WO2024099295A1 - Novel multi-specific antibodies and uses thereof - Google Patents
Novel multi-specific antibodies and uses thereof Download PDFInfo
- Publication number
- WO2024099295A1 WO2024099295A1 PCT/CN2023/130106 CN2023130106W WO2024099295A1 WO 2024099295 A1 WO2024099295 A1 WO 2024099295A1 CN 2023130106 W CN2023130106 W CN 2023130106W WO 2024099295 A1 WO2024099295 A1 WO 2024099295A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- variable region
- chain variable
- cdr sequences
- sequences selected
- Prior art date
Links
- 102100038078 CD276 antigen Human genes 0.000 claims abstract description 133
- 101000884279 Homo sapiens CD276 antigen Proteins 0.000 claims abstract description 133
- 108010074708 B7-H1 Antigen Proteins 0.000 claims abstract description 67
- 108091033319 polynucleotide Proteins 0.000 claims abstract description 18
- 102000040430 polynucleotide Human genes 0.000 claims abstract description 18
- 239000002157 polynucleotide Substances 0.000 claims abstract description 18
- 239000008194 pharmaceutical composition Substances 0.000 claims abstract description 13
- 108010047041 Complementarity Determining Regions Proteins 0.000 claims description 427
- 230000027455 binding Effects 0.000 claims description 395
- 238000009739 binding Methods 0.000 claims description 395
- 239000000427 antigen Substances 0.000 claims description 182
- 108091007433 antigens Proteins 0.000 claims description 182
- 102000036639 antigens Human genes 0.000 claims description 182
- 239000012634 fragment Substances 0.000 claims description 132
- 210000004027 cell Anatomy 0.000 claims description 116
- 241000282414 Homo sapiens Species 0.000 claims description 77
- 206010028980 Neoplasm Diseases 0.000 claims description 76
- 102000008096 B7-H1 Antigen Human genes 0.000 claims description 66
- 238000000034 method Methods 0.000 claims description 60
- 102000005962 receptors Human genes 0.000 claims description 57
- 108020003175 receptors Proteins 0.000 claims description 57
- 230000003213 activating effect Effects 0.000 claims description 40
- 201000011510 cancer Diseases 0.000 claims description 40
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 36
- 201000010099 disease Diseases 0.000 claims description 33
- 230000000694 effects Effects 0.000 claims description 32
- 238000006467 substitution reaction Methods 0.000 claims description 31
- 239000003814 drug Substances 0.000 claims description 28
- 239000013598 vector Substances 0.000 claims description 25
- 125000000539 amino acid group Chemical group 0.000 claims description 19
- 229940124597 therapeutic agent Drugs 0.000 claims description 19
- 238000007920 subcutaneous administration Methods 0.000 claims description 16
- 239000003795 chemical substances by application Substances 0.000 claims description 15
- 206010009944 Colon cancer Diseases 0.000 claims description 14
- 206010035226 Plasma cell myeloma Diseases 0.000 claims description 14
- 230000004048 modification Effects 0.000 claims description 13
- 238000012986 modification Methods 0.000 claims description 13
- 239000002246 antineoplastic agent Substances 0.000 claims description 12
- 102000048770 human CD276 Human genes 0.000 claims description 12
- 206010039491 Sarcoma Diseases 0.000 claims description 11
- 208000031671 Large B-Cell Diffuse Lymphoma Diseases 0.000 claims description 10
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 claims description 10
- 206010012818 diffuse large B-cell lymphoma Diseases 0.000 claims description 10
- 206010017758 gastric cancer Diseases 0.000 claims description 10
- 230000009870 specific binding Effects 0.000 claims description 10
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 claims description 9
- 208000014697 Acute lymphocytic leukaemia Diseases 0.000 claims description 9
- 208000034578 Multiple myelomas Diseases 0.000 claims description 9
- 208000006664 Precursor Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 claims description 9
- 208000005718 Stomach Neoplasms Diseases 0.000 claims description 9
- 201000011549 stomach cancer Diseases 0.000 claims description 9
- 208000008732 thymoma Diseases 0.000 claims description 9
- 239000003053 toxin Substances 0.000 claims description 9
- 231100000765 toxin Toxicity 0.000 claims description 9
- 208000036170 B-Cell Marginal Zone Lymphoma Diseases 0.000 claims description 8
- 208000003174 Brain Neoplasms Diseases 0.000 claims description 8
- 206010006187 Breast cancer Diseases 0.000 claims description 8
- 208000025205 Mantle-Cell Lymphoma Diseases 0.000 claims description 8
- 229940127089 cytotoxic agent Drugs 0.000 claims description 8
- 206010073071 hepatocellular carcinoma Diseases 0.000 claims description 8
- 201000007924 marginal zone B-cell lymphoma Diseases 0.000 claims description 8
- 208000021937 marginal zone lymphoma Diseases 0.000 claims description 8
- 208000037819 metastatic cancer Diseases 0.000 claims description 8
- 208000011575 metastatic malignant neoplasm Diseases 0.000 claims description 8
- 208000023275 Autoimmune disease Diseases 0.000 claims description 7
- 208000026310 Breast neoplasm Diseases 0.000 claims description 7
- 206010033128 Ovarian cancer Diseases 0.000 claims description 7
- 206010061535 Ovarian neoplasm Diseases 0.000 claims description 7
- 208000015181 infectious disease Diseases 0.000 claims description 7
- 201000001441 melanoma Diseases 0.000 claims description 7
- 208000030507 AIDS Diseases 0.000 claims description 6
- 208000031261 Acute myeloid leukaemia Diseases 0.000 claims description 6
- 208000003950 B-cell lymphoma Diseases 0.000 claims description 6
- 206010008342 Cervix carcinoma Diseases 0.000 claims description 6
- 208000035473 Communicable disease Diseases 0.000 claims description 6
- 206010058467 Lung neoplasm malignant Diseases 0.000 claims description 6
- 206010025323 Lymphomas Diseases 0.000 claims description 6
- 201000003793 Myelodysplastic syndrome Diseases 0.000 claims description 6
- 206010061902 Pancreatic neoplasm Diseases 0.000 claims description 6
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 claims description 6
- 201000010881 cervical cancer Diseases 0.000 claims description 6
- 208000029742 colonic neoplasm Diseases 0.000 claims description 6
- 231100000844 hepatocellular carcinoma Toxicity 0.000 claims description 6
- 208000032839 leukemia Diseases 0.000 claims description 6
- 201000005202 lung cancer Diseases 0.000 claims description 6
- 208000020816 lung neoplasm Diseases 0.000 claims description 6
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 claims description 6
- 201000002528 pancreatic cancer Diseases 0.000 claims description 6
- 208000008443 pancreatic carcinoma Diseases 0.000 claims description 6
- 206010003571 Astrocytoma Diseases 0.000 claims description 5
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 claims description 5
- 208000032791 BCR-ABL1 positive chronic myelogenous leukemia Diseases 0.000 claims description 5
- 206010004593 Bile duct cancer Diseases 0.000 claims description 5
- 206010005003 Bladder cancer Diseases 0.000 claims description 5
- 208000005243 Chondrosarcoma Diseases 0.000 claims description 5
- 208000001333 Colorectal Neoplasms Diseases 0.000 claims description 5
- 206010014967 Ependymoma Diseases 0.000 claims description 5
- 208000006168 Ewing Sarcoma Diseases 0.000 claims description 5
- 208000017604 Hodgkin disease Diseases 0.000 claims description 5
- 208000021519 Hodgkin lymphoma Diseases 0.000 claims description 5
- 208000010747 Hodgkins lymphoma Diseases 0.000 claims description 5
- 208000000172 Medulloblastoma Diseases 0.000 claims description 5
- 206010029260 Neuroblastoma Diseases 0.000 claims description 5
- 206010033701 Papillary thyroid cancer Diseases 0.000 claims description 5
- 206010060862 Prostate cancer Diseases 0.000 claims description 5
- 208000000236 Prostatic Neoplasms Diseases 0.000 claims description 5
- 208000006265 Renal cell carcinoma Diseases 0.000 claims description 5
- 208000024313 Testicular Neoplasms Diseases 0.000 claims description 5
- 201000009365 Thymic carcinoma Diseases 0.000 claims description 5
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 claims description 5
- 239000002168 alkylating agent Substances 0.000 claims description 5
- 238000002512 chemotherapy Methods 0.000 claims description 5
- 239000007850 fluorescent dye Substances 0.000 claims description 5
- 201000010536 head and neck cancer Diseases 0.000 claims description 5
- 208000014829 head and neck neoplasm Diseases 0.000 claims description 5
- 238000009169 immunotherapy Methods 0.000 claims description 5
- 229910052747 lanthanoid Inorganic materials 0.000 claims description 5
- 150000002602 lanthanoids Chemical class 0.000 claims description 5
- 206010024627 liposarcoma Diseases 0.000 claims description 5
- 238000004519 manufacturing process Methods 0.000 claims description 5
- 201000000050 myeloid neoplasm Diseases 0.000 claims description 5
- 208000028591 pheochromocytoma Diseases 0.000 claims description 5
- 239000000758 substrate Substances 0.000 claims description 5
- 206010042863 synovial sarcoma Diseases 0.000 claims description 5
- 201000003120 testicular cancer Diseases 0.000 claims description 5
- 208000030045 thyroid gland papillary carcinoma Diseases 0.000 claims description 5
- 201000005112 urinary bladder cancer Diseases 0.000 claims description 5
- 208000037540 Alveolar soft tissue sarcoma Diseases 0.000 claims description 4
- 208000019838 Blood disease Diseases 0.000 claims description 4
- 206010005949 Bone cancer Diseases 0.000 claims description 4
- 208000018084 Bone neoplasm Diseases 0.000 claims description 4
- 208000011691 Burkitt lymphomas Diseases 0.000 claims description 4
- 208000001843 Carotid Body Tumor Diseases 0.000 claims description 4
- 201000009047 Chordoma Diseases 0.000 claims description 4
- 208000008743 Desmoplastic Small Round Cell Tumor Diseases 0.000 claims description 4
- 206010064581 Desmoplastic small round cell tumour Diseases 0.000 claims description 4
- 201000003364 Extraskeletal myxoid chondrosarcoma Diseases 0.000 claims description 4
- 206010053717 Fibrous histiocytoma Diseases 0.000 claims description 4
- 208000022072 Gallbladder Neoplasms Diseases 0.000 claims description 4
- 208000021309 Germ cell tumor Diseases 0.000 claims description 4
- 101001117317 Homo sapiens Programmed cell death 1 ligand 1 Proteins 0.000 claims description 4
- 208000009164 Islet Cell Adenoma Diseases 0.000 claims description 4
- 208000007766 Kaposi sarcoma Diseases 0.000 claims description 4
- 208000008839 Kidney Neoplasms Diseases 0.000 claims description 4
- 206010024612 Lipoma Diseases 0.000 claims description 4
- 208000034176 Neoplasms, Germ Cell and Embryonal Diseases 0.000 claims description 4
- 206010033963 Parathyroid tumour Diseases 0.000 claims description 4
- 208000007913 Pituitary Neoplasms Diseases 0.000 claims description 4
- 206010038389 Renal cancer Diseases 0.000 claims description 4
- 208000008938 Rhabdoid tumor Diseases 0.000 claims description 4
- 206010073334 Rhabdoid tumour Diseases 0.000 claims description 4
- 208000025316 Richter syndrome Diseases 0.000 claims description 4
- 208000000453 Skin Neoplasms Diseases 0.000 claims description 4
- 208000021712 Soft tissue sarcoma Diseases 0.000 claims description 4
- 206010057644 Testis cancer Diseases 0.000 claims description 4
- 208000002495 Uterine Neoplasms Diseases 0.000 claims description 4
- 208000024447 adrenal gland neoplasm Diseases 0.000 claims description 4
- 208000008524 alveolar soft part sarcoma Diseases 0.000 claims description 4
- 229940041181 antineoplastic drug Drugs 0.000 claims description 4
- 208000037979 autoimmune inflammatory disease Diseases 0.000 claims description 4
- 230000008901 benefit Effects 0.000 claims description 4
- 208000001119 benign fibrous histiocytoma Diseases 0.000 claims description 4
- 208000012080 benign lipomatous neoplasm Diseases 0.000 claims description 4
- 208000026900 bile duct neoplasm Diseases 0.000 claims description 4
- 239000011230 binding agent Substances 0.000 claims description 4
- 210000000988 bone and bone Anatomy 0.000 claims description 4
- 210000004556 brain Anatomy 0.000 claims description 4
- 208000011654 childhood malignant neoplasm Diseases 0.000 claims description 4
- 208000006990 cholangiocarcinoma Diseases 0.000 claims description 4
- 201000010240 chromophobe renal cell carcinoma Diseases 0.000 claims description 4
- 208000009060 clear cell adenocarcinoma Diseases 0.000 claims description 4
- 201000010073 fibrogenesis imperfecta ossium Diseases 0.000 claims description 4
- 201000010103 fibrous dysplasia Diseases 0.000 claims description 4
- 201000003444 follicular lymphoma Diseases 0.000 claims description 4
- 210000000232 gallbladder Anatomy 0.000 claims description 4
- 201000010175 gallbladder cancer Diseases 0.000 claims description 4
- 208000003884 gestational trophoblastic disease Diseases 0.000 claims description 4
- 208000014951 hematologic disease Diseases 0.000 claims description 4
- 230000002489 hematologic effect Effects 0.000 claims description 4
- 102000048776 human CD274 Human genes 0.000 claims description 4
- 238000001990 intravenous administration Methods 0.000 claims description 4
- 201000002529 islet cell tumor Diseases 0.000 claims description 4
- 201000010982 kidney cancer Diseases 0.000 claims description 4
- 201000005252 lipomatous cancer Diseases 0.000 claims description 4
- 201000007270 liver cancer Diseases 0.000 claims description 4
- 208000014018 liver neoplasm Diseases 0.000 claims description 4
- 208000030883 malignant astrocytoma Diseases 0.000 claims description 4
- 206010027191 meningioma Diseases 0.000 claims description 4
- 230000001394 metastastic effect Effects 0.000 claims description 4
- 206010061289 metastatic neoplasm Diseases 0.000 claims description 4
- 206010051747 multiple endocrine neoplasia Diseases 0.000 claims description 4
- 208000023833 nerve sheath neoplasm Diseases 0.000 claims description 4
- 201000011519 neuroendocrine tumor Diseases 0.000 claims description 4
- 208000022102 pancreatic neuroendocrine neoplasm Diseases 0.000 claims description 4
- 208000010916 pituitary tumor Diseases 0.000 claims description 4
- 201000002267 posterior uveal melanoma Diseases 0.000 claims description 4
- 230000002285 radioactive effect Effects 0.000 claims description 4
- 201000000849 skin cancer Diseases 0.000 claims description 4
- 201000011096 spinal cancer Diseases 0.000 claims description 4
- 208000014618 spinal cord cancer Diseases 0.000 claims description 4
- 206010041823 squamous cell carcinoma Diseases 0.000 claims description 4
- 208000017572 squamous cell neoplasm Diseases 0.000 claims description 4
- 210000001685 thyroid gland Anatomy 0.000 claims description 4
- 208000025443 tumor of adipose tissue Diseases 0.000 claims description 4
- 208000017997 tumor of parathyroid gland Diseases 0.000 claims description 4
- 206010046766 uterine cancer Diseases 0.000 claims description 4
- 230000003044 adaptive effect Effects 0.000 claims description 3
- 238000012258 culturing Methods 0.000 claims description 3
- 239000003534 dna topoisomerase inhibitor Substances 0.000 claims description 3
- 239000003937 drug carrier Substances 0.000 claims description 3
- 230000003054 hormonal effect Effects 0.000 claims description 3
- 229910052739 hydrogen Inorganic materials 0.000 claims description 3
- 208000026278 immune system disease Diseases 0.000 claims description 3
- 239000002955 immunomodulating agent Substances 0.000 claims description 3
- 238000007918 intramuscular administration Methods 0.000 claims description 3
- 230000005855 radiation Effects 0.000 claims description 3
- 229940044693 topoisomerase inhibitor Drugs 0.000 claims description 3
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 2
- 238000001794 hormone therapy Methods 0.000 claims description 2
- 238000011275 oncology therapy Methods 0.000 claims description 2
- 238000001959 radiotherapy Methods 0.000 claims description 2
- 238000001356 surgical procedure Methods 0.000 claims description 2
- 102100024216 Programmed cell death 1 ligand 1 Human genes 0.000 abstract 1
- 150000001413 amino acids Chemical class 0.000 description 35
- 238000012360 testing method Methods 0.000 description 27
- 235000001014 amino acid Nutrition 0.000 description 26
- 108090000765 processed proteins & peptides Proteins 0.000 description 26
- 241000699666 Mus <mouse, genus> Species 0.000 description 25
- 108090000623 proteins and genes Proteins 0.000 description 24
- 125000003275 alpha amino acid group Chemical group 0.000 description 22
- 229940024606 amino acid Drugs 0.000 description 22
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 21
- 239000000562 conjugate Substances 0.000 description 21
- 235000018102 proteins Nutrition 0.000 description 21
- 102000004169 proteins and genes Human genes 0.000 description 21
- -1 FcDRl Proteins 0.000 description 20
- 102000004196 processed proteins & peptides Human genes 0.000 description 19
- 230000014509 gene expression Effects 0.000 description 18
- 239000000203 mixture Substances 0.000 description 18
- 230000004540 complement-dependent cytotoxicity Effects 0.000 description 17
- 239000012636 effector Substances 0.000 description 17
- 230000006870 function Effects 0.000 description 17
- 238000011740 C57BL/6 mouse Methods 0.000 description 12
- 101710185679 CD276 antigen Proteins 0.000 description 12
- 230000003053 immunization Effects 0.000 description 12
- 238000002649 immunization Methods 0.000 description 12
- 238000001727 in vivo Methods 0.000 description 12
- 229920001184 polypeptide Polymers 0.000 description 12
- 108060003951 Immunoglobulin Proteins 0.000 description 11
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 11
- 102000018358 immunoglobulin Human genes 0.000 description 11
- 238000011729 BALB/c nude mouse Methods 0.000 description 10
- 241001465754 Metazoa Species 0.000 description 10
- 241000699670 Mus sp. Species 0.000 description 10
- 229940049595 antibody-drug conjugate Drugs 0.000 description 10
- 239000000872 buffer Substances 0.000 description 10
- 230000004481 post-translational protein modification Effects 0.000 description 10
- 238000012216 screening Methods 0.000 description 10
- 210000004881 tumor cell Anatomy 0.000 description 10
- 108010087819 Fc receptors Proteins 0.000 description 9
- 102000009109 Fc receptors Human genes 0.000 description 9
- 230000000259 anti-tumor effect Effects 0.000 description 9
- 230000004614 tumor growth Effects 0.000 description 9
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 8
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 8
- 230000000295 complement effect Effects 0.000 description 8
- 230000013595 glycosylation Effects 0.000 description 8
- 238000006206 glycosylation reaction Methods 0.000 description 8
- 210000004408 hybridoma Anatomy 0.000 description 8
- 239000002609 medium Substances 0.000 description 8
- 238000011282 treatment Methods 0.000 description 8
- 238000012413 Fluorescence activated cell sorting analysis Methods 0.000 description 7
- 101000935587 Homo sapiens Flavin reductase (NADPH) Proteins 0.000 description 7
- 241000700605 Viruses Species 0.000 description 7
- 230000004913 activation Effects 0.000 description 7
- 239000003963 antioxidant agent Substances 0.000 description 7
- 235000006708 antioxidants Nutrition 0.000 description 7
- 238000003556 assay Methods 0.000 description 7
- 150000001875 compounds Chemical class 0.000 description 7
- 238000011161 development Methods 0.000 description 7
- 230000018109 developmental process Effects 0.000 description 7
- 239000012642 immune effector Substances 0.000 description 7
- 229940121354 immunomodulator Drugs 0.000 description 7
- 239000007924 injection Substances 0.000 description 7
- 238000002347 injection Methods 0.000 description 7
- 230000003993 interaction Effects 0.000 description 7
- 150000007523 nucleic acids Chemical group 0.000 description 7
- 230000001225 therapeutic effect Effects 0.000 description 7
- 102100039396 C-X-C motif chemokine 16 Human genes 0.000 description 6
- 101100112922 Candida albicans CDR3 gene Proteins 0.000 description 6
- 108020004414 DNA Proteins 0.000 description 6
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 6
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 6
- 206010057249 Phagocytosis Diseases 0.000 description 6
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 6
- 230000005888 antibody-dependent cellular phagocytosis Effects 0.000 description 6
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 6
- 230000021615 conjugation Effects 0.000 description 6
- 230000003013 cytotoxicity Effects 0.000 description 6
- 231100000135 cytotoxicity Toxicity 0.000 description 6
- 229950004270 enoblituzumab Drugs 0.000 description 6
- 230000004927 fusion Effects 0.000 description 6
- 230000001976 improved effect Effects 0.000 description 6
- 210000002540 macrophage Anatomy 0.000 description 6
- 238000005457 optimization Methods 0.000 description 6
- 230000008782 phagocytosis Effects 0.000 description 6
- YBYRMVIVWMBXKQ-UHFFFAOYSA-N phenylmethanesulfonyl fluoride Chemical compound FS(=O)(=O)CC1=CC=CC=C1 YBYRMVIVWMBXKQ-UHFFFAOYSA-N 0.000 description 6
- 239000000047 product Substances 0.000 description 6
- 230000002829 reductive effect Effects 0.000 description 6
- 239000000243 solution Substances 0.000 description 6
- 239000002904 solvent Substances 0.000 description 6
- 239000000126 substance Substances 0.000 description 6
- 230000008685 targeting Effects 0.000 description 6
- 230000005748 tumor development Effects 0.000 description 6
- 241000282693 Cercopithecidae Species 0.000 description 5
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 5
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 5
- 101000916644 Homo sapiens Macrophage colony-stimulating factor 1 receptor Proteins 0.000 description 5
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 description 5
- 102100026120 IgG receptor FcRn large subunit p51 Human genes 0.000 description 5
- 102100028198 Macrophage colony-stimulating factor 1 receptor Human genes 0.000 description 5
- 102100025354 Macrophage mannose receptor 1 Human genes 0.000 description 5
- 101710089372 Programmed cell death protein 1 Proteins 0.000 description 5
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 5
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 description 5
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 5
- 230000006044 T cell activation Effects 0.000 description 5
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 description 5
- 210000001744 T-lymphocyte Anatomy 0.000 description 5
- 239000000969 carrier Substances 0.000 description 5
- 238000004113 cell culture Methods 0.000 description 5
- 230000008859 change Effects 0.000 description 5
- 238000010367 cloning Methods 0.000 description 5
- 210000004443 dendritic cell Anatomy 0.000 description 5
- 238000013461 design Methods 0.000 description 5
- 238000009472 formulation Methods 0.000 description 5
- 208000027866 inflammatory disease Diseases 0.000 description 5
- 239000008176 lyophilized powder Substances 0.000 description 5
- 239000000546 pharmaceutical excipient Substances 0.000 description 5
- 230000003389 potentiating effect Effects 0.000 description 5
- 238000000746 purification Methods 0.000 description 5
- 238000010188 recombinant method Methods 0.000 description 5
- 241000894007 species Species 0.000 description 5
- 239000006228 supernatant Substances 0.000 description 5
- 210000001519 tissue Anatomy 0.000 description 5
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 5
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 4
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 4
- 241000894006 Bacteria Species 0.000 description 4
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 4
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 4
- 102100026122 High affinity immunoglobulin gamma Fc receptor I Human genes 0.000 description 4
- 101000690301 Homo sapiens Aldo-keto reductase family 1 member C4 Proteins 0.000 description 4
- 101000889133 Homo sapiens C-X-C motif chemokine 16 Proteins 0.000 description 4
- 101000913074 Homo sapiens High affinity immunoglobulin gamma Fc receptor I Proteins 0.000 description 4
- 101001116548 Homo sapiens Protein CBFA2T1 Proteins 0.000 description 4
- 101710177940 IgG receptor FcRn large subunit p51 Proteins 0.000 description 4
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 4
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 4
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 4
- 241001529936 Murinae Species 0.000 description 4
- RJURFGZVJUQBHK-UHFFFAOYSA-N actinomycin D Natural products CC1OC(=O)C(C(C)C)N(C)C(=O)CN(C)C(=O)C2CCCN2C(=O)C(C(C)C)NC(=O)C1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)NC4C(=O)NC(C(N5CCCC5C(=O)N(C)CC(=O)N(C)C(C(C)C)C(=O)OC4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-UHFFFAOYSA-N 0.000 description 4
- 201000003710 autoimmune thrombocytopenic purpura Diseases 0.000 description 4
- 239000011324 bead Substances 0.000 description 4
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 4
- 230000037396 body weight Effects 0.000 description 4
- 238000012512 characterization method Methods 0.000 description 4
- 239000008121 dextrose Substances 0.000 description 4
- 239000000839 emulsion Substances 0.000 description 4
- 238000000684 flow cytometry Methods 0.000 description 4
- 230000005764 inhibitory process Effects 0.000 description 4
- 210000003292 kidney cell Anatomy 0.000 description 4
- 239000003446 ligand Substances 0.000 description 4
- 239000000463 material Substances 0.000 description 4
- 229930182817 methionine Natural products 0.000 description 4
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 4
- 238000007799 mixed lymphocyte reaction assay Methods 0.000 description 4
- 230000001047 pyretic effect Effects 0.000 description 4
- 238000011160 research Methods 0.000 description 4
- 150000003839 salts Chemical class 0.000 description 4
- 239000007787 solid Substances 0.000 description 4
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 3
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 description 3
- UHOVQNZJYSORNB-UHFFFAOYSA-N Benzene Chemical compound C1=CC=CC=C1 UHOVQNZJYSORNB-UHFFFAOYSA-N 0.000 description 3
- 102100027314 Beta-2-microglobulin Human genes 0.000 description 3
- 241000282832 Camelidae Species 0.000 description 3
- 108010092160 Dactinomycin Proteins 0.000 description 3
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 3
- 238000001061 Dunnett's test Methods 0.000 description 3
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 3
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 description 3
- 101000576894 Homo sapiens Macrophage mannose receptor 1 Proteins 0.000 description 3
- 101000692455 Homo sapiens Platelet-derived growth factor receptor beta Proteins 0.000 description 3
- 241000725303 Human immunodeficiency virus Species 0.000 description 3
- 206010020751 Hypersensitivity Diseases 0.000 description 3
- 102000037982 Immune checkpoint proteins Human genes 0.000 description 3
- 108091008036 Immune checkpoint proteins Proteins 0.000 description 3
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 3
- 108091092195 Intron Proteins 0.000 description 3
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 3
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 3
- 102100029193 Low affinity immunoglobulin gamma Fc region receptor III-A Human genes 0.000 description 3
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 3
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 description 3
- 108091028043 Nucleic acid sequence Proteins 0.000 description 3
- 241000283973 Oryctolagus cuniculus Species 0.000 description 3
- 241000700159 Rattus Species 0.000 description 3
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 3
- 241000700584 Simplexvirus Species 0.000 description 3
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 3
- 201000009594 Systemic Scleroderma Diseases 0.000 description 3
- 206010042953 Systemic sclerosis Diseases 0.000 description 3
- 102100032990 Trem-like transcript 2 protein Human genes 0.000 description 3
- 230000007815 allergy Effects 0.000 description 3
- 238000004458 analytical method Methods 0.000 description 3
- 239000003242 anti bacterial agent Substances 0.000 description 3
- 229940088710 antibiotic agent Drugs 0.000 description 3
- 239000004599 antimicrobial Substances 0.000 description 3
- 210000003719 b-lymphocyte Anatomy 0.000 description 3
- 210000004899 c-terminal region Anatomy 0.000 description 3
- 150000001720 carbohydrates Chemical group 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- 238000004587 chromatography analysis Methods 0.000 description 3
- 230000001684 chronic effect Effects 0.000 description 3
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 3
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 3
- 235000018417 cysteine Nutrition 0.000 description 3
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 3
- 208000035475 disorder Diseases 0.000 description 3
- 238000010494 dissociation reaction Methods 0.000 description 3
- 230000005593 dissociations Effects 0.000 description 3
- 239000003995 emulsifying agent Substances 0.000 description 3
- 230000012010 growth Effects 0.000 description 3
- 102000054751 human RUNX1T1 Human genes 0.000 description 3
- 210000002865 immune cell Anatomy 0.000 description 3
- 239000006193 liquid solution Substances 0.000 description 3
- 230000003211 malignant effect Effects 0.000 description 3
- 230000001404 mediated effect Effects 0.000 description 3
- 230000007935 neutral effect Effects 0.000 description 3
- 230000003647 oxidation Effects 0.000 description 3
- 238000007254 oxidation reaction Methods 0.000 description 3
- 230000037361 pathway Effects 0.000 description 3
- 229920000642 polymer Polymers 0.000 description 3
- 239000000843 powder Substances 0.000 description 3
- 238000002360 preparation method Methods 0.000 description 3
- 230000010076 replication Effects 0.000 description 3
- 230000011664 signaling Effects 0.000 description 3
- 239000011780 sodium chloride Substances 0.000 description 3
- 239000000725 suspension Substances 0.000 description 3
- 201000000596 systemic lupus erythematosus Diseases 0.000 description 3
- 241000701161 unidentified adenovirus Species 0.000 description 3
- 241001529453 unidentified herpesvirus Species 0.000 description 3
- 239000003981 vehicle Substances 0.000 description 3
- 230000003612 virological effect Effects 0.000 description 3
- 102000010400 1-phosphatidylinositol-3-kinase activity proteins Human genes 0.000 description 2
- NITXODYAMWZEJY-UHFFFAOYSA-N 3-(pyridin-2-yldisulfanyl)propanehydrazide Chemical compound NNC(=O)CCSSC1=CC=CC=N1 NITXODYAMWZEJY-UHFFFAOYSA-N 0.000 description 2
- 229920000936 Agarose Polymers 0.000 description 2
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- 208000000659 Autoimmune lymphoproliferative syndrome Diseases 0.000 description 2
- 108090001008 Avidin Proteins 0.000 description 2
- 102100031151 C-C chemokine receptor type 2 Human genes 0.000 description 2
- 101710149815 C-C chemokine receptor type 2 Proteins 0.000 description 2
- 102100040840 C-type lectin domain family 7 member A Human genes 0.000 description 2
- 108010009992 CD163 antigen Proteins 0.000 description 2
- 102000049320 CD36 Human genes 0.000 description 2
- 108010045374 CD36 Antigens Proteins 0.000 description 2
- 108090000835 CX3C Chemokine Receptor 1 Proteins 0.000 description 2
- 102100039196 CX3C chemokine receptor 1 Human genes 0.000 description 2
- 241000283707 Capra Species 0.000 description 2
- 108010008957 Chemokine CXCL16 Proteins 0.000 description 2
- 102000050083 Class E Scavenger Receptors Human genes 0.000 description 2
- 102100024330 Collectin-12 Human genes 0.000 description 2
- 108010034753 Complement Membrane Attack Complex Proteins 0.000 description 2
- 241000699800 Cricetinae Species 0.000 description 2
- 229920000858 Cyclodextrin Polymers 0.000 description 2
- SRBFZHDQGSBBOR-IOVATXLUSA-N D-xylopyranose Chemical compound O[C@@H]1COC(O)[C@H](O)[C@H]1O SRBFZHDQGSBBOR-IOVATXLUSA-N 0.000 description 2
- 101100481408 Danio rerio tie2 gene Proteins 0.000 description 2
- 241000702421 Dependoparvovirus Species 0.000 description 2
- 201000004624 Dermatitis Diseases 0.000 description 2
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 2
- 241000255925 Diptera Species 0.000 description 2
- 241000196324 Embryophyta Species 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- 108010021468 Fc gamma receptor IIA Proteins 0.000 description 2
- 208000001640 Fibromyalgia Diseases 0.000 description 2
- 201000006353 Filariasis Diseases 0.000 description 2
- 241000233866 Fungi Species 0.000 description 2
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 2
- 208000007465 Giant cell arteritis Diseases 0.000 description 2
- 208000002250 Hematologic Neoplasms Diseases 0.000 description 2
- 208000035186 Hemolytic Autoimmune Anemia Diseases 0.000 description 2
- 241000238631 Hexapoda Species 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- 101000937544 Homo sapiens Beta-2-microglobulin Proteins 0.000 description 2
- 101000909528 Homo sapiens Collectin-12 Proteins 0.000 description 2
- 101000868279 Homo sapiens Leukocyte surface antigen CD47 Proteins 0.000 description 2
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 2
- 101001043562 Homo sapiens Low-density lipoprotein receptor-related protein 2 Proteins 0.000 description 2
- 101001018034 Homo sapiens Lymphocyte antigen 75 Proteins 0.000 description 2
- 101001018258 Homo sapiens Macrophage receptor MARCO Proteins 0.000 description 2
- 101001134216 Homo sapiens Macrophage scavenger receptor types I and II Proteins 0.000 description 2
- 101000934372 Homo sapiens Macrosialin Proteins 0.000 description 2
- 101000946889 Homo sapiens Monocyte differentiation antigen CD14 Proteins 0.000 description 2
- 101000995138 Homo sapiens NFAT activation molecule 1 Proteins 0.000 description 2
- 101000693970 Homo sapiens Scavenger receptor class A member 3 Proteins 0.000 description 2
- 101000684887 Homo sapiens Scavenger receptor class A member 5 Proteins 0.000 description 2
- 101000663183 Homo sapiens Scavenger receptor class F member 1 Proteins 0.000 description 2
- 101000663187 Homo sapiens Scavenger receptor class F member 2 Proteins 0.000 description 2
- 101000663381 Homo sapiens Scavenger receptor cysteine-rich domain-containing group B protein Proteins 0.000 description 2
- 101000884271 Homo sapiens Signal transducer CD24 Proteins 0.000 description 2
- 101000704168 Homo sapiens Soluble scavenger receptor cysteine-rich domain-containing protein SSC5D Proteins 0.000 description 2
- 101000832225 Homo sapiens Stabilin-1 Proteins 0.000 description 2
- 101000832213 Homo sapiens Stabilin-2 Proteins 0.000 description 2
- 101000795117 Homo sapiens Triggering receptor expressed on myeloid cells 2 Proteins 0.000 description 2
- 101000863873 Homo sapiens Tyrosine-protein phosphatase non-receptor type substrate 1 Proteins 0.000 description 2
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 2
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 2
- 208000003456 Juvenile Arthritis Diseases 0.000 description 2
- 206010059176 Juvenile idiopathic arthritis Diseases 0.000 description 2
- 244000285963 Kluyveromyces fragilis Species 0.000 description 2
- 241001138401 Kluyveromyces lactis Species 0.000 description 2
- 238000012313 Kruskal-Wallis test Methods 0.000 description 2
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 2
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 2
- 108090001090 Lectins Proteins 0.000 description 2
- 102000004856 Lectins Human genes 0.000 description 2
- 102100032913 Leukocyte surface antigen CD47 Human genes 0.000 description 2
- GQYIWUVLTXOXAJ-UHFFFAOYSA-N Lomustine Chemical compound ClCCN(N=O)C(=O)NC1CCCCC1 GQYIWUVLTXOXAJ-UHFFFAOYSA-N 0.000 description 2
- 102100029204 Low affinity immunoglobulin gamma Fc region receptor II-a Human genes 0.000 description 2
- 102100021922 Low-density lipoprotein receptor-related protein 2 Human genes 0.000 description 2
- 102100033486 Lymphocyte antigen 75 Human genes 0.000 description 2
- 102100020983 Lysosome membrane protein 2 Human genes 0.000 description 2
- 241000282567 Macaca fascicularis Species 0.000 description 2
- 102100033272 Macrophage receptor MARCO Human genes 0.000 description 2
- 102100034184 Macrophage scavenger receptor types I and II Human genes 0.000 description 2
- 102100025136 Macrosialin Human genes 0.000 description 2
- 108700018351 Major Histocompatibility Complex Proteins 0.000 description 2
- 241000124008 Mammalia Species 0.000 description 2
- 108010031099 Mannose Receptor Proteins 0.000 description 2
- 206010027406 Mesothelioma Diseases 0.000 description 2
- 206010027476 Metastases Diseases 0.000 description 2
- 102100035877 Monocyte differentiation antigen CD14 Human genes 0.000 description 2
- 102100022693 Mucin-4 Human genes 0.000 description 2
- 108010008699 Mucin-4 Proteins 0.000 description 2
- 101100262697 Mus musculus Axl gene Proteins 0.000 description 2
- 101100327308 Mus musculus Cd276 gene Proteins 0.000 description 2
- 101100481410 Mus musculus Tek gene Proteins 0.000 description 2
- 101100268066 Mus musculus Zap70 gene Proteins 0.000 description 2
- 208000031888 Mycoses Diseases 0.000 description 2
- 208000033776 Myeloid Acute Leukemia Diseases 0.000 description 2
- 108010077432 Myeloid Differentiation Factor 88 Proteins 0.000 description 2
- 102000010168 Myeloid Differentiation Factor 88 Human genes 0.000 description 2
- 102100034394 NFAT activation molecule 1 Human genes 0.000 description 2
- 230000004989 O-glycosylation Effects 0.000 description 2
- 108091007960 PI3Ks Proteins 0.000 description 2
- 229910019142 PO4 Inorganic materials 0.000 description 2
- 102100026547 Platelet-derived growth factor receptor beta Human genes 0.000 description 2
- ZTHYODDOHIVTJV-UHFFFAOYSA-N Propyl gallate Chemical compound CCCOC(=O)C1=CC(O)=C(O)C(O)=C1 ZTHYODDOHIVTJV-UHFFFAOYSA-N 0.000 description 2
- 201000004681 Psoriasis Diseases 0.000 description 2
- 239000008156 Ringer's lactate solution Substances 0.000 description 2
- 102000004940 SCARA5 Human genes 0.000 description 2
- 108091005487 SCARB1 Proteins 0.000 description 2
- 108091005488 SCARB2 Proteins 0.000 description 2
- 102100027192 Scavenger receptor class A member 3 Human genes 0.000 description 2
- 102100037118 Scavenger receptor class B member 1 Human genes 0.000 description 2
- 102100037081 Scavenger receptor class F member 1 Human genes 0.000 description 2
- 102100037076 Scavenger receptor class F member 2 Human genes 0.000 description 2
- 102100038959 Scavenger receptor cysteine-rich domain-containing group B protein Human genes 0.000 description 2
- 102100025831 Scavenger receptor cysteine-rich type 1 protein M130 Human genes 0.000 description 2
- 241000607720 Serratia Species 0.000 description 2
- 102100038081 Signal transducer CD24 Human genes 0.000 description 2
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 2
- 108010003723 Single-Domain Antibodies Proteins 0.000 description 2
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 2
- 102100031878 Soluble scavenger receptor cysteine-rich domain-containing protein SSC5D Human genes 0.000 description 2
- 241000256251 Spodoptera frugiperda Species 0.000 description 2
- 102100024471 Stabilin-1 Human genes 0.000 description 2
- 102100024470 Stabilin-2 Human genes 0.000 description 2
- 101150110875 Syk gene Proteins 0.000 description 2
- 239000004473 Threonine Substances 0.000 description 2
- 208000031981 Thrombocytopenic Idiopathic Purpura Diseases 0.000 description 2
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 2
- 101150014014 Traf6 gene Proteins 0.000 description 2
- 101710149051 Trem-like transcript 2 protein Proteins 0.000 description 2
- 208000004938 Trematode Infections Diseases 0.000 description 2
- 102100029678 Triggering receptor expressed on myeloid cells 2 Human genes 0.000 description 2
- 102100029690 Tumor necrosis factor receptor superfamily member 13C Human genes 0.000 description 2
- 101710178300 Tumor necrosis factor receptor superfamily member 13C Proteins 0.000 description 2
- 206010067584 Type 1 diabetes mellitus Diseases 0.000 description 2
- 101150098329 Tyro3 gene Proteins 0.000 description 2
- 102100022356 Tyrosine-protein kinase Mer Human genes 0.000 description 2
- 102100029948 Tyrosine-protein phosphatase non-receptor type substrate 1 Human genes 0.000 description 2
- VGQOVCHZGQWAOI-UHFFFAOYSA-N UNPD55612 Natural products N1C(O)C2CC(C=CC(N)=O)=CN2C(=O)C2=CC=C(C)C(O)=C12 VGQOVCHZGQWAOI-UHFFFAOYSA-N 0.000 description 2
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 2
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 2
- 208000036142 Viral infection Diseases 0.000 description 2
- 240000008042 Zea mays Species 0.000 description 2
- 235000005824 Zea mays ssp. parviglumis Nutrition 0.000 description 2
- 235000002017 Zea mays subsp mays Nutrition 0.000 description 2
- 230000002378 acidificating effect Effects 0.000 description 2
- RJURFGZVJUQBHK-IIXSONLDSA-N actinomycin D Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)N[C@@H]4C(=O)N[C@@H](C(N5CCC[C@H]5C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-IIXSONLDSA-N 0.000 description 2
- OIRDTQYFTABQOQ-KQYNXXCUSA-N adenosine Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O OIRDTQYFTABQOQ-KQYNXXCUSA-N 0.000 description 2
- 238000001042 affinity chromatography Methods 0.000 description 2
- 229940100198 alkylating agent Drugs 0.000 description 2
- 208000026935 allergic disease Diseases 0.000 description 2
- 238000012870 ammonium sulfate precipitation Methods 0.000 description 2
- 239000012491 analyte Substances 0.000 description 2
- 239000005557 antagonist Substances 0.000 description 2
- VGQOVCHZGQWAOI-HYUHUPJXSA-N anthramycin Chemical compound N1[C@@H](O)[C@@H]2CC(\C=C\C(N)=O)=CN2C(=O)C2=CC=C(C)C(O)=C12 VGQOVCHZGQWAOI-HYUHUPJXSA-N 0.000 description 2
- 239000008135 aqueous vehicle Substances 0.000 description 2
- 210000004436 artificial bacterial chromosome Anatomy 0.000 description 2
- 210000004507 artificial chromosome Anatomy 0.000 description 2
- 210000001106 artificial yeast chromosome Anatomy 0.000 description 2
