxaliplatin in C57BL/6J syngeneic mice model .
  • FIG. 11C shows CD8/CD4 ratio and M1/M2 macrophage ratio induced by the combination treatment of the chimeric anti-CD24 antibody and Oxaliplatin in C57BL/6J syngeneic mice model.
  • FIG . 12A shows the tumor volumes after the administration of the chimeric anti-CD24 antibody 81 AlF8-mIgG2a at different dosages in MC38-hCD24 syngeneic model .
  • FIG. 12B shows the tumor volumes after the administration of the chimeric anti-CD24 antibody at different dosages and the chimeric anti-CD24 antibody 81 AlF8-mIgG2a after rechallenged in MC38 ⁇ hCD24 syngeneic model.
  • FIG. 12C shows the tumor growth curves for each mouse after the administration of chimeric anti-CD24 antibody 81AlF8-mIgG2a at different dosages in MC38-hCD24 syngeneic model.
  • FIG. 12D shows summary for the in vivo efficacy of the chimeric anti-CD24 antibody at different dosages.
  • FIG, 13 A shows the tumor growth curves after the administration of single agent or combination strategy.
  • FIG. 13B shows the tumor growth curves for each mouse of the treatment groups.
  • FIG. 13C shows summary for the in vivo efficacy of single agent (81 A1F8- 2141-mIgG2a, Oxaliplatin or Atezolizumab) or combination strategy.
  • FIG. 14A shows the tumor growth curves after the administration of single agent or combination strategy.
  • FIG. 14B shows the body weights of the mice after the administration of single agent Atezolizumab) or combination strategy.
  • FIG. 14C shows summary for the in vivo efficacy of single agent (101H9G9A2-mIgG2a, 81 AlF8-2141-mIgG2a, Oxaliplatin or Atezolizumab) or combination strategy.
  • FIG . 15 shows the MFI of the anti-cmCD24 antibodies provided herein on cmCD24-293F cells.
  • FIG. 16A shows the phagocytosis index of the anti-cmCD24 antibodies provided herein on cynoCD24-293F cells.
  • FIG. 16B shows the ADCC effect induced by the anti-cmCD24 antibodies provided herein on cmCD24-293F cells.
  • FIG. 16C shows the CDC effect induced by the anti-cmCD24 antibodies provided herein on cynoCD24-293F cells.
  • antibody as used herein includes any immunoglobulin, monoclonal antibody, polyclonal antibody, multivalent antibody, bivalent antibody, monovalent antibody, multispecific antibody, or bispecific antibody that binds to a specific antigen.
  • a native intact antibody comprises two heavy (H) chains and two light (L) chains.
  • Mammalian heavy chains are classified as alpha, delta, epsilon, gamma, and mu, each heavy chain consists of a variable region and a first, second, and third constant region mammalian light chains are classified as while each light chain consists of a variable region and a constant region.
  • the antibody has a “Y” shape, with the stem of the Y consisting of the second and third constant regions of two heavy chains bound together via disulfide bonding.
  • Each arm of the Y includes the variable region and first constant region of a single heavy chain bound to the variable and constant regions of a single light chain.
  • the variable regions of the light and heavy chains are responsible for antigen binding.
  • the variable regions in both chains generally contain three highly variable loops called the complementarity determining regions (CDRs) (light chain CDRs including LCDR1, LCDR2, and LCDR3, heavy chain CDRs including HCDR1, HCDR2, and HCDR3).
  • CDRs complementarity determining regions
  • CDR boundaries for the antibodies and antigen-binding domains disclosed herein may be defined or identified by the conventions of Kabat, IMGT, AbM, Chothia, or Al-Lazikani (Al-Lazikani, B ., Chothia, C., Lesk, A. M., J. Mol. Biol., 273(4), 927 ( 1997); Chothia, C. et al., J Mol Biol. Dec 5;186(3):651-63 (1985); Chothia, C. and Lesk, A.M., J.Mol.Biol., 196,901 (1987); N. R. Whitelegg et al, Protein Engineering, vl3(12), 819-824 (2000); Chothia, C.
  • the constant regions of the heavy and light chains are not involved in antigen-binding, but exhibit various effector functions.
  • Antibodies are assigned to classes based on the amino acid sequence of the constant region of their heavy chain.
  • the five major classes or isotypes of antibodies are IgA, IgD, IgE, IgG, and IgM, which are characterized by the presence of alpha, delta, epsilon, gamma, and mu heavy chains, respectively.
  • IgGl gamma 1 heavy chain
  • IgG2 gamma2 heavy chain
  • IgG3 gamma3 heavy chain
  • IgG4 gamma4 heavy chain
  • IgAl alpha2 heavy chain
  • antibody molecule refers to an antigen-binding protein or polypeptide comprising at least one antibody fragment (such as CDR, and/or variable region sequence).
  • An antibody molecule includes, for example, a monoclonal antibody, an antibody fragment or domain, a fusion protein comprising an antibody fragment or domain, a polypeptide complex comprising an antibody fragment or domain, and so on.
  • antigen-binding domain e.g. CD24-binding domain
  • CD24-binding domain refers to an antibody fragment formed from a portion of an antibody comprising one or more CDRs, or any other antibody fragment that binds to an antigen but does not comprise an intact native antibody structure.
  • antigen-binding domain examples include, without limitation, a diabody, a Fab, a Fab’, a F(ab')2, an Fv fragment, a disulfide stabilized Fv fragment (dsFv), a (dsFv)2, a bispecific dsFv (dsFv-dsFv’), a disulfide stabilized diabody (ds diabody), a single-chain antibody molecule (scFv), an scFv dimer (bivalent diabody), a bispecific antibody, a multispecific antibody, a camelized single domain antibody, a nanobody, a domain antibody, and a bivalent domain antibody.
  • an antigen-binding domain is capable of binding to the same antigen to which the parent antibody binds.
  • an antigen-binding domain may comprise one or more CDRs from a particular human antibody grafted to a framework region from one or more different human antibodies.
  • Fab with regard to an antibody refers to that portion of the antibody consisting of a single light chain (both variable and constant regions) bound to the variable region and first constant region of a single heavy chain by a disulfide bond.
  • [000143] refers to a Fab fragment that includes a portion of the hinge region. [000144] refers to a dimer of Fab’.
  • a difficult with regard to an antibody refers to the amino- terminal half of the heavy chain fragment that can be combined with the light chain to form Fab.
  • Fd fragment may consists of the VH and CHI domains
  • Fv with regard to an antibody refers to the smallest fragment of the antibody to bear the complete antigen-binding site.
  • An Fv fragment consists of the variable region of a single light chain bound to the variable region of a single heavy chain.
  • a number of Fv designs have been provided, including dsFvs, in which the association between the two domains is enhanced by an introduced disulphide bond; and scFvs can be formed using a peptide linker to bind the two domains together as a single polypeptide.
  • Fvs constructs containing a variable domain of a heavy or light immunoglobulin chain associated to the variable and constant domain of the corresponding immunoglobulin heavy or light chain have also been produced.
  • Fvs have also been multimerised to form diabodies and triabodies (Maynard , Annu Rev Biomed Eng 2 339-376 (2000)).
  • Single-chain Fv antibody or “scFv” refers to an engineered antibody consisting of a light chain variable region and a heavy chain variable region connected to one another directly or via a peptide linker sequence (Huston JS et al. Proc Natl Acad Sci USA, 85:5879(1988)).
  • a “dsFv” refers to a disulfide-stabilized Fv fragment that the linkage between the variable region of a single light chain and the variable region of a single heavy chain is a disulfide bond.
  • a or “(dsFv-dsFv')” comprises three peptide chains: two VH moieties linked by a peptide linker (e.g, a long flexible linker) and bound to two VL moieties, respectively, via disulfide bridges.
  • dsFv-dsFv' is bispecific in which each disulfide paired heavy and light chain has a different antigen specificity.
  • Fc with regard to an antibody refers to that portion of the antibody consisting of the second and third constant regions of a first heavy chain bound to the second and third constant regions of a second heavy chain via disulfide bonding.
  • the Fc portion of the antibody is responsible for various effector functions such as antibody-dependent cell-mediated cytotoxicity (ADC 1C), and complement dependent cytotoxicity (CDC), but does not function in antigen binding.
  • ADC 1C antibody-dependent cell-mediated cytotoxicity
  • CDC complement dependent cytotoxicity
  • “Camelized single domain antibody,” “heavy chain antibody,” or “HCAb” refers to an antibody that contains two domains and no light chains (Riechmann L. and Muyldermans S., J Immunol Methods. Dec 10;23 l(l-2):25-38 (1999); Muyldermans S., J Biotechnol. Jun;74(4):277-302 (2001); WO94/04678; WO94/25591; U.S. Patent No. 6,005,079). Heavy chain antibodies were originally derived from Camelidae (camels, dromedaries, and llamas). Although devoid of light chains, camelized antibodies have an authentic antigen-binding repertoire (Hamers- Casterman C.
  • variable domain of a heavy chain antibody represents the smallest known antigen-binding unit generated by adaptive immune responses (Koch-Nolte F. et al., FASEB J. Nov;21(13):3490-8. Epub 2007 Jun 15 (2007) ).
  • a “nanobody” refers to an antibody fragment that consists of a VHH domain from a heavy chain antibody and two constant domains, CH2 and CH3,
  • “Diabodies” or “dAbs” include small antibody fragments with two antigenbinding sites, wherein the fragments comprise a domain connected to a V., domain in the same polypeptide chain (see, e.g., Holliger P. et al., Proc Natl Acad Sci U S A. Jul 15;90( 14): 6444-8 (1993); EP404097; WO93/11161).
  • the domains are forced to pair with the complementary domains of another chain, thereby creating two antigen-binding sites.
  • the antigen-binding sites may target the same or different antigens (or epitopes).
  • a “bispecific ds diabody” is a diabody target two different antigens (or epitopes).
  • an “scFv dimer” is a bivalent diabody or bivalent ScFv (BsFv) comprising (linked by a peptide linker) dimerized with another moiety such that of one moiety coordinate with the of the other moiety and form two binding sites which can target the same antigens (or epitopes) or different antigens (or epitopes).
  • an “scFv dimer” is a bispecific diabody comprising (linked by a peptide linker) associated with (also linked by a peptide linker) such that coordinate and coordinate and each coordinated pair has a different antigen specificity.
  • a “domain antibody” refers to an antibody fragment containing only the variable region of a heavy chain or the variable region of a light chain.
  • two or more domains are covalently joined with a peptide linker to create a bivalent or multivalent domain antibody.
  • the two domains of a bivalent domain antibody may target the same or different antigens.
  • chimeric means an antibody or antigen -binding domain, having a portion of heavy and/or light chain derived from one species, and the rest of the heavy and/or light chain derived from a different species.
  • a chimeric antibody may comprise a constant region derived from human and a variable region from a non-human animal, such as from mouse.
  • the non-human animal is a mammal, for example, a mouse, a rat, a rabbit, a goat, a sheep, a guinea pig, or a hamster.
  • humanized means that the antibody or antigenbinding domain comprises CDRs derived from non-human animals, FR regions derived from human, and when applicable, the constant regions derived from human.
  • operably link refers to a juxtaposition, with or without a spacer or a linker or an intervening sequence, of two or more biological sequences of interest in such a way that they are in a relationship permitting them to function in an intended manner.
  • polypeptide sequences When used with respect to polypeptides, it is intended to mean that the polypeptide sequences are linked in such a way that permits the linked product to have the intended biological function.
  • an antibody variable region may be operably linked to a constant region so as to provide for a stable product with antigen-binding activity.
  • an antigen-binding domain can be operably linked to another antigen-binding domain with an intervening sequence there between, and such intervening sequence can be a spacer or can comprise a much longer sequence such as a constant region of an antibody.
  • the term may also be used with respect to polynucleotides.
  • a polynucleotide encoding a polypeptide is operably linked to a regulatory sequence (e.g., promoter, enhancer, silencer sequence, etc.), it is intended to mean that the polynucleotide sequences are linked in such a way that permits regulated expression of the polypeptide from the polynucleotide.
  • fusion refers to combination of two or more amino acid sequences, for example by chemical bonding or recombinant means, into a single amino acid sequence which does not exist naturally.
  • a fusion amino acid sequence may be produced by genetic recombination of two encoding polynucleotide sequences, and can be expressed by a method of introducing a construct containing the recombinant polynucleotides into a host cell.
  • an “antigen” as used herein refers to a compound, composition, peptide, polypeptide, protein or substance that can stimulate the production of antibodies or a T cell response in cell culture or in an animal, including compositions (such as one that includes a cancer- specific protein) that are added to a cell culture (such as a hybridoma), or injected or absorbed into an animal.
  • An antigen reacts with the products of specific humoral or cellular immunity (such as an antibody), including those induced by heterologous antigens.
  • CD24 as used herein is intended to encompass any form of CD24, for example, 1) native unprocessed CD24 molecule, “foil-length” CD24 chain or naturally occurring variants of CD24, including, for example, splice variants or allelic variants; 2) any form of CD24 that results from processing in the cell; or 3) foil length, a fragment (e.g., a truncated form, an extracellular/transmembrane domain) or a modified form (e.g. a mutated form, a glycosylated/PEGylated, a His- tag/immunofluorescence fused form) of CD24 subunit generated through recombinant method.
  • a fragment e.g., a truncated form, an extracellular/transmembrane domain
  • a modified form e.g. a mutated form, a glycosylated/PEGylated, a His- tag/immunofluorescence fused
  • anti-CD24 antibody refers to an antibody or antigen-binding domain that is capable of specifically binding to CD24 (e.g. human, mouse or cynomolgus monkey CD24).
  • telomere binding refers to a non-random binding reaction between two molecules, such as for example between an antibody and an antigen.
  • Binding of the antibodies to recombinant CD24 or CD24 expressed on surface of cells can also be represented by “half maximal effective concentration” (EC50) value, which refers to the concentration of an antibody where 50% of its maximal effect (e.g., binding or inhibition etc.) is observed.
  • the EC50 value can be measured by methods known in the art, for example, sandwich assay such as ELISA, Western Blot, flow cytometry assay, and other binding assay.
  • the antibodies and the fragments thereof provided herein specifically bind to recombinant human CD24 at an EC50 (i.e.
  • the ability to “block binding” or “compete for the same epitope” as used herein refers to the ability of an antibody or antigen-binding domain to inhibit the binding interaction between two molecules (e.g. human CD24 and Siglec-10) to any detectable degree.
  • an antibody or antigen-binding domain that blocks binding between two molecules inhibits the binding interaction between the two molecules by at least 85%, or at least 90%. In certain embodiments, this inhibition may be greater than 85%, or greater than 90%.
  • epitope refers to the specific group of atoms or amino acids on an antigen to which an antibody binds. Epitopes can be formed both from contiguous amino acids (also called linear or sequential epitope) or noncontiguous amino acids juxtaposed by tertiary folding of a protein (also called configurational or conformational epitope).
  • Epitopes formed from contiguous amino acids are typically arranged linearly along the primary amino acid residues on the protein and the small segments of the contiguous amino acids can be digested from an antigen binding with major histocompatibility complex (MHC) molecules or retained on exposure to denaturing solvents whereas epitopes formed by tertiary folding are typically lost on treatment with denaturing solvents.
  • An epitope typically includes at least 3, and more usually, at least 5, about 7, or about 8-10 amino acids in a unique spatial conformation. Two antibodies may bind the same or a closely related epitope within an antigen if they exhibit competitive binding for the antigen.
  • an antibody or antigen-binding domain blocks binding of a reference antibody to the antigen by at least 85%, or at least 90%, or at least 95%, then the antibody or antigen- binding domain may be considered to bind the same/closely related epitope as the reference antibody.
  • a “conservative substitution” with reference to amino acid sequence refers to replacing an amino acid residue with a different amino acid residue having a side chain with similar physiochemical properties.
  • conservative substitutions can be made among amino acid residues with hydrophobic side chains (e.g. Met, Ala, Vai, Leu, and He), among residues with neutral hydrophilic side chains (e.g. Cys, Ser, Thr, Asn and Gin), among residues with acidic side chains (e.g. Asp, Glu), among amino acids with basic side chains (e.g. His, Lys, and Arg), or among residues with aromatic side chains (e.g. Trp, Tyr, and Phe).
  • hydrophobic side chains e.g. Met, Ala, Vai, Leu, and He
  • residues with neutral hydrophilic side chains e.g. Cys, Ser, Thr, Asn and Gin
  • residues with acidic side chains e.g. Asp, Glu
  • amino acids with basic side chains e.g. His
  • homolog and “homologous” as used herein are interchangeable and refer to nucleic acid sequences (or its complementary strand) or amino acid sequences that have sequence identity of at least 80% (e.g., at least 85%, 88%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%) to another sequences when optimally aligned.
  • Percent (%) sequence identity with respect to amino acid sequence (or nucleic acid sequence) is defined as the percentage of amino acid (or nucleic acid) residues in a candidate sequence that are identical to the amino acid (or nucleic acid) residues in a reference sequence, after aligning the sequences and, if necessary, introducing gaps, to achieve the maximum number of identical amino acids (or nucleic acids). Conservative substitution of the amino acid residues may or may not be considered as identical residues. Alignment for purposes of determining percent amino acid (or nucleic acid) sequence identity can be achieved, for example, using publicly available tools such as BLASTN, BLASTp (available on the website of U.S. National Center for Biotechnology Information (NCBI), see also, Altschul S.F.
  • effector functions refer to biological activities attributable to the binding of Fc region of an antibody to its effectors such as Cl complex, Fc receptor and effector cell (e.g., macrophage).
  • exemplary effector functions include: complement dependent cytotoxicity (CDC) induced by interaction of antibodies and Clq on the Cl complex; antibody-dependent cell-mediated cytotoxicity (ADCC) induced by binding of Fc region of an antibody to Fc receptor on an effector cell; and antibody-dependent cellular phagocytosis (ADCP) induced by binding of Fc region of an antibody to phagocytosis.
  • CDC complement dependent cytotoxicity
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • ADCP antibody-dependent cellular phagocytosis
  • Treating” or “treatment” of a condition as used herein includes preventing or alleviating a condition, slowing the onset or rate of development of a condition, reducing the risk of developing a condition, preventing or delaying the development of symptoms associated with a condition, reducing or ending symptoms associated with a condition, generating a complete or partial regression of a condition, curing a condition, or some combination thereof.
  • subject or “individual” or “animal” or “patient” as used herein refers to human or non-human animal, including a mammal or a primate, in need of diagnosis, prognosis, amelioration, prevention and/or treatment of a disease or disorder.
  • Mammalian subjects include humans, domestic animals, farm animals, and zoo, sports, or pet animals such as dogs, cats, guinea pigs, rabbits, rats, mice, horses, swine, cows, bears, and so on.