- 125000000613 asparagine group Chemical group N[C@@H](CC(N)=O)C(=O)* 0.000 description 2
- 208000006673 asthma Diseases 0.000 description 2
- 208000027625 autoimmune inner ear disease Diseases 0.000 description 2
- 230000004071 biological effect Effects 0.000 description 2
- 229960002685 biotin Drugs 0.000 description 2
- 235000020958 biotin Nutrition 0.000 description 2
- 239000011616 biotin Substances 0.000 description 2
- NXVYSVARUKNFNF-UHFFFAOYSA-N bis(2,5-dioxopyrrolidin-1-yl) 2,3-dihydroxybutanedioate Chemical compound O=C1CCC(=O)N1OC(=O)C(O)C(O)C(=O)ON1C(=O)CCC1=O NXVYSVARUKNFNF-UHFFFAOYSA-N 0.000 description 2
- VYLDEYYOISNGST-UHFFFAOYSA-N bissulfosuccinimidyl suberate Chemical compound O=C1C(S(=O)(=O)O)CC(=O)N1OC(=O)CCCCCCC(=O)ON1C(=O)C(S(O)(=O)=O)CC1=O VYLDEYYOISNGST-UHFFFAOYSA-N 0.000 description 2
- 108010018804 c-Mer Tyrosine Kinase Proteins 0.000 description 2
- 239000006143 cell culture medium Substances 0.000 description 2
- 230000007910 cell fusion Effects 0.000 description 2
- 230000010261 cell growth Effects 0.000 description 2
- 238000012054 celltiter-glo Methods 0.000 description 2
- 238000005119 centrifugation Methods 0.000 description 2
- 239000002738 chelating agent Substances 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- OSASVXMJTNOKOY-UHFFFAOYSA-N chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 2
- 208000013056 classic Hodgkin lymphoma Diseases 0.000 description 2
- 108010047295 complement receptors Proteins 0.000 description 2
- 102000006834 complement receptors Human genes 0.000 description 2
- 239000000356 contaminant Substances 0.000 description 2
- 235000005822 corn Nutrition 0.000 description 2
- 238000005138 cryopreservation Methods 0.000 description 2
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 2
- 231100000433 cytotoxic Toxicity 0.000 description 2
- 229960000640 dactinomycin Drugs 0.000 description 2
- 230000006378 damage Effects 0.000 description 2
- 229960000975 daunorubicin Drugs 0.000 description 2
- 230000007423 decrease Effects 0.000 description 2
- 108010025838 dectin 1 Proteins 0.000 description 2
- CFCUWKMKBJTWLW-UHFFFAOYSA-N deoliosyl-3C-alpha-L-digitoxosyl-MTM Natural products CC=1C(O)=C2C(O)=C3C(=O)C(OC4OC(C)C(O)C(OC5OC(C)C(O)C(OC6OC(C)C(O)C(C)(O)C6)C5)C4)C(C(OC)C(=O)C(O)C(C)O)CC3=CC2=CC=1OC(OC(C)C1O)CC1OC1CC(O)C(O)C(C)O1 CFCUWKMKBJTWLW-UHFFFAOYSA-N 0.000 description 2
- 201000001981 dermatomyositis Diseases 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- 230000006334 disulfide bridging Effects 0.000 description 2
- 229960004679 doxorubicin Drugs 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 235000019441 ethanol Nutrition 0.000 description 2
- DEFVIWRASFVYLL-UHFFFAOYSA-N ethylene glycol bis(2-aminoethyl)tetraacetic acid Chemical compound OC(=O)CN(CC(O)=O)CCOCCOCCN(CC(O)=O)CC(O)=O DEFVIWRASFVYLL-UHFFFAOYSA-N 0.000 description 2
- 238000004108 freeze drying Methods 0.000 description 2
- 239000008103 glucose Substances 0.000 description 2
- 150000004676 glycans Chemical group 0.000 description 2
- 235000011187 glycerol Nutrition 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- 230000002209 hydrophobic effect Effects 0.000 description 2
- 229940126546 immune checkpoint molecule Drugs 0.000 description 2
- 230000001900 immune effect Effects 0.000 description 2
- 230000028993 immune response Effects 0.000 description 2
- 210000000987 immune system Anatomy 0.000 description 2
- 230000002163 immunogen Effects 0.000 description 2
- 230000003259 immunoinhibitory effect Effects 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- 230000002401 inhibitory effect Effects 0.000 description 2
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 2
- 239000007951 isotonicity adjuster Substances 0.000 description 2
- 201000002215 juvenile rheumatoid arthritis Diseases 0.000 description 2
- 210000003734 kidney Anatomy 0.000 description 2
- JVTAAEKCZFNVCJ-UHFFFAOYSA-N lactic acid Chemical compound CC(O)C(O)=O JVTAAEKCZFNVCJ-UHFFFAOYSA-N 0.000 description 2
- 239000002523 lectin Substances 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 210000005229 liver cell Anatomy 0.000 description 2
- 238000004020 luminiscence type Methods 0.000 description 2
- 210000001165 lymph node Anatomy 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 230000014759 maintenance of location Effects 0.000 description 2
- 230000007246 mechanism Effects 0.000 description 2
- 208000023356 medullary thyroid gland carcinoma Diseases 0.000 description 2
- GLVAUDGFNGKCSF-UHFFFAOYSA-N mercaptopurine Chemical compound S=C1NC=NC2=C1NC=N2 GLVAUDGFNGKCSF-UHFFFAOYSA-N 0.000 description 2
- 230000009401 metastasis Effects 0.000 description 2
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 2
- CFCUWKMKBJTWLW-BKHRDMLASA-N mithramycin Chemical compound O([C@@H]1C[C@@H](O[C@H](C)[C@H]1O)OC=1C=C2C=C3C[C@H]([C@@H](C(=O)C3=C(O)C2=C(O)C=1C)O[C@@H]1O[C@H](C)[C@@H](O)[C@H](O[C@@H]2O[C@H](C)[C@H](O)[C@H](O[C@@H]3O[C@H](C)[C@@H](O)[C@@](C)(O)C3)C2)C1)[C@H](OC)C(=O)[C@@H](O)[C@@H](C)O)[C@H]1C[C@@H](O)[C@H](O)[C@@H](C)O1 CFCUWKMKBJTWLW-BKHRDMLASA-N 0.000 description 2
- 229960004857 mitomycin Drugs 0.000 description 2
- 238000002156 mixing Methods 0.000 description 2
- 210000001616 monocyte Anatomy 0.000 description 2
- 201000006417 multiple sclerosis Diseases 0.000 description 2
- 208000029766 myalgic encephalomeyelitis/chronic fatigue syndrome Diseases 0.000 description 2
- 210000000066 myeloid cell Anatomy 0.000 description 2
- 239000002687 nonaqueous vehicle Substances 0.000 description 2
- 231100000252 nontoxic Toxicity 0.000 description 2
- 230000003000 nontoxic effect Effects 0.000 description 2
- 102000039446 nucleic acids Human genes 0.000 description 2
- 108020004707 nucleic acids Proteins 0.000 description 2
- 201000008482 osteoarthritis Diseases 0.000 description 2
- 238000007911 parenteral administration Methods 0.000 description 2
- 210000001322 periplasm Anatomy 0.000 description 2
- 210000001539 phagocyte Anatomy 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 2
- 230000026731 phosphorylation Effects 0.000 description 2
- 238000006366 phosphorylation reaction Methods 0.000 description 2
- 239000013612 plasmid Substances 0.000 description 2
- BASFCYQUMIYNBI-UHFFFAOYSA-N platinum Chemical compound [Pt] BASFCYQUMIYNBI-UHFFFAOYSA-N 0.000 description 2
- 229960003171 plicamycin Drugs 0.000 description 2
- 229920001223 polyethylene glycol Polymers 0.000 description 2
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 2
- 229920000053 polysorbate 80 Polymers 0.000 description 2
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 2
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 2
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 2
- 230000007112 pro inflammatory response Effects 0.000 description 2
- 238000012545 processing Methods 0.000 description 2
- AQHHHDLHHXJYJD-UHFFFAOYSA-N propranolol Chemical compound C1=CC=C2C(OCC(O)CNC(C)C)=CC=CC2=C1 AQHHHDLHHXJYJD-UHFFFAOYSA-N 0.000 description 2
- 238000000159 protein binding assay Methods 0.000 description 2
- RXWNCPJZOCPEPQ-NVWDDTSBSA-N puromycin Chemical compound C1=CC(OC)=CC=C1C[C@H](N)C(=O)N[C@H]1[C@@H](O)[C@H](N2C3=NC=NC(=C3N=C2)N(C)C)O[C@@H]1CO RXWNCPJZOCPEPQ-NVWDDTSBSA-N 0.000 description 2
- 230000009467 reduction Effects 0.000 description 2
- 230000008929 regeneration Effects 0.000 description 2
- 238000011069 regeneration method Methods 0.000 description 2
- 230000001105 regulatory effect Effects 0.000 description 2
- 206010039073 rheumatoid arthritis Diseases 0.000 description 2
- 239000012146 running buffer Substances 0.000 description 2
- 108091005418 scavenger receptor class E Proteins 0.000 description 2
- 102000014452 scavenger receptors Human genes 0.000 description 2
- 108010078070 scavenger receptors Proteins 0.000 description 2
- 201000004409 schistosomiasis Diseases 0.000 description 2
- 230000035945 sensitivity Effects 0.000 description 2
- 239000003352 sequestering agent Substances 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- 230000019491 signal transduction Effects 0.000 description 2
- 239000001632 sodium acetate Substances 0.000 description 2
- 235000017281 sodium acetate Nutrition 0.000 description 2
- 125000006850 spacer group Chemical group 0.000 description 2
- 210000000952 spleen Anatomy 0.000 description 2
- 239000003381 stabilizer Substances 0.000 description 2
- 235000000346 sugar Nutrition 0.000 description 2
- 150000008163 sugars Chemical class 0.000 description 2
- 230000020382 suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I Effects 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- 206010043207 temporal arteritis Diseases 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- CWERGRDVMFNCDR-UHFFFAOYSA-N thioglycolic acid Chemical compound OC(=O)CS CWERGRDVMFNCDR-UHFFFAOYSA-N 0.000 description 2
- 125000000341 threoninyl group Chemical group [H]OC([H])(C([H])([H])[H])C([H])(N([H])[H])C(*)=O 0.000 description 2
- WYWHKKSPHMUBEB-UHFFFAOYSA-N tioguanine Chemical compound N1C(N)=NC(=S)C2=C1N=CN2 WYWHKKSPHMUBEB-UHFFFAOYSA-N 0.000 description 2
- 230000008791 toxic response Effects 0.000 description 2
- 238000001890 transfection Methods 0.000 description 2
- LWIHDJKSTIGBAC-UHFFFAOYSA-K tripotassium phosphate Chemical compound [K+].[K+].[K+].[O-]P([O-])([O-])=O LWIHDJKSTIGBAC-UHFFFAOYSA-K 0.000 description 2
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 2
- 238000000108 ultra-filtration Methods 0.000 description 2
- 241001430294 unidentified retrovirus Species 0.000 description 2
- 229960003048 vinblastine Drugs 0.000 description 2
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 2
- 229960004528 vincristine Drugs 0.000 description 2
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 2
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 2
- 230000009385 viral infection Effects 0.000 description 2
- LLXVXPPXELIDGQ-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 3-(2,5-dioxopyrrol-1-yl)benzoate Chemical compound C=1C=CC(N2C(C=CC2=O)=O)=CC=1C(=O)ON1C(=O)CCC1=O LLXVXPPXELIDGQ-UHFFFAOYSA-N 0.000 description 1
- JKHVDAUOODACDU-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 3-(2,5-dioxopyrrol-1-yl)propanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCN1C(=O)C=CC1=O JKHVDAUOODACDU-UHFFFAOYSA-N 0.000 description 1
- DYIOSHGVFJTOAR-JGWLITMVSA-N (2r,3r,4s,5r)-6-sulfanylhexane-1,2,3,4,5-pentol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)CS DYIOSHGVFJTOAR-JGWLITMVSA-N 0.000 description 1
- FDKXTQMXEQVLRF-ZHACJKMWSA-N (E)-dacarbazine Chemical compound CN(C)\N=N\c1[nH]cnc1C(N)=O FDKXTQMXEQVLRF-ZHACJKMWSA-N 0.000 description 1
- IAKHMKGGTNLKSZ-INIZCTEOSA-N (S)-colchicine Chemical compound C1([C@@H](NC(C)=O)CC2)=CC(=O)C(OC)=CC=C1C1=C2C=C(OC)C(OC)=C1OC IAKHMKGGTNLKSZ-INIZCTEOSA-N 0.000 description 1
- ICLYJLBTOGPLMC-KVVVOXFISA-N (z)-octadec-9-enoate;tris(2-hydroxyethyl)azanium Chemical compound OCCN(CCO)CCO.CCCCCCCC\C=C/CCCCCCCC(O)=O ICLYJLBTOGPLMC-KVVVOXFISA-N 0.000 description 1
- NWUYHJFMYQTDRP-UHFFFAOYSA-N 1,2-bis(ethenyl)benzene;1-ethenyl-2-ethylbenzene;styrene Chemical compound C=CC1=CC=CC=C1.CCC1=CC=CC=C1C=C.C=CC1=CC=CC=C1C=C NWUYHJFMYQTDRP-UHFFFAOYSA-N 0.000 description 1
- OWSWOWLMQKUWTE-UHFFFAOYSA-N 1-[5-(2,5-dioxo-3-sulfopyrrolidin-1-yl)oxy-5-oxopentanoyl]oxy-2,5-dioxopyrrolidine-3-sulfonic acid Chemical compound O=C1C(S(=O)(=O)O)CC(=O)N1OC(=O)CCCC(=O)ON1C(=O)C(S(O)(=O)=O)CC1=O OWSWOWLMQKUWTE-UHFFFAOYSA-N 0.000 description 1
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 1
- BAXOFTOLAUCFNW-UHFFFAOYSA-N 1H-indazole Chemical compound C1=CC=C2C=NNC2=C1 BAXOFTOLAUCFNW-UHFFFAOYSA-N 0.000 description 1
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 1
- ALEVUYMOJKJJSA-UHFFFAOYSA-N 4-hydroxy-2-propylbenzoic acid Chemical class CCCC1=CC(O)=CC=C1C(O)=O ALEVUYMOJKJJSA-UHFFFAOYSA-N 0.000 description 1
- MWZTVLNYXAKUKY-LBEKAKSKSA-N 4-hydroxy-N-[2-[(1R,13S)-3-methyl-8-oxo-11-azatetracyclo[8.4.0.01,13.02,7]tetradeca-2,4,6,9-tetraene-11-carbonyl]imidazo[1,2-a]pyridin-6-yl]benzamide Chemical compound C=1([C@]23C[C@@H]3C3)C(C)=CC=CC=1C(=O)C=C2N3C(=O)C(N=C1C=C2)=CN1C=C2NC(=O)C1=CC=C(O)C=C1 MWZTVLNYXAKUKY-LBEKAKSKSA-N 0.000 description 1
- XZIIFPSPUDAGJM-UHFFFAOYSA-N 6-chloro-2-n,2-n-diethylpyrimidine-2,4-diamine Chemical compound CCN(CC)C1=NC(N)=CC(Cl)=N1 XZIIFPSPUDAGJM-UHFFFAOYSA-N 0.000 description 1
- 102100023990 60S ribosomal protein L17 Human genes 0.000 description 1
- 206010069408 Acanthamoeba keratitis Diseases 0.000 description 1
- 206010063409 Acarodermatitis Diseases 0.000 description 1
- 241000256118 Aedes aegypti Species 0.000 description 1
- 241000256173 Aedes albopictus Species 0.000 description 1
- 208000000230 African Trypanosomiasis Diseases 0.000 description 1
- 208000008190 Agammaglobulinemia Diseases 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 208000024827 Alzheimer disease Diseases 0.000 description 1
- 208000004881 Amebiasis Diseases 0.000 description 1
- 206010001935 American trypanosomiasis Diseases 0.000 description 1
- 206010001980 Amoebiasis Diseases 0.000 description 1
- 206010002556 Ankylosing Spondylitis Diseases 0.000 description 1
- 235000002198 Annona diversifolia Nutrition 0.000 description 1
- 208000003343 Antiphospholipid Syndrome Diseases 0.000 description 1
- 241000228212 Aspergillus Species 0.000 description 1
- 241000351920 Aspergillus nidulans Species 0.000 description 1
- 241000228245 Aspergillus niger Species 0.000 description 1
- 201000001320 Atherosclerosis Diseases 0.000 description 1
- 206010003645 Atopy Diseases 0.000 description 1
- 241001203868 Autographa californica Species 0.000 description 1
- 206010003827 Autoimmune hepatitis Diseases 0.000 description 1
- 208000028564 B-cell non-Hodgkin lymphoma Diseases 0.000 description 1
- 239000010755 BS 2869 Class G Substances 0.000 description 1
- 241000194108 Bacillus licheniformis Species 0.000 description 1
- 235000014469 Bacillus subtilis Nutrition 0.000 description 1
- 108091032955 Bacterial small RNA Proteins 0.000 description 1
- 206010004146 Basal cell carcinoma Diseases 0.000 description 1
- 208000023328 Basedow disease Diseases 0.000 description 1
- 208000009137 Behcet syndrome Diseases 0.000 description 1
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Natural products O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 1
- 208000008439 Biliary Liver Cirrhosis Diseases 0.000 description 1
- 208000033222 Biliary cirrhosis primary Diseases 0.000 description 1
- 206010005098 Blastomycosis Diseases 0.000 description 1
- 108010006654 Bleomycin Proteins 0.000 description 1
- 241000255789 Bombyx mori Species 0.000 description 1
- 241000409811 Bombyx mori nucleopolyhedrovirus Species 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- 206010006143 Brain stem glioma Diseases 0.000 description 1
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 1
- 239000004322 Butylated hydroxytoluene Substances 0.000 description 1
- NLZUEZXRPGMBCV-UHFFFAOYSA-N Butylhydroxytoluene Chemical compound CC1=CC(C(C)(C)C)=C(O)C(C(C)(C)C)=C1 NLZUEZXRPGMBCV-UHFFFAOYSA-N 0.000 description 1
- 239000002126 C01EB10 - Adenosine Substances 0.000 description 1
- 102000017420 CD3 protein, epsilon/gamma/delta subunit Human genes 0.000 description 1
- 108050005493 CD3 protein, epsilon/gamma/delta subunit Proteins 0.000 description 1
- 101150013553 CD40 gene Proteins 0.000 description 1
- 201000002829 CREST Syndrome Diseases 0.000 description 1
- 108010021064 CTLA-4 Antigen Proteins 0.000 description 1
- 229940045513 CTLA4 antagonist Drugs 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- 241000282836 Camelus dromedarius Species 0.000 description 1
- 241000222120 Candida <Saccharomycetales> Species 0.000 description 1
- 241000222122 Candida albicans Species 0.000 description 1
- 206010007134 Candida infections Diseases 0.000 description 1
- 241000282465 Canis Species 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- 229920002134 Carboxymethyl cellulose Polymers 0.000 description 1
- 208000031229 Cardiomyopathies Diseases 0.000 description 1
- DLGOEMSEDOSKAD-UHFFFAOYSA-N Carmustine Chemical compound ClCCNC(=O)N(N=O)CCCl DLGOEMSEDOSKAD-UHFFFAOYSA-N 0.000 description 1
- 102100035882 Catalase Human genes 0.000 description 1
- 108010053835 Catalase Proteins 0.000 description 1
- 241000700198 Cavia Species 0.000 description 1
- 241000700199 Cavia porcellus Species 0.000 description 1
- 206010007953 Central nervous system lymphoma Diseases 0.000 description 1
- 208000024699 Chagas disease Diseases 0.000 description 1
- 108091007741 Chimeric antigen receptor T cells Proteins 0.000 description 1
- 241000282552 Chlorocebus aethiops Species 0.000 description 1
- 208000006332 Choriocarcinoma Diseases 0.000 description 1
- 208000030939 Chronic inflammatory demyelinating polyneuropathy Diseases 0.000 description 1
- 208000010833 Chronic myeloid leukaemia Diseases 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- 206010009344 Clonorchiasis Diseases 0.000 description 1
- 241000933851 Cochliomyia Species 0.000 description 1
- 208000015943 Coeliac disease Diseases 0.000 description 1
- 208000011038 Cold agglutinin disease Diseases 0.000 description 1
- 206010009868 Cold type haemolytic anaemia Diseases 0.000 description 1
- 206010009900 Colitis ulcerative Diseases 0.000 description 1
- 108010060123 Conjugate Vaccines Proteins 0.000 description 1
- 108091035707 Consensus sequence Proteins 0.000 description 1
- 229920000742 Cotton Polymers 0.000 description 1
- 208000011231 Crohn disease Diseases 0.000 description 1
- 208000019707 Cryoglobulinemic vasculitis Diseases 0.000 description 1
- 208000008953 Cryptosporidiosis Diseases 0.000 description 1
- 206010011502 Cryptosporidiosis infection Diseases 0.000 description 1
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 1
- 241000701022 Cytomegalovirus Species 0.000 description 1
- 102100039498 Cytotoxic T-lymphocyte protein 4 Human genes 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- GUBGYTABKSRVRQ-WFVLMXAXSA-N DEAE-cellulose Chemical compound OC1C(O)C(O)C(CO)O[C@H]1O[C@@H]1C(CO)OC(O)C(O)C1O GUBGYTABKSRVRQ-WFVLMXAXSA-N 0.000 description 1
- 102000053602 DNA Human genes 0.000 description 1
- WEAHRLBPCANXCN-UHFFFAOYSA-N Daunomycin Natural products CCC1(O)CC(OC2CC(N)C(O)C(C)O2)c3cc4C(=O)c5c(OC)cccc5C(=O)c4c(O)c3C1 WEAHRLBPCANXCN-UHFFFAOYSA-N 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 206010012689 Diabetic retinopathy Diseases 0.000 description 1
- 201000003066 Diffuse Scleroderma Diseases 0.000 description 1
- SHIBSTMRCDJXLN-UHFFFAOYSA-N Digoxigenin Natural products C1CC(C2C(C3(C)CCC(O)CC3CC2)CC2O)(O)C2(C)C1C1=CC(=O)OC1 SHIBSTMRCDJXLN-UHFFFAOYSA-N 0.000 description 1
- 206010013029 Diphyllobothriasis Diseases 0.000 description 1
- 241000255601 Drosophila melanogaster Species 0.000 description 1
- 231100000491 EC50 Toxicity 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- 206010014096 Echinococciasis Diseases 0.000 description 1
- 208000009366 Echinococcosis Diseases 0.000 description 1
- MBYXEBXZARTUSS-QLWBXOBMSA-N Emetamine Natural products O(C)c1c(OC)cc2c(c(C[C@@H]3[C@H](CC)CN4[C@H](c5c(cc(OC)c(OC)c5)CC4)C3)ncc2)c1 MBYXEBXZARTUSS-QLWBXOBMSA-N 0.000 description 1
- 241000588914 Enterobacter Species 0.000 description 1
- 241000588921 Enterobacteriaceae Species 0.000 description 1
- 102100029727 Enteropeptidase Human genes 0.000 description 1
- 108010013369 Enteropeptidase Proteins 0.000 description 1
- 101800003838 Epidermal growth factor Proteins 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- 241000588698 Erwinia Species 0.000 description 1
- 241000588722 Escherichia Species 0.000 description 1
- 241000701959 Escherichia virus Lambda Species 0.000 description 1
- 241001524679 Escherichia virus M13 Species 0.000 description 1
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 1
- 241000206602 Eukaryota Species 0.000 description 1
- 208000016937 Extranodal nasal NK/T cell lymphoma Diseases 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 201000008808 Fibrosarcoma Diseases 0.000 description 1
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 1
- 229930091371 Fructose Natural products 0.000 description 1
- 239000005715 Fructose Substances 0.000 description 1
- RFSUNEUAIZKAJO-ARQDHWQXSA-N Fructose Chemical compound OC[C@H]1O[C@](O)(CO)[C@@H](O)[C@@H]1O RFSUNEUAIZKAJO-ARQDHWQXSA-N 0.000 description 1
- 206010018364 Glomerulonephritis Diseases 0.000 description 1
- 108010073178 Glucan 1,4-alpha-Glucosidase Proteins 0.000 description 1
- 102100022624 Glucoamylase Human genes 0.000 description 1
- 244000068988 Glycine max Species 0.000 description 1
- 235000010469 Glycine max Nutrition 0.000 description 1
- 208000000807 Gnathostomiasis Diseases 0.000 description 1
- 241000219146 Gossypium Species 0.000 description 1
- 108010026389 Gramicidin Proteins 0.000 description 1
- 206010072579 Granulomatosis with polyangiitis Diseases 0.000 description 1
- 208000015023 Graves' disease Diseases 0.000 description 1
- 206010053759 Growth retardation Diseases 0.000 description 1
- 208000035895 Guillain-Barré syndrome Diseases 0.000 description 1
- 239000007995 HEPES buffer Substances 0.000 description 1
- 208000030836 Hashimoto thyroiditis Diseases 0.000 description 1
- 208000006968 Helminthiasis Diseases 0.000 description 1
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 1
- 208000005176 Hepatitis C Diseases 0.000 description 1
- 208000007514 Herpes zoster Diseases 0.000 description 1
- 201000002563 Histoplasmosis Diseases 0.000 description 1
- 101000599940 Homo sapiens Interferon gamma Proteins 0.000 description 1
- 101001002657 Homo sapiens Interleukin-2 Proteins 0.000 description 1
- 101000797332 Homo sapiens Trem-like transcript 2 protein Proteins 0.000 description 1
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 1
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 1
- 241001502974 Human gammaherpesvirus 8 Species 0.000 description 1
- 241000701806 Human papillomavirus Species 0.000 description 1
- 241000829111 Human polyomavirus 1 Species 0.000 description 1
- 206010020983 Hypogammaglobulinaemia Diseases 0.000 description 1
- 201000009794 Idiopathic Pulmonary Fibrosis Diseases 0.000 description 1
- 208000010159 IgA glomerulonephritis Diseases 0.000 description 1
- 206010021263 IgA nephropathy Diseases 0.000 description 1
- 108010073807 IgG Receptors Proteins 0.000 description 1
- 102000009490 IgG Receptors Human genes 0.000 description 1
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 1
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 1
- 208000022559 Inflammatory bowel disease Diseases 0.000 description 1
- 102000004877 Insulin Human genes 0.000 description 1
- 108090001061 Insulin Proteins 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 206010023076 Isosporiasis Diseases 0.000 description 1
- 241000701460 JC polyomavirus Species 0.000 description 1
- 241000588748 Klebsiella Species 0.000 description 1
- 241000235649 Kluyveromyces Species 0.000 description 1
- 241000235058 Komagataella pastoris Species 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 1
- 241000481961 Lachancea thermotolerans Species 0.000 description 1
- 241000235651 Lachancea waltii Species 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 241000282838 Lama Species 0.000 description 1
- 208000018142 Leiomyosarcoma Diseases 0.000 description 1
- 208000004554 Leishmaniasis Diseases 0.000 description 1
- 241000713666 Lentivirus Species 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- NNJVILVZKWQKPM-UHFFFAOYSA-N Lidocaine Chemical compound CCN(CC)CC(=O)NC1=C(C)C=CC=C1C NNJVILVZKWQKPM-UHFFFAOYSA-N 0.000 description 1
- 101710099301 Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- 235000007688 Lycopersicon esculentum Nutrition 0.000 description 1
- 208000016604 Lyme disease Diseases 0.000 description 1
- 208000031422 Lymphocytic Chronic B-Cell Leukemia Diseases 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 1
- PEEHTFAAVSWFBL-UHFFFAOYSA-N Maleimide Chemical compound O=C1NC(=O)C=C1 PEEHTFAAVSWFBL-UHFFFAOYSA-N 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 208000007054 Medullary Carcinoma Diseases 0.000 description 1
- 208000037196 Medullary thyroid carcinoma Diseases 0.000 description 1
- 208000027530 Meniere disease Diseases 0.000 description 1
- 208000002030 Merkel cell carcinoma Diseases 0.000 description 1
- 108700011259 MicroRNAs Proteins 0.000 description 1
- 201000000090 Microsporidiosis Diseases 0.000 description 1
- 206010049567 Miller Fisher syndrome Diseases 0.000 description 1
- VFKZTMPDYBFSTM-KVTDHHQDSA-N Mitobronitol Chemical compound BrC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CBr VFKZTMPDYBFSTM-KVTDHHQDSA-N 0.000 description 1
- 229930192392 Mitomycin Natural products 0.000 description 1
- 208000003250 Mixed connective tissue disease Diseases 0.000 description 1
- 206010028116 Mucosal inflammation Diseases 0.000 description 1
- 102000016943 Muramidase Human genes 0.000 description 1
- 108010014251 Muramidase Proteins 0.000 description 1
- 208000033761 Myelogenous Chronic BCR-ABL Positive Leukemia Diseases 0.000 description 1
- 208000006123 Myiasis Diseases 0.000 description 1
- 108010062010 N-Acetylmuramoyl-L-alanine Amidase Proteins 0.000 description 1
- 230000004988 N-glycosylation Effects 0.000 description 1
- 208000002454 Nasopharyngeal Carcinoma Diseases 0.000 description 1
- 206010061306 Nasopharyngeal cancer Diseases 0.000 description 1
- 241000221960 Neurospora Species 0.000 description 1
- 241000221961 Neurospora crassa Species 0.000 description 1
- 244000061176 Nicotiana tabacum Species 0.000 description 1
- 235000002637 Nicotiana tabacum Nutrition 0.000 description 1
- 101710089460 OTU domain-containing protein 5 Proteins 0.000 description 1
- 102100025194 OTU domain-containing protein 5 Human genes 0.000 description 1
- 101710090551 OTU domain-containing protein 5-A Proteins 0.000 description 1
- 206010030155 Oesophageal carcinoma Diseases 0.000 description 1
- 201000010133 Oligodendroglioma Diseases 0.000 description 1
- 108020005187 Oligonucleotide Probes Proteins 0.000 description 1
- 241000243985 Onchocerca volvulus Species 0.000 description 1
- 208000010195 Onychomycosis Diseases 0.000 description 1
- 108090000854 Oxidoreductases Proteins 0.000 description 1
- 102000004316 Oxidoreductases Human genes 0.000 description 1
- 229930012538 Paclitaxel Natural products 0.000 description 1
- 241001631646 Papillomaviridae Species 0.000 description 1
- 208000030852 Parasitic disease Diseases 0.000 description 1
- 235000019483 Peanut oil Nutrition 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 241000228143 Penicillium Species 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 102000010292 Peptide Elongation Factor 1 Human genes 0.000 description 1
- 108010077524 Peptide Elongation Factor 1 Proteins 0.000 description 1
- 240000007377 Petunia x hybrida Species 0.000 description 1
- 108010004729 Phycoerythrin Proteins 0.000 description 1
- 208000007641 Pinealoma Diseases 0.000 description 1
- 229920000805 Polyaspartic acid Polymers 0.000 description 1
- 206010065159 Polychondritis Diseases 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 208000007048 Polymyalgia Rheumatica Diseases 0.000 description 1
- 239000004372 Polyvinyl alcohol Substances 0.000 description 1
- 206010065857 Primary Effusion Lymphoma Diseases 0.000 description 1
- 208000012654 Primary biliary cholangitis Diseases 0.000 description 1
- 206010036711 Primary mediastinal large B-cell lymphomas Diseases 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 102100033237 Pro-epidermal growth factor Human genes 0.000 description 1
- HCBIBCJNVBAKAB-UHFFFAOYSA-N Procaine hydrochloride Chemical compound Cl.CCN(CC)CCOC(=O)C1=CC=C(N)C=C1 HCBIBCJNVBAKAB-UHFFFAOYSA-N 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 229940124158 Protease/peptidase inhibitor Drugs 0.000 description 1
- 108010029485 Protein Isoforms Proteins 0.000 description 1
- 102000001708 Protein Isoforms Human genes 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 241000588769 Proteus <enterobacteria> Species 0.000 description 1
- 102000007568 Proto-Oncogene Proteins c-fos Human genes 0.000 description 1
- 108010071563 Proto-Oncogene Proteins c-fos Proteins 0.000 description 1
- 208000010362 Protozoan Infections Diseases 0.000 description 1
- 241000589516 Pseudomonas Species 0.000 description 1
- 201000001263 Psoriatic Arthritis Diseases 0.000 description 1
- 208000036824 Psoriatic arthropathy Diseases 0.000 description 1
- 239000012980 RPMI-1640 medium Substances 0.000 description 1
- 241000700157 Rattus norvegicus Species 0.000 description 1
- 208000012322 Raynaud phenomenon Diseases 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 208000033464 Reiter syndrome Diseases 0.000 description 1
- 108700008625 Reporter Genes Proteins 0.000 description 1
- 201000000582 Retinoblastoma Diseases 0.000 description 1
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 1
- 108090000829 Ribosome Inactivating Proteins Proteins 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- AUVVAXYIELKVAI-UHFFFAOYSA-N SJ000285215 Natural products N1CCC2=CC(OC)=C(OC)C=C2C1CC1CC2C3=CC(OC)=C(OC)C=C3CCN2CC1CC AUVVAXYIELKVAI-UHFFFAOYSA-N 0.000 description 1
- SKZKKFZAGNVIMN-UHFFFAOYSA-N Salicilamide Chemical compound NC(=O)C1=CC=CC=C1O SKZKKFZAGNVIMN-UHFFFAOYSA-N 0.000 description 1
- 241000607142 Salmonella Species 0.000 description 1
- 241000293869 Salmonella enterica subsp. enterica serovar Typhimurium Species 0.000 description 1
- 108010084592 Saporins Proteins 0.000 description 1
- 241000447727 Scabies Species 0.000 description 1
- 241000235347 Schizosaccharomyces pombe Species 0.000 description 1
- 241000311088 Schwanniomyces Species 0.000 description 1
- 241001123650 Schwanniomyces occidentalis Species 0.000 description 1
- 206010039710 Scleroderma Diseases 0.000 description 1
- 208000034189 Sclerosis Diseases 0.000 description 1
- 108090000184 Selectins Proteins 0.000 description 1
- 102000003800 Selectins Human genes 0.000 description 1
- 201000010208 Seminoma Diseases 0.000 description 1
- 206010040047 Sepsis Diseases 0.000 description 1
- 241000607768 Shigella Species 0.000 description 1
- 208000021386 Sjogren Syndrome Diseases 0.000 description 1
- 206010041067 Small cell lung cancer Diseases 0.000 description 1
- 240000003768 Solanum lycopersicum Species 0.000 description 1
- 244000061456 Solanum tuberosum Species 0.000 description 1
- 235000002595 Solanum tuberosum Nutrition 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 206010072148 Stiff-Person syndrome Diseases 0.000 description 1
- 241000187747 Streptomyces Species 0.000 description 1
- ZSJLQEPLLKMAKR-UHFFFAOYSA-N Streptozotocin Natural products O=NN(C)C(=O)NC1C(O)OC(CO)C(O)C1O ZSJLQEPLLKMAKR-UHFFFAOYSA-N 0.000 description 1
- 208000006011 Stroke Diseases 0.000 description 1
- 206010042254 Strongyloidiasis Diseases 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 241000282898 Sus scrofa Species 0.000 description 1
- 108091008874 T cell receptors Proteins 0.000 description 1
- 230000005867 T cell response Effects 0.000 description 1
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 1
- 208000001106 Takayasu Arteritis Diseases 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 241001149964 Tolypocladium Species 0.000 description 1
- 241000960387 Torque teno virus Species 0.000 description 1
- 101710120037 Toxin CcdB Proteins 0.000 description 1
- 206010044269 Toxocariasis Diseases 0.000 description 1
- 201000005485 Toxoplasmosis Diseases 0.000 description 1
- 102000004338 Transferrin Human genes 0.000 description 1
- 108090000901 Transferrin Proteins 0.000 description 1
- 206010044608 Trichiniasis Diseases 0.000 description 1
- 241000223259 Trichoderma Species 0.000 description 1
- 241000223109 Trypanosoma cruzi Species 0.000 description 1
- 108090000631 Trypsin Proteins 0.000 description 1
- 102000004142 Trypsin Human genes 0.000 description 1
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 1
- GBOGMAARMMDZGR-UHFFFAOYSA-N UNPD149280 Natural products N1C(=O)C23OC(=O)C=CC(O)CCCC(C)CC=CC3C(O)C(=C)C(C)C2C1CC1=CC=CC=C1 GBOGMAARMMDZGR-UHFFFAOYSA-N 0.000 description 1
- 201000006704 Ulcerative Colitis Diseases 0.000 description 1
- 241000282458 Ursus sp. Species 0.000 description 1
- 206010046851 Uveitis Diseases 0.000 description 1
- 244000000188 Vaccinium ovalifolium Species 0.000 description 1
- 206010047115 Vasculitis Diseases 0.000 description 1
- 208000010285 Ventilator-Induced Lung Injury Diseases 0.000 description 1
- 208000014070 Vestibular schwannoma Diseases 0.000 description 1
- 206010047642 Vitiligo Diseases 0.000 description 1
- 208000033559 Waldenström macroglobulinemia Diseases 0.000 description 1
- 208000010399 Wasting Syndrome Diseases 0.000 description 1
- 208000008383 Wilms tumor Diseases 0.000 description 1
- 241000244005 Wuchereria bancrofti Species 0.000 description 1
- TVXBFESIOXBWNM-UHFFFAOYSA-N Xylitol Natural products OCCC(O)C(O)C(O)CCO TVXBFESIOXBWNM-UHFFFAOYSA-N 0.000 description 1
- 241000235013 Yarrowia Species 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 208000004064 acoustic neuroma Diseases 0.000 description 1
- 208000017733 acquired polycythemia vera Diseases 0.000 description 1
- 229930183665 actinomycin Natural products 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 230000033289 adaptive immune response Effects 0.000 description 1
- 208000009956 adenocarcinoma Diseases 0.000 description 1
- 229960005305 adenosine Drugs 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 230000002776 aggregation Effects 0.000 description 1
- 238000004220 aggregation Methods 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 238000012867 alanine scanning Methods 0.000 description 1
- 208000004631 alopecia areata Diseases 0.000 description 1
- WQZGKKKJIJFFOK-PHYPRBDBSA-N alpha-D-galactose Chemical compound OC[C@H]1O[C@H](O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-PHYPRBDBSA-N 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 239000003708 ampul Substances 0.000 description 1
- 230000003698 anagen phase Effects 0.000 description 1
- 208000007502 anemia Diseases 0.000 description 1
- 229940035674 anesthetics Drugs 0.000 description 1
- 230000033115 angiogenesis Effects 0.000 description 1
- 239000003957 anion exchange resin Substances 0.000 description 1
- 150000001450 anions Chemical class 0.000 description 1
- MWPLVEDNUUSJAV-UHFFFAOYSA-N anthracene Chemical compound C1=CC=CC2=CC3=CC=CC=C3C=C21 MWPLVEDNUUSJAV-UHFFFAOYSA-N 0.000 description 1
- 229940045799 anthracyclines and related substance Drugs 0.000 description 1
- 230000000340 anti-metabolite Effects 0.000 description 1
- 239000000611 antibody drug conjugate Substances 0.000 description 1
- 102000025171 antigen binding proteins Human genes 0.000 description 1
- 108091000831 antigen binding proteins Proteins 0.000 description 1
- 229940100197 antimetabolite Drugs 0.000 description 1
- 239000002256 antimetabolite Substances 0.000 description 1
- 239000003080 antimitotic agent Substances 0.000 description 1
- 238000003782 apoptosis assay Methods 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- PYMYPHUHKUWMLA-UHFFFAOYSA-N arabinose Natural products OCC(O)C(O)C(O)C=O PYMYPHUHKUWMLA-UHFFFAOYSA-N 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 201000009361 ascariasis Diseases 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 229960005070 ascorbic acid Drugs 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- 229960003852 atezolizumab Drugs 0.000 description 1
- 239000012298 atmosphere Substances 0.000 description 1
- 208000010668 atopic eczema Diseases 0.000 description 1
- 230000001363 autoimmune Effects 0.000 description 1
- 201000000448 autoimmune hemolytic anemia Diseases 0.000 description 1
- 208000036923 autoimmune primary adrenal insufficiency Diseases 0.000 description 1
- 201000008680 babesiosis Diseases 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 244000052616 bacterial pathogen Species 0.000 description 1
- 230000003385 bacteriostatic effect Effects 0.000 description 1
- 208000007456 balantidiasis Diseases 0.000 description 1
- 201000010642 baylisascariasis Diseases 0.000 description 1
- 229960000686 benzalkonium chloride Drugs 0.000 description 1
- UREZNYTWGJKWBI-UHFFFAOYSA-M benzethonium chloride Chemical compound [Cl-].C1=CC(C(C)(C)CC(C)(C)C)=CC=C1OCCOCC[N+](C)(C)CC1=CC=CC=C1 UREZNYTWGJKWBI-UHFFFAOYSA-M 0.000 description 1
- 229960001950 benzethonium chloride Drugs 0.000 description 1
- CADWTSSKOVRVJC-UHFFFAOYSA-N benzyl(dimethyl)azanium;chloride Chemical compound [Cl-].C[NH+](C)CC1=CC=CC=C1 CADWTSSKOVRVJC-UHFFFAOYSA-N 0.000 description 1
- 108010081355 beta 2-Microglobulin Proteins 0.000 description 1
- SRBFZHDQGSBBOR-UHFFFAOYSA-N beta-D-Pyranose-Lyxose Natural products OC1COC(O)C(O)C1O SRBFZHDQGSBBOR-UHFFFAOYSA-N 0.000 description 1
- 102000005936 beta-Galactosidase Human genes 0.000 description 1
- 108010005774 beta-Galactosidase Proteins 0.000 description 1
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Natural products O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 1
- 201000007180 bile duct carcinoma Diseases 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 229960001561 bleomycin Drugs 0.000 description 1
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 1
- RSIHSRDYCUFFLA-DYKIIFRCSA-N boldenone Chemical compound O=C1C=C[C@]2(C)[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 RSIHSRDYCUFFLA-DYKIIFRCSA-N 0.000 description 1
- 210000000481 breast Anatomy 0.000 description 1
- 201000008275 breast carcinoma Diseases 0.000 description 1
- 208000014581 breast ductal adenocarcinoma Diseases 0.000 description 1
- 201000010983 breast ductal carcinoma Diseases 0.000 description 1
- 201000003714 breast lobular carcinoma Diseases 0.000 description 1
- 208000003362 bronchogenic carcinoma Diseases 0.000 description 1
- 229960002092 busulfan Drugs 0.000 description 1
- 235000010354 butylated hydroxytoluene Nutrition 0.000 description 1
- 229940095259 butylated hydroxytoluene Drugs 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- BPKIGYQJPYCAOW-FFJTTWKXSA-I calcium;potassium;disodium;(2s)-2-hydroxypropanoate;dichloride;dihydroxide;hydrate Chemical compound O.[OH-].[OH-].[Na+].[Na+].[Cl-].[Cl-].[K+].[Ca+2].C[C@H](O)C([O-])=O BPKIGYQJPYCAOW-FFJTTWKXSA-I 0.000 description 1
- BMLSTPRTEKLIPM-UHFFFAOYSA-I calcium;potassium;disodium;hydrogen carbonate;dichloride;dihydroxide;hydrate Chemical compound O.[OH-].[OH-].[Na+].[Na+].[Cl-].[Cl-].[K+].[Ca+2].OC([O-])=O BMLSTPRTEKLIPM-UHFFFAOYSA-I 0.000 description 1
- 208000035269 cancer or benign tumor Diseases 0.000 description 1
- 201000003984 candidiasis Diseases 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- 235000010948 carboxy methyl cellulose Nutrition 0.000 description 1
- 239000008112 carboxymethyl-cellulose Substances 0.000 description 1
- 229960005243 carmustine Drugs 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 239000003729 cation exchange resin Substances 0.000 description 1
- 210000000182 cd11c+cd123- dc Anatomy 0.000 description 1
- 230000030833 cell death Effects 0.000 description 1
- 230000006037 cell lysis Effects 0.000 description 1
- 230000007969 cellular immunity Effects 0.000 description 1
- 230000019522 cellular metabolic process Effects 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 208000019065 cervical carcinoma Diseases 0.000 description 1
- NDAYQJDHGXTBJL-MWWSRJDJSA-N chembl557217 Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@@H](CC(C)C)NC(=O)[C@H](CC=3C4=CC=CC=C4NC=3)NC(=O)[C@@H](CC(C)C)NC(=O)[C@H](CC=3C4=CC=CC=C4NC=3)NC(=O)[C@@H](CC(C)C)NC(=O)[C@H](CC=3C4=CC=CC=C4NC=3)NC(=O)[C@@H](C(C)C)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](C(C)C)NC(=O)[C@H](C)NC(=O)[C@H](NC(=O)CNC(=O)[C@@H](NC=O)C(C)C)CC(C)C)C(=O)NCCO)=CNC2=C1 NDAYQJDHGXTBJL-MWWSRJDJSA-N 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- 229960004630 chlorambucil Drugs 0.000 description 1
- JCKYGMPEJWAADB-UHFFFAOYSA-N chlorambucil Chemical compound OC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 JCKYGMPEJWAADB-UHFFFAOYSA-N 0.000 description 1
- 229960004926 chlorobutanol Drugs 0.000 description 1
- 238000011098 chromatofocusing Methods 0.000 description 1
- 208000019069 chronic childhood arthritis Diseases 0.000 description 1
- 201000005795 chronic inflammatory demyelinating polyneuritis Diseases 0.000 description 1
- 208000032852 chronic lymphocytic leukemia Diseases 0.000 description 1
- 229960004316 cisplatin Drugs 0.000 description 1
- 239000007979 citrate buffer Substances 0.000 description 1
- 239000013599 cloning vector Substances 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 206010009887 colitis Diseases 0.000 description 1
- 210000001072 colon Anatomy 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 230000000052 comparative effect Effects 0.000 description 1
- 230000009137 competitive binding Effects 0.000 description 1
- 238000010668 complexation reaction Methods 0.000 description 1
- 238000012790 confirmation Methods 0.000 description 1
- 229940031670 conjugate vaccine Drugs 0.000 description 1
- 108091036078 conserved sequence Proteins 0.000 description 1
- 239000005289 controlled pore glass Substances 0.000 description 1
- 230000001276 controlling effect Effects 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 229920001577 copolymer Polymers 0.000 description 1
- 235000005687 corn oil Nutrition 0.000 description 1
- 239000002285 corn oil Substances 0.000 description 1
- 235000012343 cottonseed oil Nutrition 0.000 description 1
- 239000002385 cottonseed oil Substances 0.000 description 1
- 150000001896 cresols Chemical class 0.000 description 1
- 238000004132 cross linking Methods 0.000 description 1
- 230000037029 cross reaction Effects 0.000 description 1
- 230000009260 cross reactivity Effects 0.000 description 1
- 201000003278 cryoglobulinemia Diseases 0.000 description 1
- 208000017763 cutaneous neuroendocrine carcinoma Diseases 0.000 description 1
- 229940097362 cyclodextrins Drugs 0.000 description 1
- 201000008167 cystoisosporiasis Diseases 0.000 description 1
- 229960000684 cytarabine Drugs 0.000 description 1
- GBOGMAARMMDZGR-TYHYBEHESA-N cytochalasin B Chemical compound C([C@H]1[C@@H]2[C@@H](C([C@@H](O)[C@@H]3/C=C/C[C@H](C)CCC[C@@H](O)/C=C/C(=O)O[C@@]23C(=O)N1)=C)C)C1=CC=CC=C1 GBOGMAARMMDZGR-TYHYBEHESA-N 0.000 description 1
- GBOGMAARMMDZGR-JREHFAHYSA-N cytochalasin B Natural products C[C@H]1CCC[C@@H](O)C=CC(=O)O[C@@]23[C@H](C=CC1)[C@H](O)C(=C)[C@@H](C)[C@@H]2[C@H](Cc4ccccc4)NC3=O GBOGMAARMMDZGR-JREHFAHYSA-N 0.000 description 1
- 210000005220 cytoplasmic tail Anatomy 0.000 description 1
- 230000001472 cytotoxic effect Effects 0.000 description 1
- 125000001295 dansyl group Chemical group [H]C1=C([H])C(N(C([H])([H])[H])C([H])([H])[H])=C2C([H])=C([H])C([H])=C(C2=C1[H])S(*)(=O)=O 0.000 description 1
- 230000009615 deamination Effects 0.000 description 1
- 238000006481 deamination reaction Methods 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- RSIHSRDYCUFFLA-UHFFFAOYSA-N dehydrotestosterone Natural products O=C1C=CC2(C)C3CCC(C)(C(CC4)O)C4C3CCC2=C1 RSIHSRDYCUFFLA-UHFFFAOYSA-N 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 230000001627 detrimental effect Effects 0.000 description 1
- 239000008355 dextrose injection Substances 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- QONQRTHLHBTMGP-UHFFFAOYSA-N digitoxigenin Natural products CC12CCC(C3(CCC(O)CC3CC3)C)C3C11OC1CC2C1=CC(=O)OC1 QONQRTHLHBTMGP-UHFFFAOYSA-N 0.000 description 1
- SHIBSTMRCDJXLN-KCZCNTNESA-N digoxigenin Chemical compound C1([C@@H]2[C@@]3([C@@](CC2)(O)[C@H]2[C@@H]([C@@]4(C)CC[C@H](O)C[C@H]4CC2)C[C@H]3O)C)=CC(=O)OC1 SHIBSTMRCDJXLN-KCZCNTNESA-N 0.000 description 1
- KZNICNPSHKQLFF-UHFFFAOYSA-N dihydromaleimide Natural products O=C1CCC(=O)N1 KZNICNPSHKQLFF-UHFFFAOYSA-N 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- 230000003467 diminishing effect Effects 0.000 description 1
- 239000007884 disintegrant Substances 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 230000007783 downstream signaling Effects 0.000 description 1
- 208000008576 dracunculiasis Diseases 0.000 description 1
- 208000006036 elephantiasis Diseases 0.000 description 1
- 239000012149 elution buffer Substances 0.000 description 1
- AUVVAXYIELKVAI-CKBKHPSWSA-N emetine Chemical compound N1CCC2=CC(OC)=C(OC)C=C2[C@H]1C[C@H]1C[C@H]2C3=CC(OC)=C(OC)C=C3CCN2C[C@@H]1CC AUVVAXYIELKVAI-CKBKHPSWSA-N 0.000 description 1
- 229960002694 emetine Drugs 0.000 description 1
- AUVVAXYIELKVAI-UWBTVBNJSA-N emetine Natural products N1CCC2=CC(OC)=C(OC)C=C2[C@H]1C[C@H]1C[C@H]2C3=CC(OC)=C(OC)C=C3CCN2C[C@H]1CC AUVVAXYIELKVAI-UWBTVBNJSA-N 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 206010014881 enterobiasis Diseases 0.000 description 1
- 229940116977 epidermal growth factor Drugs 0.000 description 1
- 230000007705 epithelial mesenchymal transition Effects 0.000 description 1
- 201000004101 esophageal cancer Diseases 0.000 description 1
- 238000012869 ethanol precipitation Methods 0.000 description 1
- ZMMJGEGLRURXTF-UHFFFAOYSA-N ethidium bromide Chemical compound [Br-].C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CC)=C1C1=CC=CC=C1 ZMMJGEGLRURXTF-UHFFFAOYSA-N 0.000 description 1
- 229960005542 ethidium bromide Drugs 0.000 description 1
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 1
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 1
- 229960005420 etoposide Drugs 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 208000006275 fascioliasis Diseases 0.000 description 1
- 206010016235 fasciolopsiasis Diseases 0.000 description 1
- 239000012091 fetal bovine serum Substances 0.000 description 1
- 210000002458 fetal heart Anatomy 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 1
- 229960002949 fluorouracil Drugs 0.000 description 1
- 238000005194 fractionation Methods 0.000 description 1
- 230000001408 fungistatic effect Effects 0.000 description 1
- ZZUFCTLCJUWOSV-UHFFFAOYSA-N furosemide Chemical compound C1=C(Cl)C(S(=O)(=O)N)=CC(C(O)=O)=C1NCC1=CC=CO1 ZZUFCTLCJUWOSV-UHFFFAOYSA-N 0.000 description 1
- 108020001507 fusion proteins Proteins 0.000 description 1
- 102000037865 fusion proteins Human genes 0.000 description 1
- 229930182830 galactose Natural products 0.000 description 1
- 108010074605 gamma-Globulins Proteins 0.000 description 1
- 208000010749 gastric carcinoma Diseases 0.000 description 1
- 230000002496 gastric effect Effects 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 239000003193 general anesthetic agent Substances 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 201000006592 giardiasis Diseases 0.000 description 1
- 208000005017 glioblastoma Diseases 0.000 description 1
- 239000003862 glucocorticoid Substances 0.000 description 1
- 235000001727 glucose Nutrition 0.000 description 1
- JFCQEDHGNNZCLN-UHFFFAOYSA-N glutaric acid Chemical compound OC(=O)CCCC(O)=O JFCQEDHGNNZCLN-UHFFFAOYSA-N 0.000 description 1
- 201000000128 gnathomiasis Diseases 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 229910052737 gold Inorganic materials 0.000 description 1
- 239000010931 gold Substances 0.000 description 1
- 208000024908 graft versus host disease Diseases 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 201000009277 hairy cell leukemia Diseases 0.000 description 1
- 125000005179 haloacetyl group Chemical group 0.000 description 1
- 210000003128 head Anatomy 0.000 description 1
- 208000025750 heavy chain disease Diseases 0.000 description 1
- 201000002222 hemangioblastoma Diseases 0.000 description 1
- 208000019691 hematopoietic and lymphoid cell neoplasm Diseases 0.000 description 1
- 208000007475 hemolytic anemia Diseases 0.000 description 1
- 229960002897 heparin Drugs 0.000 description 1
- 229920000669 heparin Polymers 0.000 description 1
- 208000002672 hepatitis B Diseases 0.000 description 1
- 239000000833 heterodimer Substances 0.000 description 1
- 238000005734 heterodimerization reaction Methods 0.000 description 1
- 238000000589 high-performance liquid chromatography-mass spectrometry Methods 0.000 description 1
- 210000003630 histaminocyte Anatomy 0.000 description 1
- 125000000487 histidyl group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C([H])=N1 0.000 description 1
- 210000003701 histiocyte Anatomy 0.000 description 1
- 230000006801 homologous recombination Effects 0.000 description 1
- 238000002744 homologous recombination Methods 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 208000029080 human African trypanosomiasis Diseases 0.000 description 1
- 230000004727 humoral immunity Effects 0.000 description 1
- 239000001257 hydrogen Substances 0.000 description 1
- 238000004191 hydrophobic interaction chromatography Methods 0.000 description 1
- 125000002349 hydroxyamino group Chemical group [H]ON([H])[*] 0.000 description 1
- 238000012872 hydroxylapatite chromatography Methods 0.000 description 1
- 239000001866 hydroxypropyl methyl cellulose Substances 0.000 description 1
- 229920003088 hydroxypropyl methyl cellulose Polymers 0.000 description 1
- 235000010979 hydroxypropyl methyl cellulose Nutrition 0.000 description 1
- UFVKGYZPFZQRLF-UHFFFAOYSA-N hydroxypropyl methyl cellulose Chemical compound OC1C(O)C(OC)OC(CO)C1OC1C(O)C(O)C(OC2C(C(O)C(OC3C(C(O)C(O)C(CO)O3)O)C(CO)O2)O)C(CO)O1 UFVKGYZPFZQRLF-UHFFFAOYSA-N 0.000 description 1
- 208000007188 hymenolepiasis Diseases 0.000 description 1
- 239000007946 hypodermic tablet Substances 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 230000005746 immune checkpoint blockade Effects 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 238000010166 immunofluorescence Methods 0.000 description 1
- 230000002998 immunogenetic effect Effects 0.000 description 1
- 230000005847 immunogenicity Effects 0.000 description 1
- 230000016784 immunoglobulin production Effects 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 230000008595 infiltration Effects 0.000 description 1
- 238000001764 infiltration Methods 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 239000004615 ingredient Substances 0.000 description 1
- 208000030603 inherited susceptibility to asthma Diseases 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 239000007972 injectable composition Substances 0.000 description 1
- 238000011081 inoculation Methods 0.000 description 1
- 150000002484 inorganic compounds Chemical class 0.000 description 1
- 229910010272 inorganic material Inorganic materials 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 229940125396 insulin Drugs 0.000 description 1
- 102000006495 integrins Human genes 0.000 description 1
- 108010044426 integrins Proteins 0.000 description 1
- 230000002687 intercalation Effects 0.000 description 1
- 238000009830 intercalation Methods 0.000 description 1
- 208000036971 interstitial lung disease 2 Diseases 0.000 description 1
- 230000000968 intestinal effect Effects 0.000 description 1
- 201000006675 intestinal schistosomiasis Diseases 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 230000009545 invasion Effects 0.000 description 1
- 206010073095 invasive ductal breast carcinoma Diseases 0.000 description 1
- 238000005342 ion exchange Methods 0.000 description 1
- 238000004255 ion exchange chromatography Methods 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- 230000002147 killing effect Effects 0.000 description 1
- 239000004310 lactic acid Substances 0.000 description 1
- 235000014655 lactic acid Nutrition 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 208000028454 lice infestation Diseases 0.000 description 1
- 229960004194 lidocaine Drugs 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 239000006194 liquid suspension Substances 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 239000003589 local anesthetic agent Substances 0.000 description 1
- 229960005015 local anesthetics Drugs 0.000 description 1
- 229960002247 lomustine Drugs 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 210000005265 lung cell Anatomy 0.000 description 1
- 206010025135 lupus erythematosus Diseases 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 210000003712 lysosome Anatomy 0.000 description 1
- 230000001868 lysosomic effect Effects 0.000 description 1
- 239000004325 lysozyme Substances 0.000 description 1
- 235000010335 lysozyme Nutrition 0.000 description 1
- 229960000274 lysozyme Drugs 0.000 description 1
- 239000011777 magnesium Substances 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- ZLNQQNXFFQJAID-UHFFFAOYSA-L magnesium carbonate Chemical compound [Mg+2].[O-]C([O-])=O ZLNQQNXFFQJAID-UHFFFAOYSA-L 0.000 description 1
- 239000001095 magnesium carbonate Substances 0.000 description 1
- 229910000021 magnesium carbonate Inorganic materials 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 201000004792 malaria Diseases 0.000 description 1
- 230000036210 malignancy Effects 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 238000013411 master cell bank Methods 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 229960004961 mechlorethamine Drugs 0.000 description 1
- HAWPXGHAZFHHAD-UHFFFAOYSA-N mechlorethamine Chemical compound ClCCN(C)CCCl HAWPXGHAZFHHAD-UHFFFAOYSA-N 0.000 description 1
- 238000002483 medication Methods 0.000 description 1
- 229960001924 melphalan Drugs 0.000 description 1
- SGDBTWWWUNNDEQ-LBPRGKRZSA-N melphalan Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 SGDBTWWWUNNDEQ-LBPRGKRZSA-N 0.000 description 1
- 229960001428 mercaptopurine Drugs 0.000 description 1
- HEBKCHPVOIAQTA-UHFFFAOYSA-N meso ribitol Natural products OCC(O)C(O)C(O)CO HEBKCHPVOIAQTA-UHFFFAOYSA-N 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 201000001198 metagonimiasis Diseases 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- 108091070501 miRNA Proteins 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 238000001768 microscale thermophoresis Methods 0.000 description 1
- 238000013508 migration Methods 0.000 description 1
- 230000005012 migration Effects 0.000 description 1
- 229960005485 mitobronitol Drugs 0.000 description 1
- 229960001156 mitoxantrone Drugs 0.000 description 1
- KKZJGLLVHKMTCM-UHFFFAOYSA-N mitoxantrone Chemical compound O=C1C2=C(O)C=CC(O)=C2C(=O)C2=C1C(NCCNCCO)=CC=C2NCCNCCO KKZJGLLVHKMTCM-UHFFFAOYSA-N 0.000 description 1
- PJUIMOJAAPLTRJ-UHFFFAOYSA-N monothioglycerol Chemical compound OCC(O)CS PJUIMOJAAPLTRJ-UHFFFAOYSA-N 0.000 description 1
- 238000010172 mouse model Methods 0.000 description 1
- 229940126619 mouse monoclonal antibody Drugs 0.000 description 1
- 206010028417 myasthenia gravis Diseases 0.000 description 1
- 208000001611 myxosarcoma Diseases 0.000 description 1
- VQAFBYLFRCCWNB-GOSISDBHSA-N n-[2-[(1s)-1-(chloromethyl)-5-hydroxy-9-methyl-1,2-dihydrobenzo[e]indole-3-carbonyl]imidazo[1,2-a]pyridin-6-yl]-4-hydroxybenzamide Chemical compound C1([C@H](CCl)C2)=C3C(C)=CC=CC3=C(O)C=C1N2C(=O)C(N=C1C=C2)=CN1C=C2NC(=O)C1=CC=C(O)C=C1 VQAFBYLFRCCWNB-GOSISDBHSA-N 0.000 description 1
- 201000011216 nasopharynx carcinoma Diseases 0.000 description 1
- 210000000822 natural killer cell Anatomy 0.000 description 1
- 108010068617 neonatal Fc receptor Proteins 0.000 description 1
- 208000025189 neoplasm of testis Diseases 0.000 description 1
- 230000001613 neoplastic effect Effects 0.000 description 1
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 1
- 239000000346 nonvolatile oil Substances 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- 239000002751 oligonucleotide probe Substances 0.000 description 1
- 229920001542 oligosaccharide Polymers 0.000 description 1
- 150000002482 oligosaccharides Chemical group 0.000 description 1
- 229940121476 omburtamab Drugs 0.000 description 1
- 208000002042 onchocerciasis Diseases 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 230000001582 osteoblastic effect Effects 0.000 description 1
- 201000008968 osteosarcoma Diseases 0.000 description 1
- 239000006179 pH buffering agent Substances 0.000 description 1
- 229960001592 paclitaxel Drugs 0.000 description 1
- 230000000242 pagocytic effect Effects 0.000 description 1
- 208000004019 papillary adenocarcinoma Diseases 0.000 description 1
- 201000010198 papillary carcinoma Diseases 0.000 description 1
- 244000045947 parasite Species 0.000 description 1
- 208000014837 parasitic helminthiasis infectious disease Diseases 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 239000000312 peanut oil Substances 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 238000002823 phage display Methods 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 150000002989 phenols Chemical class 0.000 description 1
- WVDDGKGOMKODPV-ZQBYOMGUSA-N phenyl(114C)methanol Chemical compound O[14CH2]C1=CC=CC=C1 WVDDGKGOMKODPV-ZQBYOMGUSA-N 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 208000024724 pineal body neoplasm Diseases 0.000 description 1
- 201000004123 pineal gland cancer Diseases 0.000 description 1
- 210000002826 placenta Anatomy 0.000 description 1
- 208000007525 plasmablastic lymphoma Diseases 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 229910052697 platinum Inorganic materials 0.000 description 1
- 108010054442 polyalanine Proteins 0.000 description 1
- 201000006292 polyarteritis nodosa Diseases 0.000 description 1
- 108010064470 polyaspartate Proteins 0.000 description 1
- 208000037244 polycythemia vera Diseases 0.000 description 1
- 208000005987 polymyositis Diseases 0.000 description 1
- 239000000244 polyoxyethylene sorbitan monooleate Substances 0.000 description 1
- 229940068968 polysorbate 80 Drugs 0.000 description 1
- 229920002451 polyvinyl alcohol Polymers 0.000 description 1
- 230000004492 positive regulation of T cell proliferation Effects 0.000 description 1
- 230000016412 positive regulation of cytokine production Effects 0.000 description 1
- 208000017805 post-transplant lymphoproliferative disease Diseases 0.000 description 1
- 230000001124 posttranscriptional effect Effects 0.000 description 1
- 229910000160 potassium phosphate Inorganic materials 0.000 description 1
- 235000011009 potassium phosphates Nutrition 0.000 description 1
- 230000035935 pregnancy Effects 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 208000016800 primary central nervous system lymphoma Diseases 0.000 description 1
- 229960004919 procaine Drugs 0.000 description 1
- MFDFERRIHVXMIY-UHFFFAOYSA-N procaine Chemical compound CCN(CC)CCOC(=O)C1=CC=C(N)C=C1 MFDFERRIHVXMIY-UHFFFAOYSA-N 0.000 description 1
- 229960001309 procaine hydrochloride Drugs 0.000 description 1
- 229940002612 prodrug Drugs 0.000 description 1
- 239000000651 prodrug Substances 0.000 description 1
- 238000004393 prognosis Methods 0.000 description 1
- 230000005522 programmed cell death Effects 0.000 description 1
- 230000000770 proinflammatory effect Effects 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 230000000644 propagated effect Effects 0.000 description 1
- 229960003712 propranolol Drugs 0.000 description 1
- 239000000473 propyl gallate Substances 0.000 description 1
- 235000010388 propyl gallate Nutrition 0.000 description 1
- 229940075579 propyl gallate Drugs 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 229950010131 puromycin Drugs 0.000 description 1
- HNJBEVLQSNELDL-UHFFFAOYSA-N pyrrolidin-2-one Chemical compound O=C1CCCN1 HNJBEVLQSNELDL-UHFFFAOYSA-N 0.000 description 1
- 238000003044 randomized block design Methods 0.000 description 1
- 208000002574 reactive arthritis Diseases 0.000 description 1
- 230000009257 reactivity Effects 0.000 description 1
- 238000001525 receptor binding assay Methods 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 208000015347 renal cell adenocarcinoma Diseases 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 238000004007 reversed phase HPLC Methods 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 201000009410 rhabdomyosarcoma Diseases 0.000 description 1
- 201000003068 rheumatic fever Diseases 0.000 description 1
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 1
- CVHZOJJKTDOEJC-UHFFFAOYSA-N saccharin Chemical compound C1=CC=C2C(=O)NS(=O)(=O)C2=C1 CVHZOJJKTDOEJC-UHFFFAOYSA-N 0.000 description 1
- 238000005185 salting out Methods 0.000 description 1
- 239000000523 sample Substances 0.000 description 1
- 201000000306 sarcoidosis Diseases 0.000 description 1
- 208000005687 scabies Diseases 0.000 description 1
- HFHDHCJBZVLPGP-UHFFFAOYSA-N schardinger α-dextrin Chemical compound O1C(C(C2O)O)C(CO)OC2OC(C(C2O)O)C(CO)OC2OC(C(C2O)O)C(CO)OC2OC(C(O)C2O)C(CO)OC2OC(C(C2O)O)C(CO)OC2OC2C(O)C(O)C1OC2CO HFHDHCJBZVLPGP-UHFFFAOYSA-N 0.000 description 1
- 238000007423 screening assay Methods 0.000 description 1
- 201000008407 sebaceous adenocarcinoma Diseases 0.000 description 1
- 210000000717 sertoli cell Anatomy 0.000 description 1
- 239000008159 sesame oil Substances 0.000 description 1
- 235000011803 sesame oil Nutrition 0.000 description 1
- 230000003584 silencer Effects 0.000 description 1
- 239000000377 silicon dioxide Substances 0.000 description 1
- 201000002612 sleeping sickness Diseases 0.000 description 1
- 208000000587 small cell lung carcinoma Diseases 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 229960004249 sodium acetate Drugs 0.000 description 1
- WBHQBSYUUJJSRZ-UHFFFAOYSA-M sodium bisulfate Chemical compound [Na+].OS([O-])(=O)=O WBHQBSYUUJJSRZ-UHFFFAOYSA-M 0.000 description 1
- 229910000342 sodium bisulfate Inorganic materials 0.000 description 1
- 239000008354 sodium chloride injection Substances 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- 239000001488 sodium phosphate Substances 0.000 description 1
- 229910000162 sodium phosphate Inorganic materials 0.000 description 1
- AKHNMLFCWUSKQB-UHFFFAOYSA-L sodium thiosulfate Chemical compound [Na+].[Na+].[O-]S([O-])(=O)=S AKHNMLFCWUSKQB-UHFFFAOYSA-L 0.000 description 1
- 235000019345 sodium thiosulphate Nutrition 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 239000008137 solubility enhancer Substances 0.000 description 1
- 229940035044 sorbitan monolaurate Drugs 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 238000011146 sterile filtration Methods 0.000 description 1
- 239000008223 sterile water Substances 0.000 description 1
- 201000000498 stomach carcinoma Diseases 0.000 description 1
- 229960001052 streptozocin Drugs 0.000 description 1
- ZSJLQEPLLKMAKR-GKHCUFPYSA-N streptozocin Chemical compound O=NN(C)C(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O ZSJLQEPLLKMAKR-GKHCUFPYSA-N 0.000 description 1
- 229960002317 succinimide Drugs 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 238000004114 suspension culture Methods 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 201000010965 sweat gland carcinoma Diseases 0.000 description 1
- 208000011580 syndromic disease Diseases 0.000 description 1
- 238000010189 synthetic method Methods 0.000 description 1
- 239000006188 syrup Substances 0.000 description 1
- 235000020357 syrup Nutrition 0.000 description 1
- 229940037128 systemic glucocorticoids Drugs 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- 208000004441 taeniasis Diseases 0.000 description 1
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 1
- 229940066453 tecentriq Drugs 0.000 description 1
- NRUKOCRGYNPUPR-QBPJDGROSA-N teniposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@@H](OC[C@H]4O3)C=3SC=CC=3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 NRUKOCRGYNPUPR-QBPJDGROSA-N 0.000 description 1
- 229960001278 teniposide Drugs 0.000 description 1
- 229960002372 tetracaine Drugs 0.000 description 1
- GKCBAIGFKIBETG-UHFFFAOYSA-N tetracaine Chemical compound CCCCNC1=CC=C(C(=O)OCCN(C)C)C=C1 GKCBAIGFKIBETG-UHFFFAOYSA-N 0.000 description 1
- MPLHNVLQVRSVEE-UHFFFAOYSA-N texas red Chemical compound [O-]S(=O)(=O)C1=CC(S(Cl)(=O)=O)=CC=C1C(C1=CC=2CCCN3CCCC(C=23)=C1O1)=C2C1=C(CCC1)C3=[N+]1CCCC3=C2 MPLHNVLQVRSVEE-UHFFFAOYSA-N 0.000 description 1
- 230000004797 therapeutic response Effects 0.000 description 1
- 239000002562 thickening agent Substances 0.000 description 1
- RTKIYNMVFMVABJ-UHFFFAOYSA-L thimerosal Chemical compound [Na+].CC[Hg]SC1=CC=CC=C1C([O-])=O RTKIYNMVFMVABJ-UHFFFAOYSA-L 0.000 description 1
- 229940033663 thimerosal Drugs 0.000 description 1
- 229940035024 thioglycerol Drugs 0.000 description 1
- 229940104230 thymidine Drugs 0.000 description 1
- 210000001541 thymus gland Anatomy 0.000 description 1
- 208000013077 thyroid gland carcinoma Diseases 0.000 description 1
- 208000013818 thyroid gland medullary carcinoma Diseases 0.000 description 1
- 201000005882 tinea unguium Diseases 0.000 description 1
- 229960003087 tioguanine Drugs 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 235000013619 trace mineral Nutrition 0.000 description 1
- 239000011573 trace mineral Substances 0.000 description 1
- 230000005026 transcription initiation Effects 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 239000012581 transferrin Substances 0.000 description 1
- 238000002054 transplantation Methods 0.000 description 1
- 208000003982 trichinellosis Diseases 0.000 description 1
- 201000007588 trichinosis Diseases 0.000 description 1
- 208000009920 trichuriasis Diseases 0.000 description 1
- 229940117013 triethanolamine oleate Drugs 0.000 description 1
- 201000002311 trypanosomiasis Diseases 0.000 description 1
- 239000012588 trypsin Substances 0.000 description 1
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 description 1
- 208000035408 type 1 diabetes mellitus 1 Diseases 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 241001515965 unidentified phage Species 0.000 description 1
- VBEQCZHXXJYVRD-GACYYNSASA-N uroanthelone Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CS)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)C(C)C)[C@@H](C)O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CCSC)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)CNC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CS)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CS)NC(=O)CNC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(N)=O)C(C)C)[C@@H](C)CC)C1=CC=C(O)C=C1 VBEQCZHXXJYVRD-GACYYNSASA-N 0.000 description 1
- 235000013311 vegetables Nutrition 0.000 description 1
- 229920002554 vinyl polymer Polymers 0.000 description 1
- 239000013603 viral vector Substances 0.000 description 1
- 239000008215 water for injection Substances 0.000 description 1
- 229920003169 water-soluble polymer Polymers 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- 238000009736 wetting Methods 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- 239000000811 xylitol Substances 0.000 description 1
- 235000010447 xylitol Nutrition 0.000 description 1
- HEBKCHPVOIAQTA-SCDXWVJYSA-N xylitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)CO HEBKCHPVOIAQTA-SCDXWVJYSA-N 0.000 description 1
- 229960002675 xylitol Drugs 0.000 description 1
Definitions
- the present disclosure generally relates to novel multi-specific antibodies targeting CD276 and one or more additional targets.
- B7-H3 (CD276, UniProt IDs for human amino acid sequence: Q5ZPR3 and mouse amino acid sequence: Q8VE98) is an important newly found immune checkpoint member of the B7 and CD28 families, which is a type I transmembrane co-stimulatory molecule, existing in two isoforms determined by its extracellular domain.
- the extracellular domain consists of a single pair of immunoglobulin variable (IgV) -like and immunoglobulin constant (IgC) -like domains, whereas in humans it consists of one pair (2Ig-B7-H3) or two identical pairs (4Ig-B7-H3) due to exon duplication.
- B7-H3 mRNA is widely distributed in most tissues; in contrast, B7-H3 protein has a very limited expression on normal tissues because of its post-transcriptional regulation by microRNAs. However, B7-H3 protein is expressed at high frequency on many different cancer types (60%of all cancers) ("B7-H3: an attractive target for antibody-based immunotherapy” . Clinical Cancer Research: clincanres. 2584.2020) .
- B7-H3 has been controversial. It was classified as either a co-stimulatory molecule for T cell activation that inhibits tumor antigen-specific immune responses, or the non-immunological role such as promoting migration, tumor growth, invasion, metastasis, malignant stage, recurrence rate, angiogenesis, chemoresistance, epithelial-to-mesenchymal transition, and affecting tumor cell metabolism.
- the receptor for B7-H3 has been reported to be triggering receptor expressed on myeloid cell (TREM) -like transcript 2 (TLT-2, or TREML2) , which binds B7-H3 and costimulates activation of CD8 T cells in particular.
- B7-H3 is also reported an inhibitor for NK cells and osteoblastic cells by ligating unknown receptor (s) . (The contrasting role of B7-H3, PNAS July 29, 2008, 105 (30) 10277-10278) .
- mAb antibodies against CD276 appear to be a promising therapeutic strategy worthy of development. Due to its selective expression on solid tumors, several groups have generated anti-CD276 antibodies, such as enoblituzumab (MGA271) , omburtamab, MGD009, MGC018, DS-7300a, and CAR T cells ( “B7-H3: an attractive target for antibody-based immunotherapy” . Clinical Cancer Research: clincanres. 2584.2020) , and observed tumor growth suppression in vitro and in vivo.
- CD276 is also reported to be expressed in hematological tumor cells (see Wei Zhang et al., B7 Family Members in Lymphoma: Promising Novel Targets for Tumor Immunotherapy? Front. Oncol., 31 March 2021) , indicating that CD276 can also be a potential target for treating hematological cancers.
- an antibody means one antibody or more than one antibody.
- the present disclosure provides novel anti-CD276 antibody molecules, amino acid and nucleotide sequences thereof, and uses thereof.
- the present disclosure provides an multi-specific antibody or an antigen-binding fragment thereof, comprising a first binding domain and a second binding domain, wherein the first binding domain specifically binds to CD276 and the second binding domain specifically binds to a second target other than CD276.
- the first binding domain comprises 1, 2, or 3 heavy chain complementarity determining region (CDR) sequences selected from the group consisting of: SEQ ID NOs: 1-3, 9-11, 17-19, 25-27, 33-35, 41-43, 49-51, 57-59, 65-67, 73-75, 81-83, 89-91, 97-99, 105-107, 113-115, 121-123, 129-131, 137-139, 145-147, 153-155, 161-163, 169-171, 177-179, 185-187, 193-195, 201-203, 209-211, 217-219, 225-227, 233-235, 241-243, 249-251, 257-259, 265-267, 273-275, 281-283, 289-291, 297-299, 305-307, 313-315, 321-323, 329-331, 337-339 and 374-375, and/or 1, 2, or 3 light chain CDR sequences selected from the group consist
- the first binding domain comprises a heavy chain variable region selected from the group consisting of:
- a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 1-3;
- a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 9-11;
- a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 17-19;
- a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 25-27;
- a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 41-43;
- a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 49-51;
- h a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 57-59;
- a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 65-67;
- a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 73-75;
- k a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 81-83;
- m a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 97-99;
- n a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 105-107;
- a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 113-115;
- p a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 121-123;
- r a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 137-139;
- a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 145-147;
- a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 161-163;
- v a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 169-171;
- w a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 177-179;
- x a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 185-187;
- y a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 193-195;
- z a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 201-203;
- aa a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 209-211;
- bb a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 217-219;
- cc a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 225-227;
- dd a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 233-235;
- ee a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 241-243;
- ff a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 249-251;
- gg a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 257-259;
- hh a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 265-267;
- a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 273-275;
- jj a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 281-283;
- kk a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 289-291;
- ll a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 297-299;
- mm a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 305-307;
- nn a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 313-315;
- oo a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 321-323;
- pp) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 329-331;
- qq a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 337-339;
- rr a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 9, 374 and 375.
- the first binding domain provided herein comprises a light chain variable region selected from the group consisting of:
- a) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 4-6;
- a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 20-22;
- a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 28-30;
- a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 52-54;
- h a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 60-62;
- a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 68-70;
- a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 76-78;
- k a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 84-86;
- m a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 100-102, 108-110;
- n a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 108-110;
- a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 116-118;
- p a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 124-126;
- r a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 140-142;
- a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 164-166;
- v) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 172-174;
- w a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 180-181;
- x a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 188-190;
- y a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 196-198;
- z a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 204-206;
- aa a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 212-214;
- bb a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 220-222;
- cc a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 228-230;
- dd a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 236-238;
- ee a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 244-246;
- ff a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 252-254;
- gg a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 260-262;
- hh a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 268-270, ;
- a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 276-278;
- jj a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 284-286;
- kk a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 292-294;
- ll a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 300-302;
- mm a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 308-310;
- nn a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 316-318;
- oo a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 324-326;
- pp) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 332-334;
- qq a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 340-342;
- rr a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 376, 13 and 14;
- ss a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 377, 45 and 46.
- the first binding domain comprises:
- a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 4, SEQ ID NO: 5, and SEQ ID NO: 6;
- a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 17, SEQ ID NO: 18, and SEQ ID NO: 19; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 20, SEQ ID NO: 21 and SEQ ID NO: 22;
- a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 25, SEQ ID NO: 26, and SEQ ID NO: 27; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 28, SEQ ID NO: 29, and SEQ ID NO: 30;
- a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 33, SEQ ID NO: 34, and SEQ ID NO: 35; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 36, SEQ ID NO: 37, and SEQ ID NO: 38;
- a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 49, SEQ ID NO: 50, and SEQ ID NO: 51; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 52, SEQ ID NO: 53, and SEQ ID NO: 54;
- a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 57, SEQ ID NO: 58, and SEQ ID NO: 59; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID SEQ ID NO: 60, SEQ ID NO: 61, and SEQ ID NO: 62;
- a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 65, SEQ ID NO: 66, and SEQ ID NO: 67; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 68, SEQ ID NO: 69, and SEQ ID NO: 70;
- a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 73, SEQ ID NO: 74, and SEQ ID NO: 75; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 76, SEQ ID NO: 77, and SEQ ID NO: 78;
- k a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 84, SEQ ID NO: 85, and SEQ ID NO: 86;
- m a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 97, SEQ ID NO: 98, and SEQ ID NO: 99; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 100, SEQ ID NO: 101, and SEQ ID NO: 102;
- n a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 105, SEQ ID NO: 106, and SEQ ID NO: 107; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 108, SEQ ID NO: 109 and SEQ ID NO: 110;
- p a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 121, SEQ ID NO: 122, and SEQ ID NO: 123; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 124, SEQ ID NO: 125, and SEQ ID NO: 126;
- a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 145, SEQ ID NO: 146, and SEQ ID NO: 147; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID SEQ ID NO: 148, SEQ ID NO: 149, and SEQ ID NO: 150;
- a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 161, SEQ ID NO: 162, and SEQ ID NO: 163; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 164, SEQ ID NO: 165, and SEQ ID NO: 166;
- w a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 177, SEQ ID NO: 178, and SEQ ID NO: 179; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 180, SEQ ID NO: 181, and SEQ ID NO: 182;
- x a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 185, SEQ ID NO: 186, and SEQ ID NO: 187; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 188, SEQ ID NO: 189, and SEQ ID NO: 190;
- y a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 193, SEQ ID NO: 194, and SEQ ID NO: 195; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 196, SEQ ID NO: 197 and SEQ ID NO: 198;
- z a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 201, SEQ ID NO: 202, and SEQ ID NO: 203; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 204, SEQ ID NO: 205, and SEQ ID NO: 206;
- aa a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 209, SEQ ID NO: 210, and SEQ ID NO: 211; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 212, SEQ ID NO: 213, and SEQ ID NO: 214;
- bb a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 217, SEQ ID NO: 218, and SEQ ID NO: 219; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 220, SEQ ID NO: 221, and SEQ ID NO: 222;
- cc a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 225, SEQ ID NO: 226, and SEQ ID NO: 227; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 228, SEQ ID NO: 229, and SEQ ID NO: 230;
- dd a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 233, SEQ ID NO: 234, and SEQ ID NO: 235; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID SEQ ID NO: 236, SEQ ID NO: 237, and SEQ ID NO: 238;
- ee a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 241, SEQ ID NO: 242, and SEQ ID NO: 243; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 244, SEQ ID NO: 245, and SEQ ID NO: 246;
- ff a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 249, SEQ ID NO: 250, and SEQ ID NO: 251; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 252, SEQ ID NO: 253, and SEQ ID NO: 254;
- gg a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 257, SEQ ID NO: 258, and SEQ ID NO: 259; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 260, SEQ ID NO: 261, and SEQ ID NO: 262;
- hh a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 265, SEQ ID NO: 266, and SEQ ID NO: 267; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 268, SEQ ID NO: 269, and SEQ ID NO: 270;
- a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 273, SEQ ID NO: 274, and SEQ ID NO: 275; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 276, SEQ ID NO: 277, and SEQ ID NO: 278;
- jj a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 281, SEQ ID NO: 282, and SEQ ID NO: 283; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 284, SEQ ID NO: 285 and SEQ ID NO: 286;
- kk a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 289, SEQ ID NO: 290, and SEQ ID NO: 291; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 292, SEQ ID NO: 293, and SEQ ID NO: 294;
- ll a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 297, SEQ ID NO: 298, and SEQ ID NO: 299; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 300, SEQ ID NO: 301, and SEQ ID NO: 302;
- a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 305, SEQ ID NO: 306, and SEQ ID NO: 307; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 308, SEQ ID NO: 309, and SEQ ID NO: 310;
- nn a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 313, SEQ ID NO: 314, and SEQ ID NO: 315; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 316, SEQ ID NO: 317, and SEQ ID NO: 318;
- a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 321, SEQ ID NO: 322, and SEQ ID NO: 323; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID SEQ ID NO: 324, SEQ ID NO: 325, and SEQ ID NO: 326;
- qq a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 337, SEQ ID NO: 338, and SEQ ID NO: 339; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 340, SEQ ID NO: 341, and SEQ ID NO: 342; or
- rr a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 9, SEQ ID NO: 374, and SEQ ID NO: 375; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 376, SEQ ID NO: 13, and SEQ ID NO: 14; or
- ss a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 41, SEQ ID NO: 42, and SEQ ID NO: 43; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 377, SEQ ID NO: 45, and SEQ ID NO: 46.
- the first binding domain comprises a heavy chain variable region selected from the group consisting of: SEQ ID NO: 7, SEQ ID NO: 15, SEQ ID NO: 23, SEQ ID NO: 31, SEQ ID NO: 39, SEQ ID NO: 47, SEQ ID NO: 55, SEQ ID NO: 63, SEQ ID NO: 71, SEQ ID NO: 79, SEQ ID NO: 87, SEQ ID NO: 95, SEQ ID NO: 103, SEQ ID NO: 111, SEQ ID NO: 119, SEQ ID NO: 127, SEQ ID NO: 135, SEQ ID NO: 143, SEQ ID NO: 151, SEQ ID NO: 159, SEQ ID NO: 167, SEQ ID NO: 175, SEQ ID NO: 183, SEQ ID NO: 191, SEQ ID NO: 199, SEQ ID NO: 207, SEQ ID NO: 215, SEQ ID NO: 223, SEQ ID NO: 231, SEQ ID NO: 239, SEQ ID NO: 247, SEQ ID NO:
- the first binding domain comprises a light chain variable region selected from the group consisting of: SEQ ID NO: 8, SEQ ID NO: 16, SEQ ID NO: 24, SEQ ID NO: 32, SEQ ID NO: 40, SEQ ID NO: 48, SEQ ID NO: 56, SEQ ID NO: 64, SEQ ID NO: 72, SEQ ID NO: 80, SEQ ID NO: 88, SEQ ID NO: 96, SEQ ID NO: 104, SEQ ID NO: 112, SEQ ID NO: 120, SEQ ID NO: 128, SEQ ID NO: 136, SEQ ID NO: 144, SEQ ID NO: 152, SEQ ID NO: 160, SEQ ID NO: 168, SEQ ID NO: 1756, SEQ ID NO: 184, SEQ ID NO: 192, SEQ ID NO: 200, SEQ ID NO: 208, SEQ ID NO: 216, SEQ ID NO: 224, SEQ ID NO: 232, SEQ ID NO: 240, SEQ ID NO: 248, SEQEQ ID NO:
- the first binding domain comprises: (i) a heavy chain variable region comprising 1, 2, or 3 CDR sequences shown as SEQ ID NO: 9, SEQ ID NO: 10 or 374 (MRNKANAYTT) , and SEQ ID NO: 11 or 375 (VRDREGRPFAY) , respectively; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences shown as SEQ ID NO: 12 or 376 (QSLLNAINQKNF) , SEQ ID NO: 13, and SEQ ID NO: 14, respectively; or (ii) a heavy chain variable region comprising 1, 2, or 3 CDR sequences shown as SEQ ID NO: 41, SEQ ID NO: 42, and SEQ ID NO: 43, respectively; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences shown as SEQ ID NO: 44 or 377 (QSLLQSSTQKNY) , SEQ ID NO: 45, and SEQ ID NO: 46, respectively.