  • vector refers to a vehicle into which a polynucleotide encoding a protein may be operably inserted so as to bring about the expression of that protein.
  • a vector may be used to transform, transduce, or transfect a host cell so as to bring about expression of the genetic element it carries within the host cell.
  • vectors include plasmids, phagemids, cosmids, and artificial chromosomes such as yeast, artificial chromosome (YAC), bacterial artificial chromosome (BAG), or Pl -derived artificial chromosome (PAG), bacteriophages such as lambda phage or M13 phage, and animal viruses.
  • a vector may contain a variety of elements for controlling expression, including promoter sequences, transcription initiation sequences, enhancer sequences, selectable elements, and reporter genes. In addition, the vector may contain an origin of replication.
  • a vector may also include materials to aid in its entry? into the cell, including but not limited to a viral particle, a liposome, or a protein coating.
  • a vector can be an expression vector or a cloning vector.
  • host cell refers to a cell into which an exogenous polynucleotide and/or a vector has been introduced.
  • CD24-related disease or condition refers to any disease or condition caused by, exacerbated by, or otherwise linked to increased or decreased expression or activities of CD24.
  • the CD24 related condition is immune-related disorder, such as, for example, cancer, autoimmune disease, inflammatory disease or infectious disease.
  • Cancer refers to any medical condition characterized by malignant cell growth or neoplasm, abnormal proliferation, infiltration or metastasis, and includes both solid tumors and non-solid cancers (hematologic malignancies) such as leukemia.
  • solid tumor refers to a solid mass of neoplastic and/or malignant cells.
  • cancer or tumors include hematological malignancies, oral carcinomas (for example of the lip, tongue or pharynx), digestive organs (for example esophagus, stomach, small intestine, colon, large intestine, or rectum), peritoneum, liver and biliary passages, pancreas, respiratory system such as larynx or lung (small cell and non-small cell), bone, connective tissue, skin (e.g., melanoma), breast, reproductive organs (fallopian tube, uterus, cervix, testicles, ovary, or prostate), urinary tract (e.g., bladder or kidney), brain and endocrine glands such as the thyroid.
  • oral carcinomas for example of the lip, tongue or pharynx
  • digestive organs for example esophagus, stomach, small intestine, colon, large intestine, or rectum
  • peritoneum liver and biliary passages
  • pancreas respiratory system
  • respiratory system such
  • the cancer is selected from ovarian cancer, breast cancer, head and neck cancer, renal cancer, bladder cancer, hepatocellular cancer, and colorectal cancer. In certain embodiments, the cancer is selected from a lymphoma, Hodgkin's lymphoma, non-Hodgkin's lymphoma and B-cell lymphoma.
  • chemoresistant cancer refers to a type of cancer that are not responsive to the effects of chemotherapy.
  • a cancer that has been responding to a chemotherapy or a combination of different chemotherapies suddenly begins to grow can be referred to as a chemoresistant cancer.
  • pharmaceutically acceptable indicates that the designated carrier, vehicle, diluent, excipient(s), and/or salt is generally chemically and/or physically compatible with the other ingredients comprising the formulation, and physiologically compatible with the recipient thereof.
  • the present disclosure provides anti-CD24 antibodies and antigen-binding fragments thereof comprising one or more (e.g. 1, 2, 3, 4, 5, or 6) CDR sequences of an anti-CD24 antibody 33E7E12, 71A4F12, 56A7E3, 58F10-1F6, 73H5-1G2, 110D4G4, 81A1F8, 100F2E3, 111F3A2, 81A7A10, 101H9G9A2, 173B1CI, 107D10E11, 109G10A6, 94G12D11, 92F5B8, I 85B11E3, or 188H6D3.
  • one or more e.g. 1, 2, 3, 4, 5, or 6
  • CDR sequences of an anti-CD24 antibody 33E7E12, 71A4F12, 56A7E3, 58F10-1F6, 73H5-1G2, 110D4G4, 81A1F8, 100F2E3, 111F3A2, 81A7A10, 101H9
  • the anti-CD24 antibodies and antigen-binding fragments thereof provided herein is capable of specifically binding to CD24.
  • the CD24 are derived from human or cynomolgus monkey.
  • the CD24 is a recombinant CD24 or a CD24 expressed on a cell surface.
  • 33E7E12 refers to a mouse monoclonal antibody having a heavy chain variable region of SEQ ID NO: 50, and a light chain variable region of SEQ ID NO: 52.
  • 71A4F12 refers to a mouse monoclonal antibody having a heavy chain variable region of SEQ ID NO: 54, and a light chain variable region of SEQ ID NO: 56.
  • 56A7E3 refers to a mouse monoclonal antibody having a heavy chain variable region of SEQ ID NO: 58, and a light chain variable region of SEQ ID NO: 64.
  • 58F10-1F6 refers to a mouse monoclonal antibody having a heavy chain variable region of SEQ ID NO: 62, and a light chain variable region of SEQ ID NO: 64.
  • 73H5-1G2 refers to a mouse monoclonal antibody having a heavy chain variable region of SEQ ID NO: 66, and a light chain variable region of SEQ ID NO: 68.
  • 1 10D4G4 refers to a mouse monoclonal antibody having a heavy chain variable region of SEQ ID NO: 70, and a light chain variable region of SEQ ID NO: 72.
  • “81A1F8” as used herein refers to a mouse monoclonal antibody having a heavy chain variable region of SEQ ID NO: 74, and a light chain variable region of SEQ ID NO: 76.
  • 100F2E3 refers to a mouse monoclonal antibody having a heavy chain variable region of SEQ ID NO: 78, and a light chain variable region of SEQ ID NO: 80.
  • [000190] as used herein refers to a mouse monoclonal antibody having a heavy chain variable region of SEQ ID NO: 82, and a light chain variable region of SEQ ID NO: 84.
  • “81A7A10” as used herein refers to a mouse monoclonal antibody having a heavy chain variable region of SEQ ID NO: 86, and a light chain variable region of SEQ ID NO: 88.
  • 107D10D11 refers to a mouse monoclonal antibody having a heavy chain variable region of SEQ ID NO: 101 , and a light chain variable region of SEQ ID NO: 103.
  • 101H9G9A2 refers to a mouse monoclonal antibody having a heavy chain variable region of SEQ ID NO: 109, and a light chain variable region of SEQ ID NO: 111.
  • 173B1C1 refers to a mouse monoclonal antibody having a heavy chain variable region of SEQ ID NO: 118, and a light chain variable region of SEQ ID NO: 120 or SEQ ID NO: 221 .
  • 107D10EH refers to a mouse monoclonal antibody having a heavy chain variable region of SEQ ID NO: 122, and a light chain variable region of SEQ ID NO: 124.
  • 109G10A6 refers to a mouse monoclonal antibody having a heavy chain variable region of SEQ ID NO: 132, and a light chain variable region of SEQ ID NO: 134.
  • [000197] as used herein refers to a mouse monoclonal antibody having a heavy chain variable region of SEQ ID NO: 141 , and a light chain variable region of SEQ ID NO: 143.
  • 92F5B8 refers to a mouse monoclonal antibody having a heavy chain variable region of SEQ ID NO: 146, and a light chain variable region of SEQ ID NO: 146.
  • 185B11E3 refers to a mouse monoclonal antibody having a heavy chain variable region of SEQ ID NO: 156, and a light chain variable region of SEQ ID NO: 158.
  • [000200] as used herein refers to a mouse monoclonal antibody having a heavy chain variable region of SEQ ID NO: 164, and a light chain variable region of SEQ ID NO: 166,
  • [000201] as used herein refers to a mouse monoclonal antibody having a heavy chain variable region of SEQ ID NO: 174, and a light chain variable region of SEQ ID NO: 176.
  • Table 1 shows the CDR sequences of these 20 anti-CD24 antibodies according to IMGT numbering.
  • the heavy chain and light chain variable region sequences are also provided below.
  • Heavy or light chain variable region sequences of 33E7E12, 71A4F12, 56A7E3, 58F10-1F6, 73H5-1G2, 110D4G4, 81A1F8, , 111F3A2, 81A7A10, 107D10D11 101H9G9A2, 173B1C1, 107D10E11, 109G10A6, 94G12D11, 92F5B8, antibodies are provided below.
  • Amino acid sequence (SEQ ID NO: 50):
  • Amino acid sequence (SEQ ID NO: 54):
  • Amino acid sequence (SEQ ID NO: 56):
  • Amino acid sequence (SEQ ID NO: 58):
  • Amino acid sequence (SEQ ID NO: 64):
  • Amino acid sequence (SEQ ID NO: 62): EVQLRQSGPELVKPGAAVKISCKASGYSFTGYHMNAVVKQSPEKSLEWIGEIN
  • Amino acid sequence (SEQ ID NO: 64):
  • Amino acid sequence (SEQ ID NO: 68):
  • Amino acid sequence (SEQ ID NO: 70):
  • Amino acid sequence (SEQ ID NO: 72):
  • Amino acid sequence (SEQ ID NO: 76):
  • Amino acid sequence (SEQ ID NO: 78):
  • Amino acid sequence (SEQ ID NO: 80):
  • Nucleic acid sequence (SEQ ID NO: 83): CAGGTGCAGCTGAAGGAGTCAGGACCTGGCCTGGTGGCGCCCTCACAGAG
  • Amino acid sequence (SEQ ID NO: 84):
  • Amino acid sequence (SEQ ID NO: 101):
  • Nucleic acid sequence (SEQ ID NO: 110): AGATTATTTCTGTCTGCAATATATCACCTTTCCTCGGACGTTCGGTGGAGG
  • Amino acid sequence (SEQ ID NO: 120):
  • Amino acid sequence (SEQ ID NO: 124):
  • Nucleic acid sequence (SEQ ID NO: 211): TACGGCACTAGTCTTGACCACTGGGGCCAAGGCACGACTCTCACAGTCTC
  • CDRs are known to be responsible for antigen binding, however, it has been found that not all of the 6 CDRs are indispensable or unchangeable. In other words, it is possible to replace or change or modify one or more CDRs in anti-CD24 antibody 33E7E12, 71A4F12, 56A7E3, 58F10-1F6, 73H5-1G2, 110D4G4, 81A1F8, 100F2E3, 111F3A2, 81A7A10 107D10D11, 101H9G9A2, 173B1C1, 107D10E11, 109G10A6, 94G12D11, 92F5B8, 185B11E3, 168B11E2 or 188H6D3, yet substantially retain the specific binding affinity to CD24.
  • the anti-CD24 antibodies and the antigen-binding fragments provided herein comprise a heavy chain CDR3 sequence of one of the anti- CD24 antibodies 33E7E12, 71A4F12, 56A7E3, 58F10-1F6, 73H5-1G2, 110D4G4, 81A1F8, 100F2E3, 111F3A2, 81A7A10 107D10D11 , 101H9G9A2, 173B1C1, 107D10E11, 109G10A6, 94G12D11, 92F5B8, 185B11E3, 168B11E2 or 188H6D3.
  • the anti-CD24 antibodies and the antigen-binding fragments provided herein comprise a heavy chain CDR3 sequence selected from the group consisting of SEQ ID NOs: 1, 3, 5, 7, 9, 11 , 14, 16, 17, 18, 19, 21, 23, 25, 27, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 97, 104, 105, 106, 113, 114, 115, 126, 127, 128, 136, 137, 150, 151, 152, 160, 161, 162, 168, 169 170, 222, 223 and 224.
  • Heavy chain CDR3 regions are located at the center of the antigen-binding site, and therefore are believed to make the most contact with antigen and provide the most free energy to the affinity of antibody to antigen. It is also believed that the heavy chain CDR3 is by far the most diverse CDR of the antigen-binding site in terms of length, amino acid composition and conformation by multiple diversification mechanisms (Tonegawa S. Nature. 302:575-81). The diversity in the heavy chain CDR3 is sufficient to produce most antibody specificities (Xu JL, Davis MM. Immunity. 13:37-45) as well as desirable antigen-binding affinity (Schier R, etc. J Mol Biol. 263:551-67).
  • the antibodies and/or antigen-binding fragments thereof provided herein comprise suitable framework region (FR) sequences, as long as the antibodies and/or antigen-binding fragments thereof can specifically bind to CD24.
  • suitable framework region (FR) sequences are obtained from mouse antibodies, but they can be grafted to any suitable FR sequences of any suitable species such as mouse, human, rat, rabbit, among others, using suitable methods known in the art such as recombinant techniques.
  • the antibodies and/or antigen-binding fragments thereof provided herein are humanized.
  • a humanized antibody or antigen -binding fragment is desirable in its reduced immunogenicity in human.
  • a humanized antibody is chimeric in its variable regions, as non-human CDR sequences are grafted to human or substantially human FR sequences.
  • Humanization of an antibody or antigen-binding fragment can be essentially performed by substituting the non-human (such as murine) CDR genes for the corresponding human CDR genes in a human immunoglobulin gene (see, for example, Jones et al. (1986) Nature 321 :522-525; Riechmann et al. (1988) Nature 332:323-327; Verhoeyen et al. (1988) Science 239:1534-1536).
  • Suitable human heavy chain and light chain variable domains can be selected to achieve this purpose using methods known in the art.
  • “best-fit” approach can be used, where a non-human (e.g. rodent) antibody variable domain sequence is screened or BLASTed against a database of known human variable domain sequences, and the human sequence closest to the non-human query sequence is identified and used as the human scaffold for grafting the non- human CDR sequences (see, for example, Sims et al, (1993) J. Immunol. 151 :2296; Chothia et al. (1987) J. Mot. Biol. 196:901).
  • a framework derived from the consensus sequence of all human antibodies may be used for the grafting of the non-human CDRs (see, for example. Carter et al. (1992) Proc. Natl. Acad. Sci. USA, 89:4285; Presta et al. (1993) J. Immunol., 151 :2623).
  • the humanized antibodies or antigen-binding fragments provided herein are composed of substantially all human sequences except for the CDR sequences which are non- human.
  • the variable region FRs, and constant regions if present, are entirely or substantially from human immunoglobulin sequences.
  • the human FR sequences and human constant region sequences may be derived different human immunoglobulin genes, for example, FR sequences derived from one human antibody and constant region from another human antibody.
  • the present disclosure also provides anti-CD24 antibodies and antigenbinding fragments thereof comprising one or more (e.g. 1, 2, 3, 4, 5, or 6) CDR
  • [000252] as used herein refers to a humanized antibody based on 81A1F8 mouse/chimeric that comprises a heavy chain variable region of SEQ ID NO: 177, and a light chain variable region of SEQ ID NO: 180.
  • [000253] as used herein refers to a humanized antibody based on 81 A1F8 mouse/chimeric that comprises a heavy chain variable region of SEQ ID NO: 178, and a light chain variable region of SEQ ID NO: 180.
  • [000254] as used herein refers to a humanized antibody based on 81A1F8 mouse/chimeric that comprises a heavy chain variable region of SEQ ID NO: 179, and a light chain variable region of SEQ ID NO: 180.
  • [000255] as used herein refers to a humanized antibody based on 81A 1F8 mouse/chimeric that comprises a heavy chain variable region of SEQ ID NO: 177, and a light chain variable region of SEQ ID NO: 181.
  • [000256] as used herein refers to a humanized antibody based on 81A1F8 mouse/chimeric that comprises a heavy chain variable region of SEQ ID NO: 178, and a light chain variable region of SEQ ID NO: 181.
  • [000257] as used herein refers to a humanized antibody based on 81A1F8 mouse/chimeric that comprises a heavy chain variable region of SEQ ID NO: 179, and a light chain variable region of SEQ ID NO: 181.
  • [000258] as used herein refers to a humanized antibody based on 81 A1F8 mouse/chimeric that comprises a heavy chain variable region of SEQ ID NO: 177, and a light chain variable region of SEQ ID NO: 182.
  • [000259] as used herein refers to a humanized antibody based on 81 A1F8 mouse/chimeric that comprises a heavy chain variable region of SEQ ID NO: 178, and a light chain variable region of SEQ ID NO: 182.
  • [000260] as used herein refers to a humanized antibody based on 81A1F8 mouse/chimeric that comprises a heavy chain variable region of SEQ ID NO: 179, and a light chain variable region of SEQ ID NO: 182.
  • [000261] as used herein refers to a humanized antibody based on 81 A1F8 mouse/chimeric that comprises a heavy chain variable region of SEQ ID NO: 177, and a light chain variable region of SEQ ID NO: 183.
  • [000262] as used herein refers to a humanized antibody based on 81A1F8 mouse/chimeric that comprises a heavy chain variable region of SEQ ID NO: 178, and a light chain variable region of SEQ ID NO: 183.
  • [000263] as used herein refers to a humanized antibody based on 81A1F8 mouse/chimeric that comprises a heavy chain variable region of SEQ ID NO: 179, and a light chain variable region of SEQ ID NO: 183.
  • [000264] as used herein refers to a humanized antibody based on 101H9G9A2 mouse/chimeric that comprises a heavy chain variable region of SEQ ID NO: 189, and a light chain variable region of SEQ ID NO: 195.
  • [000265] as used herein refers to a humanized antibody based on 10IH9G9A2 mouse/chimeric that comprises a heavy chain variable region of SEQ ID NO: 189, and a light chain variable region of SEQ ID NO: 196.
  • [000266] as used herein refers to a humanized antibody based on 101H9G9A2 mouse/chimeric that comprises a heavy chain variable region of SEQ ID NO: 189, and a light chain variable region of SEQ ID NO: 197.
  • [000267] as used herein refers to a humanized antibody based on mouse/chimeric that comprises a heavy chain variable region of SEQ ID NO: 189, and a light chain variable region of SEQ ID NO: 198.
  • [000268] as used herein refers to a humanized antibody based on 101H9G9A2 mouse/chimeric that comprises a heavy chain variable region of SEQ ID NO: 189, and a light chain variable region of SEQ ID NO: 199.
  • [000269] as used herein refers to a humanized antibody based on 101H9G9A2 mouse/chimeric that comprises a heavy chain variable region of SEQ ID NO: 190, and a light chain variable region of SEQ ID NO: 200.
  • [000270] as used herein refers to a humanized antibody based on 101H9G9A2 mouse/chimeric that comprises a heavy chain variable region of SEQ ID NO: 190, and a light chain variable region of SEQ ID NO: 201 .
  • [000271] as used herein refers to a humanized antibody based on 101H9G9A2 mouse/chimeric that comprises a heavy chain variable region of SEQ ID NO: 190, and a light chain variable region of SEQ ID NO: 202.
  • [000272] as used herein refers to a humanized antibody based on 101H9G9A2 mouse/chimeric that comprises a heavy chain variable region of SEQ ID NO: 190, and a light chain variable region of SEQ ID NO: 203.
  • [000273] as used herein refers to a humanized antibody based on 101H9G9A2 mouse/chimeric that comprises a heavy chain variable region of SEQ ID NO: 191, and a light chain variable region of SEQ ID NO: 200.
  • [000274] as used herein refers to a humanized antibody based on 101H9G9A2 mouse/chimeric that comprises a heavy chain variable region of SEQ ID NO: 191, and a light chain variable region of SEQ ID NO: 201 .
  • [000275] as used herein refers to a humanized antibody based on 101H9G9A2 mouse/chimeric that comprises a heavy chain variable region of SEQ ID NO: 191, and a light chain variable region of SEQ ID NO: 202.
  • [000276] as used herein refers to a humanized antibody based on 101H9G9A2 mouse/chimeric that comprises a heavy chain variable region of SEQ ID NO: 191, and a light chain variable region of SEQ ID NO: 203.
  • [000277] as used herein refers to a humanized antibody based on 101H9G9A2 mouse/chimeric that comprises a heavy chain variable region of SEQ ID NO: 192, and a light chain variable region of SEQ ID NO: 200.
  • [000278] as used herein refers to a humanized antibody based on 101H9G9A2 mouse/chimeric that comprises a heavy chain variable region of SEQ ID NO: 192, and a light chain variable region of SEQ ID NO: 201 .
  • [000279] as used herein refers to a humanized antibody based on 101H9G9A2 mouse/chimeric that comprises a heavy chain variable region of SEQ ID NO: 192, and a light chain variable region of SEQ ID NO: 202.
  • [000280] as used herein refers to a humanized antibody based on 101H9G9A2 mouse/chimeric that comprises a heavy chain variable region of SEQ ID NO: 192, and a light chain variable region of SEQ ID NO: 203.
  • [000281] as used herein refers to a humanized antibody based on 101H9G9A2 mouse/chimeric that comprises a heavy chain variable region of SEQ ID NO: 193, and a light chain variable region of SEQ ID NO: 200.
  • [000282] as used herein refers to a humanized antibody based on 101H9G9A2 mouse/chimeric that comprises a heavy chain variable region of SEQ ID NO: 193, and a light chain variable region of SEQ ID NO: 201.
  • [000283] as used herein refers to a humanized antibody based on 101H9G9A2 mouse/chimeric that comprises a heavy chain variable region of SEQ ID NO: 193, and a light chain variable region of SEQ ID NO: 202.
  • [000284] as used herein refers to a humanized antibody based on 101H9G9A2 mouse/chimeric that comprises a heavy chain variable region of SEQ ID NO: 193, and a light chain variable region of SEQ ID NO: 203.
  • [000285] as used herein refers to a humanized antibody based on 101H9G9A2 mouse/chimeric that comprises a heavy chain variable region of SEQ ID NO: 194, and a light chain variable region of SEQ ID NO: 200.
  • [000286] as used herein refers to a humanized antibody based on 101H9G9A2 mouse/chimeric that comprises a heavy chain variable region of SEQ ID NO: 194, and a light chain variable region of SEQ ID NO: 201.