- the first binding domain comprises a heavy chain variable region comprising a sequence selected from SEQ ID NO: 351, 353, 355, 357, 358, 360, 362, 364, 365, 367 and 370; and a light chain variable region comprising a sequence selected from SEQ ID NO: 352, 354, 356, 359, 361, 363, 366, 368, 369, 371, 372 and 373.
- the first binding domain comprises:
- aa a heavy chain variable region comprising SEQ ID NO: 215 and a light chain variable region comprising SEQ ID NO: 216;
- gg a heavy chain variable region comprising SEQ ID NO: 263 and a light chain variable region comprising SEQ ID NO: 264;
- hh a heavy chain variable region comprising SEQ ID NO: 271 and a light chain variable region comprising SEQ ID NO: 272;
- nn a heavy chain variable region comprising SEQ ID NO: 319 and a light chain variable region comprising SEQ ID NO: 320;
- ss a heavy chain variable region comprising SEQ ID NO: 349 and a light chain variable region comprising SEQ ID NO: 350.
- the first binding domain comprises:
- the first binding domain further comprises one or more amino acid residue substitutions or modifications yet retains specific binding affinity to human CD276.
- the substitution is in one or more CDR sequences, and/or in one or more of the VH or VL sequences but not in any of the CDR sequences.
- the multi-specific antibody or antigen-binding fragment thereof further comprises an activating receptor binding domain, optionally a constant region of human Ig, or optionally a constant region of human IgG.
- the constant region comprises a constant region of human IgG1, IgG2, IgG3, or IgG4.
- the second target is PD-L1.
- the second binding domain comprises 1, 2, or 3 heavy chain complementarity determining region (CDR) sequences selected from the group consisting of: SEQ ID NOs: 384-386, and/or 1, 2, or 3 light chain CDR sequences selected from the group consisting of: SEQ ID NOs: 387-389.
- CDR heavy chain complementarity determining region
- the second binding domain comprises a heavy chain variable region comprising three CDR sequences set forth as SEQ ID NOs: 384, 385 and 386, respectively; and a light chain variable region comprising three CDR sequences set forth as SEQ ID NOs: 387, 388 and 389, respectively.
- the second binding domain comprises a heavy chain variable set forth as SEQ ID NO: 382, and/or a light chain variable region set forth as SEQ ID NO: 383.
- the second binding domain further comprises one or more amino acid residue substitutions or modifications yet retains specific binding affinity to human PD-L1.
- the substitution is in one or more CDR sequences, and/or in one or more of the VH or VL sequences but not in any of the CDR sequences.
- the second binding domain comprising an scFv structure of VH-linker-VL.
- the linker comprises a sequence of (GGGGS) 3 (SEQ ID NO: 390) .
- the N-termination of the second binding domain is operably linked to the C-termination of the activating receptor binding domain.
- the multi-specific antibody or antigen-binding fragment thereof provided herein is a bi-specific or tri-specific antibody.
- the multi-specific antibody or antigen-binding fragment is linked to one or more conjugates.
- the conjugate is covalently attached either directly or via a linker.
- the conjugate comprises a clearance-modifying agent, a chemotherapeutic agent, a toxin, a radioactive isotope, a lanthanide, a luminescent label, a fluorescent label, an enzyme-substrate label, a DNA-alkylators, a topoisomerase inhibitor, a tubulin-binders, or other anticancer drugs.
- the present disclosure provides an isolated polynucleotide encoding the antibody or antigen-binding fragment thereof provided herein.
- the present disclosure provides a vector comprising the isolated polynucleotide provided herein.
- the present disclosure provides a host cell comprising the vector provided herein.
- the present disclosure provides a pharmaceutical composition
- a pharmaceutical composition comprising the multi-specific antibody or antigen-binding fragment thereof provided herein or the polynucleotide encoding the multi-specific antibody or antigen-binding fragment thereof, and a pharmaceutically acceptable carrier.
- the present disclosure provides a method of expressing the multi-specific antibody or antigen-binding fragment thereof provided herein, comprising culturing the host cell provided herein under the condition at which the vector provided herein is expressed.
- the present disclosure provides a method of treating a disease or condition in a subject that would benefit from modulation of CD276 activity, comprising administering to the subject a therapeutically effective amount of the multi-specific antibody or antigen-binding fragment thereof provided herein or the pharmaceutical composition provided herein.
- the disease or condition is a CD276 related disease or condition.
- the disease or condition is cancer, adaptive immune disease, autoimmune disease, inflammatory disease, or infectious disease.
- the cancer is adrenal gland tumor, an AIDS-associated cancer, an alveolar soft part sarcoma, an astrocytic tumor, bladder cancer, bone cancer, a brain and spinal cord cancer, a metastatic brain tumor, a breast cancer, a carotid body tumors, a cervical cancer, a chondrosarcoma, a chordoma, a chromophobe renal cell carcinoma, a clear cell carcinoma, a colon cancer, a colorectal cancer, a cutaneous benign fibrous histiocytoma, a desmoplastic small round cell tumor, an ependymoma, a Ewing's tumor, an extraskeletal myxoid chondrosarcoma, a fibrogenesis imperfecta ossium, a fibrous dysplasia of the bone, a gallbladder or bile duct cancer, gastric cancer, a gestational trophoblastic disease, a germ cell tumor, a head and neck
- the disease or condition is hematological cancer selected from B-cell lymphomas, such as Hodgkin's lymphoma, non-Hodgkin's lymphoma (NHL) , acute lymphocytic leukemia (ALL) , acute myeloid leukemia (AML) , chronic lymphocytic leukemia (CLL) , chronic myelogenous leukemia (CML) , multiple myeloma (MM) , diffuse large B cell lymphoma (DLBCL) , Marginal zone B-cell lymphoma (MZL) , Mantle cell lymphoma (MCL) , Richter's syndrome, Burkitt's lymphoma or follicular lymphoma.
- B-cell lymphomas such as Hodgkin's lymphoma, non-Hodgkin's lymphoma (NHL) , acute lymphocytic leukemia (ALL) , acute myeloid leukemia (AML)
- the subject is human.
- the method provided herein comprises administering to the subject a therapeutically effective amount of one or more therapeutic agent.
- said therapeutic agent is a chemotherapeutic agent, a radiation therapeutic agent, a hormonal therapeutic agent, a toxin or an immunotherapeutic agent.
- the administration is via oral, nasal, intravenous, subcutaneous, sublingual, or intramuscular administration.
- said method further comprises administration of one or more additional cancer therapies selected from the group consisting of chemotherapy, immunotherapy, radiation therapy, hormonal therapy, and surgery.
- the present disclosure provides a method of modulating CD276 activity in a CD276-expressing cell, comprising exposing the CD276-expressing cell to the antibody or antigen-binding fragment thereof provided herein.
- the present disclosure provides a method of modulating PD-1/PD-L1 pathway activity in a PD-L1-expressing cell, comprising exposing the PD-L1-expressing cell to the multi-specific antibody or antigen-binding fragment thereof provided herein.
- the present disclosure provides use of the multi-specific antibody or antigen-binding fragment thereof provided herein in the manufacture of a medicament for treating a CD276 and/or PD-L1 related disease or condition in a subject.
- the medicament further comprises a second therapeutic agent.
- the second therapeutic agent is a chemotherapeutic agent, a radiation therapeutic agent, a hormonal therapeutic agent, a toxin or an immunotherapeutic agent.
- Figure 1 shows the binding affinity of the anti-CD276 antibodies provided herein on SKOV3 cells as measured by FACs analysis.
- Figure 2A-2E show binding of 6-D8-E7-A11 to several cancer cell lines that express B7H3 as measured by FACS analysis.
- Figure 3A-3C show ADCC effect of the anti-CD276 antibodies provided herein on SKOV3 cells.
- Figure 4A and 4B show CDC effect of the anti-CD276 antibodies provided herein on CHO-S-hCD276 cells.
- Figure 5A-5E show indirect ADC cytotoxicity effect of the anti-CD276 antibodies provided herein on SKOV3 cells.
- Figure 6 shows in vivo efficacy of the anti-CD276 antibodies provided herein in inhibiting the tumor growth in the mouse model inoculated with MC-38-hCD276 (B7H3) tumor cells.
- Figure 7 shows effects on tumor growth in subcutaneous calu-6 model in balb/c nude mice (mean ⁇ sem) .
- Figure 8 shows IL2 release by T cell activation in MLR assay.
- Figure 9 shows IFN ⁇ release by T cell activation in MLR assay.
- Figure 10 shows the binding affinity on SKOV3 of humanized antibodies derived from 30-C7-C11-D4.
- Figure 11 shows binding affinity on SKOV3 of humanized antibodies derived from 10-G6-C4-B2.
- Figure 12 shows effects on tumor growth in subcutaneous Calu-6 model in Balb/c nude mice (Mean ⁇ SEM) .
- Figure 13 shows effects of test articles on tumor growth in subcutaneous MC-38-hCD276 (B7H3) model in C57BL/6 Mice (Mean ⁇ SEM) .
- Figure 14 shows effects of test articles on tumor growth in subcutaneous MC-38-hCD276 (B7H3) Model in C57BL/6 Mice (Mean ⁇ SEM) .
- Figure 15 shows effects of test articles on tumor growth in subcutaneous MC-38-hCD276 (B7H3) Model in C57BL/6 Mice (Mean ⁇ SEM) .
- antibody as used herein includes any immunoglobulin, monoclonal antibody, polyclonal antibody, multivalent antibody, bivalent antibody, or monovalent antibody that binds to a specific antigen.
- a native intact antibody comprises two heavy (H) chains and two light (L) chains.
- Mammalian heavy chains are classified as alpha, delta, epsilon, gamma, and mu, each heavy chain consists of a variable region (V H ) and a first, second, and third constant region (C H1 , C H2 , C H3 , respectively) ;
- mammalian light chains are classified as ⁇ or ⁇ , while each light chain consists of a variable region (V L ) and a constant region.
- the antibody has a “Y” shape, with the stem of the Y consisting of the second and third constant regions of two heavy chains bound together via disulfide bonding.
- Each arm of the Y includes the variable region and first constant region of a single heavy chain bound to the variable and constant regions of a single light chain.
- the variable regions of the light and heavy chains are responsible for antigen binding.
- the variable regions in both chains generally contain three highly variable loops called the complementarity determining regions (CDRs) (light chain CDRs including LCDR1, LCDR2, and LCDR3, heavy chain CDRs including HCDR1, HCDR2, and HCDR3) .
- CDRs complementarity determining regions
- CDR boundaries for the antibodies and antigen-binding domains disclosed herein may be defined or identified by the conventions of Kabat, IMGT, AbM, Chothia, or Al-Lazikani (Al-Lazikani, B., Chothia, C., Lesk, A.M., J. Mol. Biol., 273 (4) , 927 (1997) ; Chothia, C. et al., J Mol Biol. Dec 5; 186 (3) : 651-63 (1985) ; Chothia, C. and Lesk, A.M., J. Mol. Biol., 196, 901 (1987) ; N. R. Whitelegg et al, Protein Engineering, v13(12) , 819-824 (2000) ; Chothia, C. et al., Nature. Dec 21-28; 342 (6252) : 877-83
- the constant regions of the heavy and light chains are not involved in antigen-binding, but exhibit various effector functions.
- Antibodies are assigned to classes based on the amino acid sequence of the constant region of their heavy chain.
- the five major classes or isotypes of antibodies are IgA, IgD, IgE, IgG, and IgM, which are characterized by the presence of alpha, delta, epsilon, gamma, and mu heavy chains, respectively.
- IgG1 gamma1 heavy chain
- IgG2 gamma2 heavy chain
- IgG3 gamma3 heavy chain
- IgG4 gamma4 heavy chain
- IgA1 alpha1 heavy chain
- IgA2 alpha2 heavy chain
- antibody molecule refers to an antigen-binding protein or polypeptide comprising at least one antibody fragment (such as CDR, and/or variable region sequence) .
- An antibody molecule includes, for example, a monoclonal antibody, an antibody fragment or domain, a fusion protein comprising an antibody fragment or domain, a polypeptide complex comprising an antibody fragment or domain, and so on.
- antigen-binding domain e.g. CD276-binding domain or PD-L1 binding domain
- antibody fragment formed from a portion of an antibody comprising one or more CDRs, or any other antibody fragment that binds to an antigen but does not comprise an intact native antibody structure.
- antigen-binding domain examples include, without limitation, a Fab, a Fab', a F (ab') 2 , an Fv fragment, a disulfide stabilized Fv fragment (dsFv) , a (dsFv) 2 , a single-chain antibody molecule (scFv) , a camelized single domain antibody, a nanobody, a domain antibody, and a bivalent domain antibody.
- An antigen-binding domain is capable of binding to the same antigen to which the parent antibody binds.
- an antigen-binding domain may comprise one or more CDRs from a particular human antibody grafted to a framework region from one or more different human antibodies.
- Fab with regard to an antibody refers to that portion of the antibody consisting of a single light chain (both variable and constant regions) bound to the variable region and first constant region of a single heavy chain by a disulfide bond.
- Fab' refers to a Fab fragment that includes a portion of the hinge region.
- F (ab') 2 refers to a dimer of Fab’ .
- a “fragment difficult (Fd) ” with regard to an antibody refers to the amino-terminal half of the heavy chain fragment that can be combined with the light chain to form Fab.
- Fd fragment may consists of the VH and CH1 domains
- Fv with regard to an antibody refers to the smallest fragment of the antibody to bear the complete antigen-binding site.
- An Fv fragment consists of the variable region of a single light chain bound to the variable region of a single heavy chain.
- a number of Fv designs have been provided, including dsFvs, in which the association between the two domains is enhanced by an introduced disulphide bond; and scFvs can be formed using a peptide linker to bind the two domains together as a single polypeptide.
- Fvs constructs containing a variable domain of a heavy or light immunoglobulin chain associated to the variable and constant domain of the corresponding immunoglobulin heavy or light chain have also been produced.
- Single-chain Fv antibody or “scFv” refers to an engineered antibody consisting of a light chain variable region and a heavy chain variable region connected to one another directly or via a peptide linker sequence (Huston JS et al. Proc Natl Acad Sci USA, 85: 5879 (1988) ) .
- a “dsFv” refers to a disulfide-stabilized Fv fragment that the linkage between the variable region of a single light chain and the variable region of a single heavy chain is a disulfide bond.
- a “ (dsFv) 2 ” or “ (dsFv-dsFv') ” comprises three peptide chains: two V H moieties linked by a peptide linker (e.g., a long flexible linker) and bound to two V L moieties, respectively, via disulfide bridges.
- dsFv-dsFv' is bispecific in which each disulfide paired heavy and light chain has a different antigen specificity.
- Fc with regard to an antibody refers to that portion of the antibody consisting of the second and third constant regions of a first heavy chain bound to the second and third constant regions of a second heavy chain via disulfide bonding.
- the Fc portion of the antibody is responsible for various effector functions such as antibody-dependent cell-mediated cytotoxicity (ADCC) , and complement dependent cytotoxicity (CDC) , but does not function in antigen binding.
- ADCC antibody-dependent cell-mediated cytotoxicity
- CDC complement dependent cytotoxicity
- “Camelized single domain antibody, ” “heavy chain antibody, ” or “HCAb” refers to an antibody that contains two V H domains and no light chains (Riechmann L. and Muyldermans S., J Immunol Methods. Dec 10; 231 (1-2) : 25-38 (1999) ; Muyldermans S., J Biotechnol. Jun; 74 (4) : 277-302 (2001) ; WO94/04678; WO94/25591; U.S. Patent No. 6,005,079) .
- Heavy chain antibodies were originally derived from Camelidae (camels, dromedaries, and llamas) .
- VHH domain The variable domain of a heavy chain antibody (VHH domain) represents the smallest known antigen-binding unit generated by adaptive immune responses (Koch-Nolte F. et al., FASEB J. Nov; 21 (13) : 3490-8. Epub 2007 Jun 15 (2007) ) .
- a “nanobody” refers to an antibody fragment that consists of a VHH domain from a heavy chain antibody and two constant domains, CH2 and CH3.
- a “domain antibody” refers to an antibody fragment containing only the variable region of a heavy chain or the variable region of a light chain.
- two or more V H domains are covalently joined with a peptide linker to create a bivalent or multivalent domain antibody.
- the two V H domains of a bivalent domain antibody may target the same or different antigens.
- chimeric means an antibody or antigen-binding domain, having a portion of heavy and/or light chain derived from one species, and the rest of the heavy and/or light chain derived from a different species.
- a chimeric antibody may comprise a constant region derived from human and a variable region from a non-human animal, such as from mouse.
- the non-human animal is a mammal, for example, a mouse, a rat, a rabbit, a goat, a sheep, a guinea pig, or a hamster.
- humanized means that the antibody or antigen-binding domain comprises CDRs derived from non-human animals, FR regions derived from human, and when applicable, the constant regions derived from human.
- operably link refers to a juxtaposition, with or without a spacer or a linker or an intervening sequence, of two or more biological sequences of interest in such a way that they are in a relationship permitting them to function in an intended manner.
- polypeptide sequences When used with respect to polypeptides, it is intended to mean that the polypeptide sequences are linked in such a way that permits the linked product to have the intended biological function.
- an antibody variable region may be operably linked to a constant region so as to provide for a stable product with antigen-binding activity.
- an antigen-binding domain can be operably linked to another antigen-binding domain with an intervening sequence there between, and such intervening sequence can be a spacer or can comprise a much longer sequence such as a constant region of an antibody.
- the term may also be used with respect to polynucleotides.
- a polynucleotide encoding a polypeptide is operably linked to a regulatory sequence (e.g., promoter, enhancer, silencer sequence, etc. ) , it is intended to mean that the polynucleotide sequences are linked in such a way that permits regulated expression of the polypeptide from the polynucleotide.
- fusion refers to combination of two or more amino acid sequences, for example by chemical bonding or recombinant means, into a single amino acid sequence which does not exist naturally.
- a fusion amino acid sequence may be produced by genetic recombination of two encoding polynucleotide sequences, and can be expressed by a method of introducing a construct containing the recombinant polynucleotides into a host cell.
- an “antigen” as used herein refers to a compound, composition, peptide, polypeptide, protein or substance that can stimulate the production of antibodies or a T cell response in cell culture or in an animal, including compositions (such as one that includes a cancer-specific protein) that are added to a cell culture (such as a hybridoma) , or injected or absorbed into an animal.
- An antigen reacts with the products of specific humoral or cellular immunity (such as an antibody) , including those induced by heterologous antigens.
- CD276 protein or “B7-H3 protein” as used herein is intended to encompass any form of CD276, for example, 1) native unprocessed CD276 molecule, “full-length” CD276 chain or naturally occurring variants of CD276, including, for example, splice variants or allelic variants; 2) any form of CD276 that results from processing in the cell; or 3) full length, a fragment (e.g., a truncated form, an extracellular/transmembrane domain) or a modified form (e.g. a mutated form, a glycosylated/PEGylated, a His-tag/immunofluorescence fused form) of CD276 subunit generated through recombinant method.
- a fragment e.g., a truncated form, an extracellular/transmembrane domain
- a modified form e.g. a mutated form, a glycosylated/PEGylated,
- anti-CD276 antibody refers to an antibody or antigen-binding domain that is capable of specifically binding to CD276 (e.g. human, monkey or mouse CD276) .
- PD-L1 refers to programmed cell death ligand 1 (PD-L1, see, for example, Freeman et al. (2000) J. Exp. Med. 192: 1027) .
- Representative amino acid sequence of human PD-L1 is disclosed under the NCBI accession number: NP_054862.1, and the representative nucleic acid sequence encoding the human PD-L1 is shown under the NCBI accession number: NM_014143.3.
- PD-L1 is expressed in placenta, spleen, lymph nodes, thymus, heart, fetal liver, and is also found on many tumor or cancer cells.
- PD-L1 binds to its receptor PD-1 or B7-1, which is expressed on activated T cells, B cells and myeloid cells.
- the binding of PD-L1 and its receptor induces signal transduction to suppress TCR-mediated activation of cytokine production and T cell proliferation.
- PD-L1 plays a major role in suppressing immune system during particular events such as pregnancy, autoimmune diseases, tissue allografts, and is believed to allow tumor or cancer cells to circumvent the immunological checkpoint and evade the immune response.
- binding or “specifically binds” as used herein refers to a non-random binding reaction between two molecules, such as for example between an antibody and an antigen.
- the antibody molecules or antigen-binding domains provided herein specifically bind to CD276 and/or PD-L1 with a binding affinity (K D ) of ⁇ 10 -6 M (e.g., ⁇ 5x10 -7 M, ⁇ 2x10 -7 M, ⁇ 10 -7 M, ⁇ 5x10 -8 M, ⁇ 2x10 -8 M, ⁇ 10 -8 M, ⁇ 5x10 -9 M, ⁇ 4x10 -9 M) .
- K D binding affinity
- K D used herein refers to the ratio of the dissociation rate to the association rate (k off /k on ) , which may be determined by using any conventional method known in the art, including but are not limited to surface plasmon resonance method, microscale thermophoresis method, HPLC-MS method and flow cytometry (such as FACS) method.
- the K D value can be appropriately determined by using flow cytometry.
- Binding affinity to CD276 and/or PD-L1 can also be represented by “half maximal effective concentration” (EC 50 ) value, which refers to the concentration of an antibody where 50%of its maximal effect (e.g., binding or inhibition etc. ) is observed.
- the EC 50 value can be measured by methods known in the art, for example, sandwich assay such as ELISA, Western Blot, flow cytometry assay, and other binding assays.
- the antibodies and the fragments thereof provided herein specifically bind to CD276 and/or PD-L1 at an EC 50 (i.e.
- the ability to “block binding” or “compete for the same epitope” as used herein refers to the ability of an antibody or antigen-binding domain to inhibit the binding interaction between two molecules (e.g. human CD276 and its binding ligand, e.g. TLT-2) to any detectable degree.
- an antibody or antigen-binding domain that blocks binding between two molecules inhibits the binding interaction between the two molecules by at least 85%, or at least 90%. In certain embodiments, this inhibition may be greater than 85%, or greater than 90%.
- epitope refers to the specific group of atoms or amino acids on an antigen to which an antibody binds. Epitopes can be formed both from contiguous amino acids (also called linear or sequential epitope) or noncontiguous amino acids juxtaposed by tertiary folding of a protein (also called configurational or conformational epitope) .
- Epitopes formed from contiguous amino acids are typically arranged linearly along the primary amino acid residues on the protein and the small segments of the contiguous amino acids can be digested from an antigen binding with major histocompatibility complex (MHC) molecules or retained on exposure to denaturing solvents whereas epitopes formed by tertiary folding are typically lost on treatment with denaturing solvents.
- An epitope typically includes at least 3, and more usually, at least 5, about 7, or about 8-10 amino acids in a unique spatial conformation. Two antibodies may bind the same or a closely related epitope within an antigen if they exhibit competitive binding for the antigen.
- an antibody or antigen-binding domain blocks binding of a reference antibody to the antigen by at least 85%, or at least 90%, or at least 95%, then the antibody or antigen-binding domain may be considered to bind the same/closely related epitope as the reference antibody.
- a “conservative substitution” with reference to amino acid sequence refers to replacing an amino acid residue with a different amino acid residue having a side chain with similar physiochemical properties.
- conservative substitutions can be made among amino acid residues with hydrophobic side chains (e.g. Met, Ala, Val, Leu, and Ile) , among residues with neutral hydrophilic side chains (e.g. Cys, Ser, Thr, Asn and Gln) , among residues with acidic side chains (e.g. Asp, Glu) , among amino acids with basic side chains (e.g. His, Lys, and Arg) , or among residues with aromatic side chains (e.g. Trp, Tyr, and Phe) .
- conservative substitution usually does not cause significant change in the protein conformational structure, and therefore could retain the biological activity of a protein.
- homolog and “homologous” as used herein are interchangeable and refer to nucleic acid sequences (or its complementary strand) or amino acid sequences that have sequence identity of at least 80% (e.g., at least 85%, 88%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%) to another sequences when optimally aligned.
- Percent (%) sequence identity with respect to amino acid sequence (or nucleic acid sequence) is defined as the percentage of amino acid (or nucleic acid) residues in a candidate sequence that are identical to the amino acid (or nucleic acid) residues in a reference sequence, after aligning the sequences and, if necessary, introducing gaps, to achieve the maximum number of identical amino acids (or nucleic acids) . Conservative substitution of the amino acid residues may or may not be considered as identical residues. Alignment for purposes of determining percent amino acid (or nucleic acid) sequence identity can be achieved, for example, using publicly available tools such as BLASTN, BLASTp (available on the website of U.S. National Center for Biotechnology Information (NCBI) , see also, Altschul S.F.
- effector functions refer to biological activities attributable to the binding of Fc region of an antibody to its effectors such as C1 complex, Fc receptor and effector cell (e.g., macrophage) .
- exemplary effector functions include: complement dependent cytotoxicity (CDC) induced by interaction of antibodies and C1q on the C1 complex; antibody-dependent cell-mediated cytotoxicity (ADCC) induced by binding of Fc region of an antibody to Fc receptor on an effector cell; and antibody-dependent cellular phagocytosis (ADCP) induced by binding of Fc region of an antibody to phagocytosis.
- CDC complement dependent cytotoxicity
- ADCC antibody-dependent cell-mediated cytotoxicity
- ADCP antibody-dependent cellular phagocytosis
- Treating” or “treatment” of a condition as used herein includes preventing or alleviating a condition, slowing the onset or rate of development of a condition, reducing the risk of developing a condition, preventing or delaying the development of symptoms associated with a condition, reducing or ending symptoms associated with a condition, generating a complete or partial regression of a condition, curing a condition, or some combination thereof.
- subject or “individual” or “animal” or “patient” as used herein refers to human or non-human animal, including a mammal or a primate, in need of diagnosis, prognosis, amelioration, prevention and/or treatment of a disease or disorder.
- Mammalian subjects include humans, monkeys, domestic animals, farm animals, and zoo, sports, or pet animals such as dogs, cats, guinea pigs, rabbits, rats, mice, horses, swine, cows, bears, and so on.
- vector refers to a vehicle into which a polynucleotide encoding a protein may be operably inserted so as to bring about the expression of that protein.
- a vector may be used to transform, transduce, or transfect a host cell so as to bring about expression of the genetic element it carries within the host cell.
- vectors include plasmids, phagemids, cosmids, and artificial chromosomes such as yeast artificial chromosome (YAC) , bacterial artificial chromosome (BAC) , or P1-derived artificial chromosome (PAC) , bacteriophages such as lambda phage or M13 phage, and animal viruses.
- a vector may contain a variety of elements for controlling expression, including promoter sequences, transcription initiation sequences, enhancer sequences, selectable elements, and reporter genes. In addition, the vector may contain an origin of replication.
- a vector may also include materials to aid in its entry into the cell, including but not limited to a viral particle, a liposome, or a protein coating.
- a vector can be an expression vector or a cloning vector.
- host cell refers to a cell into which an exogenous polynucleotide and/or a vector has been introduced.
- CD276-related disease or condition refers to any disease or condition caused by, exacerbated by, or otherwise linked to increased or decreased expression or activities of CD276.
- the CD276 related condition is immune-related disorder, such as, for example, cancer, autoimmune disease, inflammatory disease or infectious disease.
- a “PD-L1-related” disease or condition as used herein refers to any disease or condition caused by, exacerbated by, or otherwise linked to increased expression or activities of PD-L1.
- the PD-L1 related disease or condition is accompanied with a suppressed immune system.
- the PD-L1 related disease or condition is immune-related disorder, such as, for example, cancer, autoimmune disease, inflammatory disease or infectious disease.
- Cancer refers to any medical condition characterized by malignant cell growth or neoplasm, abnormal proliferation, infiltration or metastasis, and includes both solid tumors and non-solid cancers (hematologic malignancies) such as leukemia.
- solid tumor refers to a solid mass of neoplastic and/or malignant cells.
- cancer or tumors include adrenal gland tumor, an AIDS-associated cancer, an alveolar soft part sarcoma, an astrocytic tumor, bladder cancer, bone cancer, a brain and spinal cord cancer, a metastatic brain tumor, a breast cancer, a carotid body tumors, a cervical cancer, a chondrosarcoma, a chordoma, a chromophobe renal cell carcinoma, a clear cell carcinoma, a colon cancer, a colorectal cancer, a cutaneous benign fibrous histiocytoma, a desmoplastic small round cell tumor, an ependymoma, a Ewing's tumor, an extraskeletal myxoid chondrosarcoma, a fibrogenesis imperfecta ossium, a fibrous dysplasia of the bone, a gallbladder or bile duct cancer, gastric cancer, a gestational trophoblastic disease, a germ cell tumor, a head and neck cancer,
- the hematological malignancies includes B-cell lymphomas, optionally Hodgkin's lymphoma, non-Hodgkin's lymphoma (NHL) , acute lymphocytic leukemia (ALL) , acute myeloid leukemia (AML) , chronic lymphocytic leukemia (CLL) , chronic myelogenous leukemia (CML) , multiple myeloma (MM) , diffuse large B cell lymphoma (DLBCL) , Marginal zone B-cell lymphoma (MZL) , Mantle cell lymphoma (MCL) , Richter's syndrome, Burkitt's lymphoma or follicular lymphoma.
- B-cell lymphomas optionally Hodgkin's lymphoma, non-Hodgkin's lymphoma (NHL) , acute lymphocytic leukemia (ALL) , acute myeloid leukemia (AML) , chronic lymph
- the cancer is selected from gastric cancer, breast cancer, head and neck cancer, pancreatic cancer, and colon cancer. In certain embodiments, the cancer is selected from a lymphoma, Hodgkin's lymphoma, non-Hodgkin's lymphoma and B-cell lymphoma.
- the cancer is chemoresistant.
- chemoresistant cancer refers to a type of cancer that are not responsive to the effects of chemotherapy. For example, a cancer that has been responding to a chemotherapy or a combination of different chemotherapies suddenly begins to grow can be referred to as a chemoresistant cancer.
- pharmaceutically acceptable indicates that the designated carrier, vehicle, diluent, excipient (s) , and/or salt is generally chemically and/or physically compatible with the other ingredients comprising the formulation, and physiologically compatible with the recipient thereof.
- the present disclosure provides a multi-specific antibody or antigen-binding fragment thereof comprises multiple antigen binding domains and an activating receptor binding domain.
- the multiple antigen binding domains comprise at least a first binding domain targeting a first antigen and a second binding domain targeting a second antigen, wherein one of the first antigen and the second antigen is an immune checkpoint molecule or a tumor antigen, while the other one is one or more additional targets.
- the one or more additional targets comprise a target which is another immune checkpoint molecule (e.g., PD-L1) .
- the one or more additional targets comprise targets relating to immune cell (e.g., T cells or B cells) function.
- the one or more additional targets comprises a target selected from the group consisting of CD40, CD3, CD28, etc.
- the first binding domain targets CD276, while the second binding domain targets one or more additional targets. In some embodiments, the second binding domain targets CD276, while the first binding domain targets one or more additional targets. In some embodiments, the first binding domain targets CD276, while the second binding domain targets PD-L1. In some other embodiments, the first binding domain targets PD-L1, while the second binding domain targets CD276.
- the CD276 binding domain comprises one or more (e.g. 1, 2, 3, 4, 5, or 6) CDR sequences of an anti-CD276 antibody 9-E8-F9-C10, 10-G6-C4-B2, 18-F9-D8-G7, 9-G2-H6-E4, 20-F8-B5-G2, 30-C7-C11-D4, 23-F10-G4-F11, 6-H11-G5-D8, 27-E7-D8-C7, 30-E2-G7-G7, 5-D1-G6-D9, 3-C2-C3-E7, 11-G10-B4-B11, 16-C6-F7-F5, 22-E11-C3-F2, 24-C10-F9-G7, 25-C8-D7-C5, 4-D5-B9-B11, 10-B9-D10-A12, 15-G1-D1-E3, 8-B4-F5-E11, 6-F3-G
- the first binding domain is capable of specifically binding to CD276.
- the CD276 are derived from human, monkey or mouse.
- the CD276 is a recombinant CD276 or a CD276 expressed on a cell surface.
- All of these 43 anti-CD276 antibodies thereof provided herein are mouse monoclonal antibodies.
- Table 1 shows the CDR sequences of these 43 anti-CD276 antibodies according to IMGT numbering system.
- the heavy chain and light chain variable region sequences are also provided below.
- CDRs are known to be responsible for antigen binding, however, it has been found that not all of the 6 CDRs are indispensable or unchangeable.
- the CD276 binding domain comprises a heavy chain CDR3 sequence of one of the anti-CD276 antibodies 9-E8-F9-C10, 10-G6-C4-B2, 18-F9-D8-G7, 9-G2-H6-E4, 20-F8-B5-G2, 30-C7-C11-D4, 23-F10-G4-F11, 6-H11-G5-D8, 27-E7-D8-C7, 30-E2-G7-G7, 5-D1-G6-D9, 3-C2-C3-E7, 11-G10-B4-B11, 16-C6-F7-F5, 22-E11-C3-F2, 24-C10-F9-G7, 25-C8-D7-C5, 4-D5-B9-B11, 10-B9-D10-A12, 15-G1-D1-E3, 8-B4-F5-E11, 6-F3-G2-G1, 9-B9-H11
- the CD276 binding domain comprises a heavy chain CDR3 sequence selected from the group consisting of SEQ ID NOs: 3, 11, 19, 27, 35, 43, 51, 59, 67, 75, 83, 91, 99, 107, 115, 123, 131, 139, 147, 155, 163, 171, 179, 187, 195, 203, 211, 219, 227, 235, 243, 251, 259, 267, 275, 283, 291, 299, 307, 315, 323, 331, and 339.
- Heavy chain CDR3 regions are located at the center of the antigen-binding site, and therefore are believed to make the most contact with antigen and provide the most free energy to the affinity of antibody to antigen.
- the heavy chain CDR3 is by far the most diverse CDR of the antigen-binding site in terms of length, amino acid composition and conformation by multiple diversification mechanisms (Tonegawa S. Nature. 302: 575-81) .
- the diversity in the heavy chain CDR3 is sufficient to produce most antibody specificities (Xu JL, Davis MM. Immunity. 13: 37-45) as well as desirable antigen-binding affinity (Schier R, etc. J Mol Biol. 263: 551-67) .
- the CD276 binding domain comprise suitable framework region (FR) sequences, as long as the antibodies and/or antigen-binding fragments thereof can specifically bind to CD276.
- FR framework region
- the CDR sequences provided in Table 1 are obtained from mouse antibodies, but they can be grafted to any suitable FR sequences of any suitable species such as mouse, human, rat, rabbit, among others, using suitable methods known in the art such as recombinant techniques.
- sequences of the CD276 binding domain are PTM optimized.
- PTM optimization refers to post-translation modification, aiming at avoiding potential aggregation, activity loss or other risk.
- Exemplary PTM optimized CD276 binding domain includes the antigen-binding domain of mVH5-mVL4-10 or mVH-mVL1-30, derived from 10-G6-C4-B2 and 30-C7-C11-D4, respectively.
- the variable region sequences of mVH5-mVL4-10 and mVH-mVL1-30 are shown in Table 3, wherein all the CDR regions are underlined.
- the CD276 binding domain is humanized.
- a humanized antibody or antigen-binding fragment is desirable in its reduced immunogenicity in human.
- a humanized antibody is chimeric in its variable regions, as non-human CDR sequences are grafted to human or substantially human FR sequences.
- Humanization of an antibody or antigen-binding fragment can be essentially performed by substituting the non-human (such as murine) CDR genes for the corresponding human CDR genes in a human immunoglobulin gene (see, for example, Jones et al. (1986) Nature 321: 522-525; Riechmann et al. (1988) Nature 332: 323-327; Verhoeyen et al. (1988) Science 239: 1534-1536) .
- Suitable human heavy chain and light chain variable domains can be selected to achieve this purpose using methods known in the art.
- “best-fit” approach can be used, where a non-human (e.g. rodent) antibody variable domain sequence is screened or BLASTed against a database of known human variable domain sequences, and the human sequence closest to the non-human query sequence is identified and used as the human scaffold for grafting the non-human CDR sequences (see, for example, Sims et al, (1993) J. Immunol. 151: 2296; Chothia et al. (1987) J. Mot. Biol. 196: 901) .
- a framework derived from the consensus sequence of all human antibodies may be used for the grafting of the non-human CDRs (see, for example, Carter et al. (1992) Proc. Natl. Acad. Sci. USA, 89: 4285; Presta et al. (1993) J. Immunol., 151: 2623) .
- the humanized antibodies or antigen-binding fragments provided herein are composed of substantially all human sequences except for the CDR sequences which are non-human.
- the variable region FRs, and constant regions if present, are entirely or substantially from human immunoglobulin sequences.
- the human FR sequences and human constant region sequences may be derived different human immunoglobulin genes, for example, FR sequences derived from one human antibody and constant region from another human antibody.
- Table 4 below shows the heavy chain and light chain variable region amino acid sequences of humanized antibodies for 10-G6-C4-B2 and 30-C7-C11-D4, which are designated as hVH2-hVL1-10, hVH3-hVL3-10, hVH4-hVL1-10, hVH4-hVL2-10, hVH5-hVL1-10, hVH5-hVL3-10, 10-G6-C4-B2_hVH2-VL1_PTM, 10-G6-C4-B2_hVH3-VL3_PTM, 10-G6-C4-B2_hVH4-VL1_PTM, 10-G6-C4-B2_hVH4-VL2_PTM, 10-G6-C4-B2_hVH5-VL1_PTM, 10-G6-C4-B2_hVH5-VL3_PTM, hVH1-hV
- the humanized CD276 binding domain is composed of substantially all human sequences except for the CDR sequences which are non-human.
- the variable region FRs, and constant regions if present are entirely or substantially from human immunoglobulin sequences.
- the human FR sequences and human constant region sequences may be derived from different human immunoglobulin genes, for example, FR sequences derived from one human antibody and constant region from another human antibody.
- the humanized CD276 domain comprises human heavy chain HFR1-4, and/or light chain LFR1-4.
- the FR regions derived from human may comprise the same amino acid sequence as the human immunoglobulin from which it is derived.
- one or more amino acid residues of the human FR are substituted with the corresponding residues from the parent non-human antibody. This may be desirable in certain embodiments to make the humanized antibody or its fragment closely approximate the non-human parent antibody structure, so as to optimize binding characteristics (for example, increase binding affinity) .
- the humanized antibody or antigen-binding fragment thereof provided herein comprises no more than 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid residue substitutions in each of the human FR sequences, or no more than 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid residue substitutions in all the FR sequences of a heavy or a light chain variable domain.
- such change in amino acid residue could be present in heavy chain FR regions only, in light chain FR regions only, or in both chains.
- one or more amino acids of the human FR sequences are randomly mutated to increase binding affinity.
- one or more amino acids of the human FR sequences are back mutated to the corresponding amino acid (s) of the parent non-human antibody so as to increase binding affinity.
- variable regions of the PD-L1 binding domain comprised in the multi-specific antibody or antigen-binding fragments thereof disclosed herein can be any of those PD-L1 antibody heavy chain variable regions and light chain variable regions known in the art.
- the PD-L1 binding domain comprises the heavy chain variable region and the light chain variable region from YN035 recited in WO2019196309A1.
- the multi-specific antibody or antigen-binding fragments thereof further comprises an activating receptor-binding domain.
- activating receptor refers to receptors (e.g., Fc ⁇ R) expressed on an immune effector cell (e.g., a phagocytic cell, such as a macrophage) , which upon activation by binding to, for example, Fc domain, mediates at least one effector functions of the immune effector cell (e.g., a phagocytic cell, such as a macrophage) or pro-inflammatory response.
- the immune effector cell provided herein co-expresses CD276 and one or more additional targets (e.g., PD-L1) .
- the activating receptor is an Fc ⁇ R
- the activating receptor-binding domain is an Fc domain.
- Fc domain can activate Fc receptors (FcRs) on macrophages to drive a phosphorylation cascade propagated by the receptors’ immunoreceptor tyrosine-based activation motifs (ITAMs) .
- ITAMs are conserved sequences present in the cytoplasmic tails of several activating receptors on immune effector cells, such as FcRs, T cell receptors and immunoglobulins (Ig) .
- ITAMs can be featured with a conserved amino acid sequence motif, which consists of paired YXXL/I motifs (wherein Y, L and I refer to Tyrosine, Lysine and Isoleucine respectively) and separated by a defined interval of six to eight amino acids. Phosphorylation of residues within the ITAM recruits several signaling molecules for phagocytosis activation. Accordingly, the activating receptor can be any receptor expressed on an immune effector cell that can be bound and activated to induce phagocytosis via an ITAM-comprising intracellular phagocytosis signaling domain.
- the activating receptor is a receptor involved in a different phagocytic signaling or mechanism, such as, Akt mediated signaling cascade (via CD19, CD28, CSFR or PDGFR receptor) , clustering of a group of receptors on an immune effector cell (e.g., macrophage) that potentiates phagocytosis (via, for example, integrins or selectins) , or antigen mediated cytotoxicity (via FcDR1 (CD89) receptor or CD206) .