  • [000287] as used herein refers to a humanized antibody based on 101H9G9A2 mouse/chimeric that comprises a heavy chain variable region of SEQ ID NO: 194, and a light chain variable region of SEQ ID NO: 202.
  • [000288] as used herein refers to a humanized antibody based on 101H9G9A2 mouse/chimeric that comprises a heavy chain variable region of SEQ ID NO: 194, and a light chain variable region of SEQ ID NO: 203.
  • Table 2 shows the CDR sequences of these 37 humanized anti-CD24 antibodies according to IMGT numbering.
  • the heavy chain and light chain variable region sequences are also provided below.
  • VH Amino acid sequence (SEQ ID NO: 177):
  • VL Amino add sequence (SEQ ID NO: 180):
  • VH Amino add sequence (SEQ ID NO: 178): VL Amino add sequence (SEQ ID NO: 180):
  • VH Amino add sequence (SEQ ID NO: 179):
  • VL Amino add sequence (SEQ ID NO: 180):
  • VH Amino add sequence (SEQ ID NO: 177):
  • VL Amino add sequence (SEQ ID NO: 181):
  • VH Amino add sequence (SEQ ID NO: 178):
  • VL Amino add sequence (SEQ ID NO: 181):
  • VH Amino acid sequence (SEQ ID NO: 179): QVQLVQSGAEVKKPGASVKVSCKASGYLFTGYYMNWVRQAPGQRLEWMG EINPNTGDTNNNQKFKARVTITWRSASTAYMELSSLRSEDTAVYYCVRRDY GTSLDYWGQGTLVTVSS
  • VL Amino add sequence (SEQ ID NO: 181):
  • VL Amino add sequence (SEQ ID NO: 182):
  • VH Amino add sequence (SEQ ID NO: 178):
  • VL Amino add sequence (SEQ ID NO: 182):
  • VH Amino acid sequence (SEQ ID NO: 179):
  • VL Amino add sequence (SEQ ID NO: 182):
  • VL Amino acid sequence (SEQ ID NO: 183):
  • VH Amino acid sequence (SEQ ID NO: 178):
  • VL Amino acid sequence (SEQ ID NO: 183):
  • VH Amino acid sequence (SEQ ID NO: 179):
  • VL Amino acid sequence (SEQ ID NO: 183):
  • VH Amino acid sequence (SEQ ID NO: 189):
  • VL Amino acid sequence (SEQ ID NO: 195):
  • VH Amino acid sequence (SEQ ID NO: 189):
  • VL Amino acid sequence (SEQ ID NO: 196):
  • VH Amino acid sequence (SEQ ID NO: 189):
  • VL Amino add sequence (SEQ ID NO: 197):
  • VH Amino acid sequence (SEQ ID NO: 189):
  • VL Amino add sequence (SEQ ID NO: 198):
  • VL Amino acid sequence (SEQ ID NO: 199):
  • VH Amino acid sequence (SEQ ID NO: 190):
  • VL Amino add sequence (SEQ ID NO: 200):
  • VL Amino add sequence (SEQ ID NO: 201):
  • VH Amino acid sequence (SEQ ID NO: 190):
  • VH Amino add sequence (SEQ ID NO: 190):
  • VL Amino add sequence (SEQ ID NO: 203):
  • VH Amino acid sequence (SEQ ID NO: 191):
  • VL Amino add sequence (SEQ ID NO: 200):
  • VH Amino acid sequence (SEQ ID NO: 191):
  • VL Amino add sequence (SEQ ID NO: 201):
  • VH Amino acid sequence (SEQ ID NO: 191):
  • VL Amino add sequence (SEQ ID NO: 202):
  • VH Amino acid sequence (SEQ ID NO: 191):
  • VL Amino add sequence (SEQ ID NO: 203):
  • VH Amino acid sequence (SEQ ID NO: 192):
  • VL Amino add sequence (SEQ ID NO: 200):
  • VH Amino acid sequence (SEQ ID NO: 192): QVQLVQSGAEVKKPGASVKVSCKASDYTFTSYWMDWVRQAPGQGLEWMG NIYPSDSKTHYNQKFKDRVTMTVDKSISTAYMELSRLRSDDTAVYYCARRGG YYAYAMDYWGQGTLVTVSS
  • VL Amino add sequence (SEQ ID NO: 201):
  • VH Amino add sequence (SEQ ID NO: 192):
  • VL Amino acid sequence (SEQ ID NO: 202):
  • VH Amino acid sequence (SEQ ID NO: 192):
  • VL Amino add sequence (SEQ ID NO: 203):
  • VH Amino acid sequence (SEQ ID NO: 193):
  • VL Amino add sequence (SEQ ID NO: 200):
  • VH Amino acid sequence (SEQ ID NO: 193):
  • VL Amino acid sequence (SEQ ID NO: 201):
  • VH Amino acid sequence (SEQ ID NO: 193):
  • VL Amino add sequence (SEQ ID NO: 202):
  • VH Amino acid sequence (SEQ ID NO: 193):
  • VL Amino add sequence (SEQ ID NO: 203):
  • VL Amino acid sequence (SEQ ID NO: 200):
  • VH Amino acid sequence (SEQ ID NO: 194):
  • VL Amino add sequence (SEQ ID NO: 201):
  • VH Amino acid sequence (SEQ ID NO: 194):
  • VL Amino add sequence (SEQ ID NO: 202):
  • VH Amino acid sequence (SEQ ID NO: 194):
  • the anti-CD24 antibodies and the fragments thereof provided herein further comprise an immunoglobulin constant region.
  • an immunoglobulin constant region comprises a heavy chain and/or a light chain constant region.
  • the heavy chain constant region comprises CHI, hinge, and/or CH2-CH3 regions.
  • the heavy chain constant region comprises an Fc region.
  • the light chain constant region comprises
  • the anti-CD24 antibodies and antigen-binding fragments thereof provided herein have a constant region of an immunoglobulin optionally a human Ig, optionally a human IgG.
  • the anti-CD24 antibodies and antigen-binding fragments thereof provided herein comprises a constant region of human IgGl, IgG2, IgG3, or IgG4.
  • Human IgG isotypes (the subclasses of mature gamma globulin class G antibodies; IgGl, IgG2, IgG3 and IgG4) exhibit differential capacity to recruit effector functions. For example, ADCC is promoted by IgGl and IgG3, ADCP is promoted by IgGl, IgG2, IgG3 and IgG4, and CDC is promoted by IgGl and IgG3. Isotype-specific engagement of such effector functions is based on selectivity for Fc receptors on distinct, immune cells and the ability to bind Clq thereby activating the assembly of a membrane attack complex (MAC).
  • MAC membrane attack complex
  • Fey affinity for IgG2 is considerably lower with the exception of FcyRIIa Hl 31 polymorphism and IgG4 only has measurable affinity for FcyRI.
  • the anti-CD24 antibodies and antigen-binding fragments thereof provided herein comprises a constant region of IgGl isotype, which could induce ADCC, CDC or ADCP, or a constant region of IgG4 or IgG2 isotype, which has reduced or depleted effector function.
  • Effector functions such as ADCC and CDC can lead to cytotoxicity to cells expressing CD24. Effector functions can be evaluated using various assays such as Fc receptor binding assay, Clq binding assay, and cell lysis assay.
  • the present disclosure also encompasses various variants of the antibodies and/or antigen-binding fragments thereof provided herein.
  • the present disclosure encompasses various types of variants of an exemplary antibody provided herein, i.e., 33E7E12, 71A4F12, 56A7E3, 58F10-1F6, 73H5-1G2, 110D4G4, 81A1F8, 100F2E3, 111F3A2, 81A7A10 or 107D10D11.
  • the antibody variants comprise one or more modifications or substitutions in one or more CDR sequences as provided in Table I, one or more FR sequences, the heavy or light chain variable region sequences provided herein, and/or the constant region (e.g. Fc region).
  • Such variants retain specific binding affinity to CD24 of their parent antibodies, but have one or more desirable properties conferred by the modification(s) or substitution(s).
  • the antibody variants may have improved antigen-binding affinity, improved glycosylation pattern, reduced risk of glycosylation, reduced deamination, reduced or depleted effector function(s), improved FcRn receptor binding, increased pharmacokinetic half-life, pH sensitivity, and/or compatibility to conjugation (e.g. one or more introduced cysteine residues).
  • the parent antibody sequence may be screened to identify suitable or preferred residues to be modified or substituted, using methods known in the art, for example “alanine scanning mutagenesis” (see, for example, Cunningham and Wells (1989) Science, 244: 1081-1085). Briefly, target residues (e.g., charged residues such as Arg, Asp, His, Lys, and Glu) can be identified and replaced by a neutral or negatively charged amino acid (e.g., alanine or polyalanine), and the modified antibodies are produced and screened for the interested property. If substitution at a particular amino acid location demonstrates an interested functional change, then the position can be identified as a potential residue for modification or substitution. The potential residues may be further assessed by substituting with a different type of residue (e.g. cysteine residue, positively charged residue, etc.).
  • alanine scanning mutagenesis see, for example, Cunningham and Wells (1989) Science, 244: 1081-1085.
  • target residues e.g.
  • Affinity variant may contain modifications or substitutions in one or more CDR sequences as provided in Table 1, one or more FR sequences, or the heavy or light chain variable region sequences provided herein.
  • the affinity variants retain specific binding affinity to CD24 of the parent antibody, or even have improved CD24 specific binding affinity over the parent antibody.
  • at least one (or all) of the substitution(s) in the CDR sequences, FR sequences, or variable region sequences comprises a conservative substitution.
  • one or more amino acid residues may be substituted yet the resulting antibody or antigen-binding fragment still retain the binding affinity to CD24, or even have an improved binding affinity.
  • Various methods known in the art can be used to achieve this purpose.
  • a library of antibody variants such as Fab or scFv variants
  • computer software can be used to virtually simulate the binding of the antibodies to human CD24, and identify the amino acid residues on the antibodies winch form the binding interface. Such residues may be either avoided in the substitution so as to prevent reduction in binding affinity, or targeted for substitution to provide for a stronger binding.
  • the humanized antibody or antigen-binding fragment provided herein comprises one or more amino acid residue substitutions in one or more CDR sequences, and/or one or more FR sequences.
  • an affinity variant comprises no more than 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 substitutions in the CDR sequences and/or FR sequences in total.
  • the anti-CD24 antibodies and antigen-binding fragments thereof comprise I, 2, or 3 CDR sequences having at least 80% (e.g. at least 85%, 88%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%) sequence identity to that (or those) listed in Table 1, and in the meantime retain the binding affinity to CD24 at a level similar to or even higher than its parent antibody.
  • the anti-CD24 antibodies and antigen-binding fragments thereof comprise one or more variable region sequences having at least 80% (e.g. at least 85%, 88%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%) sequence identity to that (or those) listed in Table 1, and in the meantime retain the binding affinity to CD24 at a level similar to or even higher than its parent antibody.
  • a total of 1 to 10 amino acids have been substituted, inserted, or deleted in a sequence selected from that (or those) listed in Table I .
  • the substitutions, insertions, or deletions occur in regions outside the CDRs (i.e., in the FRs).
  • the anti-CD24 antibodies and antigen-binding fragments provided herein also encompass a glycosylation variant, which can be obtained to either increase or decrease the extent of glycosylation of the antibody or antigen binding fragment.
  • the antibody or antigen binding fragment thereof may comprise one or more amino acid residues with a side chain to which a carbohydrate moiety (e.g. an oligosaccharide structure) can be attached.
  • Glycosylation of antibodies is typically either N-linked or O-linked.
  • N-linked refers to the attachment of the carbohydrate moiety to the side chain of an asparagine residue, for example, an asparagine residue in a tripeptide sequence such as asparagine-X-serine and asparagine-X-threonine, where X is any amino acid except proline.
  • O-linked glycosylation refers to the attachment of one of the sugars N-aceylgalactosamine, galactose, or xylose to a hydroxyamino acid, most commonly to serine or threonine. Removal of a native glycosylation site can be conveniently accomplished, for example, by altering the amino acid sequence such that one of the above-described tripeptide sequences (for N-linked glycosylation sites) or serine or threonine residues (for O-linked glycosylation sites) present in the sequence is substituted. A new glycosylation site can be created in a similar way by introducing such a tripeptide sequence or serine or threonine residue.
  • the anti-CD24 antibodies and antigen-binding fragments provided herein also encompass a cysteine-engineered variant, which comprises one or more introduced free cysteine amino acid residues.
  • a free cysteine residue is one which is not part of a disulfide bridge.
  • a cysteine-engineered variant is useful for conjugation with for example, a cytotoxic and/or imaging compound, a label, or a radioisoptype among others, at the site of the engineered cysteine, through for example a maleimide or haloacetyl.
  • Methods for engineering antibodies or antigen-binding fragments to introduce free cysteine residues are known in the art, see, for example, W02006/034488.
  • anti-CD24 antibodies and antigen-binding fragments provided herein also encompass an Fc variant, which comprises one or more amino acid residue modifications or substitutions at its Fc region and/or hinge region.
  • the anti-CD24 antibodies or antigen-binding fragments comprise one or more amino acid substitution(s) that improves pH- dependent binding to neonatal Fc receptor (FcRn).
  • FcRn neonatal Fc receptor
  • Such a variant can have an extended pharmacokinetic half-life, as it binds to FcRn at acidic pH which allows it to escape from degradation in the lysosome and then be translocated and released out of the cell.
  • Methods of engineering an antibody and antigen-binding fragment thereof to improve binding affinity with FcRn are well-known in the art, see, for example, Vaughn, D. et al, Structure, 6(1): 63-73, 1998; Kontermann, R.
  • the anti-CD24 antibodies or antigen-binding fragments comprise one or more amino acid substitution(s) that alters the antibodydependent cellular cytotoxicity (ADCC).
  • ADCC antibodydependent cellular cytotoxicity
  • Certain amino acid residues at Cl 12 domain of the Fc region can be substituted to provide for enhanced ADCC activity.
  • carbohydrate structures on the antibody can be changed to enhance ADCC activity.
  • the anti-CD24 antibodies or antigen-binding fragments comprise one or more amino acid substitution(s) that alters Complement Dependent Cytotoxicity (CDC), for example, by improving or diminishing Clq binding and/or CDC (see, for example, WO99/51642, Duncan & Winter Nature 322:738-40 (1988); U.S. Pat. No. 5,648,260; U.S. Pat. No. 5,624,821), and WO94/29351 concerning other examples of Fc region variants.
  • CDC Complement Dependent Cytotoxicity
  • the anti-CD24 antibodies or antigen-binding fragments comprise one or more amino acid substitution(s) in the interface of the Fc region to facilitate and/or promote heterodimerization.
  • modifications comprise introduction of a protuberance into a first Fc polypeptide and a cavity into a second Fc polypeptide, wherein the protuberance can be positioned in the cavity so as to promote interaction of the first and second Fc polypeptides to form a heterodimer or a complex.
  • anti-CD24 antigen-binding fragments are also provided herein.
  • Various types of antigen-binding fragments are known in the art and can be developed based on the anti-CD24 antibodies provided herein, including for example, the exemplary antibodies whose CDR and FR sequences are shown in Table 1 , and their different variants (such as affinity variants, glycosylation variants, Fc variants, cysteine- engineered variants and so on).
  • an anti-CD24 antigen-binding fragment is a camelized single domain antibody, a diabody, a single chain Fv fragment (scFv), an scFv dimer, a BsFv, a dsFv, a (dsFv)2, a dsFv-dsFv', an Fv fragment, a Fab, a Fab', a F(ab') 2 , a bi specific antibody, a ds diabody , a nanobody, a domain antibody , a single domain antibody, or a bivalent domain antibody.
  • Various techniques can be used for the production of such antigen-binding fragments.
  • Illustrative methods include, enzymatic digestion of intact antibodies (see, e.g., Morimoto et al., Journal of Biochemical and Biophysical Methods 24:107-117 (1992); and Brennan et al., Science, 229:81 (1985)), recombinant expression by host, cells such as E. Coli (e.g. for Fab, Fv and ScFv antibody fragments), screening from a phage display library as discussed above (e.g.
  • the antigen-binding fragment is a scFv.
  • Generation of scFv is described in, for example, WO 93/16185; U.S. Pat. Nos. 5,571,894; and 5,587,458.
  • scFv may be fused to an effector protein at either the amino or the carboxy terminus to provide for a fusion protein (see, for example, Antibody Engineering, ed, Borrebaeck).
  • Bispecific Antibodies, Multivalent Antibodies are described in, for example, WO 93/16185; U.S. Pat. Nos. 5,571,894; and 5,587,458.
  • scFv may be fused to an effector protein at either the amino or the carboxy terminus to provide for a fusion protein (see, for example, Antibody Engineering, ed, Borrebaeck).
  • the antibodies or antigen-binding fragments thereof provided herein are bivalent, tetravalent, hexavalent, or multivalent. In certain embodiments, the antibodies and/or antigen-binding fragments thereof provided herein are monospecific, or bispecific.
  • bivalent refers to the presence of a specified number of antigen binding sites in a given molecule.
  • bivalent can be monospecific if the two binding sites are both for specific binding of the same antigen or the same epitope.
  • a trivalent molecule can be bi specific, for example, when two binding sites are monospecific for a first antigen (or epitope) and the third binding site is specific for a second antigen (or epitope).
  • the antibodies or antigen-binding fragments thereof provided herein can be monospecific but bivalent, trivalent, or tetravalent, with at least two binding sites specific for the same antigen or epitope. This, in certain embodiments, provides for stronger binding to the antigen or the epitope than a monovalent counterpart.
  • the first valent of binding site and the second valent of binding site are structurally identical (i.e. having the same sequences), or structurally different (i.e. having different sequences albeit with the same specificity).
  • the antibodies or antigen-binding fragments thereof provided herein are bispecific. In some embodiments, the bispecific antibodies and antigen-binding fragments thereof provided herein binds to a first and a second epitope of CD24, wherein the first and the second epitope of CD24 are different.
  • the bispecific antibodies or antigen-binding fragments thereof provided herein binds to a first epitope of CD24, and a second epitope of an antigen other than CD24.
  • the bispecific antibody molecules provided herein can be in any suitable bispecific format known in the Examples of reference bispecific antibody formats known in the art include, without limitation, (i) a bispecific antibody with symmetric Fc, (ii) a bispecific antibody with asymmetric Fc, (iii) a regular antibody appended with an additional antigen-binding moiety, (iv) a bispecific antibody fragment, (v) a regular antibody fragment appended with an additional antigen-binding moiety, (vi) a bispecific antibody appended with human albumin or human albumin-binding peptide.
  • Bispecific IgG-like antibodies (BsIgG) is monovalent for each antigen and can be produced by co-expression of the two light and two heavy chains in a single host cell.
  • An appending IgG is engineered to form bispecific IgG by appending either the amino or carboxyl termini of either light or heavy chains with additional antigenbinding units.
  • the additional antigen-binding units can be single domain antibodies (unpaired VL or VH), such as DVD-Ig, paired antibody variable domains (e.g. Fv or scFv) or engineered protein scaffolds.
  • Bi specific antibody fragments are antigen-binding fragments that are derived from an antibody but lack some or all of the antibody constant domains.
  • bispecific antibody fragment include, for example, such as single domain antibody, Fv, Fab and diabody etc.
  • the bispecific antibody molecules as provided herein are based on the format of a “whole” antibody, such as whole IgG or IgG-like molecules, and small recombinant formats, such as tandem single chain variable fragment molecules (taFvs), diabodies (Dbs), single chain diabodies (scDbs) and various other derivatives of these (cf. bispecific antibody formats as described by Byrne H. et al. (2013) Trends Biotech, 31 (11): 621 -632.
  • Examples of bispecific antibody is based on a format which include, but is not limited to, quadroma, chemically coupled Fab (fragment antigen binding), and BiTE (bispecific T cell engager).
  • the bi specific antibody molecules as provided herein are in a bi specific format selected from Trioniabs; hybrid hybridoma (quadroma), Multispecific anticalin platform (Pieris); Diabodies; Single chain diabodies; Tandem single chain Fv fragments; TandAbs, Trispecific Abs (Affimed); Darts (dual affinity retargeting; Macrogenics); Bispecific Xmabs (Xencor); Bispecific T cell engagers (Bites, Amgen; 55 kDa); Triplebodies; Tribody (Fab-scFv) Fusion Protein (CreativeBiolabs) multifunctional recombinant antibody derivates; Duobody platform (Genmab); Dock and lock platform; Knob into hole (KIH) platform; Humanized bispecific IgG antibody (REGN1979) (Regeneron); Mab2 bispecific antibodies (F-Star); DVD-Ig (dual variable domain immunoglobulin) (Abbvie); kappa-lambd
  • the bispecific antibody molecules as provided herein are in a bispecific format selected from BsIgG comprising CrossMab; DAF (two-in-one); DAF (four-in-one); DutaMab; DT-IgG; Knobs-in-holes common LC; Knob s-in- holes assembly; Charge pair; Fab-arm exchange; SEEDbody; LUZ-Y, Fcab; kappa-lamda-body; and Orthogonal Fab.
  • BsIgG comprising CrossMab
  • DAF two-in-one
  • DAF four-in-one
  • DT-IgG Knobs-in-holes common LC
  • Knob s-in- holes assembly Charge pair
  • Fab-arm exchange SEEDbody
  • LUZ-Y Fcab
  • kappa-lamda-body and Orthogonal Fab.
  • the bispecific antibody molecules as provided herein are in a bispecific format selected from IgG -appended antibodies with an additional antigen-binding moiety comprising DVD-IgG; IgG(H)-scFv; scFv-(H)IgG; IgG(L)-scFv; scFV-(L)IgG; IgG(L,H)-Fv; IgG(H)-V; V(H)-IgG; IgG(L)-V; V(L)-IgG; KIH IgG-scFab; 2scFv-IgG; IgG-2scFv; scFv4-Ig; scFv4-Ig; Zybody; and DVI-IgG (four-in-one) (see Id.).
  • the bispecific antibody molecules as provided herein are in a format selected from bi specific antibody fragments comprising Nanobody; Nanobody-HAS; BiTE; Diabody; DART; TandAb; scDiabody; sc- Diabody-CH3; Diabody-CH3; Triple Body; Miniantibody; Minibody; TriBi minibody; scFv-CH3 KIH; Fab-scFv; scFv-CH-CL-scFv; F(ab')2; F(ab')2-scFv2; scFv-KIH;
  • the bispecific antibody molecules as provided herein are in a bispecific format such as Dock and Lock; ImmTAC; HSAbody; scDiabody-HAS; and Tandem scFv-Toxin (see Id.).
  • the bi specific antibody molecules as provided herein are based on a format selected from bispecific antibody conjugates comprising IgG-IgG; Cov-X-Body; and scFvl-PEG-scFv2 (see Id.).
  • the second antigen-binding domain is operably linked to the N terminus or the C terminus of the CD24 -binding domain.
  • the CD24-binding domain is operably linked to the N terminus or the C terminus of the second antigen-binding domain.
  • the operable linkage can be a direct chemical bond linkage or an indirect linkage via a spacer or via an intervening sequence.
  • spacer refers to an artificial amino acid sequence having 1, 2, 3, 4 or 5 amino acid residues, or a length of between 5 and 15, 20, 30, 50 or more amino acid residues, joined by peptide bonds and are used to link one or more binding domains, such as a scFv and a Fab or IgG.
  • the spacer can be identical to or different from the peptide linker in the scFv.
  • the spacer comprises 1, 2, 3, 4 or more sequential or tandem repeats of SEQ ID NOs: 90, 91, 92 and 93.
  • the spacer comprises GGGGS (SEQ ID NO: 90). In certain embodiments, the spacer comprises GGGGSGGGGS (SEQ ID NO: 91), GGGGSGGGGSGGGGS (SEQ ID NO: 92), GGGGSGGGGSGGGGSGGGGS (SEQ ID NO: 93).
  • the intervening sequence as used herein can be any amino acid sequence located between the CD24- binding domain and the second antigen-binding domain, as long as both the CD24- binding domain and the second antigen-binding domain are capable of binding to its respective antigen. In an illustrative example, the intervening sequence can comprise a heavy chain constant region, or a light chain constant region.
  • the second antigen-binding domain comprises a scFv and the CD24-binding domain comprises a Fab or IgG.
  • the second antigen-binding scFv can be operably linked to the N terminus or the C- terminus of the heavy chain of the CD24-binding Fab or IgG (e.g. the C -terminus of the heavy chain constant region following the CD24-binding Fab), or to the N terminus or the C -terminus of the light chain of the CD24-binding Fab or IgG, or any combination thereof, and vice versa.
  • the bispecific antibody molecule can comprise a heavy chain in the format of: VH(anti-CD24)-CHl-Hinge-CH2-CH3 -spacer-second antigen-binding scFv or second antigen-binding scFv-spacer-VH(anti-CD24)-CHl- Hinge-CH2-CH3, and a light chain in the format of VL(anti-CD24)-CL.
  • VH(anti-CD24) and VL(anti-CD24) refer respectively to the heavy and light chain variable domain of the CD24 binding domain; second antigen-binding scFv refers to scFv of the second antigen-binding domain, CL refers to the light chain constant region; and CH1-Hinge-CH2-CH3 are collectively heavy chain constant region.
  • the bispecific antibody molecule can comprise a light chain in the format of: second antigen-binding scFv- spacer- VL(anti- CD24)-CL or VL(anti-CD24)-CL-spacer-second antigen-binding scFv, and a heavy chain in the format of VH(anti-CD24) ⁇ CHl -Hinge-CH2-CH3, by the same token.
  • the CD24-binding domain comprises scFv and the second antigen-binding domain comprises Fab or IgG.
  • the CD24-binding domain scFv can be operably linked to the N terminus or the C- terminus of the heavy chain of the second antigen-binding Fab or IgG (e.g. the C- terminus of the heavy chain constant region following the CD24-bmding Fab), or to the N terminus or the C -terminus of the light chain of the second antigen-binding Fab or IgG, or any combination thereof’ and vice versa.
  • the bispecific antibody molecule can comprise a heavy chain in the format of second antigen-binding VH-CH1-Hinge-CH2-CH3- spacer-scFv(anti-CD24) or scFv(anti-CD24)-spacer-second antigen-binding VH-CH1- Hinge-CH2-CH3, and a light chain in the format of second antigen-binding VL-CL, by the same token.
  • the bispecific antibody molecule can comprise a light chain in the format of: scFv (anti-CD24)-spacer-second antigenbinding VL-CL or second antigen-binding VL-CL-spacer-scFv (anti-CD24), and a heavy chain second antigen-binding VH-CH1-Hinge-CH2-CH3, by the same token.
  • the second antigenbinding domain may be monovalent (i.e. one scFv or Fab) or multivalent (e.g. more than one scFv or Fab), and/or the CD24-binding domain may be monovalent or multivalent.
  • the second antigen is an immune related target, optionally selected from the group consisting of: PD-L1, PD-L2, PD-I, CLTA-4, TIM-3, LAG3, CD160, 2B4, TGF ⁇ , VISTA, BTLA, TIGIT, LAIR1, 0X40, CD2, CD27, ICAM-1, NKG2C, SLAMF7, NKp80, CD 160, B7-H3, LFA-1, ICOS, 4-1 BB, GITR, CD30, CD40, BAFFR, HVEM, CD7, LIGHT, IL-2, IL-15, CD3, CD 16, SIRPa, Siglec 10, LILRB2, Clever-1, Macro, LILRB4, Siglecl5, CSF1R, PSGL-1, VSIG-4, B2M and CD83.
  • an immune related target optionally selected from the group consisting of: PD-L1, PD-L2, PD-I, CLTA-4, TIM-3, LAG3, CD160, 2B
  • the second antigen is a tumor associated antigen or an epitope thereof.
  • tumor associated antigen used interchangeably with the term “tumor antigen”, refers to an antigen that is or can be presented on a tumor cell surface and that is located on or within tumor cells.
  • the tumor associated antigens can be presented only by tumor cells and not by normal, i.e. non-tumor cells.
  • the tumor associated antigens can be exclusively expressed on tumor cells or may represent a tumor specific mutation compared to non-tumor cells.
  • the tumor associated antigens cart be found in both tumor cells and non-tumor cells, but is overexpressed on tumor cells when compared to non-tumor cells or are accessible for antibody binding in tumor cells due to the less compact structure of the tumor tissue compared to non-tumor tissue.
  • the tumor antigen is selected from the group consisting of CA-125, gangliosides G(D2), G(M2) and G(D3), CD19, CD20, CD33, CD47, CD52, Ep-CAM, CEA, CLDN18.2, bombesin-like peptides, PSA, HER2/neu, epidermal growth factor receptor (EGFR), erbB2, erbB3/HER3, erbB4, CD44v6, CD44v9, Ki-67, cancer-associated mucin, VEGF, VEGFRs (e.g., VEGFR3), estrogen receptors, Lewis- Y antigen, TGF ⁇ 1, IGF-1 receptor, EGFa, c-Kit receptor, transferrin receptor, IL-2R, CDH6, CEA, FOLR1, TROP2, PTK7, SLITRK6, CD 142, NECTIN- 4, ROR1, ROR2, CD 142, CD123, CD22, CD79b, DLL3, SLC
  • the second antigen is an immunoinhibitory molecule selected from the group consisting of PD-L1, SIRPa, CD47 and B2M.
  • the second antigen is CD47.
  • the CD47-binding scFv is operably linked to the C terminus of the heavy chain constant region following the CD24-binding Fab.
  • the bispecific antibody molecule comprise a heavy chain in the format of: VH(anti-CD24)-CHl-Hinge-CH2-CH3-spacer-scFv(anti- CD47), associated with a light chain in the format of VL(anti-CD24)-CL.
  • the CD47-binding scFv is 5F9 derived scFv and comprises an amino acid sequence of SEQ ID NO: 94 (QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYN WVRQAPGQRLEWMG TIYPGNDDTSYNQKFKDRVTITADTSASTAYMELSSLRSEDTAVYYCARGGY RAMDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIVMTQSPLSLPVTPGEPASI SCRSSQSIVYSNGNTYLGWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGT DFTLKISRVEAEDVGVYYCFQGSHVPYTFGQGTKLEIK).
  • SEQ ID NO: 94 QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYN WVRQAPGQRLEWMG TIYPGNDDTSYNQKFKDRVTITADTSASTAYMELSSLRSEDTAVY
  • tumor associated antigen examples include CD 10, CD21, CD22, CD25, CD30, CD34, CD37, CD38, CD123, GPRC5D, CD44v6, CD45, CD133, Fms-like tyrosine kinase 3 (FLT-3, CD135), chondroitin sulfate proteoglycan 4 (CSPG4, melanoma-associated chondroitin sulfate proteoglycan), Her2, Her3, IGFR, IL3R, fibroblast activating protein (FAP), CDCP1, Derlinl, Tenascin, frizzled 1 -10, the vascular antigens VEGFR2 (KDR/FLK1), VEGFR3 (FLT4, CD309), PDGFR- alpha (CD140a), PDGFR-beta (CD140b), Endoglin, CLEC14, CLECI2a, Teml-8, and Tie2.
  • Further examples may include A33, CAMPATH-1 (CDw52), Carcinoembryonic antigen (CEA), Carboanhydrase IX (MN/CA IX), de2-7, EGFRvIII, EpCAM, Folate-binding protein, G250, c-Kit (CD 117), CSF1R (CD 115), HLA-DR, IL-2 receptor, 1L3R, MCSP (Melanoma-associated cell surface chondroitin sulphate proteoglycane), Muc-1, Prostate-specific membrane antigen (PSMA), Prostate stem cell antigen (PSCA), Prostate specific antigen (PSA), and TAG-72.
  • CAMPATH-1 CDw52
  • CEA Carcinoembryonic antigen
  • MN/CA IX Carboanhydrase IX
  • de2-7 EGFRvIII
  • EpCAM EpCAM
  • Folate-binding protein G250, c-Kit (CD 117), CSF1R (CD
  • bispecific antibodies and antigen-binding fragments provided herein can be made with any suitable methods known in the art.
  • two immunoglobulin heavy chain-light chain pairs having different antigenic specificities can be co-expressed in a host cell to produce bi specific antibodies in a recombinant way (see, for example, Milstein and Cuello, Nature, 305: 537 (1983)), followed by purification by affinity chromatography.
  • Recombinant approach may also be used, where sequences encoding the antibody heavy chain variable domains for the two specificities are respectively fused to immunoglobulin constant domain sequences, followed by insertion to an expression vector which is co-transfected with an expression vector for the light chain sequences to a suitable host cell for recombinant expression of the bi specific antibody (see, for example, WO 94/04690, Suresh et al., Methods in Enzymology, 121 :210 (1986)).
  • scFv dimers can also be recombinantly constructed and expressed from a host cell (see, e.g. Gruber et al., J. Immunol., 152:5368 (1994).)
  • leucine zipper peptides from the Fos and Jun proteins can be linked to the Fab' portions of two different antibodies by gene fusion.
  • the linked antibodies are reduced at the hinge region to four half antibodies (i.e. monomers) and then re-oxidized to form heterodimers (Kostelny et al., J. Immunol., 148(5): 1547-1553 (1992)).
  • the two antigen-binding domains may aiso be conjugated or cross-linked to form a bi specific antibody or antigen-binding fragment.
  • one antibody can be coupled to biotin while the other antibody to avidin, and the strong association between biotin and avidin would complex the two antibodies together to form a bispecific antibody (see, for example, U.S. Pat. No. 4,676,980, WO 91/00360, WO 92/00373, and EP 03089).
  • the two antibodies or antigen-binding fragments can be cross-linked by conventional methods known in the art., for example, as disclosed in U.S. Pat. No. 4,676,980.
  • Bispecific antigen-binding fragments may be generated from a bispecific antibody, for example, by proteolytic cleavage, or by chemical linking.
  • an antigen-binding fragment e.g. Fab’
  • an antibody may be prepared and converted to Fab'-thiol derivative and then mixed and reacted with another converted Fab’ derivative having a different antigenic specificity to form a bispecific antigenbinding fragment (see, for example, Brennan et al., Science, 229: 81 (1985)).
  • the bispecific antibody or antigen-binding fragments may be engineered at the interface so that a knob-into-hole association can be formed to promote heterodimerization of the two different antigen-binding sites.
  • Knob-into-hole refers to an interaction between two polypeptides (such as domain), where one polypeptide has a protuberance (i.e. “knob”) due to presence of an amino acid residue having a bulky side chain (e.g. tyrosine or tryptophan), and the other polypeptide has a cavity (i.e. “hole”) where a small side chain amino acid residue resides (e.g.
  • the anti-CD24 antibodies and antigen-binding fragments thereof is linked to one or more conjugates, optionally, wherein the conjugate is covalently attached either directly or via a linker.
  • a conjugate is a non- proteinaceous moiety that can be attached to the antibody or antigen-binding fragment thereof. It is contemplated that a variety of conjugates may be linked to the antibodies or antigen-binding fragments provided herein (see, for example, “Conjugate Vaccines”, Contributions to Microbiology and Immunology, J. M. Cruse and R. E. Lewis, Jr. (eds.), Carger Press, New York, (1989)).
  • conjugates may be linked to the antibodies or antigen-binding fragments by covalent binding, affinity binding, intercalation, coordinate binding, cornplexation, association, blending, or addition, among other methods.
  • the conjugate comprises a clearancemodifying agent, a chemotherapeutic agent, a toxin, a radioactive isotope, a lanthanide, a luminescent label, a fluorescent label, an enzyme-substrate label, a DNA-alkylators, a topoisomerase inhibitor, a tubulin-binders, or other anticancer drugs.
  • the antibodies and antigen-binding fragments disclosed herein may be engineered to contain specific sites outside the epitope binding portion that may be utilized for binding to one or more conjugates.
  • a site may include one or more reactive amino acid residues, such as for example cysteine or histidine residues, to facilitate covalent linkage to a conjugate.
  • the antibodies may be linked to a conjugate indirectly, or through another conjugate.
  • the antibody or antigenbinding fragments may be conjugated to biotin, then indirectly conjugated to a second conjugate that is conjugated to avidin.
  • the conjugate can be a toxin (e.g., a chemotherapeutic agent), a detectable label (e.g., a radioactive isotope, a lanthanide, a luminescent label, a fluorescent label, or an enzyme-substrate label).
  • a “toxin” can be any agent that is detrimental to cells or that can damage or kill cells.
  • toxin include, without limitation, taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicm, doxorubicin, daunorubicin, dihydroxy anthracin dione, mitoxantrone, mithramycin, actinomycin D, 1 -dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, puromycin and analogs thereof, antimetabolites (e.g., methotrexate, 6-mercaptopurine, 6-thioguanine, cytarabine, 5 -fluorouracil decarbazine), alkylating agents (e.g., mechlorethyl,
  • detectable label may include a fluorescent labels (e.g. fluorescein, rhodamine, dansyl, phycoerythrin, or Texas Red), enzyme-substrate labels (e.g. horseradish peroxidase, alkaline phosphatase, luceriferases, glucoamylase, digoxigenin, biotin/ avidin, a DNA molecule or gold for detection.
  • fluorescent labels e.g. fluorescein, rhodamine, dansyl, phycoerythrin, or Texas Red
  • enzyme-substrate labels e.g. horseradish peroxidase, alkaline phosphatase, luceriferases, glucoamylase, digoxigenin, biotin/ avidin, a DNA molecule or gold for detection.
  • the conjugate can be a pharmacokinetic modifying moiety which helps increase half-life of the antibody.
  • pharmacokinetic modifying moiety include water-soluble polymers, such as PEG, carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinyl pyrrolidone, copolymers of ethylene glycol/propylene glycol, and the like.
  • the polymer may be of any molecular weight, and may be branched or unbranched.
  • the number of polymers attached to the antibody may vary, and if more than one polymer are attached, they can be the same or different molecules.
  • the conjugate can be a purification moiety such as a magnetic bead.
  • the antibodies and/or antigen-binding fragments thereof provided herein is used for a base for a conjugate.
  • the present disclosure provides isolated polynucleotides that encode the anti-CD24 antibodies and antigen-binding fragments thereof.
  • the isolated polynucleotides comprise one or more nucleotide sequences as shown in SEQ ID NO: 51, SEQ ID NO: 53, SEQ ID NO: 55, SEQ ID NO: 57, SEQ ID NO: 59,
  • SEQ ID NO: 61 SEQ ID NO: 63, SEQ ID NO: 65, SEQ ID NO: 67, SEQ ID NO: 69,
  • DNA encoding the monoclonal antibody is readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the antibody).
  • the encoding DNA may also be obtained by synthetic methods.
  • the isolated polynucleotide that encodes the anti-CD24 antibodies and antigen-binding fragments thereof e.g. including the sequences in as shown in SEQ ID NO: 51, SEQ ID NO: 53, SEQ ID NO: 55, SEQ ID NO: 57, SEQ ID NO: 59, SEQ
  • SEQ ID NO: 102, SEQ ID NO: 110, SEQ ID NO: 204, SEQ ID NO: 205, SEQ ID NO: 206, SEQ ID NO: 207, SEQ ID NO: 208, SEQ ID NO: 209, SEQ ID NO: 210, SEQ ID NO: 211, SEQ ID NO: 212, SEQ ID NO: 213, SEQ ID NO: 214, SEQ ID NO: 215, SEQ ID NO: 216, SEQ ID NO: 217, SEQ ID NO: 218, SEQ ID NO: 219, SEQ ID NO: 228, SEQ ID NO: 229 and/or SEQ ID NO: 220) can be inserted into a vector for farther cloning (amplification of the DNA) or for expression, using recombinant techniques known in the art.
  • the vector components generally include, but are not limited to, one or more of the a signal sequence, an origin of repli cation, one or more marker genes, an enhancer element, a promoter (e.g. SV40, CMV, EF-la), and a transcription termination sequence.
  • a promoter e.g. SV40, CMV, EF-la
  • the vector system includes mammalian, bacterial, yeast systems, etc, and comprises plasmids such as, but not limited to, pALTER, pBAD, pcDNA, pCal, pL, pET, pGEMEX, pGEX, pCI, pCMV, pEGFP, pEGFT, pSV2, pFUSE, pVITRO,pVIVO, pMAL, pMD18-T, pMONO, pSELECT, pUNO, pDUO, Psg5L, pBABE, pWPXL, pBI, pTD, pRS420, pLexA, pACT2.2 etc, and other laboratorial and commercially available vectors.
  • Suitable vectors may include, plasmid, or viral vectors (e.g., replication defective retroviruses, adenoviruses and adeno-associated viruses).
  • Vectors comprising the polynucleotide sequence encoding the antibody or antigen-binding fragment can be introduced to a host cell for cloning or gene expression.
  • Suitable host cells for cloning or expressing the DNA in the vectors herein are the prokaryote, yeast, or higher eukaryote cells described above.
  • Suitable prokaryotes for this purpose include eubacteria, such as Gram-negative or Grampositive organisms, for example, Enterobacteriaceae such as Escherichia, e.g., E.
  • eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for anti-CD24 antibody-encoding vectors.
  • Saccharomyces cerevisiae or common baker's yeast, is the most commonly used among lower eukaryotic host microorganisms.
  • a number of other genera, species, and strains are commonly available and useful herein, such as Schizosaccharomyces pombe; Kluyveromyces hosts such as, e.g., K. lactis, K. fragilis (ATCC 12,424), K. bulgaricus (ATCC 16,045), K. wickeramii (ATCC 24,178), K.
  • waltii ATCC 56,500
  • K. drosophilarum ATCC 36,906
  • K. thermotolerans K. marxianus
  • yarrowia EP 402,226
  • Pichia pastoris EP 183,070
  • Candida Trichoderma reesia
  • Neurospora crassa Schwanniomyces such as Schwanniomyces occidentalis
  • filamentous fungi such as, e.g., Neurospora, Penicillium, Tolypocladium, and Aspergillus hosts such as A. nidulans and A. nig er.
  • Suitable host cells for the expression of glycosylated antibodies or antigenfragment provided here are derived from multicellular organisms.
  • invertebrate cells include plant and insect cells.
  • Numerous baculoviral strains and variants and corresponding permissive insect host cells from hosts such as Spodoptera frugiperda (caterpillar), Aedes aegypti (mosquito), Aedes albopictus (mosquito), Drosophila melanogaster (fruiffly), and Bombyx mori have been identified.
  • a variety of viral strains for transfection are publicly available, e.g,, the L-l variant of Autographa californica NPV and the Bm-5 strain of Bombyx mori NPV, and such viruses may be used as the virus herein according to the present invention, particularly for transfection of Spodoptera frugiperda cells.