- Akt mediated signaling cascade via CD19, CD28, CSFR or PDGFR receptor
- an immune effector cell e.g., macrophage
- FcDR1 (CD89) receptor or CD206 antigen mediated cytotoxicity
- activating receptors that are relevant to effector functions can be fragment crystallizable ⁇ receptors (Fc ⁇ Rs) , TREM2, lectin, scavenger receptor Al (SRA1) , MARCO, CD36, CD163, CD68, CD205, CD206, FcDRl, CD207, CD209, RAGE, CD14, CD64, F4/80, CD64, CD32a, CD16a, CD89, CD19, CD28, CSFR, PDGFR, MSR1, SCARA3, COLEC12, SCARA5, SCARB1, SCARB2, dectin 1, RAGE (SR-E1) , LRPl, LRP2, ASGP, SR-PSOX, CXCL16, OLR1, SCARF1, SCARF2, CXCL16, STAB1, STAB2, SRCRB4D, SSC5D, CCR2, CX3CR1, CSF1R, Tie2, HuCRIg (L) , and CD169 receptor or
- Fc ⁇ Rs fragment crystalliz
- the activating receptor that can generate pro-inflammatory signals upon activation include without limitation, PI3K, Fc ⁇ Rl, Fc ⁇ R2A, Fc ⁇ R2B2, Fc ⁇ R2C, Fc ⁇ R3A, BAH. Tyro3, Axl, Traf6, Syk, MyD88, Zap70, Fc ⁇ Rl, Fc ⁇ Rl, BAFF-R, DAP 12, NFAM1, MRC1, ItgB5, MERTK, ELMO, and CD79b.
- activating receptor-binding domain refers to domain (e.g., a portion of an antibody) that is capable of specifically binding to an activating receptor on an immune effector cell and such binding leads to activation of the receptor as well as downstream signaling thereof (e.g., effector function or pro-inflammatory response of the immune cell) .
- the activating receptor-binding domain comprises an Fc domain of an antibody or a variant thereof.
- the Fc domain can be derived from IgG1 or IgG4.
- the activating receptor-binding domain of the multi-specific molecules provided herein binds and activates activating receptor selected from the group consisting of fragment crystallizable ⁇ receptors (Fc ⁇ Rs) , TREM2, lectin, scavenger receptor Al (SRA1) , MARCO, CD36, CD163, CD68, CD205, CD206, FcDRl, CD207, CD209, RAGE, CD14, CD64, F4/80, CD64, CD32a, CD16a, CD89, CD19, CD28, CSFR, PDGFR, MSR1, SCARA3, COLEC12, SCARA5, SCARB1, SCARB2, dectin 1, RAGE (SR-E1) , LRPl, LRP2, ASGP, SR-PSOX, CXCL16, OLR1, SCARF1, SCARF2, CXCL16, STAB1, STAB2, SRCRB4D, SSC5D, CCR2, CX3CR1, CSF1R, Tie2,
- the activating receptor-binding domain of the multi-specific molecule provided herein comprises a Fc domain or a variant thereof, which activates Fc receptors (FcRs) on macrophages, such as Fc ⁇ RII.
- FcRs Fc receptors
- the activating receptor-binding domain comprises a heavy chain and/or a light chain constant region.
- the heavy chain constant region comprises CH1, hinge, and/or CH2-CH3 regions.
- the heavy chain constant region comprises an Fc region.
- the light chain constant region comprises C ⁇ or C ⁇ .
- the activating receptor-binding domain is derived from an immunoglobulin (Ig) , optionally a human Ig, optionally a human IgG. In some embodiments, the activating receptor-binding domain is derived from human IgG1, IgG2, IgG3, or IgG4.
- Ig immunoglobulin
- the activating receptor-binding domain is derived from human IgG1, IgG2, IgG3, or IgG4.
- Human IgG isotypes (the subclasses of mature gamma globulin class G antibodies; IgG1, IgG2, IgG3 and IgG4) exhibit differential capacity to recruit effector functions. For example, ADCC is promoted by IgG1 and IgG3, ADCP is promoted by IgG1, IgG2, IgG3 and IgG4, and CDC is promoted by IgG1 and IgG3. Isotype-specific engagement of such effector functions is based on selectivity for Fc receptors on distinct immune cells and the ability to bind C1q thereby activating the assembly of a membrane attack complex (MAC) .
- MAC membrane attack complex
- Fc ⁇ receptors which include Fc ⁇ RI, Fc ⁇ RIIa/b/c, and Fc ⁇ RIIIa/b is high for IgG1 and IgG3.
- Fc ⁇ affinity for IgG2 is considerably lower with the exception of Fc ⁇ RIIa H131 polymorphism and IgG4 only has measurable affinity for Fc ⁇ RI.
- the activating receptor-binding domain is derived from human IgG1 isotype, which could induce ADCC, CDC or ADCP, or a constant region of IgG4 or IgG2 isotype, which has reduced or depleted effector function.
- Effector functions such as ADCC and CDC can lead to cytotoxicity to cells expressing tumor antigen (e.g., CD276) .
- Effector functions can be evaluated using various assays such as Fc receptor binding assay, C1q binding assay, and cell lysis assay.
- the activating receptor-binding domain is derived from a constant region of mouse IgG2 isotype, which could induce ADCC, CDC or ADCP.
- the multi-specific antibody or antigen-binding fragments thereof provided herein is a recombinant protein comprising multiple antigen binding domains described throughout the specification, wherein each of the multiple antigen binding domains has specific binding affinity to each targeted antigen, and is connected with each other by one or more linkers.
- the one or more linkers may have cognate peptides that exhibit complementary binding with each other.
- the first binding domain of the multi-specific antibody or antigen-binding fragments thereof provided herein is fused with the first of a pair of cognate peptides, while the second binding domain thereof is fused with the second of the pairs of cognate peptides; as such, the first binding domain and the second binding domain can be connected by the pair of cognate peptides through the complementary binding between each of the pair of cognate peptides.
- the pair of cognate peptides comprises two heavy chains of an antibody or any complementary portion thereof, a pair of light chain and heavy chain complementary to each other of an antibody or any complementary portion thereof, leucine zipper domains that exhibit complementary binding with each other (e.g., the zipper sequences within the binding regions of c-Fos and c-June proteins) , or synthetic peptides designed to specifically bind to each other via synthetic connectors.
- the multiple antigen binding domains (e.g., the first binding domain and the second binding domain) and the activating receptor binding domain of the multi-specific antibody or antigen-binding fragments thereof provided herein can also be connected via chemical binding, such as crosslinking (e.g., BS2G crosslinker (Bis [Sulfosuccmimidyl] glutarate) , BS3 crosslinker (Bis [sulfosuccinimidyl] suberate) , Sulfo-DSS, DST crosslinker (Disuccinimidyl tartrate) , BMPS (N- (B-Maleimidopropyloxy) succinimide ester; MBS crosslinker (mMaleimidobenzoyl-N-hydroxysuccinimide ester) ; or PDPH crosslinker (3- [2-Pyridyldithio] propionylhydrazide) ) .
- crosslinking e.g., BS
- the first binding domain (e.g., CD276 binding domain or PD-L1 binding domain) is linked to N-termination of the activating receptor-binding domain (e.g., Fc domain) .
- the first binding antibody domain (e.g., CD276 binding domain or PD-L1 binding domain) comprises a Fab domain, optionally, the Fab domain comprises a heavy chain linked to one of the N-termination of the activating receptor-binding domain (e.g., Fc domain) .
- both of the first binding domain and the second binding domain comprise a Fab domain
- each of the Fab domains comprises a heavy chain linked to each N-termination of the activating receptor-binding domain (e.g., Fc domain) , respectively.
- the second binding domain (e.g., CD276 binding domain or PD-L1 binding domain) is linked to the activating receptor-binding domain (e.g., Fc domain) or to the first binding domain.
- the second binding domain comprises an scFv structure.
- the second binding domain is linked to the C-termination of light chain of the first binding domain (e.g., the first binding domain comprising a Fab domain) . In certain embodiments, the second binding domain is linked to the N-termination of light chain of the first binding domain (e.g., the first binding domain comprising a Fab domain) . In certain embodiments, the second binding domain is linked to the C-termination of heavy chain of the first binding domain (e.g., the first binding domain comprising a Fab domain) . In certain embodiments, the second binding domain is linked to the N-termination of heavy chain of the first binding domain (e.g., the first binding domain comprising a Fab domain) .
- linked to refers to covalent or non-covalent interactions (e.g., hydrogen bonds, ionic bonds, van der Waals interactions, and hydrophobic bonds) between two components.
- the second binding domain is linked to C-termination of the activating receptor-binding domain (e.g., Fc domain) .
- the first binding domain e.g., the first binding domain comprising a Fab domain
- the second binding domain is linked to the C-termination of activating receptor-binding domain.
- the first binding domain e.g., CD276 binding domain or PD-L1 binding domain
- the activating receptor binding domain e.g., Fc domain
- the second binding domain comprises an scFv structure from N-termination to C-termination comprising a second heavy chain variable region, a first linker and a second light chain variable region.
- the first linker has a sequence of (GGGGS) 3 (SEQ ID NO: 390) .
- the N-termination of the second binding domain is linked to the C-termination of the activating receptor binding domain via a second linker.
- the second linker has a sequence of (GGGGS) 3 (SEQ ID NO: 390) .
- the multi-specific antibody or antigen-binding fragments thereof disclosed herein comprises two second binding domains, each of which is operably linked to each C-termination of the activation receptor binding domain, respectively.
- the multi-specific antibody or antigen-binding fragments thereof comprises four chains, which from N-termination to C-termination have the structures as following:
- Chains 1 and 4 VL1-CL;
- Chains 2 and 3 VH1-CH1-hing region-CH2-CH3-linker 2-VH2-linker 1-VL2;
- VH1 stands for the heavy chain variable region of the first binding domain
- VL1 stands for the light chain variable region of the first binding domain
- VH2 stands for the heavy chain variable region of the second binding domain
- VL2 stands for the light chain variable region of the second binding domain
- linker 1 stands for the first linker
- linker 2 stands for the second linker.
- the first binding domain is a CD276 binding domain and the second binding domain is a PD-L1 binding domain. In some other certain embodiments, the first binding domain is a PD-L1 binding domain and the second binding domain is a CD276 binding domain.
- the present disclosure also encompasses various variants of the multi-specific antibodies and/or antigen-binding fragments thereof provided herein.
- the present disclosure encompasses various types of variants of an exemplary antibody provided herein, i.e., the antibody with a heavy chain CDR3 sequence selected from the group consisting of SEQ ID NOs: 3, 11, 19, 27, 35, 43, 51, 59, 67, 75, 83, 91, 99, 107, 115, 123, 131, 139, 147, 155, 163, 171, 179, 187, 195, 203, 211, 219, 227, 235, 243, 251, 259, 267, 275, 283, 291, 299, 307, 315, 323, 331, 339, or 375.
- the antibody variants comprise one or more modifications or substitutions in one or more CDR sequences as provided in Table 1, 3 or 5, one or more FR sequences, the heavy or light chain variable region sequences provided in Table 2, 4 or 6, and/or the activating receptor binding domain (e.g. Fc region) .
- Such variants retain specific binding affinity to CD276 and/or PD-L1 of their parent antibodies, but have one or more desirable properties conferred by the modification (s) or substitution (s) .
- the antibody variants may have improved antigen-binding affinity, improved glycosylation pattern, reduced risk of glycosylation, reduced deamination, reduced or depleted effector function (s) , improved FcRn receptor binding, increased pharmacokinetic half-life, pH sensitivity, and/or compatibility to conjugation (e.g. one or more introduced cysteine residues) .
- the parent antibody sequence may be screened to identify suitable or preferred residues to be modified or substituted, using methods known in the art, for example “alanine scanning mutagenesis” (see, for example, Cunningham and Wells (1989) Science, 244: 1081-1085) .
- target residues e.g., charged residues such as Arg, Asp, His, Lys, and Glu
- a neutral or negatively charged amino acid e.g., alanine or polyalanine
- substitution at a particular amino acid location demonstrates an interested functional change, then the position can be identified as a potential residue for modification or substitution.
- the potential residues may be further assessed by substituting with a different type of residue (e.g. cysteine residue, positively charged residue, etc. ) .
- Affinity variant may contain modifications or substitutions in one or more CDR sequences as provided in Table 1, 3 or 5, one or more FR sequences, or the heavy or light chain variable region sequences in provided in Table 2, 3, 4 or 6.
- the affinity variants retain specific binding affinity to CD276 and/or PD-L1 of the parent antibody, or even have improved CD276 and/or PD-L1 specific binding affinity over the parent antibody.
- at least one (or all) of the substitution (s) in the CDR sequences, FR sequences, or variable region sequences comprises a conservative substitution.
- one or more amino acid residues may be substituted yet the resulting antibody or antigen-binding fragment still retain the binding affinity to CD276 and/or PD-L1, or even have an improved binding affinity.
- Various methods known in the art can be used to achieve this purpose.
- a library of antibody variants such as Fab or scFv variants
- phage display technology can be generated and expressed with phage display technology, and then screened for the binding affinity to CD276 and/or PD-L1.
- computer software can be used to virtually simulate the binding of the antibodies to CD276 and PD-L1, and identify the amino acid residues on the antibodies which form the binding interface. Such residues may be either avoided in the substitution so as to prevent reduction in binding affinity, or targeted for substitution to provide for a stronger binding.
- the humanized antibody or antigen-binding fragment provided herein comprises one or more amino acid residue substitutions in one or more CDR sequences, and/or one or more FR sequences.
- an affinity variant comprises no more than 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 substitutions in the CDR sequences and/or FR sequences in total.
- the multi-specific antibodies and antigen-binding fragments thereof comprise 1, 2, or 3 CDR sequences having at least 80% (e.g. at least 85%, 88%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%) sequence identity to that (or those) listed in Table 1 or 5, and in the meantime retain the binding affinity to CD276 and/or PD-L1 at a level similar to or even higher than its parent antibody.
- the multi-specific antibodies and antigen-binding fragments thereof comprise one or more variable region sequences having at least 80% (e.g. at least 85%, 88%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%) sequence identity to that (or those) listed in Table 2, 4 or 6, and in the meantime retain the binding affinity to CD276 and/or PD-L1 at a level similar to or even higher than its parent antibody.
- a total of 1 to 10 amino acids have been substituted, inserted, or deleted in a sequence selected from that (or those) listed in Table 1.
- the substitutions, insertions, or deletions occur in regions outside the CDRs (i.e., in the FRs) .
- the multi-specific antibodies and antigen-binding fragments provided herein also encompass a glycosylation variant, which can be obtained to either increase or decrease the extent of glycosylation of the antibody or antigen binding fragment thereof.
- the multi-specific antibody or antigen binding fragment thereof may comprise one or more amino acid residues with a side chain to which a carbohydrate moiety (e.g. an oligosaccharide structure) can be attached.
- Glycosylation of antibodies is typically either N-linked or O-linked.
- N-linked refers to the attachment of the carbohydrate moiety to the side chain of an asparagine residue, for example, an asparagine residue in a tripeptide sequence such as asparagine-X-serine and asparagine-X-threonine, where X is any amino acid except proline.
- O-linked glycosylation refers to the attachment of one of the sugars N-aceylgalactosamine, galactose, or xylose to a hydroxyamino acid, most commonly to serine or threonine. Removal of a native glycosylation site can be conveniently accomplished, for example, by altering the amino acid sequence such that one of the above-described tripeptide sequences (for N-linked glycosylation sites) or serine or threonine residues (for O-linked glycosylation sites) present in the sequence is substituted. A new glycosylation site can be created in a similar way by introducing such a tripeptide sequence or serine or threonine residue.
- the multi-specific antibodies and antigen-binding fragments provided herein also encompass a cysteine-engineered variant, which comprises one or more introduced free cysteine amino acid residues.
- a free cysteine residue is one which is not part of a disulfide bridge.
- a cysteine-engineered variant is useful for conjugation with for example, a cytotoxic and/or imaging compound, a label, or a radioisoptype among others, at the site of the engineered cysteine, through for example a maleimide or haloacetyl.
- Methods for engineering antibodies or antigen-binding fragments to introduce free cysteine residues are known in the art, see, for example, WO2006/034488.
- the multi-specific antibodies and antigen-binding fragments provided herein also encompass an Fc variant, which comprises one or more amino acid residue modifications or substitutions at its Fc region and/or hinge region.
- the multi-specific antibodies or antigen-binding fragments comprise one or more amino acid substitution (s) that improves pH-dependent binding to neonatal Fc receptor (FcRn) .
- FcRn neonatal Fc receptor
- Such a variant can have an extended pharmacokinetic half-life, as it binds to FcRn at acidic pH which allows it to escape from degradation in the lysosome and then be translocated and released out of the cell.
- Methods of engineering an antibody and antigen-binding fragment thereof to improve binding affinity with FcRn are well-known in the art, see, for example, Vaughn, D. et al, Structure, 6 (1) : 63-73, 1998; Kontermann, R.
- the multi-specific antibodies or antigen-binding fragments comprise one or more amino acid substitution (s) that alters the antibody-dependent cellular cytotoxicity (ADCC) .
- Certain amino acid residues at CH2 domain of the Fc region can be substituted to provide for enhanced ADCC activity.
- carbohydrate structures on the antibody can be changed to enhance ADCC activity.
- the multi-specific antibodies or antigen-binding fragments comprise one or more amino acid substitution (s) that alters Complement Dependent Cytotoxicity (CDC) , for example, by improving or diminishing C1q binding and/or CDC (see, for example, WO99/51642; Duncan &Winter Nature 322: 738-40 (1988) ; U.S. Pat. No. 5,648,260; U.S. Pat. No. 5,624,821) ; and WO94/29351 concerning other examples of Fc region variants.
- CDC Complement Dependent Cytotoxicity
- the multi-specific antibodies or antigen-binding fragments thereof comprise one or more amino acid substitution (s) in the interface of the Fc region to facilitate and/or promote heterodimerization.
- modifications comprise introduction of a protuberance into a first Fc polypeptide and a cavity into a second Fc polypeptide, wherein the protuberance can be positioned in the cavity so as to promote interaction of the first and second Fc polypeptides to form a heterodimer or a complex.
- the multi-specific antibodies and antigen-binding fragments thereof is linked to one or more conjugates, optionally, wherein the conjugate is covalently attached either directly or via a linker.
- a conjugate is a non-proteinaceous moiety that can be attached to the antibody or antigen-binding fragment thereof. It is contemplated that a variety of conjugates may be linked to the antibodies or antigen-binding fragments provided herein (see, for example, “Conjugate Vaccines” , Contributions to Microbiology and Immunology, J.M. Cruse and R.E. Lewis, Jr. (eds. ) , Carger Press, New York, (1989) ) .
- conjugates may be linked to the multi-specific antibodies or antigen-binding fragments by covalent binding, affinity binding, intercalation, coordinate binding, complexation, association, blending, or addition, among other methods.
- the conjugate comprises a clearance-modifying agent, a chemotherapeutic agent, a toxin, a radioactive isotope, a lanthanide, a luminescent label, a fluorescent label, an enzyme-substrate label, a DNA-alkylators, a topoisomerase inhibitor, a tubulin-binders, or other anticancer drugs.
- the multi-specific antibodies and antigen-binding fragments disclosed herein may be engineered to contain specific sites outside the epitope binding portion that may be utilized for binding to one or more conjugates.
- a site may include one or more reactive amino acid residues, such as for example cysteine or histidine residues, to facilitate covalent linkage to a conjugate.
- the multi-specific antibodies may be linked to a conjugate indirectly, or through another conjugate.
- the multi-specific antibody or antigen-binding fragments may be conjugated to biotin, then indirectly conjugated to a second conjugate that is conjugated to avidin.
- the conjugate can be a toxin (e.g., a chemotherapeutic agent) , a detectable label (e.g., a radioactive isotope, a lanthanide, a luminescent label, a fluorescent label, or an enzyme-substrate label) .
- a “toxin” can be any agent that is detrimental to cells or that can damage or kill cells.
- toxin include, without limitation, taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorubicin, daunorubicin, dihydroxy anthracin dione, mitoxantrone, mithramycin, actinomycin D, 1-dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, puromycin and analogs thereof, antimetabolites (e.g., methotrexate, 6-mercaptopurine, 6-thioguanine, cytarabine, 5-fluorouracil decarbazine) , alkylating agents (e.g., mechlorethamine, thioe
- detectable label may include a fluorescent labels (e.g. fluorescein, rhodamine, dansyl, phycoerythrin, or Texas Red) , enzyme-substrate labels (e.g. horseradish peroxidase, alkaline phosphatase, luceriferases, glucoamylase, lysozyme, saccharide oxidases or ⁇ -D-galactosidase) , radioisotopes (e.g.
- the conjugate can be a pharmacokinetic modifying moiety which helps increase half-life of the antibody.
- Illustrative examples include water-soluble polymers, such as PEG, carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinyl pyrrolidone, copolymers of ethylene glycol/propylene glycol, and the like.
- the polymer may be of any molecular weight, and may be branched or unbranched.
- the number of polymers attached to the antibody may vary, and if more than one polymer are attached, they can be the same or different molecules.
- the conjugate can be a purification moiety such as a magnetic bead.
- the multi-specific antibodies and/or antigen-binding fragments thereof provided herein is used for a base for a conjugate.
- the present disclosure provides isolated polynucleotides that encode the multi-specific antibodies and antigen-binding fragments thereof.
- DNA encoding the monoclonal antibody is readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the antibody) .
- the encoding DNA may also be obtained by synthetic methods.
- the isolated polynucleotide that encodes the multi-specific antibodies and antigen-binding fragments thereof can be inserted into a vector for further cloning (amplification of the DNA) or for expression, using recombinant techniques known in the art.
- Many vectors are available.
- the vector components generally include, but are not limited to, one or more of the following: a signal sequence, an origin of replication, one or more marker genes, an enhancer element, a promoter (e.g. SV40, CMV, EF-1 ⁇ ) , and a transcription termination sequence.
- the vector system includes mammalian, bacterial, yeast systems, etc, and comprises plasmids such as, but not limited to, pALTER, pBAD, pcDNA, pCal, pL, pET, pGEMEX, pGEX, pCI, pCMV, pEGFP, pEGFT, pSV2, pFUSE, pVITRO, pVIVO, pMAL, pMD18-T, pMONO, pSELECT, pUNO, pDUO, Psg5L, pBABE, pWPXL, pBI, p15TV-L, pPro18, pTD, pRS420, pLexA, pACT2.2 etc, and other laboratorial and commercially available vectors.
- Suitable vectors may include, plasmid, or viral vectors (e.g., replication defective retroviruses, adenoviruses and adeno-associated vectors
- Vectors comprising the polynucleotide sequence encoding the antibody or antigen-binding fragment can be introduced to a host cell for cloning or gene expression.
- Suitable host cells for cloning or expressing the DNA in the vectors herein are the prokaryote, yeast, or higher eukaryote cells described above.
- Suitable prokaryotes for this purpose include eubacteria, such as Gram-negative or Gram-positive organisms, for example, Enterobacteriaceae such as Escherichia, e.g., E.
- eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for multi-specific antibody-encoding vectors.
- Saccharomyces cerevisiae or common baker's yeast, is the most commonly used among lower eukaryotic host microorganisms.
- a number of other genera, species, and strains are commonly available and useful herein, such as Schizosaccharomyces pombe; Kluyveromyces hosts such as, e.g., K. lactis, K. fragilis (ATCC 12,424) , K. bulgaricus (ATCC 16,045) , K. wickeramii (ATCC 24,178) , K.
- waltii ATCC 56,500
- K. drosophilarum ATCC 36,906
- K. thermotolerans K. marxianus
- yarrowia EP 402,226)
- Pichia pastoris EP 183,070
- Candida Trichoderma reesia
- Neurospora crassa Neurospora crassa
- Schwanniomyces such as Schwanniomyces occidentalis
- filamentous fungi such as, e.g., Neurospora, Penicillium, Tolypocladium, and Aspergillus hosts such as A. nidulans and A. niger.
- Suitable host cells for the expression of glycosylated antibodies or antigen-fragment provided here are derived from multicellular organisms.
- invertebrate cells include plant and insect cells.
- Numerous baculoviral strains and variants and corresponding permissive insect host cells from hosts such as Spodoptera frugiperda (caterpillar) , Aedes aegypti (mosquito) , Aedes albopictus (mosquito) , Drosophila melanogaster (fruiffly) , and Bombyx mori have been identified.
- a variety of viral strains for transfection are publicly available, e.g., the L-1 variant of Autographa californica NPV and the Bm-5 strain of Bombyx mori NPV, and such viruses may be used as the virus herein according to the present invention, particularly for transfection of Spodoptera frugiperda cells.
- Plant cell cultures of cotton, corn, potato, soybean, petunia, tomato, and tobacco can also be utilized as hosts.
- vertebrate cells have been greatest in vertebrate cells, and propagation of vertebrate cells in culture (tissue culture) has become a routine procedure.
- useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7, ATCC CRL 1651) ; human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al., J. Gen Virol. 36: 59(1977) ) ; baby hamster kidney cells (BHK, ATCC CCL 10) ; Chinese hamster ovary cells/-DHFR (CHO, Urlaub et al., Proc. Natl. Acad. Sci.
- mice sertoli cells TM4, Mather, Biol. Reprod. 23: 243-251 (1980) ) ; monkey kidney cells (CV1 ATCC CCL 70) ; African green monkey kidney cells (VERO-76, ATCC CRL-1587) ; human cervical carcinoma cells (HELA, ATCC CCL 2) ; canine kidney cells (MDCK, ATCC CCL 34) ; buffalo rat liver cells (BRL 3A, ATCC CRL 1442) ; human lung cells (W138, ATCC CCL 75) ; human liver cells (Hep G2, HB 8065) ; mouse mammary tumor (MMT 060562, ATCC CCL51) ; TRI cells (Mather et al., Annals N. Y. Acad. Sci. 383: 44-68 (1982) ) ; MRC 5 cells; FS4 cells; and a human hepatoma line (Hep G2) .
- Host cells are transformed with the above-described expression or cloning vectors for multi-specific antibody production and cultured in conventional nutrient media modified as appropriate for inducing promoters, selecting transformants, or amplifying the genes encoding the desired sequences.
- the antibody may be produced by homologous recombination known in the art.
- the host cells used to produce the multi-specific antibodies or antigen-binding fragments provided herein may be cultured in a variety of media.
- Commercially available media such as Ham's F10 (Sigma) , Minimal Essential Medium (MEM) , (Sigma) , RPMI-1640 (Sigma) , and Dulbecco's Modified Eagle's Medium (DMEM) , Sigma) are suitable for culturing the host cells.
- any of these media may be supplemented as necessary with hormones and/or other growth factors (such as insulin, transferrin, or epidermal growth factor) , salts (such as sodium chloride, calcium, magnesium, and phosphate) , buffers (such as HEPES) , nucleotides (such as adenosine and thymidine) , antibiotics (such as GENTAMYCIN TM drug) , trace elements (defined as inorganic compounds usually present at final concentrations in the micromolar range) , and glucose or an equivalent energy source. Any other necessary supplements may also be included at appropriate concentrations that would be known to those skilled in the art.
- the culture conditions such as temperature, pH, and the like, are those previously used with the host cell selected for expression, and will be apparent to the ordinarily skilled artisan.
- the multi-specific antibody can be produced intracellularly, in the periplasmic space, or directly secreted into the medium. If the antibody is produced intracellularly, as a first step, the particulate debris, either host cells or lysed fragments, is removed, for example, by centrifugation or ultrafiltration. Carter et al., Bio/Technology 10: 163-167 (1992) describe a procedure for isolating antibodies which are secreted to the periplasmic space of E. coli. Briefly, cell paste is thawed in the presence of sodium acetate (pH 3.5) , EDTA, and phenylmethylsulfonylfluoride (PMSF) over about 30 min.
- sodium acetate pH 3.5
- EDTA EDTA
- PMSF phenylmethylsulfonylfluoride
- Cell debris can be removed by centrifugation.
- supernatants from such expression systems are generally first concentrated using a commercially available protein concentration filter, for example, an Amicon or Millipore Pellicon ultrafiltration unit.
- a protease inhibitor such as PMSF may be included in any of the foregoing steps to inhibit proteolysis and antibiotics may be included to prevent the growth of adventitious contaminants.
- the multi-specific antibodies and antigen-binding fragments thereof prepared from the cells can be purified using, for example, hydroxylapatite chromatography, gel electrophoresis, dialysis, DEAE-cellulose ion exchange chromatography, ammonium sulfate precipitation, salting out, and affinity chromatography, with affinity chromatography being the preferred purification technique.
- Protein A immobilized on a solid phase is used for immunoaffinity purification of the antibody and antigen-binding fragment thereof.
- the suitability of protein A as an affinity ligand depends on the species and isotype of any immunoglobulin Fc domain that is present in the antibody.
- Protein A can be used to purify antibodies that are based on human gamma1, gamma2, or gamma4 heavy chains (Lindmark et al., J. Immunol. Meth. 62: 1-13 (1983) ) .
- Protein G is recommended for all mouse isotypes and for human gamma3 (Guss et al., EMBO J. 5: 1567 1575 (1986) ) .
- the matrix to which the affinity ligand is attached is most often agarose, but other matrices are available.
- Mechanically stable matrices such as controlled pore glass or poly (styrenedivinyl) benzene allow for faster flow rates and shorter processing times than can be achieved with agarose.
- the antibody comprises a CH3 domain
- the Bakerbond ABX. TM. resin J.T. Baker, Phillipsburg, N.J. ) is useful for purification.
- the mixture comprising the antibody of interest and contaminants may be subjected to low pH hydrophobic interaction chromatography using an elution buffer at a pH between about 2.5-4.5, preferably performed at low salt concentrations (e.g., from about 0-0.25M salt) .
- the present disclosure further provides pharmaceutical compositions comprising the multi-specific antibodies or antigen-binding fragments thereof and one or more pharmaceutically acceptable carriers.
- Pharmaceutical acceptable carriers for use in the pharmaceutical compositions disclosed herein may include, for example, pharmaceutically acceptable liquid, gel, or solid carriers, aqueous vehicles, nonaqueous vehicles, antimicrobial agents, isotonic agents, buffers, antioxidants, anesthetics, suspending/dispending agents, sequestering or chelating agents, diluents, adjuvants, excipients, or non-toxic auxiliary substances, other components known in the art, or various combinations thereof.
- Suitable components may include, for example, antioxidants, fillers, binders, disintegrants, buffers, preservatives, lubricants, flavorings, thickeners, coloring agents, emulsifiers or stabilizers such as sugars and cyclodextrins.
- Suitable antioxidants may include, for example, methionine, ascorbic acid, EDTA, sodium thiosulfate, platinum, catalase, citric acid, cysteine, thioglycerol, thioglycolic acid, thiosorbitol, butylated hydroxanisol, butylated hydroxytoluene, and/or propyl gallate.
- compositions comprising an antibody or antigen-binding fragment and conjugates as provided herein decreases oxidation of the antibody or antigen-binding fragment. This reduction in oxidation prevents or reduces loss of binding affinity, thereby improving antibody stability and maximizing shelf-life. Therefore, in certain embodiments compositions are provided that comprise one or more multi-specific antibodies or antigen-binding fragments thereof as disclosed herein and one or more antioxidants such as methionine.
- pharmaceutical acceptable carriers may include, for example, aqueous vehicles such as sodium chloride injection, Ringer's injection, isotonic dextrose injection, sterile water injection, or dextrose and lactated Ringer's injection, nonaqueous vehicles such as fixed oils of vegetable origin, cottonseed oil, corn oil, sesame oil, or peanut oil, antimicrobial agents at bacteriostatic or fungistatic concentrations, isotonic agents such as sodium chloride or dextrose, buffers such as phosphate or citrate buffers, antioxidants such as sodium bisulfate, local anesthetics such as procaine hydrochloride, suspending and dispersing agents such as sodium carboxymethylcelluose, hydroxypropyl methylcellulose, or polyvinylpyrrolidone, emulsifying agents such as Polysorbate 80 (TWEEN-80) , sequestering or chelating agents such as EDTA (ethylenediaminetetraacetic acid) or EGTA (
- Antimicrobial agents utilized as carriers may be added to pharmaceutical compositions in multiple-dose containers that include phenols or cresols, mercurials, benzyl alcohol, chlorobutanol, methyl and propyl p-hydroxybenzoic acid esters, thimerosal, benzalkonium chloride and benzethonium chloride.
- Suitable excipients may include, for example, water, saline, dextrose, glycerol, or ethanol.
- Suitable non-toxic auxiliary substances may include, for example, wetting or emulsifying agents, pH buffering agents, stabilizers, solubility enhancers, or agents such as sodium acetate, sorbitan monolaurate, triethanolamine oleate, or cyclodextrin.
- compositions can be a liquid solution, suspension, emulsion, pill, capsule, tablet, sustained release formulation, or powder.
- Oral formulations can include standard carriers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, polyvinyl pyrollidone, sodium saccharine, cellulose, magnesium carbonate, etc.
- the pharmaceutical compositions are formulated into an injectable composition.
- the injectable pharmaceutical compositions may be prepared in any conventional form, such as for example liquid solution, suspension, emulsion, or solid forms suitable for generating liquid solution, suspension, or emulsion.
- Preparations for injection may include sterile and/or non-pyretic solutions ready for injection, sterile dry soluble products, such as lyophilized powders, ready to be combined with a solvent just prior to use, including hypodermic tablets, sterile suspensions ready for injection, sterile dry insoluble products ready to be combined with a vehicle just prior to use, and sterile and/or non-pyretic emulsions.
- the solutions may be either aqueous or nonaqueous.
- unit-dose parenteral preparations are packaged in an ampoule, a vial or a syringe with a needle. All preparations for parenteral administration should be sterile and not pyretic, as is known and practiced in the art.
- a sterile, lyophilized powder is prepared by dissolving an antibody or antigen-binding fragment as disclosed herein in a suitable solvent.
- the solvent may contain an excipient which improves the stability or other pharmacological components of the powder or reconstituted solution, prepared from the powder. Excipients that may be used include, but are not limited to, water, dextrose, sorbital, fructose, corn syrup, xylitol, glycerin, glucose, sucrose or other suitable agents.
- the solvent may contain a buffer, such as citrate, sodium or potassium phosphate or other such buffer known to those of skill in the art at, in one embodiment, about neutral pH.
- the resulting solution will be apportioned into vials for lyophilization.
- Each vial can contain a single dosage or multiple dosages of the anti-CD276 antibody or antigen-binding fragment thereof or composition thereof.
- Overfilling vials with a small amount above that needed for a dose or set of doses e.g., about 10% is acceptable so as to facilitate accurate sample withdrawal and accurate dosing.
- the lyophilized powder can be stored under appropriate conditions, such as at about 4 °C to room temperature.
- Reconstitution of a lyophilized powder with water for injection provides a formulation for use in parenteral administration.
- the sterile and/or non-pyretic water or other liquid suitable carrier is added to lyophilized powder. The precise amount depends upon the selected therapy being given, and can be empirically determined.
- the present disclosure also provides therapeutic methods comprising: administering a therapeutically effective amount of the multi-specific antibody or antigen-binding fragment thereof as provided herein to a subject in need thereof, thereby treating or preventing a CD276 and/or PD-L1 related disease or condition.
- the CD276-related disease or condition is cancer, autoimmune disease, inflammatory disease, adaptive immune disease or infectious disease.
- cancer examples include but are not limited to, non-small cell lung cancer (squamous/nonsquamous) , small cell lung cancer, renal cell cancer, colorectal cancer, colon cancer, ovarian cancer, breast cancer (including basal breast carcinoma, ductal carcinoma and lobular breast carcinoma) , pancreatic cancer, gastric carcinoma, bladder cancer, esophageal cancer, mesothelioma, melanoma, head and neck cancer, thyroid cancer, sarcoma, prostate cancer, glioblastoma, cervical cancer, thymic carcinoma, melanoma, myelomas, mycoses fungoids, merkel cell cancer, hepatocellular carcinoma (HCC) , fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma, osteogenic sarcoma, and other sarcomas, synovioma, mesothelioma, Ewing's tumor, leiomyos
- the cancer is adrenal gland tumor, an AIDS-associated cancer, an alveolar soft part sarcoma, an astrocytic tumor, bladder cancer, bone cancer, a brain and spinal cord cancer, a metastatic brain tumor, a breast cancer, a carotid body tumors, a cervical cancer, a chondrosarcoma, a chordoma, a chromophobe renal cell carcinoma, a clear cell carcinoma, a colon cancer, a colorectal cancer, a cutaneous benign fibrous histiocytoma, a desmoplastic small round cell tumor, an ependymoma, a Ewing's tumor, an extraskeletal myxoid chondrosarcoma, a fibrogenesis imperfecta ossium, a fibrous dysplasia of the bone, a gallbladder or bile duct cancer, gastric cancer, a gestational trophoblastic disease, a germ cell tumor, a head and neck
- the disease or condition is hematological cancer chosen from B-cell lymphomas.
- B-cell lymphomas includes but not limited to, Hodgkin's lymphoma, non-Hodgkin's lymphoma (NHL) , acute lymphocytic leukemia (ALL) , acute myeloid leukemia (AML) , chronic lymphocytic leukemia (CLL) , chronic myelogenous leukemia (CML) , multiple myeloma (MM) , diffuse large B cell lymphoma (DLBCL) , Marginal zone B-cell lymphoma (MZL) , Mantle cell lymphoma (MCL) , Richter's syndrome, Burkitt's lymphoma or follicular lymphoma.
- NHL non-Hodgkin's lymphoma
- ALL acute lymphocytic leukemia
- AML acute myeloid leukemia
- CLL chronic lymphocytic leukemia
- Autoimmune diseases include, but are not limited to, Acquired Immunodeficiency Syndrome (AIDS, which is a viral disease with an autoimmune component) , alopecia areata, ankylosing spondylitis, antiphospholipid syndrome, autoimmune Addison's disease, autoimmune hemolytic anemia, autoimmune hepatitis, autoimmune inner ear disease (AIED) , autoimmune lymphoproliferative syndrome (ALPS) , autoimmune thrombocytopenic purpura (ATP) , Behcet's disease, cardiomyopathy, celiac sprue-dermatitis hepetiformis; chronic fatigue immune dysfunction syndrome (CFIDS) , chronic inflammatory demyelinating polyneuropathy (CIPD) , cicatricial pemphigold, cold agglutinin disease, crest syndrome, Crohn's disease, Degos'disease, dermatomyositis-juvenile, discoid lupus, essential mixed cryoglob
- Inflammatory disorders include, for example, chronic and acute inflammatory disorders.
- inflammatory disorders include Alzheimer's disease, asthma, atopic allergy, allergy, atherosclerosis, bronchial asthma, eczema, glomerulonephritis, graft vs. host disease, hemolytic anemias, osteoarthritis, sepsis, stroke, transplantation of tissue and organs, vasculitis, diabetic retinopathy and ventilator induced lung injury.
- the CD276 associated conditions are inflammatory diseases such as systemic lupus erythematosus (SLE) , intestinal mucosal inflammation, wasting disease associated with colitis, multiple sclerosis, viral infections, rheumatoid arthritis, osteoarthritis, Cohn's disease, and inflammatory bowel disease, psoriasis, systemic scleroderma, autoimmune diabetes and the like.
- SLE systemic lupus erythematosus
- Infectious disease include, but are not limited to, fungus infection, parasite/protozoan infection or chronic viral infection, for example, malaria, coccidioiodmycosis immitis, histoplasmosis, onychomycosis, aspergilosis, blastomycosis, candidiasis albicans, paracoccidioiomycosis, microsporidiosis, Acanthamoeba keratitis, Amoebiasis, Ascariasis, Babesiosis, Balantidiasis, Baylisascariasis, Chagas disease, Clonorchiasis, Cochliomyia, Cryptosporidiosis, Diphyllobothriasis, Dracunculiasis, Echinococcosis, Elephantiasis, Enterobiasis, Fascioliasis, Fasciolopsiasis, Filariasis, Giardiasis
- the subject is human.
- methods are provided to treat a disease or condition in a subject that would benefit from modulation of CD276 activity, comprising administering a therapeutically effective amount of the multi-specific antibody or antigen-binding fragment thereof as provided herein to a subject in need thereof.
- methods are provided to treat a disease or condition in a subject that would benefit from modulation of PD-1/PD-L1 pathway activity, comprising administering a therapeutically effective amount of the multi-specific antibody or antigen-binding fragment thereof as provided herein to a subject in need thereof.
- the term “disease or condition” as used herein can be used interchangeably with the term “CD276 and/or PD-L1 related disease or condition” .
- an antibody or antigen-binding fragment thereof as provided herein will depend on various factors known in the art, such as for example body weight, age, past medical history, present medications, state of health of the subject and potential for cross-reaction, allergies, sensitivities and adverse side-effects, as well as the administration route and extent of disease development. Dosages may be proportionally reduced or increased by one of ordinary skill in the art (e.g., physician or veterinarian) as indicated by these and other circumstances or requirements.
- an multi-specific antibody or antigen-binding fragment thereof as provided herein may be administered at a therapeutically effective dosage of about 0.01 mg/kg to about 100 mg/kg (e.g., about 0.01 mg/kg, about 0.5 mg/kg, about 1 mg/kg, about 2 mg/kg, about 3 mg/kg, about 5 mg/kg, about 10 mg/kg, about 15 mg/kg, about 20 mg/kg, about 25 mg/kg, about 30 mg/kg, about 35 mg/kg, about 40 mg/kg, about 45 mg/kg, about 50 mg/kg, about 55 mg/kg, about 60 mg/kg, about 65 mg/kg, about 70 mg/kg, about 75 mg/kg, about 80 mg/kg, about 85 mg/kg, about 90 mg/kg, about 95 mg/kg, or about 100 mg/kg) .
- the antibody or antigen-binding fragment thereof is administered at a dosage of about 50 mg/kg or less, and in certain of these embodiments the dosage is 10 mg/kg or less, 5 mg/kg or less, 3 mg/kg or less, 1 mg/kg or less, 0.5 mg/kg or less, or 0.1 mg/kg or less.
- the administration dosage may change over the course of treatment. For example, in certain embodiments, the initial administration dosage may be higher than subsequent administration dosages. In certain embodiments, the administration dosage may vary over the course of treatment depending on the reaction of the subject.
- Dosage regimens may be adjusted to provide the optimum desired response (e.g., a therapeutic response) .
- a single dose may be administered, or several divided doses may be administered over time.
- the multi-specific antibodies and antigen-binding fragments thereof disclosed herein may be administered by any route known in the art, such as for example parenteral (e.g., subcutaneous, intraperitoneal, intravenous, including intravenous infusion, intramuscular, or intradermal injection) or non-parenteral (e.g., oral, intranasal, intraocular, sublingual, rectal, or topical) routes.
- parenteral e.g., subcutaneous, intraperitoneal, intravenous, including intravenous infusion, intramuscular, or intradermal injection
- non-parenteral e.g., oral, intranasal, intraocular, sublingual, rectal, or topical routes.