  • Plant cell cultures of cotton, corn, potato, soybean, petunia, tomato, and tobacco can also be utilized as hosts.
  • vertebrate cells have been greatest in vertebrate cells, and propagation of vertebrate cells in culture (tissue culture) has become a routine procedure.
  • useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7, ATCC CRL 1651); human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al., J. Gen Virol. 36:59 ( 1977)); baby hamster kidney cells (BHK, ATCC CCL 10); Chinese hamster ovary cells/ - DHFR (CHO, Urlaub et al., Proc. Natl Acad. Sci. USA 77:4216 (1980)), mouse sertoli cells (TM4, Mather, Biol. Reprod.
  • SV40 monkey kidney CV1 line transformed by SV40
  • human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al., J. Gen Virol. 36:59 ( 1977)
  • baby hamster kidney cells
  • monkey kidney cells (CVl ATCC CCL 70); African green monkey kidney cells (VERO-76, ATCC CRL- 1587), human cervical carcinoma cells (HEL.A, ATCC CCL 2); canine kidney cells (MDCK, ATCC CCL 34); buffalo rat liver cells (BRL 3 A, ATCC CRL 1442); human lung cells (W138, ATCC CCL 75); human liver cells (Hep G2, HB 8065); mouse mammary tumor (MMT 060562, ATCC CCL51); TRI cells (Mather et al., Annals N.Y. Acad. Sci. 383:44-68 (1982)); MRC 5 cells; FS4 cells; and a human hepatoma line (Hep G2).
  • Host cells are transformed with the above-described expression or cloning vectors for anti-CD24 antibody production and cultured in conventional nutrient media modified as appropriate for inducing promoters, selecting transformants, or amplifying the genes encoding the desired sequences.
  • the antibody may be produced by homologous recombination known in the art.
  • the host cells used to produce the antibodies or antigen-binding fragments provided herein may be cultured in a variety of media.
  • Commercially available media such as Ham's F10 (Sigma), Minimal Essential Medium (MEM), (Sigma), RPMI- 1640 (Sigma), and Dulbecco's Modified Eagle's Medium (DMEM), Sigma) are suitable for culturing the host cells.
  • 4,767,704, 4,657,866; 4,927,762; 4,560,655; or 5,122,469; WO 90/03430; WO 87/00195; or U.S. Pat. Re. 30,985 may be used as culture media for the host cells. Any of these media may be supplemented as necessary with hormones and/or other growth factors (such as insulin, transferrin, or epidermal growth factor), salts (such as sodium chloride, calcium, magnesium, and phosphate), buffers (such as HEPES), nucleotides (such as adenosine and thymidine), antibiotics (such as drug), trace elements (defined as inorganic compounds usually present at final concentrations in the micromolar range), and glucose or an equivalent energy source. Any other necessary supplements may also be included at appropriate concentrations that would be known to those skilled in the art.
  • the culture conditions, such as temperature, pH, and the like, are those previously used with the host cell selected for expression, and will be apparent to the ordinarily skilled
  • the antibody can be produced intracellularly, in the periplasmic space, or directly secreted into the medium. If the antibody is produced intracellularly, as a first step, the particulate debris, either host cells or lysed fragments, is removed, for example, by centrifugation or ultrafiltration. Carter et al., Bio/Technology 10: 163-167 (1992) describe a procedure for isolating antibodies which are secreted to the periplasmic space of E. coli. Briefly, cell paste is thawed in the presence of sodium acetate (pH 3.5), EDTA, and phenylmethylsulfonylfluoride (PMSF) over about 30 min.
  • sodium acetate pH 3.5
  • EDTA EDTA
  • PMSF phenylmethylsulfonylfluoride
  • Cell debris can be removed by centrifugation.
  • supernatants from such expression systems are generally first concentrated using a commercially available protein concentration filter, for example, an Amicon or Millipore Pellicon ultrafiltration unit.
  • a protease inhibitor such as PMSF may be included in any of the foregoing steps to inhibit proteolysis and antibiotics may be included to prevent the growth of adventitious contaminants.
  • the anti-CD24 antibodies and antigen-binding fragments thereof prepared from the cells can be purified using, for example, hydroxylapatite chromatography, gel electrophoresis, dialysis, DEAE-cellulose ion exchange chromatography, ammonium sulfate precipitation, salting out, and affinity chromatography, with affinity chromatography being the preferred purification technique.
  • Protein A immobilized on a solid phase is used for immunoaffinity purification of the antibody and antigen-binding fragment, thereof.
  • the suitability of protein A as an affinity ligand depends on the species and isotype of any immunoglobulin Fc domain that is present in the antibody.
  • Protein A can be used to purify antibodies that are based on human gamma 1, gamma2, or gamma4 heavy chains (Lindmark et al., J. Immunol. Meth. 62:1-13 (1983)).
  • Protein G is recommended for all mouse isotypes and for human gamma3 (Guss et al., EMBO J. 5: 1567 1575 (1986)).
  • the matrix to which the affinity ligand is attached is most often agarose, but other matrices are available. Mechanically stable matrices such as controlled pore glass or poly(styrenedivinyl)benzene allow for faster flow rates and shorter processing times than can be achieved with agarose. Where the antibody comprises a CH3 domain, the Bakerbond ABX.TM. resin (J. T. Baker, Phillipsburg, N.J.) is useful for purification.
  • the mixture comprising the antibody of interest and contaminants may be subjected to low pH hydrophobic interaction chromatography using an elution buffer at a pH between about 2.5 -4.5, preferably performed at low salt concentrations (e.g., from about 0-0.25M salt).
  • the present disclosure also provides chimeric antigen receptor (CAR) comprising an antigen binding domain, a transmembrane domain, a costimulatory signaling region, and a TCR signaling domain, wherein the antigen binding domain specifically binds to CD24 and comprises an antigen binding fragment provided herein.
  • the antigen binding fragment is a Fab or a scFv.
  • the CAR provided herein is bispecific. The CAR is capable of further specifically binding to a second antigen other than CD24, or a second epitope on CD24,
  • the second antigen is a tumor antigen, tumor associated antigen, or an immune related target as mentioned above.
  • the TCR signaling domain can be selected from the group consisting of: an intracellular signal regions sequence of CD27, CD28, CD137, CD134, MyD88, CD40, CD278, TLRs, or a combination thereof.
  • the transmembrane region can comprise a transmembrane region of CD3, CD4, CDS or CD28.
  • the second antigen is an immunoinhibitory molecule, such as PD-L.1 ,
  • the present disclosure also provides a nucleic acid sequence encoding the CAR as mentioned above as well as a cell or a vector comprising such nucleic acid sequence or a cell genetically modified to express the CAR provided herein.
  • the cell can be an immune cell, optionally, wherein the immune cell is T lymphocyte, NK cell, monocyte, macrophage or NKT lymphocyte.
  • compositions comprising the anti-CD24 antibodies or antigen-binding fragments thereof and one or more pharmaceutically acceptable carriers.
  • Pharmaceutical acceptable carriers for use in the pharmaceutical compositions disclosed herein may include, for example, pharmaceutically acceptable liquid, gel, or solid carriers, aqueous vehicles, nonaqueous vehicles, antimicrobial agents, isotonic agents, buffers, antioxidants, anesthetics, suspending/dispending agents, sequestering or chelating agents, diluents, adjuvants, excipients, or non-toxic auxiliary substances, other components known in the art, or various combinations thereof
  • Suitable components may include, for example, antioxidants, fillers, binders, disintegrants, buffers, preservatives, lubricants, flavorings, thickeners, coloring agents, emulsifiers or stabilizers such as sugars and cyclodextrins.
  • Suitable antioxidants may include, for example, methionine, ascorbic acid, EDTA, sodium thiosulfate, platinum, catalase, citric acid, cysteine, thioglycerol, thioglycolic acid, thiosorbitol, butylated hydroxanisol, butylated hydroxytoluene, and/or propyl gallate.
  • compositions that comprise one or more antibodies or antigen-binding fragments as disclosed herein and one or more antioxidants such as methionine. Further provided are methods for preventing oxidation of. extending the shelf-life of, and/or improving the efficacy of an antibody or antigen-binding fragment as provided herein by mixing the antibody or antigen-binding fragment with one or more antioxidants such as methionine.
  • pharmaceutical acceptable carriers may include, for example, aqueous vehicles such as sodium chloride injection, Ringer's injection, isotonic dextrose injection, sterile water injection, or dextrose and lactated Ringer’s injection, nonaqueous vehicles such as fixed oils of vegetable origin, cottonseed oil, corn oil, sesame oil, or peanut oil, antimicrobial agents at bacteriostatic or fungistatic concentrations, isotonic agents such as sodium chloride or dextrose, buffers such as phosphate or citrate buffers, antioxidants such as sodium bisulfate, local anesthetics such as procaine hydrochloride, suspending and dispersing agents such as sodium carboxymethylcelluose, hydroxypropyl methylcellulose, or polyvinylpyrrolidone, emulsifying agents such as Polysorbate 80 (TWEEN-80), sequestering or chelating agents such as EDTA (ethylenediaminetetraacetic acid) or
  • Antimicrobial agents utilized as carriers may be added to pharmaceutical compositions in multiple-dose containers that, include phenols or cresols, mercurials, benzyl alcohol, chlorobutanol, methyl and propyl p-hydroxybenzoic acid esters, thimerosal, benzalkonium chloride and benzethonium chloride.
  • Suitable excipients may include, for example, water, saline, dextrose, glycerol, or ethanol.
  • Suitable non-toxic auxiliary substances may include, for example, wetting or emulsifying agents, pH buffering agents, stabilizers, solubility enhancers, or agents such as sodium acetate, sorbitan monolaurate, triethanolamine oleate, or cyclodextrin.
  • the pharmaceutical compositions can be a liquid solution, suspension, emulsion, pill, capsule, tablet, sustained release formulation, or powder.
  • Oral formulations can include standard carriers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, polyvinyl pyrollidone, sodium saccharine, cellulose, magnesium carbonate, etc.
  • the pharmaceutical compositions are formulated into an injectable composition.
  • the injectable pharmaceutical compositions may be prepared in any conventional form, such as for example liquid solution, suspension, emulsion, or solid forms suitable for generating liquid solution, suspension, or emulsion.
  • Preparations for injection may include sterile and/or non-pyretic solutions ready for injection, sterile dry soluble products, such as lyophilized powders, ready to be combined with a solvent just prior to use, including hypodermic tablets, sterile suspensions ready for injection, sterile dry insoluble products ready to be combined with a vehicle just prior to use, and sterile and/or non-pyretic emulsions.
  • the solutions may be either aqueous or nonaqueous.
  • unit-dose parenteral preparations are packaged in an ampoule, a vial or a syringe with a needle. All preparations for parenteral administration should be sterile and not pyretic, as is known and practiced in the art.
  • a sterile, lyophilized powder is prepared by dissolving an antibody or antigen-binding fragment as disclosed herein in a suitable solvent.
  • the solvent may contain an excipient which improves the stability or other pharmacological components of the powder or reconstituted solution, prepared from the powder. Excipients that may be used include, but are not limited to, water, dextrose, sorbital, fructose, corn syrup, xylitol, glycerin, glucose, sucrose or other suitable agent.
  • the solvent may contain a buffer, such as citrate, sodium or potassium phosphate or other such buffer known to those of skill in the art at, in one embodiment, about neutral pH.
  • the resulting solution will be apportioned into vials for lyophilization.
  • Each vial can contain a single dosage or multiple dosages of the anti-CD24 antibody or antigen-binding fragment thereof or composition thereof. Overfilling vials with a small amount above that needed for a dose or set of doses (e.g., about 10%) is acceptable so as to facilitate accurate sample withdrawal and accurate dosing.
  • the lyophilized powder can be stored under appropriate conditions, such as at about 4 °C to room temperature.
  • Reconstitution of a lyophilized powder with water for injection provides a formulation for use in parenteral administration.
  • the sterile and/or non-pyretic water or other liquid suitable carrier is added to lyophilized powder. The precise amount depends upon the selected therapy being given, and can be empirically determined.
  • the present disclosure also provides therapeutic methods comprising: administering a therapeutically effective amount of the antibody or antigen-binding fragment as provided herein to a subject in need thereof, thereby treating or preventing a CD24-related disease or condition.
  • the CD24-related disease or condition is cancer, autoimmune disease, inflammatory disease, adaptive immune disease or infectious disease.
  • cancer examples include but are not limited to, non-small cell lung cancer (squamous/nonsquamous), small cell lung cancer, renal cell cancer, colorectal cancer, colon cancer, ovarian cancer, breast cancer (including basal breast carcinoma, ductal carcinoma and lobular breast carcinoma), pancreatic cancer, gastric carcinoma, bladder cancer, esophageal cancer, mesothelioma, melanoma, head and neck cancer, thyroid cancer, sarcoma, prostate cancer, glioblastoma, cervical cancer, thymic carcinoma, melanoma, myelomas, mycoses fungoids, merkel cell cancer, hepatocellular carcinoma (HCC), fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma, osteogenic sarcoma, and other sarcomas, synovioma, mesothelioma, Ewing's tumor, leiomyosar
  • CNS lymphoma spinal axis tumor
  • brain stem glioma astrocytoma, medulloblastoma, craniopharyogioma, ependymoma, pinealoma, hemangioblastoma, acoustic neuroma, oligodendroglioma, menangioma, melanoma, neuroblastoma and retinoblastoma.
  • the cancer is lung cancer, bronchial cancer, bone cancer, liver and bile duct cancer, pancreatic cancer, breast cancer, liver cancer, ovarian cancer, testicle cancer, kidney cancer, bladder cancer, head and neck cancer, spine cancer, brain cancer, cervix cancer, uterine cancer, endometrial cancer, colon cancer, colorectal cancer, rectal cancer, anal cancer, esophageal cancer, gastrointestinal cancer, skin cancer, prostate cancer, pituitary cancer, stomach cancer, vagina cancer, thyroid cancer, glioblastoma, astrocytoma, melanoma, myelodysplastic syndrome, sarcoma, teratoma, adenocarcinoma, leukemia, myeloma and lymphoma.
  • the cancer is chemoresistant.
  • the disease or condition is hematological cancer chosen from B-cell lymphomas.
  • B-cell lymphomas includes but not limited to, Hodgkin's lymphoma, non-Hodgkin's lymphoma (NHL), acute lymphocytic leukemia (ALL), acute myeloid leukemia (AML), chronic lymphocytic leukemia (CLL), chronic myelogenous leukemia (CML), multiple myeloma (MM), diffuse large B cell lymphoma (DLBCL), Marginal zone B-cell lymphoma (MZL), Mantle cell lymphoma (MCL), Richter's syndrome, Burkitt's lymphoma or follicular lymphoma.
  • NHL non-Hodgkin's lymphoma
  • ALL acute lymphocytic leukemia
  • AML acute myeloid leukemia
  • CLL chronic lymphocytic leukemia
  • CML chronic myelogenous leukemia
  • MM multiple mye
  • Autoimmune diseases include, but are not limited to, Acquired Immunodeficiency Syndrome (AIDS, which is a viral disease with an autoimmune component), alopecia areata, ankylosing spondylitis, antiphospholipid syndrome, autoimmune Addison's disease, autoimmune hemolytic anemia, autoimmune hepatitis, autoimmune inner ear disease (AIED), autoimmune lymphoproliferative syndrome (ALPS), autoimmune thrombocytopenic purpura (ATP), Behcet's disease, cardiomyopathy, celiac sprue-dermatitis hepetiformis; chronic fatigue immune dysfunction syndrome (CFIDS), chronic inflammatory demyelinating polyneuropathy (CIPD), cicatricial pemphigoid, cold agglutinin disease, crest syndrome, Crohn's disease, Degos' disease, dermatomyositis-juvenile, discoid lupus, essential mixed cryoglobulinemia, fibromyalg
  • Inflammatory' disorders include, for example, chronic and acute inflammatory' disorders.
  • inflammatory disorders include Alzheimer's disease, asthma, atopic allergy, allergy, atherosclerosis, bronchial asthma, eczema, glomerulonephritis, graft vs. host disease, hemolytic anemias, osteoarthritis, sepsis, stroke, transplantation of tissue and organs, vasculitis, diabetic retinopathy and ventilator induced lung injury.
  • the CD24 associated conditions are inflammatory' diseases such as systemic lupus erythematosus (SLE), intestinal mucosal inflammation, wasting disease associated with colitis, multiple sclerosis, viral infections, rheumatoid arthritis, osteoarthritis, Cohn's disease, and inflammatory' bowel disease, psoriasis, systemic scleroderma, autoimmune diabetes and the like.
  • SLE systemic lupus erythematosus
  • intestinal mucosal inflammation wasting disease associated with colitis
  • multiple sclerosis multiple sclerosis
  • viral infections rheumatoid arthritis
  • osteoarthritis osteoarthritis
  • Cohn's disease inflammatory' bowel disease
  • psoriasis systemic scleroderma
  • autoimmune diabetes autoimmune diabetes and the like.
  • Infectious disease include, but are not limited to, fungus infection, parasite/protozoan infection or chronic viral infection, for example, malaria, coccidioiodmycosis immitis, histoplasmosis, onychomycosis, aspergilosis, blastomycosis, candidiasis albicans, paracoccidioiomycosis, microsporidiosis, Acanthamoeba keratitis, Amoebiasis, Ascariasis, Babesiosis, Balantidiasis, Baylisascariasis, Chagas disease, Clonorchiasis, Cochliomyia, Cryptosporidiosis, Diphyllobothriasis, Dracunculiasis, Echinococcosis, Elephantiasis, Enterobiasis, Fascioliasis, Fasciolopsiasis, Filariasis, Giard
  • the subject is human.
  • methods are provided to treat a disease or condition in a subject that would benefit from modulation of CD24 activity, comprising administering a therapeutically effective amount of the antibody or antigen-binding fragment as provided herein to a subject in need thereof
  • disease or condition as used herein can be used interchangeably with the term “CD24-related disease or condition”.
  • an antibody or antigen-binding fragment as provided herein will depend on various factors known in the art, such as for example body weight, age, past medical history, present medications, state of health of the subject and potential for cross-reaction, allergies, sensitivities and adverse side-effects, as well as the administration route and extent of disease development. Dosages may be proportionally reduced or increased by one of ordinary skill in the art (e.g., physician or veterinarian) as indicated by these and other circumstances or requirements.
  • an antibody or antigen-binding fragment as provided herein may be administered at a therapeutically effective dosage of about 0.01 mg/kg to about. 100 mg/kg (e.g., about 0.01 mg/kg, about 0.5 mg/kg, about 1 mg/kg, about 2 mg/kg, about 3 mg/kg, about 5 mg/kg, about 10 mg/kg, about 15 mg/kg, about 20 mg/kg, about 25 mg/kg, about 30 mg/kg, about 35 mg/kg, about 40 mg/kg, about 45 mg/kg, about 50 mg/kg, about 55 mg/kg, about 60 mg/kg, about 65 mg/kg, about 70 mg/kg, about 75 mg/kg, about 80 mg/kg, about 85 mg/kg, about 90 mg/kg, about 95 mg/kg, or about 100 mg/kg).
  • 100 mg/kg e.g., about 0.01 mg/kg, about 0.5 mg/kg, about 1 mg/kg, about 2 mg/kg, about 3 mg/kg, about 5 mg/kg, about 10 mg/kg, about 15
  • the antibody or antigen-binding fragment is administered at a dosage of about 50 mg/kg or less, and in certain of these embodiments the dosage is 10 mg/kg or less, 5 mg/kg or less, 3 mg/kg or less, 1 mg/kg or less, 0.5 mg/kg or less, or 0.1 mg/kg or less.
  • the administration dosage may change over the course of treatment. For example, in certain embodiments the initial administration dosage may be higher than subsequent administration dosages. In certain embodiments, the administration dosage may vary over the course of treatment depending on the reaction of the subject.
  • Dosage regimens may be adjusted to provide the optimum desired response (e.g., a therapeutic response). For example, a single dose may be administered, or several divided doses may be administered over time.
  • the antibodies and antigen-binding fragments disclosed herein may be administered by any route known in the art, such as for example parenteral (e.g., subcutaneous, intraperitoneal, intravenous, including intravenous infusion, intramuscular, or intradermal injection) or non-parenteral (e.g., oral, intranasal, intraocular, sublingual, rectal, or topical) routes.
  • parenteral e.g., subcutaneous, intraperitoneal, intravenous, including intravenous infusion, intramuscular, or intradermal injection
  • non-parenteral e.g., oral, intranasal, intraocular, sublingual, rectal, or topical
  • the antibodies or antigen-binding fragments disclosed herein may be administered alone or in combination with one or more additional therapeutic means or agents.
  • the antibodies or antigen-binding fragments disclosed herein may be administered alone or in combination with a second therapeutic agent.
  • the antibodies or antigenbinding fragments disclosed herein may be administered in combination with a second therapeutic agent, for example, a chemotherapeutic agent or an anti-cancer drug.
  • the antibodies or antigen-binding fragments disclosed herein may be administered in combination with with an antagonist of one or more immunoinhibitory molecule, e.g., CD47, SIRPa, PD-L1, or the beta-2 microglobulin subunit of the major histocompatibility class I complex (B2M).
  • an antagonist of one or more immunoinhibitory molecule e.g., CD47, SIRPa, PD-L1, or the beta-2 microglobulin subunit of the major histocompatibility class I complex (B2M).
  • the term “antagonist” as used herein comprises can refer to any small molecule, small or micro RNAs, or antibodies or antigen-binding fragments thereof that blocks or inhibits binding of CD47, SIRPa, PD-L1 or B2M to their respective binding partners so as to prevent elicit of immunoinhibitory signals.
  • the antibodies or antigen-binding fragments disclosed herein is administered in combination with a CD47 antagonist, such as a SIRPa-Fc fusion protein or variant thereof, an anti-CD47 antibody or antigen-binding fragment thereof.
  • a CD47 antagonist such as a SIRPa-Fc fusion protein or variant thereof, an anti-CD47 antibody or antigen-binding fragment thereof.
  • the antibodies or antigen-binding fragments disclosed herein is administered in combination with a SIRPa antagonist, such as a soluble CD47 or variant thereof, an anti-SIRPa antibody or an antigen-binding fragment thereof.
  • anti-CD47 antibody can refer to any known anti-CD47 antibodies or antigen-binding fragment thereof, including without limitation, Hu5F9 as disclosed in US9382320B2.
  • Hu5F9-G4 is also used, which is an anti-human CD47 antibody and was humanized by grafting its complementarity determining regions (CDRs) onto a human IgG4 format and results in the humanized 5F9 antibody (Hu5F9-G4) (Liu J. et al., PLoS One, 2015, 10: e0137345).
  • an antibody or antigen-binding fragment as disclosed herein that is administered in combination with one or more additional therapeutic agents may be administered simultaneously with the one or more additional therapeutic agents, and in certain of these embodiments the antibody or antigen-binding fragment and the additional therapeutic agent(s) may be administered as part of the same pharmaceutical composition.
  • an antibody or antigenbinding fragment administered “in combination” with another therapeutic agent does not have to be administered simultaneously with or in the same composition as the agent.
  • An antibody or antigen-binding fragment administered prior to or after another agent is considered to be administered “in combination” with that agent as the phrase is used herein, even if the antibody or antigen-binding fragment and second agent are administered via different routes.
  • additional therapeutic agents administered in combination with the antibodies or antigen-binding fragments disclosed herein are administered according to the schedule listed in the product information sheet of the additional therapeutic agent, or according to the Physicians' Desk Reference 2003 (Physicians' Desk Reference, 57th Ed; Medical Economics Company; ISBN: 1563634457; 57th edition (November 2002)) or protocols well known in the art.
  • the present disclosure provides methods of detecting presence or amount of CD24 in a sample, comprising contacting the sample with the antibody or antigen-binding fragment thereof, and determining the presence or the amount of CD24 in the sample.
  • the present disclosure provides methods of diagnosing a CD24 related disease or condition in a subject, comprising: a) obtaining a sample from the subject; b) contacting the sample obtained from the subject with the antibody or antigen-binding fragment thereof provided herein; c) determining presence or amount of CD24 in the sample; and d) correlating the existence of the CD24 to the CD24 related disease or condition in the subject.
  • the present disclosure also provides use of the antibody or antigen-binding fragment thereof provided herein in the manufacture of a medicament for treating a CD24 related disease or condition in a subject, in the manufacture of a diagnostic reagent for diagnosing a CD24 related disease or condition.
  • the present disclosure also provides a method of modulating CD24 activity in a CD24-expressing cell, comprising exposing the CD24- expressing cell to the antibody or antigen-binding fragment thereof provided herein.
  • the present disclosure also provides a method of detecting presence or amount of CD24 in a sample, comprising contacting the sample with the antibody or antigen-binding fragment thereof provided herein, and determining the presence or the amount of CD24 in the sample.
  • the present disclosure also provides a method of diagnosing a CD24 related disease or condition in a subject, comprising: a) obtaining a sample from the subject; b) contacting the sample obtained from the subject with the antibody or antigen-binding fragment thereof provided herein; c) determining presence or amount of CD24 in the sample; and d) correlating the presence or the amount of CD24 to existence or status of the CD24 related disease or condition in the subject.
  • the present disclosure also provides use of the antibody or antigen-binding fragment thereof provided herein in the manufacture of a medicament for treating a CD24 related disease or condition in a subject.
  • the medicament can further comprise a second therapeutic agent, e.g., a CD47 antagonist, optionally, wherein the CD47 antagonist is a SIRPa-Fc fusion protein or variant thereof, or an anti-CD47 antibody or antigen-binding fragment thereof.
  • a second therapeutic agent e.g., a CD47 antagonist, optionally, wherein the CD47 antagonist is a SIRPa-Fc fusion protein or variant thereof, or an anti-CD47 antibody or antigen-binding fragment thereof.
  • the present disclosure also provides use of the antibody or antigen-binding fragment thereof provided herein in the manufacture of a diagnostic reagent for diagnosing a CD24 related disease or condition.
  • the present disclosure also provides a kit comprising the antibody or antigen-binding fragment thereof provided herein, useful in detecting CD24, optionally recombinant CD24, CD24 expressed on cell surface, or CD24- expresing cells.
  • kit comprising the antibody or antigen-binding fragment thereof provided herein, useful in detecting CD24, optionally recombinant CD24, CD24 expressed on cell surface, or CD24- expresing cells.
  • recombinant refers to artificial manipulation of one or more biological molecules such as polynucleotide or polypeptide molecules using one or more molecular biology techniques to make such biological molecule(s) into something other than its natural state.
  • the present disclosure also provides a method for stimulating a T cell-mediated immune response to a CD24-expressing cell or tissue in a mammal, the method comprising administering to the mammal an effective amount of a cell genetically modified to express the CAR comprising an antigen binding domain, a transmembrane domain, a costimulatory signaling region, and a TCR signaling domain, wherein the antigen binding domain specifically binds to CD24 and comprises an antigen binding fragment provided herein.
  • the antigen binding fragment is a Fab or a scFv.
  • the CAR provided herein is bispecific.
  • the CAR is capable of further specifically binding to a second antigen other than CD24 or a second epitope on CD24.
  • the second antigen is a tumor antigen as mentioned above.
  • the TCR signaling domain can be selected from the group consisting of: an intracellular signal region sequence of CD27, CD28, CD137, CD134, MyD88, CD40, CD278, TLRs, or a combination thereof.
  • the transmembrane region can comprise a transmembrane region of CD3, CD4, CD8 or CD28.
  • the second antigen is an immunoinhibitory molecule, e.g., PD-L1, CD47 or B2M.
  • the present disclosure also provides method for treating a mammal having a CD24 related disease or condition, comprising administering to the mammal an effective amount of a cell that is genetically modified to express the CAR provided herein (e.g., an autologous T cell), thereby treating the mammal.
  • the CD24 related disease or condition is cancer.
  • the mammal is a human subject.
  • mice were immunized as shown in Table 2. The primary immunization were followed by several boosts until animals developed satisfactory' antiserum titers suitable for hybridoma development. All the immunization strategies were carried out in parallel in order to compare the performance and immune response in serum level.
  • Test bleeds were performed and evaluated by testing using FACS on 293F cell line stably over-expressing human CD24 (293F-hCD24) and MCF7 cells.
  • Fusion Splenocyte fusions were performed on the mice which responded the best to the immunizations as determined by test bleed FACS. The lymphocytes from spleens and lymph nodes were fused to a cell line using an optimized electrofusion protocol. Multiple fissions were performed to ensure success of the project.
  • Hybridomas of interest were chosen to proceed to subcloning.
  • Subcloning The parental hybridomas with desired reactivity and isotypes from the screening tunnel above were then subcloned by multiple rounds of limiting dilution or single cell sorting until mono-clones are obtained.
  • Cryopreservation- The desired sub-clonal cell lines were sequenced and further expanded into culture flasks for cryopreservation. 4-6 vials per cell line at 0.5- were initially cryopreserved. Master cell bank and working cell bank could be established for the selected most valuable cell lines if desired.
  • EXAMPLE 2 Antibody characterization: Affinity
  • the protocol for FACs analysis is described as follows: a. Digested cells using TrypLETM Express Enzyme (IX); Centrifuged the harvested cells at 400g for 5 min and discarding the supernatant. b. Washed the cells 2 times with cold FACS buffer by centrifuging at 400g for 5 min and discarding the supernatant. c. Resuspended the cells, and 2*10 5 cell/well was seeded into the assay plate in 50ul FACS buffer, then added 50pl primary antibody (primary antibody final concentration: 50.00, 16.67, 5.56, 1.85, 0.62, 0.21, 0.07, 0.02, 0.01, Incubate at 40°C for Ih. d. Washed the cells twice by using the condition in step b.
  • Resuspended the cells with diluted 2nd antibody incubated at 4 degree for Ih in the dark. e. Washed the cells twice by using the condition in step b. Resuspended the cells with cold FACS buffer. Kept the cells in dark for FACS analysis.
  • Table 10 shows binding affinity of the antibodies on 293F cells, 293F- hCD24, breast cancer cells (MCF7, MDA-MB-468), bladder cancer cells (5637), chronic myelocytic leukemia cells (Nalml), CKOK1 cells, CKOKl-hCD24 cells, colorectal cancer cells (HT29), ovarian cancer cells (SKOV3), and Lung carcinoma cells (H1975 and A549).
  • Prefix “ch-” means chimeric, wherein hlgGl represents heavy chain constant region of human IgGl isotype, and h!gG4 represents heavy chain constant region of human IgG4 isotype.
  • FIGs. 1J-1R show binding affinity of the antibodies on acute lymphoblastic leukemia cells (Nahn6), B cell lymphoma cells (SU-DHL6 and DoFIH2), human B cells, colorectal cancer cells (H T29), hepatocellular carcinoma cells (Huh7), breast cancer cells (MCF7) and lung carcinoma cells (NCI-H1975 and A549).
  • Monocytes were separated from PBMC using human CD14 Positive selection kit II (StemCell, 17858).
  • Monocyte-derived macrophages (MDMs) were induced by culturing the monocytes for 7 days in RPMI 1640 medium supplemented with 10% FBS and 100 ng/niL rhM-CSF; Replaced half of the medium and supply cytokines every 3 to 4 days. Add 100 ng/mL and rhIL-10 and culture for additional 5 days; Replaced half of the medium and add cytokines every 3 to 4 days.
  • HT-29 cells (a human colorectal adenocarcinoma cell line) were labeled with fluorescence enhancing ligand (CFSE, Invitrogen, C34554) according to operational manuscript (Label and incubate for 20 min at 37 °C in a cell incubator). Seed 40,000 cells/well in 100 pL to 96 wells U- bottom sterile plate (Coming, cat: 3894). After that, added 50 pL serial diluted antibodies listed in Table 6 to each well and incubated the plate at 37°C 5% CO2 for 2 hr.
  • fluorescence enhancing ligand CFSE, Invitrogen, C34554
  • harvested MDM cells and re-suspended in RPMI1640 medium (Gibco, Abovementioned MDM cells were disassociated by trypsin and resuspended in complete 1640 medium at 10 6 cells/mL. (40000 cells) as mentioned were supplied into each well of the assay plate. After 2 hours incubation in washed the cell mixture and stained the cells with Washed the cells and analyzed the samples with flow cytometer.
  • phagocytosis index (number of macrophages containing engulfed cells/total number of counted macrophages) on HT-29 cells, and four of them showed compared with bench mark antibody, SN3 (Table 11, FIG. 2).
  • the phagocytosis assay was performed following the method above-mentioned.
  • the effector to target cell ratio (E:T) (E/T ratio) of Macrophage and tumor cells was 1 : 1.
  • chimeric antibodies also enhanced the phagocytosis effect on HEK293F cells that over-express hCD24 as well as on the colorectal cancers (CRC) cell line HT-29. Some showed higher max phagocytosis index on these cells, and some showed much stronger EC50 compared with the reference antibody, SN3. hlgGl typed chimeric antibody induced ADCP so that much better phagocytosis effect could be detected (Table 11, FIG. 2). [000517] Combination of anti-CD47 with our anti-CD24 chimeric antibodies (chAbl 10D4G4, chAbl l lF3A2 and F8) were tested. HT29 colorectal tumor cells were selected as the target cells.
  • IgG-scFv format bispecific antibody was constructed with a and Hu5F9 derived scFv, comprising two heavy chains in the format of VH-CHl-Hinge-CH2-CH3-spacer-scFv, associated with a light chain in the format of VL-CL, respectively. Affinity of this bispecific antibody was tested and then the phagocytosis assays was performed too (see FIG. 4). AH the antibody concentration was set as which was enough for the max phagocytosis. The E/T ratio was set as 1 :5 and 1 : 1.
  • Bispecific antibody showed improved phagocytosis compared with hu5F9 and the combo group showed almost 100% phagocytosis when the E/T ratio was 1 :5.
  • the bispecific antibody, as well as the Combo of anti-CD24 and anti-CD47 antibodies was tested by phagocytosis assay.
  • the max index could reach 85% when the E/T ratio was 1:1 as the assays before, and 98% with a E/T ratio of 1:5.
  • Bispecific antibody showed very good potency of phagocytosis.
  • Humanization of 81A1F8 and 101H9G9A2 was carried out with the following steps: 1) modelling of the mouse antibody VH and VL domains, 2) alignment with a range of preferred human germline sequences; 3) assessment of conflicts between non-human CDRs and human FRs and design of back mutations to prevent a loss of affinity in the final products; and 4) CDR grafting onto preferred germline backbones. 5 different humanized sequences were generated, followed by cloning and small-scale production of all humanized variants and chimeric in mammalian expression system.
  • EXAMPLE 5 Humanized antibody characterization: Affinity [000525] Briefly, HT-29 or Nalm6 cells were washed three times using PBS and firstly incubated with humanized variants. After three times washing, secondary antibody was incubated with cells. MFI of the samples was analyzed with Flow Cytometry and cells-based affinity was calculated.
  • HT-29, Nalm6, HEK293T-hCD24 and MCF7-hCD24 cells were digested with neuraminidase or de-glycosylation mix kit.
  • 81A1F8 and 110D4G4 kept the affinity against target cells and the MFI signal did not decline. decreased heavily after target cells treated with neuraminidase or de-glycosylation mix as shown in FIG. 6 A and FIG. 6B.
  • Bench mark antibody SN3 also recognized a glycosylation epitope which was reported before. As shown in FIG. 6C and FIG. 6D,
  • EXAMPLE 8 ELISA based receptor binding assay for 81A1F8
  • EXAMPLE 9 In vitro efficacy assays for 81A1F8 and its humanized variants [000540] 1. Phagocytosis assay
  • a & B Phagocytosis of target tumor cells (HT-29 and Nalm6) was performed using anti-CD24 mAbs (hIgG4 Fc) and bench mark antibody SWA 11 as well as anti-CD47 mAb 5F9-IgG4. The results were shown in FIG. 9A and FIG. 9B,
  • D 81AlF8-hIgG4 chimeric antibody also enhanced the phagocytosis effect of anti-CD47 antibody hu5F9 when administered in combination (see FIG. 9D).
  • ADCC effects of 81A1F8 and its humanized variants were tested on target cell HT-29.
  • HT-29 cells were incubated with PBMC.
  • Different concentrations of 81A1F8 as well as humanized variants 81 A 1 F8- 1141 and 81A1F8-2141 were added to samples. Lysis of target cells were tested via LDH kit.
  • ADCC effect could only be induced by hlgGl iso-typed antibodies.
  • B CDC effects of 81 A1F8 and its humanized variants was tested on target cell hCD24-MCF7. Different concentrations of antibodies were incubated with target cells and complement system. As shown in FIG 10B, over 90% lysis of target cells could be detected at high concentrations of 81A1F8 antibody variants.
  • EXAMPLE 10 In vivo efficacy assays of anti-CD24 antibodies
  • FIG. 11B Summary of the in vivo efficacy test was shown in FIG. 11C.
  • Tumor infiltrating lymphocytes were isolated from tumor tissue and analyzed via flow cytometry.
  • FIG. showed CD8/CD4 ratio, as well as M1/M2 macrophage ratio increased a lot when treated with the combination of 81 AlF8-hIgG4 and Oxaliplatin, as compared to control (CTRL).
  • a rechallenge assay was performed by inoculating MC38-Hcd24 cells again and tumors could grow up. However, no tumors relapsed again in treatment groups, showing that immune memory formed after 81 A1F8 treatment
  • FIG. 12C showed tumor growth curves for each mouse treated with vehicle control or
  • FIG, 12D showed summary for the in vivo efficacy of tested. Briefly, MC38-hCD24 tumor cells were inoculated. When average tumor volume reached mice were grouped and treated with single agent or combination strategy. The tumor inhibitory effect of the tested humanized 81A1F8 (81AlF8-2141-mIgG2a) was shown in FIG. 13 A - FIG. 13C, wherein FIG. 13 A showed the tumor growth curve after the administration of drugs, FIG. 13B showed the tumor growth curve for each mouse of the treatment group, and FIG. 13C showed the Summary for the in vivo efficacy of 81 A1F8-2141 -mIgG2a.
  • FIG. 13 A showed the tumor growth curve after the administration of drugs
  • FIG. 13B showed the tumor growth curve for each mouse of the treatment group
  • FIG. 13C showed the Summary for the in vivo efficacy of 81 A1F8-2141 -mIgG2a.
  • FIG. 14A - FIG. 14C The tumor inhibitory effect of the tested 101H9G9A2-mIgG2a and humanized 81A1F8 (81 AlF8-2141-mIgG2a) was shown in FIG. 14A - FIG. 14C, wherein FIG. 14A showed the tumor volume curve of the mice that were grouped as shown, FIG. 14B showed the body weight of the mice, and FIG. 14C showed the summary of the efficacy of different treatment.
  • FIG. 16A showed the results from the phagocytosis assay of anti-cmCD24 antibodies provided herein
  • FIG. 16B showed the ADCC effect of the anti-cmCD24 antibodies provided herein
  • FIG. 16C showed the CDC effect of the anti-cmCD24 antibodies provided herein.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Public Health (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Engineering & Computer Science (AREA)
  • Cell Biology (AREA)
  • Urology & Nephrology (AREA)
  • Biomedical Technology (AREA)
  • Hematology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Zoology (AREA)
  • Toxicology (AREA)
  • Microbiology (AREA)
  • Food Science & Technology (AREA)
  • Analytical Chemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Biotechnology (AREA)
  • Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Organic Low-Molecular-Weight Compounds And Preparation Thereof (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicinal Preparation (AREA)
PCT/US2022/015711 2021-02-08 2022-02-08 Novel anti-cd24 antibodies Ceased WO2022170280A2 (en)