- the multi-specific antibodies or antigen-binding fragments thereof disclosed herein may be administered alone or in combination with one or more additional therapeutic means or agents. In some embodiments, the multi-specific antibodies or antigen-binding fragments thereof disclosed herein may be administered alone or in combination with a second therapeutic agent. For example, the multi-specific antibodies or antigen-binding fragments thereof disclosed herein may be administered in combination with a second therapeutic agent, for example, a chemotherapeutic agent or an anti-cancer drug.
- a second therapeutic agent for example, a chemotherapeutic agent or an anti-cancer drug.
- the multi-specific antibodies or antigen-binding fragments thereof disclosed herein may be administered in combination with an antagonist of one or more immunoinhibitory molecule, e.g., CD24, CD47, SIRP ⁇ , PD-L1, or the beta-2 microglobulin subunit of the major histocompatibility class I complex (B2M) .
- an antagonist of one or more immunoinhibitory molecule e.g., CD24, CD47, SIRP ⁇ , PD-L1, or the beta-2 microglobulin subunit of the major histocompatibility class I complex (B2M) .
- the term “antagonist” as used herein comprises can refer to any small molecule, small or micro RNAs, or antibodies or antigen-binding fragments thereof that blocks or inhibits binding of CD24, CD47, SIRP ⁇ , PD-L1 or B2M to their respective binding partners so as to prevent elicit of immunoinhibitory signals.
- a multi-specific antibody or antigen-binding fragment thereof as disclosed herein that is administered in combination with one or more additional therapeutic agents may be administered simultaneously with the one or more additional therapeutic agents, and in certain of these embodiments the multi-specific antibody or antigen-binding fragment thereof and the additional therapeutic agent (s) may be administered as part of the same pharmaceutical composition.
- an antibody or antigen-binding fragment thereof administered “in combination” with another therapeutic agent does not have to be administered simultaneously with or in the same composition as the agent.
- An antibody or antigen-binding fragment thereof administered prior to or after another agent is considered to be administered “in combination” with that agent as the phrase is used herein, even if the antibody or antigen-binding fragment thereof and a second agent are administered via different routes.
- additional therapeutic agents administered in combination with the antibodies or antigen-binding fragments thereof disclosed herein are administered according to the schedule listed in the product information sheet of the additional therapeutic agent, or according to the Physicians'Desk Reference 2003 (Physicians’ Desk Reference, 57 th Edition; Medical Economics Company; ISBN: 1563634457; 57 th Edition (November 2002) ) or protocols well known in the art.
- the present disclosure also provides use of the antibody or antigen-binding fragment thereof provided herein in the manufacture of a medicament for treating a CD276 and/or PD-L1 related disease or condition in a subject.
- the present disclosure also provides a method of modulating CD276 activity in a CD276-expressing cell, comprising exposing the CD276-expressing cell to the multi-specific antibody or antigen-binding fragment thereof provided herein.
- the present disclosure also provides a method of modulating PD-1/PD-L1 pathway activity in a PD-L1-expressing cell, comprising exposing the PD-L1-expressing cell to the multi-specific antibody or antigen-binding fragment thereof provided herein.
- the present disclosure also provides use of the multi-specific antibody or antigen-binding fragment thereof provided herein in the manufacture of a medicament for treating a CD276 and/or PD-L1 related disease or condition in a subject.
- CHO-Scells overexpressing human CD276 protein (UniProt ID: Q5ZPR3, i.e. CHO-S-hCD276) or mouse CD276 protein (UniProt ID: Q8VE98, i.e. CHO-S-hCD276) were used as immunogen.
- Recombinant human CD276 protein (SEQ ID NO: 346) : the recombinant human CD276 protein was prepared by digesting the human CD276 protein with enterokinase, and the extracellular domain of human CD276 was fused with 6xHis tag and DDDDK (SEQ ID NO: 345) .
- Recombinant human CD276 protein (SEQ ID NO: 346) :
- mice Balb/c and SJL mice were immunized as shown below. The primary immunization was followed by several boosts until animals developed satisfactory antiserum titers suitable for hybridoma development.
- Screening-Test bleeds were performed and evaluated by testing using FACS on CHO-Scell line stably over-expressing human and/or mouse CD276 (CHO-S-hCD276 and/or CHO-S-mCD276) .
- Screening-Test bleeds were performed and evaluated by testing using Elisa with extra-cellular domain of recombinant human CD276 protein.
- Fusion-Splenocyte fusions were performed on the mice which responded the best to the immunizations as determined by test bleed FACS.
- the lymphocytes from spleens and lymph nodes were fused to a Sp2/0 cell line using an optimized electrofusion protocol. Multiple fusions were performed to ensure success of the cell fusion.
- fusion was plated (2 x 10 4 to 10 5 per well) into a stack of 96-well plates. Plates were monitored for growth and fed weekly. Wells with cell growth were screened by primary screening assays in 10-14 days with FACS and/or other feasible assays such as Elisa. Multiple fusions for each targeting antigen were performed and screened. The positive parental clones which showed positive binding with CHO-S-CD276 and positive Elisa signal from primary screening were expanded into 24-well plates for secondary screening.
- Hybridomas of interest were chosen to proceed to subcloning.
- Sequences of 31 mouse antibodies from Table 5 were selected to generate and produce human IgG1 chimeric antibodies.
- the binding affinity of these antibodies and bench mark antibody, Enoblituzumab see US8802091, MGA271, specifically with a construct designated as hBRCA84D-2) and MGC018 (an antibody-drug-conjugate, in which the mAb MGA017 (human IgG1) is conjugated via a cleavable linker to the prodrug seco-DUocarmycin hydroxyBenzamide Azaindole (DUBA) , an alkylating agent that can damage DNA in both dividing and non-dividing cells, thereby causing cell death) with human patient derived ovarian cancer cell line, SKOV3, was determined by FACS analysis.
- DUBA prodrug seco-DUocarmycin hydroxyBenzamide Azaindole
- step 4 Washed the cells twice by using the condition in step 2. Resuspended the cells with 100 ⁇ l/well diluted 2 nd antibody, incubated at 4°C for 1 hour in the dark.
- step 5 Washed the cells twice by using the condition in step 2. Resuspended the cells with 100 ⁇ l/well FACS buffer. Kept the cells in dark for FACS analysis.
- the binding affinity of the selected antibodies on SKOV3 are higher, lower or comparable with bench mark antibody Enoblituzumab (see Table 8 and Figure 1) .
- Table 9 shows the binding affinity of the chimeric antibodies on hB7H3 by Biacore (ChemPartner)
- B7H3 expression were detected by FACS with 6-D8-E7-A11. High expression level of B7H3 on several cancer cell lines, such as BxPC3 (Pancreatic) , MCF7 (Breast) , Dentroit562 (Head and neck) , RKO (Colon) and SUN620 (Gastric) , were found (see Figure 2) .
- SKOV3 cells ahuman ovarian cancer cell line
- Some of the antibodies showed lower or comparable EC 50 compared with bench mark antibody, Enoblituzumab (Table 10 and figure 3) , indicating that they are more potent in mediating ADCC effect on SKOV3 cells than Enoblituzumab (MGA271) .
- CHO-S-hCD276 cells were resuspended in cell culture medium at 4E5 cells/mL and were then added into a 96-well opaque wall plate at 50 ⁇ L/well.
- Anti-CD276 antibodies were diluted with complete F-12K medium and added to the 96-well opaque wall plate at 50 ⁇ L/well.
- Human serum complement was diluted with cell culture medium and was added to the same plate at 50 ⁇ L/well. The mixture was incubated for 2 hours in a CO 2 incubator at 37°C. CellTiter-Glo reagent for determining the cell cytotoxicity was added at 50 ⁇ L/well and the mixture was incubated for 10 mins at R.T. Luminescence signal of viable cells on a microplate reader was recorded.
- Fab-ZAP is a chemical conjugate of goat anti-human monovalent antibody (asecondary antibody) and the ribosome-inactivating protein, saporin. Fab-ZAP is used to determine the internalization ability of antibodies.
- 80 ⁇ L SKOV-3 cells were plated at 2000 cells/well in a 96-well plate and incubated overnight at 37°C.
- Anti-CD276 antibodies were then added at 40 ⁇ L/well.
- Fab-ZAP human dilution were added at 40 ⁇ L/well and incubated for 96 hours in a CO 2 incubator at 37°C.
- CellTiter-Glo reagent for determining the cell cytotoxicity were added at 100 ⁇ L/well and incubated for 10 mins at R.T. Luminescence signal of viable cells on a microplate reader were recorded.
- All the anti-CD276 antibodies showed potent indirect ADC effect on SKOV3 cells, with lower or comparable IC 50 compared with bench mark antibody, MGC018 (Table 12, Figure 5) , indicating that they are potential candidates for making ADCs.
- EXAMPLE 6 Antibody in vivo efficacy in the treatment of subcutaneous MC-38-hCD276 murine colon carcinoma in female C57BL/6 mice
- bi-specific antibodies follows the following pattern.
- the CD276 binding domain i.e., the binding domain derived from 25-C8-D7-C5
- the PD-L1 binding domain is the second binding domain
- the CD276 binding domain i.e., the binding domain derived from 25-C8-D7-C5
- the CD276 binding domain is the second binding domain
- the PD-L1 binding domain is the first binding domain.
- the MC-38-hCD276 (B7H3) tumor cells were maintained in vitro with DMEM medium supplemented with 10%fetal bovine serum at 37°C in an atmosphere of 5%CO 2 in air. The cells in exponential growth phase were harvested and quantitated by cell counter before tumor inoculation.
- mice Each mouse was inoculated subcutaneously in the right rear flank region with MC-38-hCD276 (B7H3) tumor cells (1 x 10 ⁇ 6) in 0.1 ml of PBS for tumor development. The date of randomization was denoted as day 0, and dosing starts from day 0.
- the randomization will start when the mean tumor size reaches approximately 50-60 mm 3 .60 mice were enrolled in this study. All animals were randomly allocated to 7 study groups. Randomization was performed based on randomized block design.
- Atezolizumab an anti-PD-L1 antibody, also named Tecentriq or MPDL3280A, see WO2010077634A1
- Antengene-084M MAA271’s Fab sequence (see US8802091B) constructed with mouse IgG2a) were used as control.
- Each Balb/c nude mouse for Calu-6 study was inoculated subcutaneously in the right front flank region with Calu-6 tumor cells (5 x 10 6 ) in 0.1 ml of PBS for tumor development. The randomization starts when the mean tumor size reaches approximately 122 mm 3 . 60 mice were enrolled in the study. The date of randomization was denoted as day 0, dosing starts from day 0.
- a Mean ⁇ SEM
- b TGI, T/C and p values were compared with group 1 tumor volume on day 24 by using Dunnett’s tests.
- Monocyte cells were re-suspended at 5 x 10 6 in 3 ml complete medium supplemented with 2 U/ml of dendritic cell culture factor and then culture cells in 6-well plate. At the second day, 2 ml/well of fresh complete medium supplemented with 2 U/ml of dendritic cell culture factor were added for another three days culture. Then monocytes differentiated into immature dendritic cells (iDC) . After stimulated 48 hours with 2 U/ml of dendritic cell mature factor, iDCs would differentiate into mature dendritic cells.
- iDC immature dendritic cells
- the tube was put on a magnet for 1 min RT, the F (ab) 2 is in supernatant and the Fc was captured by beads.
- 30-C7-C11-D4 can activate T cell activation while 25-C8-D7-C5 and BMK (MGA271) cannot.
- 10-G6-C4-B2 and 30-C7-C11-D4 were chosen to perform humanization and PTM optimization.
- the affinity of humanized candidates and optimized PTM sequences were evaluated by FACS.
- Analyte B7H3.
- Running buffer HBS-EP+.
- Flow Rate 30 ⁇ L/min.
- Capture Abs, 10 ⁇ L/min for 60 s.
- Method Multiple cycle kinetics/affinity using capture.
- Machine Model Biacore 8K (GE) . Analysis Temperature: 25°C.
- Each Balb/c nude mouse for Calu-6 study was inoculated subcutaneously in the right front flank region with Calu-6 tumor cells (5 x 10 6 ) in 0.1 ml of PBS for tumor development.
- the randomization starts when the mean tumor size reaches approximately 122 mm 3 .60 mice were enrolled in the study.
- the date of randomization was denoted as day 0, dosing starts from day 0.
- mice C57BL/6 were inoculated subcutaneously in the right rear flank region with MC-38-hCD276 (B7H3) tumor cells (1 x 10 6 ) in 0.1 ml of PBS for tumor development.
- the randomization starts when the mean tumor size reaches approximately 139 mm 3 .66 mice were enrolled in the study.
- the date of randomization was denoted as day 0, dosing starts from the day of randomization (day 0) .
- mice C57BL/6 were inoculated subcutaneously in the right rear flank region with MC-38-hCD276 (B7H3) tumor cells (1 x 10 6 ) in 0.1 ml of PBS for tumor development.
- the randomization starts when the mean tumor size reaches approximately 100 mm 3 .30 mice were enrolled in the study.
- the date of randomization was denoted as day 0, dosing starts from the day of randomization (day 0) .
- the humanized antibodies incorporated PTM optimization were constructed and expressed for the in vivo efficacy.
- a bispecific antibody using B7H3 mAb 30-C7-C11-D4 and PD-L1 mAb (SHANGHAI ORIGINCELL MEDICAL TECHNOLOGY CO., LTD; see WO2019196309A1, YN035) with human IgG1 was also constructed in the format of IgG (H) scFV.
- the N terminal of the anti-PD-L1 scFv VH followed by (GGGGS) 3-VL was linked to the C terminal of the Fc region of the B7H3-antibody.
- mice C57BL/6 were inoculated subcutaneously in the right rear flank region with MC-38-hCD276 (B7H3) tumor cells (1 x 10 6 ) in 0.1 ml of PBS for tumor development.
- the randomization starts when the mean tumor size reaches approximately 100 mm 3 .54 mice were enrolled in the study.
- the date of randomization was denoted as day 0, dosing starts from the day of randomization (day 0) .
- Bis-30-C7-C11-D4_hVH3-hVL2-PTM and Bis-30-C7-C11-D4_hVH4-hVL5-PTM showed comparable tumor growth inhibition with parental Bis-30-C7-C11-D4, as shown in Table 21 and Figure 15.
Landscapes
- Peptides Or Proteins (AREA)
Abstract
Provided are multi-specific molecules specific for CD276 and PD-L1, isolated polynucleotides encoding the same, pharmaceutical compositions comprising the same, and the uses thereof.
Description
The present disclosure generally relates to novel multi-specific antibodies targeting CD276 and one or more additional targets.
B7-H3 (CD276, UniProt IDs for human amino acid sequence: Q5ZPR3 and mouse amino acid sequence: Q8VE98) is an important newly found immune checkpoint member of the B7 and CD28 families, which is a type I transmembrane co-stimulatory molecule, existing in two isoforms determined by its extracellular domain. In mice, the extracellular domain consists of a single pair of immunoglobulin variable (IgV) -like and immunoglobulin constant (IgC) -like domains, whereas in humans it consists of one pair (2Ig-B7-H3) or two identical pairs (4Ig-B7-H3) due to exon duplication. B7-H3 mRNA is widely distributed in most tissues; in contrast, B7-H3 protein has a very limited expression on normal tissues because of its post-transcriptional regulation by microRNAs. However, B7-H3 protein is expressed at high frequency on many different cancer types (60%of all cancers) ("B7-H3: an attractive target for antibody-based immunotherapy" . Clinical Cancer Research: clincanres. 2584.2020) .
The function of B7-H3 has been controversial. It was classified as either a co-stimulatory molecule for T cell activation that inhibits tumor antigen-specific immune responses, or the non-immunological role such as promoting migration, tumor growth, invasion, metastasis, malignant stage, recurrence rate, angiogenesis, chemoresistance, epithelial-to-mesenchymal transition, and affecting tumor cell metabolism. The receptor for B7-H3 has been reported to be triggering receptor expressed on myeloid cell (TREM) -like transcript 2 (TLT-2, or TREML2) , which binds B7-H3 and costimulates activation of CD8 T cells in particular. B7-H3 is also reported an inhibitor for NK cells and osteoblastic cells by ligating unknown
receptor (s) . (The contrasting role of B7-H3, PNAS July 29, 2008, 105 (30) 10277-10278) .
Based on the clinical success of inhibitory immune checkpoint blockade (CTLA-4, PD-1, and PD-L1) , mAb antibodies against CD276 appear to be a promising therapeutic strategy worthy of development. Due to its selective expression on solid tumors, several groups have generated anti-CD276 antibodies, such as enoblituzumab (MGA271) , omburtamab, MGD009, MGC018, DS-7300a, and CAR T cells ( “B7-H3: an attractive target for antibody-based immunotherapy” . Clinical Cancer Research: clincanres. 2584.2020) , and observed tumor growth suppression in vitro and in vivo. CD276 is also reported to be expressed in hematological tumor cells (see Wei Zhang et al., B7 Family Members in Lymphoma: Promising Novel Targets for Tumor Immunotherapy? Front. Oncol., 31 March 2021) , indicating that CD276 can also be a potential target for treating hematological cancers.
Despite of the development of therapeutics targeting the CD276, there is a significant need for antibodies targeting CD276 as well as one or more additional targets, such as PD-L1.
BRIEF SUMMARY OF THE INVENTION
Throughout the present disclosure, the articles “a, ” “an, ” and “the” are used herein to refer to one or to more than one (i.e., to at least one) of the grammatical object of the article. By way of example, “an antibody” means one antibody or more than one antibody.
The present disclosure provides novel anti-CD276 antibody molecules, amino acid and nucleotide sequences thereof, and uses thereof.
In one aspect, the present disclosure provides an multi-specific antibody or an antigen-binding fragment thereof, comprising a first binding domain and a second binding domain, wherein the first binding domain specifically binds to CD276 and the second binding domain specifically binds to a second target other than CD276.
In some embodiments, the first binding domain comprises 1, 2, or 3 heavy chain complementarity determining region (CDR) sequences selected from the group consisting of: SEQ ID NOs: 1-3, 9-11, 17-19, 25-27, 33-35, 41-43, 49-51, 57-59, 65-67, 73-75, 81-83, 89-91, 97-99, 105-107, 113-115, 121-123, 129-131, 137-139, 145-147, 153-155, 161-163, 169-171, 177-179, 185-187, 193-195, 201-203, 209-211, 217-219, 225-227, 233-235, 241-243, 249-251, 257-259, 265-267, 273-275, 281-283, 289-291, 297-299, 305-307, 313-315, 321-323, 329-331, 337-339 and 374-375, and/or 1, 2, or 3 light chain CDR sequences selected from the group consisting of: SEQ ID NOs: 4-6, 12-14, 20-22, 28-30, 36-38, 44-46, 52-54, 60-62, 68-70, 76-78, 84-86, 92-94, 100-102, 108-110, 116-118, 124-126, 132-134, 140-142, 148-150, 156-158, 164-166, 172-174, 180-181, 188-190, 196-198, 204-206, 212-214, 220-222, 228-230, 236-238, 244-246, 252-254, 260-262, 268-270, 276-278, 284-286, 292-294, 300-302, 308-310, 316-318, 324-326, 332-334, 340-342 and 376-377.
In some embodiments, the first binding domain comprises a heavy chain variable region selected from the group consisting of:
a) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 1-3;
b) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 9-11;
c) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 17-19;
d) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 25-27;
e) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 33-35;
f) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 41-43;
g) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 49-51;
h) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 57-59;
i) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 65-67;
j) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 73-75;
k) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 81-83;
l) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 89-91;
m) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 97-99;
n) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 105-107;
o) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 113-115;
p) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 121-123;
q) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 129-131;
r) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 137-139;
s) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 145-147;
t) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 153-155;
u) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 161-163;
v) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 169-171;
w) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 177-179;
x) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 185-187;
y) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 193-195;
z) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 201-203;
aa) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 209-211;
bb) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 217-219;
cc) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 225-227;
dd) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 233-235;
ee) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 241-243;
ff) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 249-251;
gg) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 257-259;
hh) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 265-267;
ii) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 273-275;
jj) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 281-283;
kk) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 289-291;
ll) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 297-299;
mm) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 305-307;
nn) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 313-315;
oo) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 321-323;
pp) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 329-331;
qq) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 337-339; and
rr) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 9, 374 and 375.
In some embodiments, the first binding domain provided herein comprises a light chain variable region selected from the group consisting of:
a) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 4-6;
b) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 12-14;
c) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 20-22;
d) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 28-30;
e) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 36-38;
f) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 44-46;
g) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 52-54;
h) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 60-62;
i) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 68-70;
j) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 76-78;
k) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 84-86;
l) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 92-94;
m) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 100-102, 108-110;
n) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 108-110;
o) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 116-118;
p) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 124-126;
q) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 132-134;
r) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 140-142;
s) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 148-150;
t) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 156-158;
u) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 164-166;
v) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 172-174;
w) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 180-181;
x) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 188-190;
y) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 196-198;
z) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 204-206;
aa) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 212-214;
bb) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 220-222;
cc) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 228-230;
dd) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 236-238;
ee) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 244-246;
ff) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 252-254;
gg) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 260-262;
hh) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 268-270, ;
ii) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 276-278;
jj) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 284-286;
kk) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 292-294;
ll) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 300-302;
mm) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 308-310;
nn) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 316-318;
oo) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 324-326;
pp) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 332-334;
qq) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 340-342;
rr) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 376, 13 and 14; and
ss) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 377, 45 and 46.
In some embodiments, the first binding domain comprises:
a) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 4, SEQ ID NO: 5, and SEQ ID NO: 6;
b) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 9, SEQ ID NO: 10, and SEQ ID NO: 11; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 12, SEQ ID NO: 13, and SEQ ID NO: 14;
c) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 17, SEQ ID NO: 18, and SEQ ID NO: 19; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 20, SEQ ID NO: 21 and SEQ ID NO: 22;
d) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 25, SEQ ID NO: 26, and SEQ ID NO: 27; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 28, SEQ ID NO: 29, and SEQ ID NO: 30;
e) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 33, SEQ ID NO: 34, and SEQ ID NO: 35; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 36, SEQ ID NO: 37, and SEQ ID NO: 38;
f) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 41, SEQ ID NO: 42, and SEQ ID NO: 43; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 44, SEQ ID NO: 45, and SEQ ID NO: 46;
g) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 49, SEQ ID NO: 50, and SEQ ID NO: 51; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 52, SEQ ID NO: 53, and SEQ ID NO: 54;
h) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 57, SEQ ID NO: 58, and SEQ ID NO: 59; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID SEQ ID NO: 60, SEQ ID NO: 61, and SEQ ID NO: 62;
i) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 65, SEQ ID NO: 66, and SEQ ID NO: 67; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 68, SEQ ID NO: 69, and SEQ ID NO: 70;
j) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 73, SEQ ID NO: 74, and SEQ ID NO: 75; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 76, SEQ ID NO: 77, and SEQ ID NO: 78;
k) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83; and a kappa light
chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 84, SEQ ID NO: 85, and SEQ ID NO: 86;
l) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 89, SEQ ID NO: 90, and SEQ ID NO: 91; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 92, SEQ ID NO: 93, and SEQ ID NO: 94;
m) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 97, SEQ ID NO: 98, and SEQ ID NO: 99; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 100, SEQ ID NO: 101, and SEQ ID NO: 102;
n) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 105, SEQ ID NO: 106, and SEQ ID NO: 107; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 108, SEQ ID NO: 109 and SEQ ID NO: 110;
o) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 113, SEQ ID NO: 114, and SEQ ID NO: 115; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 116, SEQ ID NO: 117, and SEQ ID NO: 118;
p) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 121, SEQ ID NO: 122, and SEQ ID NO: 123; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 124, SEQ ID NO: 125, and SEQ ID NO: 126;
q) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 129, SEQ ID NO: 130, and SEQ ID NO: 131; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 132, SEQ ID NO: 133, and SEQ ID NO: 134;
r) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 137, SEQ ID NO: 138, and SEQ ID NO: 139; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 140, SEQ ID NO: 141, and SEQ ID NO: 142;
s) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 145, SEQ ID NO: 146, and SEQ ID NO: 147; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID SEQ ID NO: 148, SEQ ID NO: 149, and SEQ ID NO: 150;
t) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 153, SEQ ID NO: 154, and SEQ ID NO: 155; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 156, SEQ ID NO: 157, and SEQ ID NO: 158;
u) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 161, SEQ ID NO: 162, and SEQ ID NO: 163; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 164, SEQ ID NO: 165, and SEQ ID NO: 166;
v) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 169, SEQ ID NO: 170, and SEQ ID NO: 171; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 172, SEQ ID NO: 173, and SEQ ID NO: 174;
w) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 177, SEQ ID NO: 178, and SEQ ID NO: 179; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 180, SEQ ID NO: 181, and SEQ ID NO: 182;
x) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 185, SEQ ID NO: 186, and SEQ ID NO: 187; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 188, SEQ ID NO: 189, and SEQ ID NO: 190;
y) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 193, SEQ ID NO: 194, and SEQ ID NO: 195; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 196, SEQ ID NO: 197 and SEQ ID NO: 198;
z) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 201, SEQ ID NO: 202, and SEQ ID NO: 203; and a light
chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 204, SEQ ID NO: 205, and SEQ ID NO: 206;
aa) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 209, SEQ ID NO: 210, and SEQ ID NO: 211; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 212, SEQ ID NO: 213, and SEQ ID NO: 214;
bb) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 217, SEQ ID NO: 218, and SEQ ID NO: 219; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 220, SEQ ID NO: 221, and SEQ ID NO: 222;
cc) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 225, SEQ ID NO: 226, and SEQ ID NO: 227; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 228, SEQ ID NO: 229, and SEQ ID NO: 230;
dd) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 233, SEQ ID NO: 234, and SEQ ID NO: 235; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID SEQ ID NO: 236, SEQ ID NO: 237, and SEQ ID NO: 238;
ee) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 241, SEQ ID NO: 242, and SEQ ID NO: 243; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 244, SEQ ID NO: 245, and SEQ ID NO: 246;
ff) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 249, SEQ ID NO: 250, and SEQ ID NO: 251; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 252, SEQ ID NO: 253, and SEQ ID NO: 254;
gg) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 257, SEQ ID NO: 258, and SEQ ID NO: 259; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 260, SEQ ID NO: 261, and SEQ ID NO: 262;
hh) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 265, SEQ ID NO: 266, and SEQ ID NO: 267; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 268, SEQ ID NO: 269, and SEQ ID NO: 270;
ii) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 273, SEQ ID NO: 274, and SEQ ID NO: 275; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 276, SEQ ID NO: 277, and SEQ ID NO: 278;
jj) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 281, SEQ ID NO: 282, and SEQ ID NO: 283; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 284, SEQ ID NO: 285 and SEQ ID NO: 286;
kk) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 289, SEQ ID NO: 290, and SEQ ID NO: 291; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 292, SEQ ID NO: 293, and SEQ ID NO: 294;
ll) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 297, SEQ ID NO: 298, and SEQ ID NO: 299; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 300, SEQ ID NO: 301, and SEQ ID NO: 302;
mm) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 305, SEQ ID NO: 306, and SEQ ID NO: 307; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 308, SEQ ID NO: 309, and SEQ ID NO: 310;
nn) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 313, SEQ ID NO: 314, and SEQ ID NO: 315; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 316, SEQ ID NO: 317, and SEQ ID NO: 318;
oo) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 321, SEQ ID NO: 322, and SEQ ID NO: 323; and a light
chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID SEQ ID NO: 324, SEQ ID NO: 325, and SEQ ID NO: 326;
pp) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 329, SEQ ID NO: 330, and SEQ ID NO: 331; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 332, SEQ ID NO: 333, and SEQ ID NO: 334;
qq) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 337, SEQ ID NO: 338, and SEQ ID NO: 339; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 340, SEQ ID NO: 341, and SEQ ID NO: 342; or
rr) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 9, SEQ ID NO: 374, and SEQ ID NO: 375; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 376, SEQ ID NO: 13, and SEQ ID NO: 14; or
ss) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 41, SEQ ID NO: 42, and SEQ ID NO: 43; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 377, SEQ ID NO: 45, and SEQ ID NO: 46.
In some embodiments, the first binding domain comprises a heavy chain variable region selected from the group consisting of: SEQ ID NO: 7, SEQ ID NO: 15, SEQ ID NO: 23, SEQ ID NO: 31, SEQ ID NO: 39, SEQ ID NO: 47, SEQ ID NO: 55, SEQ ID NO: 63, SEQ ID NO: 71, SEQ ID NO: 79, SEQ ID NO: 87, SEQ ID NO: 95, SEQ ID NO: 103, SEQ ID NO: 111, SEQ ID NO: 119, SEQ ID NO: 127, SEQ ID NO: 135, SEQ ID NO: 143, SEQ ID NO: 151, SEQ ID NO: 159, SEQ ID NO: 167, SEQ ID NO: 175, SEQ ID NO: 183, SEQ ID NO: 191, SEQ ID NO: 199, SEQ ID NO: 207, SEQ ID NO: 215, SEQ ID NO: 223, SEQ ID NO: 231, SEQ ID NO: 239, SEQ ID NO: 247, SEQ ID NO: 255, SEQ ID NO: 263, SEQ ID NO: 271, SEQ ID NO: 279, SEQ ID NO: 287, SEQ ID NO: 295, SEQ ID NO: 303, SEQ ID NO: 311, SEQ ID NO: 319, SEQ ID NO: 327, SEQ ID NO: 335, SEQ ID NO: 343, SEQ ID NO: 347, and SEQ ID NO: 349 and the homologue sequences of at least 80% (e.g., at
least 85%, 88%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%) sequence identity thereof.
In some embodiments, the first binding domain comprises a light chain variable region selected from the group consisting of: SEQ ID NO: 8, SEQ ID NO: 16, SEQ ID NO: 24, SEQ ID NO: 32, SEQ ID NO: 40, SEQ ID NO: 48, SEQ ID NO: 56, SEQ ID NO: 64, SEQ ID NO: 72, SEQ ID NO: 80, SEQ ID NO: 88, SEQ ID NO: 96, SEQ ID NO: 104, SEQ ID NO: 112, SEQ ID NO: 120, SEQ ID NO: 128, SEQ ID NO: 136, SEQ ID NO: 144, SEQ ID NO: 152, SEQ ID NO: 160, SEQ ID NO: 168, SEQ ID NO: 1756, SEQ ID NO: 184, SEQ ID NO: 192, SEQ ID NO: 200, SEQ ID NO: 208, SEQ ID NO: 216, SEQ ID NO: 224, SEQ ID NO: 232, SEQ ID NO: 240, SEQ ID NO: 248, SEQ ID NO: 256, SEQ ID NO: 264, SEQ ID NO: 272, SEQ ID NO: 280, SEQ ID NO: 288, SEQ ID NO: 296, SEQ ID NO: 304, SEQ ID NO: 312, SEQ ID NO: 320, SEQ ID NO: 328, SEQ ID NO: 336, SEQ ID NO: 344, SEQ ID NO: 348, and SEQ ID NO: 350 and the homologue sequences of at least 80% (e.g., at least 85%, 88%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%) sequence identity thereof.
In some embodiments, the first binding domain comprises SEQ ID NO: 378 (EVQLVESGGGLXQPGXSLRLSCXTSGFTLSDYYMSWVRQXPGKGLEWVXF MRNKANXYTTEYSASVRGRFTISRDTSKSXIYLQMNSLXXEDTAVYYCVRDR XGRPFAYWGQGTLVTVSS) , wherein the X at position i (i=12, 16, 23, 40, 49, 57, 80, 89, 90 and 103) of SEQ ID NO: 378 is referred as XHi, wherein XH12 is V or I, XH16 is G or R, XH23 is A or T, XH40 is A or P, XH49 is G or S, XH57 is A or G, XH80 is I or T, XH89 is R or K, XH90 is A or T, XH103 is D or E; and a light chain variable region comprising SEQ ID NO: 379 (DIXMTQSPXSLXXXXGXXXXIXCKSSQSLLNXINQKNFLTWYXQKPGXXPX LLIYWASTRESGVPXRFSGSGSGTDFTLXISXXXXEDLXXYYCQNDYTYPLTF GQGTKLEIK) , wherein the X at position i (i=3, 9, 12, 13, 14, 15, 17, 18, 19, 20, 22, 32, 43, 48, 49, 51, 66, 80, 83, 84, 85, 86, 90 and 91) of SEQ ID NO: 379 is referred as XLi, wherein XL3 is V or Q, XL9 is D, L or S, XL12 is A, S or P, XL13 is A or V, XL14 is S or T, XL15 is L, V or P, XL17 is D or E, XL18 is R or P, XL19 is A or V, XL20 is S or T,
XL22 is N, T or S, XL32 is A or S, XL43 is Q or L, XL48 is Q or K, XL49 is A, P or S, XL51 is K or Q, XL66 is S or D, XL80 is K or T, XL83 is R or S, XL84 is L or V, XL85 is Q or E, XL86 is A or P, XL90 is A or G, XL91 is T or V.
In some embodiments, the first binding domain comprises a heavy chain variable region comprising SEQ ID NO: 380 (QVQLQESGPGLVKPSXTLSLTCXVXGYSITSDYAWNWIRQXPGKGLEWIGYI SHSGSTSYNPSLKSRVTISRDTSKNQFSLKLSSVTAADTAVYYCARSLGRRWY FDVWGQGTTVTVSS) , wherein the X at position i (i=16, 23, 25 and 41) of SEQ ID NO:380 is referred as XHi, wherein XH16 is E or Q, XH23 is A or T, XH25 is S or Y, XH41 is H or P; and a light chain variable region comprising SEQ ID NO: 381 (DIXMTQSPXSLXXXXGXXXXIXCKSSQSLLXSSTQKNYLAWYXQKPGXXPX LLIYFASTRDSGVPXRFSGSGSGTDFTLXISXXXXEDLXXYFCQQHYIIPFTFG QGTKLEIK) , wherein the X at position i (i=3, 9, 12, 13, 14, 15, 17, 18, 19, 20, 22, 31, 43, 48, 49, 51, 66, 80, 83, 84, 85, 86, 90 and 91) of SEQ ID NO: 381 is referred as XLi, wherein XL3 is V or Q, XL9 is D, L or S, XL12 is A, S or P, XL13 is A or V, XL14 is S or T, XL15 is L, V or P, XL17 is D or E, XL18 is R or P, XL19 is A or V, XL20 is S or T, XL22 is N, T or S, XL31 is N or Q, XL43 is Q or L, XL48 is Q or K, XL49 is A, P or S, XL51 is K or Q, XL66 is S or D, XL80 is K or T, XL83 is R or S, XL84 is L or V, XL85 is Q or E, XL86 is A or P, XL90 is A or G, XL91 is T or V.
In some embodiments, the first binding domain comprises: (i) a heavy chain variable region comprising 1, 2, or 3 CDR sequences shown as SEQ ID NO: 9, SEQ ID NO: 10 or 374 (MRNKANAYTT) , and SEQ ID NO: 11 or 375 (VRDREGRPFAY) , respectively; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences shown as SEQ ID NO: 12 or 376 (QSLLNAINQKNF) , SEQ ID NO: 13, and SEQ ID NO: 14, respectively; or (ii) a heavy chain variable region comprising 1, 2, or 3 CDR sequences shown as SEQ ID NO: 41, SEQ ID NO: 42, and SEQ ID NO: 43, respectively; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences shown as SEQ ID NO: 44 or 377 (QSLLQSSTQKNY) , SEQ ID NO: 45, and SEQ ID NO: 46, respectively.
In some embodiments, the first binding domain comprises a heavy chain variable region comprising a sequence selected from SEQ ID NO: 351, 353, 355, 357, 358, 360, 362, 364, 365, 367 and 370; and a light chain variable region comprising a sequence selected from SEQ ID NO: 352, 354, 356, 359, 361, 363, 366, 368, 369, 371, 372 and 373.
In some embodiments, the first binding domain comprises:
a) a heavy chain variable region comprising SEQ ID NO: 7 and a light chain variable region comprising SEQ ID NO: 8;
b) a heavy chain variable region comprising SEQ ID NO: 15 and a light chain variable region comprising SEQ ID NO: 16;
c) a heavy chain variable region comprising SEQ ID NO: 23 and a light chain variable region comprising SEQ ID NO: 24;
d) a heavy chain variable region comprising SEQ ID NO: 31 and a light chain variable region comprising SEQ ID NO: 32;
e) a heavy chain variable region comprising SEQ ID NO: 39 and a light chain variable region comprising SEQ ID NO: 40;
f) a heavy chain variable region comprising SEQ ID NO: 47 and a light chain variable region comprising SEQ ID NO: 48;
g) a heavy chain variable region comprising SEQ ID NO: 55 and a light chain variable region comprising SEQ ID NO: 56;
h) a heavy chain variable region comprising SEQ ID NO: 63 and a light chain variable region comprising SEQ ID NO: 64;
i) a heavy chain variable region comprising SEQ ID NO: 71 and a light chain variable region comprising SEQ ID NO: 72;
j) a heavy chain variable region comprising SEQ ID NO: 79 and a light chain variable region comprising SEQ ID NO: 80;
k) a heavy chain variable region comprising SEQ ID NO: 87 and a light chain variable region comprising SEQ ID NO: 88;
l) a heavy chain variable region comprising SEQ ID NO: 95 and a light chain variable region comprising SEQ ID NO: 96;
m) a heavy chain variable region comprising SEQ ID NO: 103 and a light chain variable region comprising SEQ ID NO: 104;
n) a heavy chain variable region comprising SEQ ID NO: 111 and a light chain variable region comprising SEQ ID NO: 112;
o) a heavy chain variable region comprising SEQ ID NO: 119 and a light chain variable region comprising SEQ ID NO: 120;
p) a heavy chain variable region comprising SEQ ID NO: 127 and a light chain variable region comprising SEQ ID NO: 128;
q) a heavy chain variable region comprising SEQ ID NO: 135 and a light chain variable region comprising SEQ ID NO: 136;
r) a heavy chain variable region comprising SEQ ID NO: 143 and a light chain variable region comprising SEQ ID NO: 144;
s) a heavy chain variable region comprising SEQ ID NO: 151 and a light chain variable region comprising SEQ ID NO: 152;
t) a heavy chain variable region comprising SEQ ID NO: 159 and a light chain variable region comprising SEQ ID NO: 160;
u) a heavy chain variable region comprising SEQ ID NO: 167 and a light chain variable region comprising SEQ ID NO: 168;
v) a heavy chain variable region comprising SEQ ID NO: 175 and a light chain variable region comprising SEQ ID NO: 176;
w) a heavy chain variable region comprising SEQ ID NO: 183 and a light chain variable region comprising SEQ ID NO: 184;
x) a heavy chain variable region comprising SEQ ID NO: 191 and a light chain variable region comprising SEQ ID NO: 192;
y) a heavy chain variable region comprising SEQ ID NO: 199 and a light chain variable region comprising SEQ ID NO: 200;
z) a heavy chain variable region comprising SEQ ID NO: 207 and a light chain variable region comprising SEQ ID NO: 208;
aa) a heavy chain variable region comprising SEQ ID NO: 215 and a light chain variable region comprising SEQ ID NO: 216;
bb) a heavy chain variable region comprising SEQ ID NO: 223 and a light chain variable region comprising SEQ ID NO: 224;
cc) a heavy chain variable region comprising SEQ ID NO: 231 and a light chain variable region comprising SEQ ID NO: 232;
dd) a heavy chain variable region comprising SEQ ID NO: 239 and a light chain variable region comprising SEQ ID NO: 240;
ee) a heavy chain variable region comprising SEQ ID NO: 247 and a light chain variable region comprising SEQ ID NO: 248;
ff) a heavy chain variable region comprising SEQ ID NO: 255 and a light chain variable region comprising SEQ ID NO: 256;
gg) a heavy chain variable region comprising SEQ ID NO: 263 and a light chain variable region comprising SEQ ID NO: 264;
hh) a heavy chain variable region comprising SEQ ID NO: 271 and a light chain variable region comprising SEQ ID NO: 272;
ii) a heavy chain variable region comprising SEQ ID NO: 279 and a light chain variable region comprising SEQ ID NO: 280;
jj) a heavy chain variable region comprising SEQ ID NO: 287 and a light chain variable region comprising SEQ ID NO: 288;
kk) a heavy chain variable region comprising SEQ ID NO: 295 and a light chain variable region comprising SEQ ID NO: 296;
ll) a heavy chain variable region comprising SEQ ID NO: 303 and a light chain variable region comprising SEQ ID NO: 304;
mm) a heavy chain variable region comprising SEQ ID NO: 311 and a light chain variable region comprising SEQ ID NO: 312;
nn) a heavy chain variable region comprising SEQ ID NO: 319 and a light chain variable region comprising SEQ ID NO: 320;
oo) a heavy chain variable region comprising SEQ ID NO: 327 and a light chain variable region comprising SEQ ID NO: 328;
pp) a heavy chain variable region comprising SEQ ID NO: 335 and a light chain variable region comprising SEQ ID NO: 336;
qq) a heavy chain variable region comprising SEQ ID NO: 343 and a light chain variable region comprising SEQ ID NO: 344;
rr) a heavy chain variable region comprising SEQ ID NO: 347 and a light chain variable region comprising SEQ ID NO: 348; or
ss) a heavy chain variable region comprising SEQ ID NO: 349 and a light chain variable region comprising SEQ ID NO: 350.
In some embodiments, the first binding domain comprises:
a) a heavy chain variable region comprising SEQ ID NO: 351 and a light chain variable region comprising SEQ ID NO: 352;
b) a heavy chain variable region comprising SEQ ID NO: 353 and a light chain variable region comprising SEQ ID NO: 354;
c) a heavy chain variable region comprising SEQ ID NO: 355 and a light chain variable region comprising SEQ ID NO: 352;
d) a heavy chain variable region comprising SEQ ID NO: 355 and a light chain variable region comprising SEQ ID NO: 356;
e) a heavy chain variable region comprising SEQ ID NO: 357 and a light chain variable region comprising SEQ ID NO: 352;
f) a heavy chain variable region comprising SEQ ID NO: 357 and a light chain variable region comprising SEQ ID NO: 354;
g) a heavy chain variable region comprising SEQ ID NO: 358 and a light chain variable region comprising SEQ ID NO: 359;
h) a heavy chain variable region comprising SEQ ID NO: 360 and a light chain variable region comprising SEQ ID NO: 361;
i) a heavy chain variable region comprising SEQ ID NO: 362 and a light chain variable region comprising SEQ ID NO: 359;
j) a heavy chain variable region comprising SEQ ID NO: 362 and a light chain variable region comprising SEQ ID NO: 363;
k) a heavy chain variable region comprising SEQ ID NO: 364 and a light chain variable region comprising SEQ ID NO: 359;
l) a heavy chain variable region comprising SEQ ID NO: 364 and a light chain variable region comprising SEQ ID NO: 361;
m) a heavy chain variable region comprising SEQ ID NO: 365 and a light chain variable region comprising SEQ ID NO: 366;
n) a heavy chain variable region comprising SEQ ID NO: 367 and a light chain variable region comprising SEQ ID NO: 368;
o) a heavy chain variable region comprising SEQ ID NO: 367 and a light chain variable region comprising SEQ ID NO: 369;
p) a heavy chain variable region comprising SEQ ID NO: 367 and a light chain variable region comprising SEQ ID NO: 366;
q) a heavy chain variable region comprising SEQ ID NO: 370 and a light chain variable region comprising SEQ ID NO: 369;
r) a heavy chain variable region comprising SEQ ID NO: 370 and a light chain variable region comprising SEQ ID NO: 366;
s) a heavy chain variable region comprising SEQ ID NO: 365 and a light chain variable region comprising SEQ ID NO: 371;
t) a heavy chain variable region comprising SEQ ID NO: 367 and a light chain variable region comprising SEQ ID NO: 372;
u) a heavy chain variable region comprising SEQ ID NO: 367 and a light chain variable region comprising SEQ ID NO: 373;
v) a heavy chain variable region comprising SEQ ID NO: 367 and a light chain variable region comprising SEQ ID NO: 371;
w) a heavy chain variable region comprising SEQ ID NO: 370 and a light chain variable region comprising SEQ ID NO: 373; or
x) a heavy chain variable region comprising SEQ ID NO: 370 and a light chain variable region comprising SEQ ID NO: 371.