Priority Applications (10)

Application Number Priority Date Filing Date Title
IL304898A IL304898A (en) 2021-02-08 2022-02-08 New anti-CD24 antibodies
JP2023547592A JP2024508672A (ja) 2021-02-08 2022-02-08 新規抗cd24抗体
CA3210934A CA3210934A1 (en) 2021-02-08 2022-02-08 Novel anti-cd24 antibodies
MX2023009238A MX2023009238A (es) 2021-02-08 2022-02-08 Nuevos anticuerpos anti-cd24.
US18/264,436 US20240052052A1 (en) 2021-02-08 2022-02-08 Novel anti-cd24 antibodies
CN202280013601.9A CN117412770A (zh) 2021-02-08 2022-02-08 新颖抗cd24抗体
AU2022217072A AU2022217072A1 (en) 2021-02-08 2022-02-08 Novel anti-cd24 antibodies
EP22750598.9A EP4288099A4 (en) 2021-02-08 2022-02-08 NEW ANTI-CD24 ANTIBODIES
KR1020237030578A KR20230143177A (ko) 2021-02-08 2022-02-08 신규한 항-cd24 항체
CONC2023/0011463A CO2023011463A2 (es) 2021-02-08 2023-08-29 Nuevos anticuerpos anti-cd24

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
CN2021076075 2021-02-08
CNPCT/CN2021/076075 2021-02-08
CN202210088172 2022-01-25
CN202210088172.3 2022-01-25

Publications (2)

Publication Number Publication Date
WO2022170280A2 true WO2022170280A2 (en) 2022-08-11
WO2022170280A3 WO2022170280A3 (en) 2022-09-09

Family

ID=82741874

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2022/015711 Ceased WO2022170280A2 (en) 2021-02-08 2022-02-08 Novel anti-cd24 antibodies

Country Status (12)

Country Link
US (1) US20240052052A1 (enExample)
EP (1) EP4288099A4 (enExample)
JP (1) JP2024508672A (enExample)
KR (1) KR20230143177A (enExample)
CN (1) CN117412770A (enExample)
AU (1) AU2022217072A1 (enExample)
CA (1) CA3210934A1 (enExample)
CO (1) CO2023011463A2 (enExample)
IL (1) IL304898A (enExample)
MX (1) MX2023009238A (enExample)
TW (1) TW202241956A (enExample)
WO (1) WO2022170280A2 (enExample)

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024251257A1 (en) * 2023-06-09 2024-12-12 TJ Biopharma (Shanghai) Co., Ltd. Anti-cd24 antibodies and uses thereof
WO2025093886A1 (en) 2023-11-01 2025-05-08 Cambridge Enterprise Limited Therapeutic use of an anti-cd24 antibody
WO2025101970A1 (en) * 2023-11-08 2025-05-15 Pheast Therapeutics, Inc. Cd24 antibodies
WO2025128830A1 (en) * 2023-12-12 2025-06-19 The Methodist Hospital Therapeutic lilrb regulation for treating neurological disorders
WO2025132836A1 (en) * 2023-12-19 2025-06-26 Pentixapharm Ag Antibodies against cd24
WO2025159754A1 (en) * 2024-01-25 2025-07-31 China Medical University Therapeutic cd24 humanized monoclonal antibodies and anti-tumor translational use
WO2025218729A1 (en) * 2024-04-17 2025-10-23 TJ Biopharma (Shanghai) Co., Ltd. Multifunctional molecules targeting cd24

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN119161485B (zh) * 2024-10-29 2026-03-24 上海中医药大学附属曙光医院 靶向GFRα3的抗体及其制备方法和在抗癌中的应用

Family Cites Families (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20080002341A (ko) * 2006-06-30 2008-01-04 재단법인서울대학교산학협력재단 Cd24를 표적으로 하는 암 억제방법
WO2009063461A1 (en) * 2007-11-14 2009-05-22 The Medical Research, Infrastructure, And Health Services Fund Of The Tel Aviv Medical Center Methods of treating cancer using anti cd24 antibodies
CN106456748A (zh) * 2014-01-08 2017-02-22 小利兰·斯坦福大学托管委员会 小细胞肺癌的靶向疗法
CN106456749B (zh) * 2014-03-11 2021-03-30 小利兰·斯坦福大学托管委员会 抗SIRPα抗体和双特异性巨噬细胞增强型抗体
US10239950B2 (en) * 2014-04-28 2019-03-26 Medicinal Chemistry Pharmaceuticals, Co., Ltd. Anti-MUC1 antibody or antigen-binding fragment thereof and uses thereof
US20170158753A1 (en) * 2014-06-25 2017-06-08 Integrated Biotherapeutics, Inc. Monoclonal antibodies directed against envelope glycoproteins from multiple filovirus species
AU2019269361C1 (en) * 2018-05-14 2025-06-12 Children's Research Institute, Children's National Medical Center Anti-CD24 compositions and uses thereof
EP3947460A4 (en) * 2019-03-26 2023-05-10 Forty Seven, Inc. MULTISPECIFIC AGENTS FOR TREATMENT OF CANCER
WO2020261280A1 (en) * 2019-06-25 2020-12-30 Ichilov Tech Ltd. Anti-cd24 antibody and uses thereof

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024251257A1 (en) * 2023-06-09 2024-12-12 TJ Biopharma (Shanghai) Co., Ltd. Anti-cd24 antibodies and uses thereof
WO2025093886A1 (en) 2023-11-01 2025-05-08 Cambridge Enterprise Limited Therapeutic use of an anti-cd24 antibody
WO2025101970A1 (en) * 2023-11-08 2025-05-15 Pheast Therapeutics, Inc. Cd24 antibodies
WO2025128830A1 (en) * 2023-12-12 2025-06-19 The Methodist Hospital Therapeutic lilrb regulation for treating neurological disorders
WO2025132836A1 (en) * 2023-12-19 2025-06-26 Pentixapharm Ag Antibodies against cd24
WO2025159754A1 (en) * 2024-01-25 2025-07-31 China Medical University Therapeutic cd24 humanized monoclonal antibodies and anti-tumor translational use
WO2025218729A1 (en) * 2024-04-17 2025-10-23 TJ Biopharma (Shanghai) Co., Ltd. Multifunctional molecules targeting cd24

Also Published As

Publication number Publication date
IL304898A (en) 2023-10-01
AU2022217072A1 (en) 2023-10-05
EP4288099A2 (en) 2023-12-13
MX2023009238A (es) 2023-08-16
CN117412770A (zh) 2024-01-16
CO2023011463A2 (es) 2023-09-18
EP4288099A4 (en) 2025-09-17
US20240052052A1 (en) 2024-02-15
JP2024508672A (ja) 2024-02-28
CA3210934A1 (en) 2022-08-11
KR20230143177A (ko) 2023-10-11
WO2022170280A3 (en) 2022-09-09
TW202241956A (zh) 2022-11-01
AU2022217072A9 (en) 2024-01-18

Similar Documents

Publication Publication Date Title
US12485298B2 (en) Anti-CD3epsilon antibodies
US20240052052A1 (en) Novel anti-cd24 antibodies
WO2019179391A1 (en) Novel bispecific pd-1/ctla-4 antibody molecules
WO2020156405A1 (en) Novel bispecific cd3/cd20 polypeptide complexes
WO2019179434A1 (en) Novel bispecific pd-1/cd47 antibody molecules
WO2022237820A1 (en) Novel anti-cd276 antibodies and the uses thereof
WO2019179390A1 (en) Novel bispecific pd-1/egfr antibody molecules
US20250270315A1 (en) Novel anti-sirpa antibodies
CA3257679A1 (en) NEW ANTI-GPRC5D ANTIBODIES, BISPECIFIC ANTIGEN-BINDING MOLECULES THAT BIND TO GPRC5D AND CD3, AND THEIR USES
WO2020192709A1 (en) Novel bispecific polypeptide complexes
WO2019179421A1 (en) Novel bispecific pd-1/ctla-4 antibody molecules
WO2019179422A1 (en) Novel bispecific pd-1/lag-3 antibody molecules
US12486325B2 (en) Anti-CD3epsilon antibodies
WO2024099295A9 (en) Novel multi-specific antibodies and uses thereof
EA052500B1 (ru) Новые антитела против cd24
TW202317618A (zh) 新型抗cd276抗體及其用途

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22750598

Country of ref document: EP

Kind code of ref document: A2

WWE Wipo information: entry into national phase

Ref document number: 304898

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 12023552156

Country of ref document: PH

Ref document number: 202280013601.9

Country of ref document: CN

WWE Wipo information: entry into national phase

Ref document number: 2023547592

Country of ref document: JP

Ref document number: 18264436

Country of ref document: US

Ref document number: MX/A/2023/009238

Country of ref document: MX

ENP Entry into the national phase

Ref document number: 3210934

Country of ref document: CA

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112023015452

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: 202392115

Country of ref document: EA

WWE Wipo information: entry into national phase

Ref document number: NC2023/0011463

Country of ref document: CO

ENP Entry into the national phase

Ref document number: 112023015452

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20230801

WWE Wipo information: entry into national phase

Ref document number: 202317059610

Country of ref document: IN

ENP Entry into the national phase

Ref document number: 20237030578

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 1020237030578

Country of ref document: KR

WWE Wipo information: entry into national phase

Ref document number: 803518

Country of ref document: NZ

Ref document number: 2022750598

Country of ref document: EP

Ref document number: 2022217072

Country of ref document: AU

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2022750598

Country of ref document: EP

Effective date: 20230908

WWP Wipo information: published in national office

Ref document number: NC2023/0011463

Country of ref document: CO

WWE Wipo information: entry into national phase

Ref document number: 11202305838U

Country of ref document: SG

ENP Entry into the national phase

Ref document number: 2022217072

Country of ref document: AU

Date of ref document: 20220208

Kind code of ref document: A

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22750598

Country of ref document: EP

Kind code of ref document: A2

WWE Wipo information: entry into national phase

Ref document number: 523450213

Country of ref document: SA

WWE Wipo information: entry into national phase

Ref document number: 523450213

Country of ref document: SA

WWE Wipo information: entry into national phase

Ref document number: 523450213

Country of ref document: SA

WWE Wipo information: entry into national phase

Ref document number: 523450213

Country of ref document: SA