In some embodiments, the first binding domain further comprises one or more amino acid residue substitutions or modifications yet retains specific binding affinity to human CD276. In some embodiments, the substitution is in one or more
CDR sequences, and/or in one or more of the VH or VL sequences but not in any of the CDR sequences.
In some embodiments, the multi-specific antibody or antigen-binding fragment thereof further comprises an activating receptor binding domain, optionally a constant region of human Ig, or optionally a constant region of human IgG. In some embodiments, the constant region comprises a constant region of human IgG1, IgG2, IgG3, or IgG4.
In some embodiments, the second target is PD-L1.
In some embodiments, the second binding domain comprises 1, 2, or 3 heavy chain complementarity determining region (CDR) sequences selected from the group consisting of: SEQ ID NOs: 384-386, and/or 1, 2, or 3 light chain CDR sequences selected from the group consisting of: SEQ ID NOs: 387-389. In some embodiments, the second binding domain comprises a heavy chain variable region comprising three CDR sequences set forth as SEQ ID NOs: 384, 385 and 386, respectively; and a light chain variable region comprising three CDR sequences set forth as SEQ ID NOs: 387, 388 and 389, respectively.
In some embodiments, the second binding domain comprises a heavy chain variable set forth as SEQ ID NO: 382, and/or a light chain variable region set forth as SEQ ID NO: 383.
In some embodiments, the second binding domain further comprises one or more amino acid residue substitutions or modifications yet retains specific binding affinity to human PD-L1. In some embodiments, the substitution is in one or more CDR sequences, and/or in one or more of the VH or VL sequences but not in any of the CDR sequences.
In some embodiments, the second binding domain comprising an scFv structure of VH-linker-VL. In some embodiments, the linker comprises a sequence of (GGGGS) 3 (SEQ ID NO: 390) .
In some embodiments, the N-termination of the second binding domain is operably linked to the C-termination of the activating receptor binding domain.
In some embodiments, the multi-specific antibody or antigen-binding fragment thereof provided herein is a bi-specific or tri-specific antibody.
In some embodiments, the multi-specific antibody or antigen-binding fragment is linked to one or more conjugates. In some embodiments, the conjugate is covalently attached either directly or via a linker. In some embodiments, the conjugate comprises a clearance-modifying agent, a chemotherapeutic agent, a toxin, a radioactive isotope, a lanthanide, a luminescent label, a fluorescent label, an enzyme-substrate label, a DNA-alkylators, a topoisomerase inhibitor, a tubulin-binders, or other anticancer drugs.
In one aspect, the present disclosure provides an isolated polynucleotide encoding the antibody or antigen-binding fragment thereof provided herein.
In one aspect, the present disclosure provides a vector comprising the isolated polynucleotide provided herein.
In one aspect, the present disclosure provides a host cell comprising the vector provided herein.
In one aspect, the present disclosure provides a pharmaceutical composition comprising the multi-specific antibody or antigen-binding fragment thereof provided herein or the polynucleotide encoding the multi-specific antibody or antigen-binding fragment thereof, and a pharmaceutically acceptable carrier.
In one aspect, the present disclosure provides a method of expressing the multi-specific antibody or antigen-binding fragment thereof provided herein, comprising culturing the host cell provided herein under the condition at which the vector provided herein is expressed.
In one aspect, the present disclosure provides a method of treating a disease or condition in a subject that would benefit from modulation of CD276 activity, comprising administering to the subject a therapeutically effective amount of the multi-specific antibody or antigen-binding fragment thereof provided herein or the pharmaceutical composition provided herein.
In some embodiments, the disease or condition is a CD276 related disease or condition.
In some embodiments, the disease or condition is cancer, adaptive immune disease, autoimmune disease, inflammatory disease, or infectious disease.
In some embodiments, the cancer is adrenal gland tumor, an AIDS-associated cancer, an alveolar soft part sarcoma, an astrocytic tumor, bladder cancer, bone cancer, a brain and spinal cord cancer, a metastatic brain tumor, a breast cancer, a carotid body tumors, a cervical cancer, a chondrosarcoma, a chordoma, a chromophobe renal cell carcinoma, a clear cell carcinoma, a colon cancer, a colorectal cancer, a cutaneous benign fibrous histiocytoma, a desmoplastic small round cell tumor, an ependymoma, a Ewing's tumor, an extraskeletal myxoid chondrosarcoma, a fibrogenesis imperfecta ossium, a fibrous dysplasia of the bone, a gallbladder or bile duct cancer, gastric cancer, a gestational trophoblastic disease, a germ cell tumor, a head and neck cancer, hepatocellular carcinoma, an islet cell tumor, a Kaposi's Sarcoma, a kidney cancer, a leukemia, a lipoma/benign lipomatous tumor, a liposarcoma/malignant lipomatous tumor, a liver cancer, a lymphoma, a lung cancer, a medulloblastoma, a melanoma, a meningioma, a multiple endocrine neoplasia, a multiple myeloma, a myelodysplastic syndrome, a neuroblastoma, a neuroendocrine tumors, an ovarian cancer, a pancreatic cancer, a papillary thyroid carcinoma, a parathyroid tumor, a pediatric cancer, a peripheral nerve sheath tumor, a phaeochromocytoma, a pituitary tumor, a prostate cancer, a posterior uveal melanoma, a rare hematologic disorder, a renal metastatic cancer, a rhabdoid tumor, a rhabdomysarcoma, a sarcoma, a skin cancer, a soft-tissue sarcoma, a squamous cell cancer, a stomach cancer, a synovial sarcoma, a testicular cancer, a thymic carcinoma, a thymoma, a thyroid metastatic cancer, and a uterine cancer, optionally, wherein the cancer is chemoresistant.
In some embodiments, the disease or condition is hematological cancer selected from B-cell lymphomas, such as Hodgkin's lymphoma, non-Hodgkin's lymphoma (NHL) , acute lymphocytic leukemia (ALL) , acute myeloid leukemia (AML) , chronic lymphocytic leukemia (CLL) , chronic myelogenous leukemia (CML) , multiple myeloma (MM) , diffuse large B cell lymphoma (DLBCL) , Marginal
zone B-cell lymphoma (MZL) , Mantle cell lymphoma (MCL) , Richter's syndrome, Burkitt's lymphoma or follicular lymphoma.
In some embodiments, the subject is human.
In some embodiments, the method provided herein comprises administering to the subject a therapeutically effective amount of one or more therapeutic agent. In some embodiments, said therapeutic agent is a chemotherapeutic agent, a radiation therapeutic agent, a hormonal therapeutic agent, a toxin or an immunotherapeutic agent.
In some embodiments, the administration is via oral, nasal, intravenous, subcutaneous, sublingual, or intramuscular administration.
In some embodiments, said method further comprises administration of one or more additional cancer therapies selected from the group consisting of chemotherapy, immunotherapy, radiation therapy, hormonal therapy, and surgery.
In one aspect, the present disclosure provides a method of modulating CD276 activity in a CD276-expressing cell, comprising exposing the CD276-expressing cell to the antibody or antigen-binding fragment thereof provided herein.
In one aspect, the present disclosure provides a method of modulating PD-1/PD-L1 pathway activity in a PD-L1-expressing cell, comprising exposing the PD-L1-expressing cell to the multi-specific antibody or antigen-binding fragment thereof provided herein.
In one aspect, the present disclosure provides use of the multi-specific antibody or antigen-binding fragment thereof provided herein in the manufacture of a medicament for treating a CD276 and/or PD-L1 related disease or condition in a subject.
In some embodiments, the medicament further comprises a second therapeutic agent. In some embodiments, the second therapeutic agent is a chemotherapeutic agent, a radiation therapeutic agent, a hormonal therapeutic agent, a toxin or an immunotherapeutic agent.
BRIEF DESCFRIPTION OF THE DRAWINGS
The drawings are for illustration purposes only not for limitation.
Figure 1 shows the binding affinity of the anti-CD276 antibodies provided herein on SKOV3 cells as measured by FACs analysis.
Figure 2A-2E show binding of 6-D8-E7-A11 to several cancer cell lines that express B7H3 as measured by FACS analysis.
Figure 3A-3C show ADCC effect of the anti-CD276 antibodies provided herein on SKOV3 cells.
Figure 4A and 4B show CDC effect of the anti-CD276 antibodies provided herein on CHO-S-hCD276 cells.
Figure 5A-5E show indirect ADC cytotoxicity effect of the anti-CD276 antibodies provided herein on SKOV3 cells.
Figure 6 shows in vivo efficacy of the anti-CD276 antibodies provided herein in inhibiting the tumor growth in the mouse model inoculated with MC-38-hCD276 (B7H3) tumor cells.
Figure 7 shows effects on tumor growth in subcutaneous calu-6 model in balb/c nude mice (mean± sem) .
Figure 8 shows IL2 release by T cell activation in MLR assay.
Figure 9 shows IFNγ release by T cell activation in MLR assay.
Figure 10 shows the binding affinity on SKOV3 of humanized antibodies derived from 30-C7-C11-D4.
Figure 11 shows binding affinity on SKOV3 of humanized antibodies derived from 10-G6-C4-B2.
Figure 12 shows effects on tumor growth in subcutaneous Calu-6 model in Balb/c nude mice (Mean± SEM) .
Figure 13 shows effects of test articles on tumor growth in subcutaneous MC-38-hCD276 (B7H3) model in C57BL/6 Mice (Mean ± SEM) .
Figure 14 shows effects of test articles on tumor growth in subcutaneous MC-38-hCD276 (B7H3) Model in C57BL/6 Mice (Mean± SEM) .
Figure 15 shows effects of test articles on tumor growth in subcutaneous MC-38-hCD276 (B7H3) Model in C57BL/6 Mice (Mean± SEM) .
The following description of the disclosure is merely intended to illustrate various embodiments of the disclosure. As such, the specific modifications discussed are not to be construed as limitations on the scope of the disclosure. It will be apparent to one skilled in the art that various equivalents, changes, and modifications may be made without departing from the scope of the disclosure, and it is understood that such equivalent embodiments are to be included herein. All references cited herein, including publications, patents and patent applications are incorporated herein by reference in their entirety.
Definitions
The term “antibody” as used herein includes any immunoglobulin, monoclonal antibody, polyclonal antibody, multivalent antibody, bivalent antibody, or monovalent antibody that binds to a specific antigen. A native intact antibody comprises two heavy (H) chains and two light (L) chains. Mammalian heavy chains are classified as alpha, delta, epsilon, gamma, and mu, each heavy chain consists of a variable region (VH) and a first, second, and third constant region (CH1, CH2, CH3, respectively) ; mammalian light chains are classified as λ or κ, while each light chain consists of a variable region (VL) and a constant region. The antibody has a “Y” shape, with the stem of the Y consisting of the second and third constant regions of two heavy chains bound together via disulfide bonding. Each arm of the Y includes the variable region and first constant region of a single heavy chain bound to the variable and constant regions of a single light chain. The variable regions of the
light and heavy chains are responsible for antigen binding. The variable regions in both chains generally contain three highly variable loops called the complementarity determining regions (CDRs) (light chain CDRs including LCDR1, LCDR2, and LCDR3, heavy chain CDRs including HCDR1, HCDR2, and HCDR3) . CDR boundaries for the antibodies and antigen-binding domains disclosed herein may be defined or identified by the conventions of Kabat, IMGT, AbM, Chothia, or Al-Lazikani (Al-Lazikani, B., Chothia, C., Lesk, A.M., J. Mol. Biol., 273 (4) , 927 (1997) ; Chothia, C. et al., J Mol Biol. Dec 5; 186 (3) : 651-63 (1985) ; Chothia, C. and Lesk, A.M., J. Mol. Biol., 196, 901 (1987) ; N. R. Whitelegg et al, Protein Engineering, v13(12) , 819-824 (2000) ; Chothia, C. et al., Nature. Dec 21-28; 342 (6252) : 877-83
; Kabat E. A. et al., National Institutes of Health, Bethesda, Md. (1991) ; Marie-Paule Lefranc et al, Developmental and Comparative Immunology, 27: 55-77 (2003) ; Marie-Paule Lefranc et al, Immunome Research, 1 (3) , (2005) ; Marie-Paule Lefranc, Molecular Biology of B cells (second edition) , chapter 26, 481-514, (2015) ) . The three CDRs are interposed between flanking stretches known as framework regions (FRs) , which are more highly conserved than the CDRs and form a scaffold to support the hypervariable loops. The constant regions of the heavy and light chains are not involved in antigen-binding, but exhibit various effector functions. Antibodies are assigned to classes based on the amino acid sequence of the constant region of their heavy chain. The five major classes or isotypes of antibodies are IgA, IgD, IgE, IgG, and IgM, which are characterized by the presence of alpha, delta, epsilon, gamma, and mu heavy chains, respectively. Several of the major antibody classes are divided into subclasses such as IgG1 (gamma1 heavy chain) , IgG2 (gamma2 heavy chain) , IgG3 (gamma3 heavy chain) , IgG4 (gamma4 heavy chain) , IgA1 (alpha1 heavy chain) , or IgA2 (alpha2 heavy chain) .
The term “antibody molecule” as used herein refers to an antigen-binding protein or polypeptide comprising at least one antibody fragment (such as CDR, and/or variable region sequence) . An antibody molecule includes, for example, a monoclonal antibody, an antibody fragment or domain, a fusion protein comprising an
antibody fragment or domain, a polypeptide complex comprising an antibody fragment or domain, and so on.
The term “antigen-binding domain” (e.g. CD276-binding domain or PD-L1 binding domain) as used herein refers to an antibody fragment formed from a portion of an antibody comprising one or more CDRs, or any other antibody fragment that binds to an antigen but does not comprise an intact native antibody structure. Examples of antigen-binding domain include, without limitation, a Fab, a Fab', a F (ab') 2, an Fv fragment, a disulfide stabilized Fv fragment (dsFv) , a (dsFv) 2, a single-chain antibody molecule (scFv) , a camelized single domain antibody, a nanobody, a domain antibody, and a bivalent domain antibody. An antigen-binding domain is capable of binding to the same antigen to which the parent antibody binds. In certain embodiments, an antigen-binding domain may comprise one or more CDRs from a particular human antibody grafted to a framework region from one or more different human antibodies. For more and detailed formats of antigen-binding domain are described in Spiess et al, 2015, and Brinkman et al., mAbs, 9 (2) , pp. 182–212 (2017) , which are incorporated herein by entirety reference.
“Fab” with regard to an antibody refers to that portion of the antibody consisting of a single light chain (both variable and constant regions) bound to the variable region and first constant region of a single heavy chain by a disulfide bond.
“Fab'” refers to a Fab fragment that includes a portion of the hinge region.
“F (ab') 2” refers to a dimer of Fab’ .
A “fragment difficult (Fd) ” with regard to an antibody refers to the amino-terminal half of the heavy chain fragment that can be combined with the light chain to form Fab. For example, Fd fragment may consists of the VH and CH1 domains
“Fv” with regard to an antibody refers to the smallest fragment of the antibody to bear the complete antigen-binding site. An Fv fragment consists of the variable region of a single light chain bound to the variable region of a single heavy chain. A number of Fv designs have been provided, including dsFvs, in which the
association between the two domains is enhanced by an introduced disulphide bond; and scFvs can be formed using a peptide linker to bind the two domains together as a single polypeptide. Fvs constructs containing a variable domain of a heavy or light immunoglobulin chain associated to the variable and constant domain of the corresponding immunoglobulin heavy or light chain have also been produced.
“Single-chain Fv antibody” or “scFv” refers to an engineered antibody consisting of a light chain variable region and a heavy chain variable region connected to one another directly or via a peptide linker sequence (Huston JS et al. Proc Natl Acad Sci USA, 85: 5879 (1988) ) .
A “dsFv” refers to a disulfide-stabilized Fv fragment that the linkage between the variable region of a single light chain and the variable region of a single heavy chain is a disulfide bond. In some embodiments, a “ (dsFv) 2” or “ (dsFv-dsFv') ” comprises three peptide chains: two VH moieties linked by a peptide linker (e.g., a long flexible linker) and bound to two VL moieties, respectively, via disulfide bridges. In some embodiments, dsFv-dsFv'is bispecific in which each disulfide paired heavy and light chain has a different antigen specificity.
“Fc” with regard to an antibody refers to that portion of the antibody consisting of the second and third constant regions of a first heavy chain bound to the second and third constant regions of a second heavy chain via disulfide bonding. The Fc portion of the antibody is responsible for various effector functions such as antibody-dependent cell-mediated cytotoxicity (ADCC) , and complement dependent cytotoxicity (CDC) , but does not function in antigen binding.
“Camelized single domain antibody, ” “heavy chain antibody, ” or “HCAb” refers to an antibody that contains two VH domains and no light chains (Riechmann L. and Muyldermans S., J Immunol Methods. Dec 10; 231 (1-2) : 25-38 (1999) ; Muyldermans S., J Biotechnol. Jun; 74 (4) : 277-302 (2001) ; WO94/04678; WO94/25591; U.S. Patent No. 6,005,079) . Heavy chain antibodies were originally derived from Camelidae (camels, dromedaries, and llamas) . Although devoid of
light chains, camelized antibodies have an authentic antigen-binding repertoire (Hamers-Casterman C. et al., Nature. Jun 3; 363 (6428) : 446-8 (1993) ; Nguyen VK. et al. “Heavy-chain antibodies in Camelidae; a case of evolutionary innovation, ” Immunogenetics. Apr; 54 (1) : 39-47 (2002) ; Nguyen VK. et al. Immunology. May; 109 (1) : 93-101 (2003) ) . The variable domain of a heavy chain antibody (VHH domain) represents the smallest known antigen-binding unit generated by adaptive immune responses (Koch-Nolte F. et al., FASEB J. Nov; 21 (13) : 3490-8. Epub 2007 Jun 15 (2007) ) .
A “nanobody” refers to an antibody fragment that consists of a VHH domain from a heavy chain antibody and two constant domains, CH2 and CH3.
A “domain antibody” refers to an antibody fragment containing only the variable region of a heavy chain or the variable region of a light chain. In certain instances, two or more VH domains are covalently joined with a peptide linker to create a bivalent or multivalent domain antibody. The two VH domains of a bivalent domain antibody may target the same or different antigens.
The term “chimeric” as used herein, means an antibody or antigen-binding domain, having a portion of heavy and/or light chain derived from one species, and the rest of the heavy and/or light chain derived from a different species. In an illustrative example, a chimeric antibody may comprise a constant region derived from human and a variable region from a non-human animal, such as from mouse. In some embodiments, the non-human animal is a mammal, for example, a mouse, a rat, a rabbit, a goat, a sheep, a guinea pig, or a hamster.
The term “humanized” as used herein means that the antibody or antigen-binding domain comprises CDRs derived from non-human animals, FR regions derived from human, and when applicable, the constant regions derived from human.
The term “operably link” or “operably linked” refers to a juxtaposition, with or without a spacer or a linker or an intervening sequence, of two or more biological sequences of interest in such a way that they are in a relationship permitting them to
function in an intended manner. When used with respect to polypeptides, it is intended to mean that the polypeptide sequences are linked in such a way that permits the linked product to have the intended biological function. For example, an antibody variable region may be operably linked to a constant region so as to provide for a stable product with antigen-binding activity. For another example, an antigen-binding domain can be operably linked to another antigen-binding domain with an intervening sequence there between, and such intervening sequence can be a spacer or can comprise a much longer sequence such as a constant region of an antibody. The term may also be used with respect to polynucleotides. For one instance, when a polynucleotide encoding a polypeptide is operably linked to a regulatory sequence (e.g., promoter, enhancer, silencer sequence, etc. ) , it is intended to mean that the polynucleotide sequences are linked in such a way that permits regulated expression of the polypeptide from the polynucleotide.
The term “fusion” or “fused” when used with respect to amino acid sequences (e.g. peptide, polypeptide or protein) refers to combination of two or more amino acid sequences, for example by chemical bonding or recombinant means, into a single amino acid sequence which does not exist naturally. A fusion amino acid sequence may be produced by genetic recombination of two encoding polynucleotide sequences, and can be expressed by a method of introducing a construct containing the recombinant polynucleotides into a host cell.
An “antigen” as used herein refers to a compound, composition, peptide, polypeptide, protein or substance that can stimulate the production of antibodies or a T cell response in cell culture or in an animal, including compositions (such as one that includes a cancer-specific protein) that are added to a cell culture (such as a hybridoma) , or injected or absorbed into an animal. An antigen reacts with the products of specific humoral or cellular immunity (such as an antibody) , including those induced by heterologous antigens.
The term “CD276 protein” or “B7-H3 protein” as used herein is intended to encompass any form of CD276, for example, 1) native unprocessed CD276 molecule,
“full-length” CD276 chain or naturally occurring variants of CD276, including, for example, splice variants or allelic variants; 2) any form of CD276 that results from processing in the cell; or 3) full length, a fragment (e.g., a truncated form, an extracellular/transmembrane domain) or a modified form (e.g. a mutated form, a glycosylated/PEGylated, a His-tag/immunofluorescence fused form) of CD276 subunit generated through recombinant method.
The term “anti-CD276 antibody” , “anti-CD276 binding domain” or “CD276-binding domain” refers to an antibody or antigen-binding domain that is capable of specifically binding to CD276 (e.g. human, monkey or mouse CD276) .
“PD-L1” as used herein refers to programmed cell death ligand 1 (PD-L1, see, for example, Freeman et al. (2000) J. Exp. Med. 192: 1027) . Representative amino acid sequence of human PD-L1 is disclosed under the NCBI accession number: NP_054862.1, and the representative nucleic acid sequence encoding the human PD-L1 is shown under the NCBI accession number: NM_014143.3. PD-L1 is expressed in placenta, spleen, lymph nodes, thymus, heart, fetal liver, and is also found on many tumor or cancer cells. PD-L1 binds to its receptor PD-1 or B7-1, which is expressed on activated T cells, B cells and myeloid cells. The binding of PD-L1 and its receptor induces signal transduction to suppress TCR-mediated activation of cytokine production and T cell proliferation. Accordingly, PD-L1 plays a major role in suppressing immune system during particular events such as pregnancy, autoimmune diseases, tissue allografts, and is believed to allow tumor or cancer cells to circumvent the immunological checkpoint and evade the immune response.
The term “specific binding” or “specifically binds” as used herein refers to a non-random binding reaction between two molecules, such as for example between an antibody and an antigen.
In certain embodiments, the antibody molecules or antigen-binding domains provided herein specifically bind to CD276 and/or PD-L1 with a binding affinity (KD) of ≤10-6 M (e.g., ≤5x10-7 M, ≤2x10-7 M, ≤10-7 M, ≤5x10-8 M, ≤2x10-8 M, ≤10-8 M,
≤5x10-9 M, ≤4x10-9M) . KD used herein refers to the ratio of the dissociation rate to the association rate (koff/kon) , which may be determined by using any conventional method known in the art, including but are not limited to surface plasmon resonance method, microscale thermophoresis method, HPLC-MS method and flow cytometry (such as FACS) method. In certain embodiments, the KD value can be appropriately determined by using flow cytometry.
Binding affinity to CD276 and/or PD-L1 can also be represented by “half maximal effective concentration” (EC50) value, which refers to the concentration of an antibody where 50%of its maximal effect (e.g., binding or inhibition etc. ) is observed. The EC50 value can be measured by methods known in the art, for example, sandwich assay such as ELISA, Western Blot, flow cytometry assay, and other binding assays. In certain embodiments, the antibodies and the fragments thereof provided herein specifically bind to CD276 and/or PD-L1 at an EC50 (i.e. 50%binding concentration) of no more than 0.05 nM, no more than 0.06 nM, no more than 0.07 nM, no more than 0.08 nM, no more than 0.09 nM, no more than 0.1 nM, no more than 0.2 nM, no more than 0.3 nM, no more than 0.4 nM, no more than 0.5 nM, no more than 0.6 nM, no more than 0.7 nM, no more than 0.8 nM, no more than 0.9 nM, no more than 1 nM, no more than 1.5 nM, no more than 2 nM, no more than 2.5 nM, no more than 3.5 nM, no more than 3 nM, no more than 4 nM, no more than 4.5 nM, no more than 5 nM, no more than 6 nM, no more than 7 nM, no more than 8 nM, no more than 9 nM, or no more than 10 nM, by flow cytometry assay.
The ability to “block binding” or “compete for the same epitope” as used herein refers to the ability of an antibody or antigen-binding domain to inhibit the binding interaction between two molecules (e.g. human CD276 and its binding ligand, e.g. TLT-2) to any detectable degree. In certain embodiments, an antibody or antigen-binding domain that blocks binding between two molecules inhibits the binding interaction between the two molecules by at least 85%, or at least 90%. In certain embodiments, this inhibition may be greater than 85%, or greater than 90%.
The term “epitope” as used herein refers to the specific group of atoms or amino acids on an antigen to which an antibody binds. Epitopes can be formed both from contiguous amino acids (also called linear or sequential epitope) or noncontiguous amino acids juxtaposed by tertiary folding of a protein (also called configurational or conformational epitope) . Epitopes formed from contiguous amino acids are typically arranged linearly along the primary amino acid residues on the protein and the small segments of the contiguous amino acids can be digested from an antigen binding with major histocompatibility complex (MHC) molecules or retained on exposure to denaturing solvents whereas epitopes formed by tertiary folding are typically lost on treatment with denaturing solvents. An epitope typically includes at least 3, and more usually, at least 5, about 7, or about 8-10 amino acids in a unique spatial conformation. Two antibodies may bind the same or a closely related epitope within an antigen if they exhibit competitive binding for the antigen. For example, if an antibody or antigen-binding domain blocks binding of a reference antibody to the antigen by at least 85%, or at least 90%, or at least 95%, then the antibody or antigen-binding domain may be considered to bind the same/closely related epitope as the reference antibody.
A “conservative substitution” with reference to amino acid sequence refers to replacing an amino acid residue with a different amino acid residue having a side chain with similar physiochemical properties. For example, conservative substitutions can be made among amino acid residues with hydrophobic side chains (e.g. Met, Ala, Val, Leu, and Ile) , among residues with neutral hydrophilic side chains (e.g. Cys, Ser, Thr, Asn and Gln) , among residues with acidic side chains (e.g. Asp, Glu) , among amino acids with basic side chains (e.g. His, Lys, and Arg) , or among residues with aromatic side chains (e.g. Trp, Tyr, and Phe) . As known in the art, conservative substitution usually does not cause significant change in the protein conformational structure, and therefore could retain the biological activity of a protein.
The term “homolog” and “homologous” as used herein are interchangeable and refer to nucleic acid sequences (or its complementary strand) or amino acid sequences that have sequence identity of at least 80% (e.g., at least 85%, 88%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%) to another sequences when optimally aligned.
“Percent (%) sequence identity” with respect to amino acid sequence (or nucleic acid sequence) is defined as the percentage of amino acid (or nucleic acid) residues in a candidate sequence that are identical to the amino acid (or nucleic acid) residues in a reference sequence, after aligning the sequences and, if necessary, introducing gaps, to achieve the maximum number of identical amino acids (or nucleic acids) . Conservative substitution of the amino acid residues may or may not be considered as identical residues. Alignment for purposes of determining percent amino acid (or nucleic acid) sequence identity can be achieved, for example, using publicly available tools such as BLASTN, BLASTp (available on the website of U.S. National Center for Biotechnology Information (NCBI) , see also, Altschul S.F. et al, J. Mol. Biol., 215: 403–410 (1990) ; Stephen F. et al, Nucleic Acids Res., 25: 3389–3402 (1997) ) , ClustalW2 (available on the website of European Bioinformatics Institute, see also, Higgins D. G. et al, Methods in Enzymology, 266: 383-402 (1996) ; Larkin M.A. et al, Bioinformatics (Oxford, England) , 23 (21) : 2947-8 (2007) ) , and ALIGN or Megalign (DNASTAR) software. Those skilled in the art may use the default parameters provided by the tool, or may customize the parameters as appropriate for the alignment, such as for example, by selecting a suitable algorithm.
“Effector functions” as used herein refer to biological activities attributable to the binding of Fc region of an antibody to its effectors such as C1 complex, Fc receptor and effector cell (e.g., macrophage) . Exemplary effector functions include: complement dependent cytotoxicity (CDC) induced by interaction of antibodies and C1q on the C1 complex; antibody-dependent cell-mediated cytotoxicity (ADCC) induced by binding of Fc region of an antibody to Fc receptor on an effector cell; and antibody-dependent cellular phagocytosis (ADCP) induced by binding of Fc region of
an antibody to phagocytosis. It has become well established that the specific glycan structures associated with the conserved bi-antennary glycan in the Fc-CH2 domain can strongly influence the interaction with the FcyRs that mediate ADCC and ADCP and with Clq binding, the initial binding event leading to CDC (see Reusch D, Tejada ML. Fc glycans of therapeutic antibodies as critical quality attributes. Glycobiology 2015; 25: 1325-34) .
“Treating” or “treatment” of a condition as used herein includes preventing or alleviating a condition, slowing the onset or rate of development of a condition, reducing the risk of developing a condition, preventing or delaying the development of symptoms associated with a condition, reducing or ending symptoms associated with a condition, generating a complete or partial regression of a condition, curing a condition, or some combination thereof.
The term “subject” or “individual” or “animal” or “patient” as used herein refers to human or non-human animal, including a mammal or a primate, in need of diagnosis, prognosis, amelioration, prevention and/or treatment of a disease or disorder. Mammalian subjects include humans, monkeys, domestic animals, farm animals, and zoo, sports, or pet animals such as dogs, cats, guinea pigs, rabbits, rats, mice, horses, swine, cows, bears, and so on.
The term “vector” as used herein refers to a vehicle into which a polynucleotide encoding a protein may be operably inserted so as to bring about the expression of that protein. A vector may be used to transform, transduce, or transfect a host cell so as to bring about expression of the genetic element it carries within the host cell. Examples of vectors include plasmids, phagemids, cosmids, and artificial chromosomes such as yeast artificial chromosome (YAC) , bacterial artificial chromosome (BAC) , or P1-derived artificial chromosome (PAC) , bacteriophages such as lambda phage or M13 phage, and animal viruses. Categories of animal viruses used as vectors include retrovirus (including lentivirus) , adenovirus, adeno-associated virus, herpesvirus (e.g., herpes simplex virus) , poxvirus, baculovirus, papillomavirus, and papovavirus (e.g., SV40) . A vector may contain a variety of elements for
controlling expression, including promoter sequences, transcription initiation sequences, enhancer sequences, selectable elements, and reporter genes. In addition, the vector may contain an origin of replication. A vector may also include materials to aid in its entry into the cell, including but not limited to a viral particle, a liposome, or a protein coating. A vector can be an expression vector or a cloning vector.
The phrase “host cell” as used herein refers to a cell into which an exogenous polynucleotide and/or a vector has been introduced.
A “CD276-related” disease or condition as used herein refers to any disease or condition caused by, exacerbated by, or otherwise linked to increased or decreased expression or activities of CD276. In some embodiments, the CD276 related condition is immune-related disorder, such as, for example, cancer, autoimmune disease, inflammatory disease or infectious disease.
A “PD-L1-related” disease or condition as used herein refers to any disease or condition caused by, exacerbated by, or otherwise linked to increased expression or activities of PD-L1. In some embodiments, the PD-L1 related disease or condition is accompanied with a suppressed immune system. In some embodiments, the PD-L1 related disease or condition is immune-related disorder, such as, for example, cancer, autoimmune disease, inflammatory disease or infectious disease.
“Cancer” as used herein refers to any medical condition characterized by malignant cell growth or neoplasm, abnormal proliferation, infiltration or metastasis, and includes both solid tumors and non-solid cancers (hematologic malignancies) such as leukemia. As used herein “solid tumor” refers to a solid mass of neoplastic and/or malignant cells. Examples of cancer or tumors include adrenal gland tumor, an AIDS-associated cancer, an alveolar soft part sarcoma, an astrocytic tumor, bladder cancer, bone cancer, a brain and spinal cord cancer, a metastatic brain tumor, a breast cancer, a carotid body tumors, a cervical cancer, a chondrosarcoma, a chordoma, a chromophobe renal cell carcinoma, a clear cell carcinoma, a colon cancer, a colorectal cancer, a cutaneous benign fibrous histiocytoma, a desmoplastic small round cell
tumor, an ependymoma, a Ewing's tumor, an extraskeletal myxoid chondrosarcoma, a fibrogenesis imperfecta ossium, a fibrous dysplasia of the bone, a gallbladder or bile duct cancer, gastric cancer, a gestational trophoblastic disease, a germ cell tumor, a head and neck cancer, hepatocellular carcinoma, an islet cell tumor, a Kaposi's Sarcoma, a kidney cancer, a leukemia, a lipoma/benign lipomatous tumor, a liposarcoma/malignant lipomatous tumor, a liver cancer, a lymphoma, a lung cancer, a medulloblastoma, a melanoma, a meningioma, a multiple endocrine neoplasia, a multiple myeloma, a myelodysplastic syndrome, a neuroblastoma, a neuroendocrine tumors, an ovarian cancer, a pancreatic cancer, a papillary thyroid carcinoma, a parathyroid tumor, a pediatric cancer, a peripheral nerve sheath tumor, a phaeochromocytoma, a pituitary tumor, a prostate cancer, a posterior uveal melanoma, a rare hematologic disorder, a renal metastatic cancer, a rhabdoid tumor, a rhabdomysarcoma, a sarcoma, a skin cancer, a soft-tissue sarcoma, a squamous cell cancer, a stomach cancer, a synovial sarcoma, a testicular cancer, a thymic carcinoma, a thymoma, a thyroid metastatic cancer, and a uterine cancer.
In certain embodiments, the hematological malignancies includes B-cell lymphomas, optionally Hodgkin's lymphoma, non-Hodgkin's lymphoma (NHL) , acute lymphocytic leukemia (ALL) , acute myeloid leukemia (AML) , chronic lymphocytic leukemia (CLL) , chronic myelogenous leukemia (CML) , multiple myeloma (MM) , diffuse large B cell lymphoma (DLBCL) , Marginal zone B-cell lymphoma (MZL) , Mantle cell lymphoma (MCL) , Richter's syndrome, Burkitt's lymphoma or follicular lymphoma.
In certain embodiments, the cancer is selected from gastric cancer, breast cancer, head and neck cancer, pancreatic cancer, and colon cancer. In certain embodiments, the cancer is selected from a lymphoma, Hodgkin's lymphoma, non-Hodgkin's lymphoma and B-cell lymphoma.
In certain embodiments, the cancer is chemoresistant. The term “chemoresistant cancer” as used herein refers to a type of cancer that are not responsive to the effects of chemotherapy. For example, a cancer that has been
responding to a chemotherapy or a combination of different chemotherapies suddenly begins to grow can be referred to as a chemoresistant cancer.
The term “pharmaceutically acceptable” indicates that the designated carrier, vehicle, diluent, excipient (s) , and/or salt is generally chemically and/or physically compatible with the other ingredients comprising the formulation, and physiologically compatible with the recipient thereof.
Multi-specific antibody or antigen-binding fragments thereof
In one aspect, the present disclosure provides a multi-specific antibody or antigen-binding fragment thereof comprises multiple antigen binding domains and an activating receptor binding domain.
i. Multiple antigen binding domains
In some embodiments, the multiple antigen binding domains comprise at least a first binding domain targeting a first antigen and a second binding domain targeting a second antigen, wherein one of the first antigen and the second antigen is an immune checkpoint molecule or a tumor antigen, while the other one is one or more additional targets.
In some embodiments, the one or more additional targets comprise a target which is another immune checkpoint molecule (e.g., PD-L1) . In some other embodiments, the one or more additional targets comprise targets relating to immune cell (e.g., T cells or B cells) function. In some embodiments, the one or more additional targets comprises a target selected from the group consisting of CD40, CD3, CD28, etc.
In some embodiments, the first binding domain targets CD276, while the second binding domain targets one or more additional targets. In some embodiments, the second binding domain targets CD276, while the first binding domain targets one or more additional targets. In some embodiments, the first binding domain targets CD276, while the second binding domain targets PD-L1. In
some other embodiments, the first binding domain targets PD-L1, while the second binding domain targets CD276.
CD276 binding domain
In certain embodiments, the CD276 binding domain comprises one or more (e.g. 1, 2, 3, 4, 5, or 6) CDR sequences of an anti-CD276 antibody 9-E8-F9-C10, 10-G6-C4-B2, 18-F9-D8-G7, 9-G2-H6-E4, 20-F8-B5-G2, 30-C7-C11-D4, 23-F10-G4-F11, 6-H11-G5-D8, 27-E7-D8-C7, 30-E2-G7-G7, 5-D1-G6-D9, 3-C2-C3-E7, 11-G10-B4-B11, 16-C6-F7-F5, 22-E11-C3-F2, 24-C10-F9-G7, 25-C8-D7-C5, 4-D5-B9-B11, 10-B9-D10-A12, 15-G1-D1-E3, 8-B4-F5-E11, 6-F3-G2-G1, 9-B9-H11-G7, 9-G12-D6-A11, 13-A8-C4-G1, 15-C8-B5-G7, 28-G2-E6-B10, 3-G7-D8-D3, 14-E7-G9-D4, 20-C5-D7-D3, 8-C3-E3-F3, 2-A7-B10-A3, 26-D2-D6-B12, 11-C12-F4-F6, 16-G3-D10-C10, 27-F8-E10-E11, 7-E1-F8-F6, 25-D3-G4-C6, 13-E4-G9-A4, 20-A2-D10-G8, 3-F2-E7-F9, 6-D8-E7-A11, and 21-B3-B1-H5. In certain embodiments, the first binding domain is capable of specifically binding to CD276. Optionally, the CD276 are derived from human, monkey or mouse. In certain embodiments, the CD276 is a recombinant CD276 or a CD276 expressed on a cell surface.
All of these 43 anti-CD276 antibodies thereof provided herein are mouse monoclonal antibodies. Table 1 shows the CDR sequences of these 43 anti-CD276 antibodies according to IMGT numbering system. The heavy chain and light chain variable region sequences are also provided below.
Table 1. CDR sequences of the anti-CD276 antibodies
Heavy or light chain variable region sequences of 9-E8-F9-C10, 10-G6-C4-B2, 18-F9-D8-G7, 9-G2-H6-E4, 20-F8-B5-G2, 30-C7-C11-D4, 23-F10-G4-F11, 6-H11-G5-D8, 27-E7-D8-C7, 30-E2-G7-G7, 5-D1-G6-D9, 3-C2-C3-E7, 11-G10-B4-
B11, 16-C6-F7-F5, 22-E11-C3-F2, 24-C10-F9-G7, 25-C8-D7-C5, 4-D5-B9-B11, 10-B9-D10-A12, 15-G1-D1-E3, 8-B4-F5-E11, 6-F3-G2-G1, 9-B9-H11-G7, 9-G12-D6-A11, 13-A8-C4-G1, 15-C8-B5-G7, 28-G2-E6-B10, 3-G7-D8-D3, 14-E7-G9-D4, 20-C5-D7-D3, 8-C3-E3-F3, 2-A7-B10-A3, 26-D2-D6-B12, 11-C12-F4-F6, 16-G3-D10-C10, 27-F8-E10-E11, 7-E1-F8-F6, 25-D3-G4-C6, 13-E4-G9-A4, 20-A2-D10-G8, 3-F2-E7-F9, 6-D8-E7-A11, and 21-B3-B1-H5 antibodies are provided in Table 2.
Table 2. Variable region sequences of the anti-CD276 antibodies
CDRs are known to be responsible for antigen binding, however, it has been found that not all of the 6 CDRs are indispensable or unchangeable. In other words, it is possible to replace or change or modify one or more CDRs in the CD276 binding domain comprising the CDRs from anti-CD276 antibody 9-E8-F9-C10, 10-G6-C4-B2, 18-F9-D8-G7, 9-G2-H6-E4, 20-F8-B5-G2, 30-C7-C11-D4, 23-F10-G4-F11, 6-H11-G5-D8, 27-E7-D8-C7, 30-E2-G7-G7, 5-D1-G6-D9, 3-C2-C3-E7, 11-G10-B4-B11, 16-C6-F7-F5, 22-E11-C3-F2, 24-C10-F9-G7, 25-C8-D7-C5, 4-D5-B9-B11, 10-B9-D10-A12, 15-G1-D1-E3, 8-B4-F5-E11, 6-F3-G2-G1, 9-B9-H11-G7, 9-G12-D6-A11, 13-A8-C4-G1, 15-C8-B5-G7, 28-G2-E6-B10, 3-G7-D8-D3, 14-E7-G9-D4, 20-C5-D7-D3, 8-C3-E3-F3, 2-A7-B10-A3, 26-D2-D6-B12, 11-C12-F4-F6, 16-G3-D10-C10, 27-F8-E10-E11, 7-E1-F8-F6, 25-D3-G4-C6, 13-E4-G9-A4, 20-A2-D10-G8, 3-F2-E7-F9, 6-D8-E7-A11, or 21-B3-B1-H5, yet substantially retain the specific binding affinity to CD276.
In certain embodiments, the CD276 binding domain comprises a heavy chain CDR3 sequence of one of the anti-CD276 antibodies 9-E8-F9-C10, 10-G6-C4-B2, 18-F9-D8-G7, 9-G2-H6-E4, 20-F8-B5-G2, 30-C7-C11-D4, 23-F10-G4-F11, 6-H11-G5-D8, 27-E7-D8-C7, 30-E2-G7-G7, 5-D1-G6-D9, 3-C2-C3-E7, 11-G10-B4-B11, 16-C6-F7-F5, 22-E11-C3-F2, 24-C10-F9-G7, 25-C8-D7-C5, 4-D5-B9-B11, 10-B9-D10-A12, 15-G1-D1-E3, 8-B4-F5-E11, 6-F3-G2-G1, 9-B9-H11-G7, 9-G12-D6-A11, 13-A8-C4-G1, 15-C8-B5-G7, 28-G2-E6-B10, 3-G7-D8-D3, 14-E7-G9-D4, 20-C5-D7-D3, 8-C3-E3-F3, 2-A7-B10-A3, 26-D2-D6-B12, 11-C12-F4-F6, 16-G3-D10-C10, 27-F8-E10-E11, 7-E1-F8-F6, 25-D3-G4-C6, 13-E4-G9-A4, 20-A2-D10-G8, 3-F2-E7-F9, 6-D8-E7-A11, and 21-B3-B1-H5. In certain embodiments, the CD276 binding domain comprises a heavy chain CDR3 sequence selected from the group
consisting of SEQ ID NOs: 3, 11, 19, 27, 35, 43, 51, 59, 67, 75, 83, 91, 99, 107, 115, 123, 131, 139, 147, 155, 163, 171, 179, 187, 195, 203, 211, 219, 227, 235, 243, 251, 259, 267, 275, 283, 291, 299, 307, 315, 323, 331, and 339. Heavy chain CDR3 regions are located at the center of the antigen-binding site, and therefore are believed to make the most contact with antigen and provide the most free energy to the affinity of antibody to antigen. It is also believed that the heavy chain CDR3 is by far the most diverse CDR of the antigen-binding site in terms of length, amino acid composition and conformation by multiple diversification mechanisms (Tonegawa S. Nature. 302: 575-81) . The diversity in the heavy chain CDR3 is sufficient to produce most antibody specificities (Xu JL, Davis MM. Immunity. 13: 37-45) as well as desirable antigen-binding affinity (Schier R, etc. J Mol Biol. 263: 551-67) .
In certain embodiments, the CD276 binding domain comprise suitable framework region (FR) sequences, as long as the antibodies and/or antigen-binding fragments thereof can specifically bind to CD276. The CDR sequences provided in Table 1 are obtained from mouse antibodies, but they can be grafted to any suitable FR sequences of any suitable species such as mouse, human, rat, rabbit, among others, using suitable methods known in the art such as recombinant techniques.
In certain embodiments, sequences of the CD276 binding domain are PTM optimized. As used herein, PTM optimization refers to post-translation modification, aiming at avoiding potential aggregation, activity loss or other risk. Exemplary PTM optimized CD276 binding domain includes the antigen-binding domain of mVH5-mVL4-10 or mVH-mVL1-30, derived from 10-G6-C4-B2 and 30-C7-C11-D4, respectively. The variable region sequences of mVH5-mVL4-10 and mVH-mVL1-30 are shown in Table 3, wherein all the CDR regions are underlined.
Table 3. CDR sequences and variable region sequences of the anti-CD276 antibodies with PTM optimization
In certain embodiments, the CD276 binding domain is humanized. A humanized antibody or antigen-binding fragment is desirable in its reduced immunogenicity in human. A humanized antibody is chimeric in its variable regions, as non-human CDR sequences are grafted to human or substantially human FR sequences. Humanization of an antibody or antigen-binding fragment can be essentially performed by substituting the non-human (such as murine) CDR genes for the corresponding human CDR genes in a human immunoglobulin gene (see, for example, Jones et al. (1986) Nature 321: 522-525; Riechmann et al. (1988) Nature 332: 323-327; Verhoeyen et al. (1988) Science 239: 1534-1536) .
Suitable human heavy chain and light chain variable domains can be selected to achieve this purpose using methods known in the art. In an illustrative
example, “best-fit” approach can be used, where a non-human (e.g. rodent) antibody variable domain sequence is screened or BLASTed against a database of known human variable domain sequences, and the human sequence closest to the non-human query sequence is identified and used as the human scaffold for grafting the non-human CDR sequences (see, for example, Sims et al, (1993) J. Immunol. 151: 2296; Chothia et al. (1987) J. Mot. Biol. 196: 901) . Alternatively, a framework derived from the consensus sequence of all human antibodies may be used for the grafting of the non-human CDRs (see, for example, Carter et al. (1992) Proc. Natl. Acad. Sci. USA, 89: 4285; Presta et al. (1993) J. Immunol., 151: 2623) . In certain embodiments, the humanized antibodies or antigen-binding fragments provided herein are composed of substantially all human sequences except for the CDR sequences which are non-human. In some embodiments, the variable region FRs, and constant regions if present, are entirely or substantially from human immunoglobulin sequences. The human FR sequences and human constant region sequences may be derived different human immunoglobulin genes, for example, FR sequences derived from one human antibody and constant region from another human antibody.
Table 4 below shows the heavy chain and light chain variable region amino acid sequences of humanized antibodies for 10-G6-C4-B2 and 30-C7-C11-D4, which are designated as hVH2-hVL1-10, hVH3-hVL3-10, hVH4-hVL1-10, hVH4-hVL2-10, hVH5-hVL1-10, hVH5-hVL3-10, 10-G6-C4-B2_hVH2-VL1_PTM, 10-G6-C4-B2_hVH3-VL3_PTM, 10-G6-C4-B2_hVH4-VL1_PTM, 10-G6-C4-B2_hVH4-VL2_PTM, 10-G6-C4-B2_hVH5-VL1_PTM, 10-G6-C4-B2_hVH5-VL3_PTM, hVH1-hVL5-30, hVH2-hVL1-30, hVH3-hVL2-30, hVH3-hVL5-30, hVH4-hVL2-30, hVH4-hVL5-30, 30-C7-C11-D4_hVH1-hVL5_PTM, 30-C7-C11-D4_hVH2-hVL1_PTM, 30-C7-C11-D4_hVH3-hVL2_PTM, 30-C7-C11-D4_hVH3-hVL5_PTM, 30-C7-C11-D4_hVH4-hVL2_PTM and 30-C7-C11-D4_hVH4-hVL5_PTM, wherein all the CDR regions are underlined.
Table 4. Variable region amino acid sequences of the humanized antibodies
In certain embodiments, the humanized CD276 binding domain is composed of substantially all human sequences except for the CDR sequences which are non-human. In some embodiments, the variable region FRs, and constant regions if present, are entirely or substantially from human immunoglobulin sequences. The human FR sequences and human constant region sequences may be derived from different human immunoglobulin genes, for example, FR sequences derived from one human antibody and constant region from another human antibody. In some embodiments, the humanized CD276 domain comprises human heavy chain HFR1-4, and/or light chain LFR1-4.
In some embodiments, the FR regions derived from human may comprise the same amino acid sequence as the human immunoglobulin from which it is derived. In some embodiments, one or more amino acid residues of the human FR are substituted with the corresponding residues from the parent non-human antibody. This may be desirable in certain embodiments to make the humanized antibody or its fragment closely approximate the non-human parent antibody structure, so as to optimize binding characteristics (for example, increase binding affinity) . In certain embodiments, the humanized antibody or antigen-binding fragment thereof provided herein comprises no more than 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid residue substitutions in each of the human FR sequences, or no more than 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid residue substitutions in all the FR sequences of a heavy or a light chain variable domain. In some embodiments, such change in amino acid residue could be present in heavy chain FR regions only, in light chain FR regions only, or in both chains. In certain embodiments, one or more amino acids of the human FR sequences are randomly mutated to increase binding affinity. In certain embodiments, one or more amino acids of the human FR sequences are back mutated to the corresponding amino acid (s) of the parent non-human antibody so as to increase binding affinity.
PD-L1 binding domain
In some embodiments, the variable regions of the PD-L1 binding domain comprised in the multi-specific antibody or antigen-binding fragments thereof disclosed herein can be any of those PD-L1 antibody heavy chain variable regions and light chain variable regions known in the art. In certain embodiments, the PD-L1 binding domain comprises the heavy chain variable region and the light chain variable region from YN035 recited in WO2019196309A1.
Table 5. CDR sequences of the PD-L1 binding domain
Table 6. Variable region sequences of the PD-L1 binding domain
ii. Activating receptor binding domain
The multi-specific antibody or antigen-binding fragments thereof further comprises an activating receptor-binding domain. As used herein, the term “activating receptor” refers to receptors (e.g., FcγR) expressed on an immune effector cell (e.g., a phagocytic cell, such as a macrophage) , which upon activation by binding to, for example, Fc domain, mediates at least one effector functions of the immune effector cell (e.g., a phagocytic cell, such as a macrophage) or pro-inflammatory response. In
certain embodiments, the immune effector cell provided herein co-expresses CD276 and one or more additional targets (e.g., PD-L1) .
In certain embodiments, the activating receptor is an FcγR, and the activating receptor-binding domain is an Fc domain. Fc domain can activate Fc receptors (FcRs) on macrophages to drive a phosphorylation cascade propagated by the receptors’ immunoreceptor tyrosine-based activation motifs (ITAMs) . ITAMs are conserved sequences present in the cytoplasmic tails of several activating receptors on immune effector cells, such as FcRs, T cell receptors and immunoglobulins (Ig) . ITAMs can be featured with a conserved amino acid sequence motif, which consists of paired YXXL/I motifs (wherein Y, L and I refer to Tyrosine, Lysine and Isoleucine respectively) and separated by a defined interval of six to eight amino acids. Phosphorylation of residues within the ITAM recruits several signaling molecules for phagocytosis activation. Accordingly, the activating receptor can be any receptor expressed on an immune effector cell that can be bound and activated to induce phagocytosis via an ITAM-comprising intracellular phagocytosis signaling domain.
In other embodiments, the activating receptor is a receptor involved in a different phagocytic signaling or mechanism, such as, Akt mediated signaling cascade (via CD19, CD28, CSFR or PDGFR receptor) , clustering of a group of receptors on an immune effector cell (e.g., macrophage) that potentiates phagocytosis (via, for example, integrins or selectins) , or antigen mediated cytotoxicity (via FcDR1 (CD89) receptor or CD206) .
For example, activating receptors that are relevant to effector functions such as phagocytosis can be fragment crystallizable γ receptors (FcγRs) , TREM2, lectin, scavenger receptor Al (SRA1) , MARCO, CD36, CD163, CD68, CD205, CD206, FcDRl, CD207, CD209, RAGE, CD14, CD64, F4/80, CD64, CD32a, CD16a, CD89, CD19, CD28, CSFR, PDGFR, MSR1, SCARA3, COLEC12, SCARA5, SCARB1, SCARB2, dectin 1, RAGE (SR-E1) , LRPl, LRP2, ASGP, SR-PSOX, CXCL16, OLR1, SCARF1, SCARF2, CXCL16, STAB1, STAB2, SRCRB4D, SSC5D, CCR2, CX3CR1,
CSF1R, Tie2, HuCRIg (L) , and CD169 receptor or complement receptors, such as CR1 and CR3. In certain embodiments, the activating receptor is FcγR.
In certain embodiments, the activating receptor that can generate pro-inflammatory signals upon activation, include without limitation, PI3K, FcγRl, FcγR2A, FcγR2B2, FcγR2C, FcγR3A, BAH. Tyro3, Axl, Traf6, Syk, MyD88, Zap70, FcεRl, Fc αRl, BAFF-R, DAP 12, NFAM1, MRC1, ItgB5, MERTK, ELMO, and CD79b.
The term “activating receptor-binding domain” , as used herein, refers to domain (e.g., a portion of an antibody) that is capable of specifically binding to an activating receptor on an immune effector cell and such binding leads to activation of the receptor as well as downstream signaling thereof (e.g., effector function or pro-inflammatory response of the immune cell) . For example, the activating receptor-binding domain comprises an Fc domain of an antibody or a variant thereof. In certain embodiments, the Fc domain can be derived from IgG1 or IgG4.
In certain embodiments, the activating receptor-binding domain of the multi-specific molecules provided herein binds and activates activating receptor selected from the group consisting of fragment crystallizable γ receptors (FcγRs) , TREM2, lectin, scavenger receptor Al (SRA1) , MARCO, CD36, CD163, CD68, CD205, CD206, FcDRl, CD207, CD209, RAGE, CD14, CD64, F4/80, CD64, CD32a, CD16a, CD89, CD19, CD28, CSFR, PDGFR, MSR1, SCARA3, COLEC12, SCARA5, SCARB1, SCARB2, dectin 1, RAGE (SR-E1) , LRPl, LRP2, ASGP, SR-PSOX, CXCL16, OLR1, SCARF1, SCARF2, CXCL16, STAB1, STAB2, SRCRB4D, SSC5D, CCR2, CX3CR1, CSF1R, Tie2, HuCRIg (L) , and CD169 receptor or complement receptors (such as CR1 and CR3) , PI3K, FcγRl, FcγR2A, FcγR2B2, FcγR2C, FcγR3A, BAH. Tyro3, Axl, Traf6, Syk, MyD88, Zap70, FcεRl, FcαRl, BAFF-R, DAP 12, NFAM1, MRC1, ItgB5, MERTK, ELMO, and CD79b.
In certain embodiments, the activating receptor-binding domain of the multi-specific molecule provided herein comprises a Fc domain or a variant thereof, which activates Fc receptors (FcRs) on macrophages, such as FcγRII.
In some embodiments, the activating receptor-binding domain comprises a heavy chain and/or a light chain constant region. The heavy chain constant region comprises CH1, hinge, and/or CH2-CH3 regions. In certain embodiments, the heavy chain constant region comprises an Fc region. In certain embodiments, the light chain constant region comprises Cκ or Cλ.
In some embodiments, the activating receptor-binding domain is derived from an immunoglobulin (Ig) , optionally a human Ig, optionally a human IgG. In some embodiments, the activating receptor-binding domain is derived from human IgG1, IgG2, IgG3, or IgG4.
Human IgG isotypes (the subclasses of mature gamma globulin class G antibodies; IgG1, IgG2, IgG3 and IgG4) exhibit differential capacity to recruit effector functions. For example, ADCC is promoted by IgG1 and IgG3, ADCP is promoted by IgG1, IgG2, IgG3 and IgG4, and CDC is promoted by IgG1 and IgG3. Isotype-specific engagement of such effector functions is based on selectivity for Fc receptors on distinct immune cells and the ability to bind C1q thereby activating the assembly of a membrane attack complex (MAC) . Among the various isotypes, relative affinity for Fcγ receptors, which include FcγRI, FcγRIIa/b/c, and FcγRIIIa/b is high for IgG1 and IgG3. However, Fcγ affinity for IgG2 is considerably lower with the exception of FcγRIIa H131 polymorphism and IgG4 only has measurable affinity for FcγRI.
In certain embodiments, the activating receptor-binding domain is derived from human IgG1 isotype, which could induce ADCC, CDC or ADCP, or a constant region of IgG4 or IgG2 isotype, which has reduced or depleted effector function. Effector functions such as ADCC and CDC can lead to cytotoxicity to cells expressing tumor antigen (e.g., CD276) . Effector functions can be evaluated using various assays such as Fc receptor binding assay, C1q binding assay, and cell lysis assay.
In certain embodiments, the activating receptor-binding domain is derived from a constant region of mouse IgG2 isotype, which could induce ADCC, CDC or ADCP.
iii. Configuration of the multi-specific antibody or antigen-binding
fragments thereof
In certain embodiments, the multi-specific antibody or antigen-binding fragments thereof provided herein is a recombinant protein comprising multiple antigen binding domains described throughout the specification, wherein each of the multiple antigen binding domains has specific binding affinity to each targeted antigen, and is connected with each other by one or more linkers. The one or more linkers may have cognate peptides that exhibit complementary binding with each other. For example, the first binding domain of the multi-specific antibody or
antigen-binding fragments thereof provided herein is fused with the first of a pair of cognate peptides, while the second binding domain thereof is fused with the second of the pairs of cognate peptides; as such, the first binding domain and the second binding domain can be connected by the pair of cognate peptides through the complementary binding between each of the pair of cognate peptides.
In certain embodiments, the pair of cognate peptides comprises two heavy chains of an antibody or any complementary portion thereof, a pair of light chain and heavy chain complementary to each other of an antibody or any complementary portion thereof, leucine zipper domains that exhibit complementary binding with each other (e.g., the zipper sequences within the binding regions of c-Fos and c-June proteins) , or synthetic peptides designed to specifically bind to each other via synthetic connectors.
The multiple antigen binding domains (e.g., the first binding domain and the second binding domain) and the activating receptor binding domain of the multi-specific antibody or antigen-binding fragments thereof provided herein can also be connected via chemical binding, such as crosslinking (e.g., BS2G crosslinker
(Bis [Sulfosuccmimidyl] glutarate) , BS3 crosslinker (Bis [sulfosuccinimidyl] suberate) , Sulfo-DSS, DST crosslinker (Disuccinimidyl tartrate) , BMPS (N- (B-Maleimidopropyloxy) succinimide ester; MBS crosslinker (mMaleimidobenzoyl-N-hydroxysuccinimide ester) ; or PDPH crosslinker (3- [2-Pyridyldithio] propionylhydrazide) ) .
In certain embodiments, the first binding domain (e.g., CD276 binding domain or PD-L1 binding domain) is linked to N-termination of the activating receptor-binding domain (e.g., Fc domain) . In certain embodiments, the first binding antibody domain (e.g., CD276 binding domain or PD-L1 binding domain) comprises a Fab domain, optionally, the Fab domain comprises a heavy chain linked to one of the N-termination of the activating receptor-binding domain (e.g., Fc domain) .
In certain embodiments, both of the first binding domain and the second binding domain comprise a Fab domain, optionally, each of the Fab domains comprises a heavy chain linked to each N-termination of the activating receptor-binding domain (e.g., Fc domain) , respectively.
In certain embodiments, the second binding domain (e.g., CD276 binding domain or PD-L1 binding domain) is linked to the activating receptor-binding domain (e.g., Fc domain) or to the first binding domain. In certain embodiments, the second binding domain comprises an scFv structure.
In certain embodiments, the second binding domain is linked to the C-termination of light chain of the first binding domain (e.g., the first binding domain comprising a Fab domain) . In certain embodiments, the second binding domain is linked to the N-termination of light chain of the first binding domain (e.g., the first binding domain comprising a Fab domain) . In certain embodiments, the second binding domain is linked to the C-termination of heavy chain of the first binding domain (e.g., the first binding domain comprising a Fab domain) . In certain embodiments, the second binding domain is linked to the N-termination of heavy
chain of the first binding domain (e.g., the first binding domain comprising a Fab domain) .
As used herein, the term “linked to” refers to covalent or non-covalent interactions (e.g., hydrogen bonds, ionic bonds, van der Waals interactions, and hydrophobic bonds) between two components.
In certain embodiments, the second binding domain is linked to C-termination of the activating receptor-binding domain (e.g., Fc domain) . In certain embodiments, the first binding domain (e.g., the first binding domain comprising a Fab domain) is linked to the N-termination of activating receptor-binding domain, and the second binding domain is linked to the C-termination of activating receptor-binding domain. In such embodiments, the first binding domain (e.g., CD276 binding domain or PD-L1 binding domain) and the activating receptor binding domain (e.g., Fc domain) of the multi-specific antibody or antigen-binding fragments thereof disclosed herein together form an intact antibody structure. In some embodiments, the second binding domain comprises an scFv structure from N-termination to C-termination comprising a second heavy chain variable region, a first linker and a second light chain variable region. In certain embodiments, the first linker has a sequence of (GGGGS) 3 (SEQ ID NO: 390) .
In some embodiments, the N-termination of the second binding domain is linked to the C-termination of the activating receptor binding domain via a second linker. In certain embodiments, the second linker has a sequence of (GGGGS) 3 (SEQ ID NO: 390) .
In certain embodiments, the multi-specific antibody or antigen-binding fragments thereof disclosed herein comprises two second binding domains, each of which is operably linked to each C-termination of the activation receptor binding domain, respectively.
In some embodiments, the multi-specific antibody or antigen-binding fragments thereof comprises four chains, which from N-termination to C-termination have the structures as following:
Chains 1 and 4: VL1-CL;
Chains 2 and 3: VH1-CH1-hing region-CH2-CH3-linker 2-VH2-linker 1-VL2;
wherein VH1 stands for the heavy chain variable region of the first binding domain, VL1 stands for the light chain variable region of the first binding domain; VH2 stands for the heavy chain variable region of the second binding domain, VL2 stands for the light chain variable region of the second binding domain; linker 1 stands for the first linker; and linker 2 stands for the second linker.
In some certain embodiments, the first binding domain is a CD276 binding domain and the second binding domain is a PD-L1 binding domain. In some other certain embodiments, the first binding domain is a PD-L1 binding domain and the second binding domain is a CD276 binding domain.
Antibody Variants
The present disclosure also encompasses various variants of the multi-specific antibodies and/or antigen-binding fragments thereof provided herein. In certain embodiments, the present disclosure encompasses various types of variants of an exemplary antibody provided herein, i.e., the antibody with a heavy chain CDR3 sequence selected from the group consisting of SEQ ID NOs: 3, 11, 19, 27, 35, 43, 51, 59, 67, 75, 83, 91, 99, 107, 115, 123, 131, 139, 147, 155, 163, 171, 179, 187, 195, 203, 211, 219, 227, 235, 243, 251, 259, 267, 275, 283, 291, 299, 307, 315, 323, 331, 339, or 375.
In certain embodiments, the antibody variants comprise one or more modifications or substitutions in one or more CDR sequences as provided in Table 1, 3 or 5, one or more FR sequences, the heavy or light chain variable region sequences
provided in Table 2, 4 or 6, and/or the activating receptor binding domain (e.g. Fc region) . Such variants retain specific binding affinity to CD276 and/or PD-L1 of their parent antibodies, but have one or more desirable properties conferred by the modification (s) or substitution (s) . For example, the antibody variants may have improved antigen-binding affinity, improved glycosylation pattern, reduced risk of glycosylation, reduced deamination, reduced or depleted effector function (s) , improved FcRn receptor binding, increased pharmacokinetic half-life, pH sensitivity, and/or compatibility to conjugation (e.g. one or more introduced cysteine residues) .
The parent antibody sequence may be screened to identify suitable or preferred residues to be modified or substituted, using methods known in the art, for example “alanine scanning mutagenesis” (see, for example, Cunningham and Wells (1989) Science, 244: 1081-1085) . Briefly, target residues (e.g., charged residues such as Arg, Asp, His, Lys, and Glu) can be identified and replaced by a neutral or negatively charged amino acid (e.g., alanine or polyalanine) , and the modified antibodies are produced and screened for the interested property. If substitution at a particular amino acid location demonstrates an interested functional change, then the position can be identified as a potential residue for modification or substitution. The potential residues may be further assessed by substituting with a different type of residue (e.g. cysteine residue, positively charged residue, etc. ) .
Affinity variant
Affinity variant may contain modifications or substitutions in one or more CDR sequences as provided in Table 1, 3 or 5, one or more FR sequences, or the heavy or light chain variable region sequences in provided in Table 2, 3, 4 or 6. The affinity variants retain specific binding affinity to CD276 and/or PD-L1 of the parent antibody, or even have improved CD276 and/or PD-L1 specific binding affinity over the parent antibody. In certain embodiments, at least one (or all) of the substitution (s) in the CDR sequences, FR sequences, or variable region sequences comprises a conservative substitution.
A skilled artisan will understand that in the CDR sequences provided in Table 1 or 5, and FR sequences, one or more amino acid residues may be substituted yet the resulting antibody or antigen-binding fragment still retain the binding affinity to CD276 and/or PD-L1, or even have an improved binding affinity. Various methods known in the art can be used to achieve this purpose. For example, a library of antibody variants (such as Fab or scFv variants) can be generated and expressed with phage display technology, and then screened for the binding affinity to CD276 and/or PD-L1. For another example, computer software can be used to virtually simulate the binding of the antibodies to CD276 and PD-L1, and identify the amino acid residues on the antibodies which form the binding interface. Such residues may be either avoided in the substitution so as to prevent reduction in binding affinity, or targeted for substitution to provide for a stronger binding.
In certain embodiments, the humanized antibody or antigen-binding fragment provided herein comprises one or more amino acid residue substitutions in one or more CDR sequences, and/or one or more FR sequences. In certain embodiments, an affinity variant comprises no more than 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 substitutions in the CDR sequences and/or FR sequences in total.
In certain embodiments, the multi-specific antibodies and antigen-binding fragments thereof comprise 1, 2, or 3 CDR sequences having at least 80% (e.g. at least 85%, 88%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%) sequence identity to that (or those) listed in Table 1 or 5, and in the meantime retain the binding affinity to CD276 and/or PD-L1 at a level similar to or even higher than its parent antibody.
In certain embodiments, the multi-specific antibodies and antigen-binding fragments thereof comprise one or more variable region sequences having at least 80% (e.g. at least 85%, 88%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%) sequence identity to that (or those) listed in Table 2, 4 or 6, and in the meantime retain the binding affinity to CD276 and/or PD-L1 at a level similar to or even higher than its parent antibody. In some embodiments, a total of 1 to 10 amino acids have
been substituted, inserted, or deleted in a sequence selected from that (or those) listed in Table 1. In some embodiments, the substitutions, insertions, or deletions occur in regions outside the CDRs (i.e., in the FRs) .
Glycosylation variant
The multi-specific antibodies and antigen-binding fragments provided herein also encompass a glycosylation variant, which can be obtained to either increase or decrease the extent of glycosylation of the antibody or antigen binding fragment thereof.
The multi-specific antibody or antigen binding fragment thereof may comprise one or more amino acid residues with a side chain to which a carbohydrate moiety (e.g. an oligosaccharide structure) can be attached. Glycosylation of antibodies is typically either N-linked or O-linked. N-linked refers to the attachment of the carbohydrate moiety to the side chain of an asparagine residue, for example, an asparagine residue in a tripeptide sequence such as asparagine-X-serine and asparagine-X-threonine, where X is any amino acid except proline. O-linked glycosylation refers to the attachment of one of the sugars N-aceylgalactosamine, galactose, or xylose to a hydroxyamino acid, most commonly to serine or threonine. Removal of a native glycosylation site can be conveniently accomplished, for example, by altering the amino acid sequence such that one of the above-described tripeptide sequences (for N-linked glycosylation sites) or serine or threonine residues (for O-linked glycosylation sites) present in the sequence is substituted. A new glycosylation site can be created in a similar way by introducing such a tripeptide sequence or serine or threonine residue.
Cysteine-engineered variant
The multi-specific antibodies and antigen-binding fragments provided herein also encompass a cysteine-engineered variant, which comprises one or more introduced free cysteine amino acid residues.
A free cysteine residue is one which is not part of a disulfide bridge. A cysteine-engineered variant is useful for conjugation with for example, a cytotoxic and/or imaging compound, a label, or a radioisoptype among others, at the site of the engineered cysteine, through for example a maleimide or haloacetyl. Methods for engineering antibodies or antigen-binding fragments to introduce free cysteine residues are known in the art, see, for example, WO2006/034488.
Fc Variant
The multi-specific antibodies and antigen-binding fragments provided herein also encompass an Fc variant, which comprises one or more amino acid residue modifications or substitutions at its Fc region and/or hinge region.
In certain embodiments, the multi-specific antibodies or antigen-binding fragments comprise one or more amino acid substitution (s) that improves pH-dependent binding to neonatal Fc receptor (FcRn) . Such a variant can have an extended pharmacokinetic half-life, as it binds to FcRn at acidic pH which allows it to escape from degradation in the lysosome and then be translocated and released out of the cell. Methods of engineering an antibody and antigen-binding fragment thereof to improve binding affinity with FcRn are well-known in the art, see, for example, Vaughn, D. et al, Structure, 6 (1) : 63-73, 1998; Kontermann, R. et al, Antibody Engineering, Volume 1, Chapter 27: Engineering of the Fc region for improved PK, published by Springer, 2010; Yeung, Y. et al, Cancer Research, 70: 3269-3277 (2010) ; and Hinton, P. et al, J. Immunology, 176: 346-356 (2006) .
In certain embodiments, the multi-specific antibodies or antigen-binding fragments comprise one or more amino acid substitution (s) that alters the antibody-dependent cellular cytotoxicity (ADCC) . Certain amino acid residues at CH2 domain of the Fc region can be substituted to provide for enhanced ADCC activity. Alternatively or additionally, carbohydrate structures on the antibody can be changed to enhance ADCC activity. Methods of altering ADCC activity by antibody engineering have been described in the art, see for example, Shields RL. et al., J Biol
Chem. 2001.276 (9) : 6591-604; Idusogie EE. et al., J Immunol. 2000.164 (8) : 4178-84; Steurer W. et al., J Immunol. 1995, 155 (3) : 1165-74; Idusogie EE. et al., J Immunol. 2001, 166 (4) : 2571-5; Lazar GA. et al., PNAS, 2006, 103 (11) : 4005-4010; Ryan MC. et al., Mol. Cancer Ther., 2007, 6: 3009-3018; Richards JO, . et al., Mol Cancer Ther. 2008, 7 (8) : 2517-27; Shields R. L. et al, J. Biol. Chem, 2002, 277: 26733-26740; Shinkawa T. et al, J. Biol. Chem, 2003, 278: 3466-3473.
In certain embodiments, the multi-specific antibodies or antigen-binding fragments comprise one or more amino acid substitution (s) that alters Complement Dependent Cytotoxicity (CDC) , for example, by improving or diminishing C1q binding and/or CDC (see, for example, WO99/51642; Duncan &Winter Nature 322: 738-40 (1988) ; U.S. Pat. No. 5,648,260; U.S. Pat. No. 5,624,821) ; and WO94/29351 concerning other examples of Fc region variants.
In certain embodiments, the multi-specific antibodies or antigen-binding fragments thereof comprise one or more amino acid substitution (s) in the interface of the Fc region to facilitate and/or promote heterodimerization. These modifications comprise introduction of a protuberance into a first Fc polypeptide and a cavity into a second Fc polypeptide, wherein the protuberance can be positioned in the cavity so as to promote interaction of the first and second Fc polypeptides to form a heterodimer or a complex. Methods of generating antibodies with these modifications are known in the art, e.g., as described in U.S. Pat. No. 5,731,168.
Conjugates
In some embodiments, the multi-specific antibodies and antigen-binding fragments thereof is linked to one or more conjugates, optionally, wherein the conjugate is covalently attached either directly or via a linker. A conjugate is a non-proteinaceous moiety that can be attached to the antibody or antigen-binding fragment thereof. It is contemplated that a variety of conjugates may be linked to the antibodies or antigen-binding fragments provided herein (see, for example, “Conjugate Vaccines” , Contributions to Microbiology and Immunology, J.M. Cruse
and R.E. Lewis, Jr. (eds. ) , Carger Press, New York, (1989) ) . These conjugates may be linked to the multi-specific antibodies or antigen-binding fragments by covalent binding, affinity binding, intercalation, coordinate binding, complexation, association, blending, or addition, among other methods. In some embodiments, the conjugate comprises a clearance-modifying agent, a chemotherapeutic agent, a toxin, a radioactive isotope, a lanthanide, a luminescent label, a fluorescent label, an enzyme-substrate label, a DNA-alkylators, a topoisomerase inhibitor, a tubulin-binders, or other anticancer drugs.
In certain embodiments, the multi-specific antibodies and antigen-binding fragments disclosed herein may be engineered to contain specific sites outside the epitope binding portion that may be utilized for binding to one or more conjugates. For example, such a site may include one or more reactive amino acid residues, such as for example cysteine or histidine residues, to facilitate covalent linkage to a conjugate.
In certain embodiments, the multi-specific antibodies may be linked to a conjugate indirectly, or through another conjugate. For example, the multi-specific antibody or antigen-binding fragments may be conjugated to biotin, then indirectly conjugated to a second conjugate that is conjugated to avidin. The conjugate can be a toxin (e.g., a chemotherapeutic agent) , a detectable label (e.g., a radioactive isotope, a lanthanide, a luminescent label, a fluorescent label, or an enzyme-substrate label) .
A “toxin” can be any agent that is detrimental to cells or that can damage or kill cells. Examples of toxin include, without limitation, taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorubicin, daunorubicin, dihydroxy anthracin dione, mitoxantrone, mithramycin, actinomycin D, 1-dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, puromycin and analogs thereof, antimetabolites (e.g., methotrexate, 6-mercaptopurine, 6-thioguanine, cytarabine, 5-fluorouracil decarbazine) , alkylating agents (e.g., mechlorethamine, thioepa chlorambucil, melphalan, carmustine (BSNU) and lomustine (CCNU) ,
cyclothosphamide, busulfan, dibromomannitol, streptozotocin, mitomycin C, and cis-dichlorodiamine platinum (II) (DDP) cisplatin) , anthracyclines (e.g., daunorubicin (formerly daunomycin) and doxorubicin) , antibiotics (e.g., dactinomycin (formerly actinomycin) , bleomycin, mithramycin, and anthramycin (AMC) ) , and anti-mitotic agents (e.g., vincristine and vinblastine) .
Examples of detectable label may include a fluorescent labels (e.g. fluorescein, rhodamine, dansyl, phycoerythrin, or Texas Red) , enzyme-substrate labels (e.g. horseradish peroxidase, alkaline phosphatase, luceriferases, glucoamylase, lysozyme, saccharide oxidases or β-D-galactosidase) , radioisotopes (e.g. 123I, 124I, 125I, 131I, 35S, 3H, 111In, 112In, 14C, 64Cu, 67Cu, 86Y, 88Y, 90Y, 177Lu, 211At, 186Re, 188Re, 153Sm, 212Bi, and 32P, other lanthanides, luminescent labels) , chromophoric moiety, digoxigenin, biotin/avidin, a DNA molecule or gold for detection.
In certain embodiments, the conjugate can be a pharmacokinetic modifying moiety which helps increase half-life of the antibody. Illustrative examples include water-soluble polymers, such as PEG, carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinyl pyrrolidone, copolymers of ethylene glycol/propylene glycol, and the like. The polymer may be of any molecular weight, and may be branched or unbranched. The number of polymers attached to the antibody may vary, and if more than one polymer are attached, they can be the same or different molecules.
In certain embodiments, the conjugate can be a purification moiety such as a magnetic bead.
In certain embodiments, the multi-specific antibodies and/or antigen-binding fragments thereof provided herein is used for a base for a conjugate.
Polynucleotides and Recombinant Methods
The present disclosure provides isolated polynucleotides that encode the multi-specific antibodies and antigen-binding fragments thereof. DNA encoding the monoclonal antibody is readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes
encoding the heavy and light chains of the antibody) . The encoding DNA may also be obtained by synthetic methods.
The isolated polynucleotide that encodes the multi-specific antibodies and antigen-binding fragments thereof can be inserted into a vector for further cloning (amplification of the DNA) or for expression, using recombinant techniques known in the art. Many vectors are available. The vector components generally include, but are not limited to, one or more of the following: a signal sequence, an origin of replication, one or more marker genes, an enhancer element, a promoter (e.g. SV40, CMV, EF-1α) , and a transcription termination sequence.
In some embodiments, the vector system includes mammalian, bacterial, yeast systems, etc, and comprises plasmids such as, but not limited to, pALTER, pBAD, pcDNA, pCal, pL, pET, pGEMEX, pGEX, pCI, pCMV, pEGFP, pEGFT, pSV2, pFUSE, pVITRO, pVIVO, pMAL, pMD18-T, pMONO, pSELECT, pUNO, pDUO, Psg5L, pBABE, pWPXL, pBI, p15TV-L, pPro18, pTD, pRS420, pLexA, pACT2.2 etc, and other laboratorial and commercially available vectors. Suitable vectors may include, plasmid, or viral vectors (e.g., replication defective retroviruses, adenoviruses and adeno-associated viruses) .
Vectors comprising the polynucleotide sequence encoding the antibody or antigen-binding fragment can be introduced to a host cell for cloning or gene expression. Suitable host cells for cloning or expressing the DNA in the vectors herein are the prokaryote, yeast, or higher eukaryote cells described above. Suitable prokaryotes for this purpose include eubacteria, such as Gram-negative or Gram-positive organisms, for example, Enterobacteriaceae such as Escherichia, e.g., E. coli, Enterobacter, Erwinia, Klebsiella, Proteus, Salmonella, e.g., Salmonella typhimurium, Serratia, e.g., Serratia marcescans, and Shigella, as well as Bacilli such as B. subtilis and B. licheniformis, Pseudomonas such as P. aeruginosa, and Streptomyces.
In addition to prokaryotes, eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for multi-specific antibody-encoding
vectors. Saccharomyces cerevisiae, or common baker's yeast, is the most commonly used among lower eukaryotic host microorganisms. However, a number of other genera, species, and strains are commonly available and useful herein, such as Schizosaccharomyces pombe; Kluyveromyces hosts such as, e.g., K. lactis, K. fragilis (ATCC 12,424) , K. bulgaricus (ATCC 16,045) , K. wickeramii (ATCC 24,178) , K. waltii (ATCC 56,500) , K. drosophilarum (ATCC 36,906) , K. thermotolerans, and K. marxianus; yarrowia (EP 402,226) ; Pichia pastoris (EP 183,070) ; Candida; Trichoderma reesia (EP 244,234) ; Neurospora crassa; Schwanniomyces such as Schwanniomyces occidentalis; and filamentous fungi such as, e.g., Neurospora, Penicillium, Tolypocladium, and Aspergillus hosts such as A. nidulans and A. niger.
Suitable host cells for the expression of glycosylated antibodies or antigen-fragment provided here are derived from multicellular organisms. Examples of invertebrate cells include plant and insect cells. Numerous baculoviral strains and variants and corresponding permissive insect host cells from hosts such as Spodoptera frugiperda (caterpillar) , Aedes aegypti (mosquito) , Aedes albopictus (mosquito) , Drosophila melanogaster (fruiffly) , and Bombyx mori have been identified. A variety of viral strains for transfection are publicly available, e.g., the L-1 variant of Autographa californica NPV and the Bm-5 strain of Bombyx mori NPV, and such viruses may be used as the virus herein according to the present invention, particularly for transfection of Spodoptera frugiperda cells. Plant cell cultures of cotton, corn, potato, soybean, petunia, tomato, and tobacco can also be utilized as hosts.
However, interest has been greatest in vertebrate cells, and propagation of vertebrate cells in culture (tissue culture) has become a routine procedure. Examples of useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7, ATCC CRL 1651) ; human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al., J. Gen Virol. 36: 59(1977) ) ; baby hamster kidney cells (BHK, ATCC CCL 10) ; Chinese hamster ovary cells/-DHFR (CHO, Urlaub et al., Proc. Natl. Acad. Sci. USA 77: 4216 (1980) ) ; mouse sertoli cells (TM4, Mather, Biol. Reprod. 23: 243-251 (1980) ) ; monkey kidney
cells (CV1 ATCC CCL 70) ; African green monkey kidney cells (VERO-76, ATCC CRL-1587) ; human cervical carcinoma cells (HELA, ATCC CCL 2) ; canine kidney cells (MDCK, ATCC CCL 34) ; buffalo rat liver cells (BRL 3A, ATCC CRL 1442) ; human lung cells (W138, ATCC CCL 75) ; human liver cells (Hep G2, HB 8065) ; mouse mammary tumor (MMT 060562, ATCC CCL51) ; TRI cells (Mather et al., Annals N. Y. Acad. Sci. 383: 44-68 (1982) ) ; MRC 5 cells; FS4 cells; and a human hepatoma line (Hep G2) .
Host cells are transformed with the above-described expression or cloning vectors for multi-specific antibody production and cultured in conventional nutrient media modified as appropriate for inducing promoters, selecting transformants, or amplifying the genes encoding the desired sequences. In another embodiment, the antibody may be produced by homologous recombination known in the art.
The host cells used to produce the multi-specific antibodies or antigen-binding fragments provided herein may be cultured in a variety of media. Commercially available media such as Ham's F10 (Sigma) , Minimal Essential Medium (MEM) , (Sigma) , RPMI-1640 (Sigma) , and Dulbecco's Modified Eagle's Medium (DMEM) , Sigma) are suitable for culturing the host cells. In addition, any of the media described in Ham et al., Meth. Enz. 58: 44 (1979) , Barnes et al., Anal. Biochem. 102: 255 (1980) , U.S. Pat. No. 4,767,704; 4,657,866; 4,927,762; 4,560,655; or 5,122,469; WO 90/03430; WO 87/00195; or U.S. Pat. Re. 30,985 may be used as culture media for the host cells. Any of these media may be supplemented as necessary with hormones and/or other growth factors (such as insulin, transferrin, or epidermal growth factor) , salts (such as sodium chloride, calcium, magnesium, and phosphate) , buffers (such as HEPES) , nucleotides (such as adenosine and thymidine) , antibiotics (such as GENTAMYCINTM drug) , trace elements (defined as inorganic compounds usually present at final concentrations in the micromolar range) , and glucose or an equivalent energy source. Any other necessary supplements may also be included at appropriate concentrations that would be known to those skilled in the art. The culture conditions, such as temperature, pH, and the like, are those previously
used with the host cell selected for expression, and will be apparent to the ordinarily skilled artisan.
When using recombinant techniques, the multi-specific antibody can be produced intracellularly, in the periplasmic space, or directly secreted into the medium. If the antibody is produced intracellularly, as a first step, the particulate debris, either host cells or lysed fragments, is removed, for example, by centrifugation or ultrafiltration. Carter et al., Bio/Technology 10: 163-167 (1992) describe a procedure for isolating antibodies which are secreted to the periplasmic space of E. coli. Briefly, cell paste is thawed in the presence of sodium acetate (pH 3.5) , EDTA, and phenylmethylsulfonylfluoride (PMSF) over about 30 min. Cell debris can be removed by centrifugation. Where the antibody is secreted into the medium, supernatants from such expression systems are generally first concentrated using a commercially available protein concentration filter, for example, an Amicon or Millipore Pellicon ultrafiltration unit. A protease inhibitor such as PMSF may be included in any of the foregoing steps to inhibit proteolysis and antibiotics may be included to prevent the growth of adventitious contaminants.
The multi-specific antibodies and antigen-binding fragments thereof prepared from the cells can be purified using, for example, hydroxylapatite chromatography, gel electrophoresis, dialysis, DEAE-cellulose ion exchange chromatography, ammonium sulfate precipitation, salting out, and affinity chromatography, with affinity chromatography being the preferred purification technique.
In certain embodiments, Protein A immobilized on a solid phase is used for immunoaffinity purification of the antibody and antigen-binding fragment thereof. The suitability of protein A as an affinity ligand depends on the species and isotype of any immunoglobulin Fc domain that is present in the antibody. Protein A can be used to purify antibodies that are based on human gamma1, gamma2, or gamma4 heavy chains (Lindmark et al., J. Immunol. Meth. 62: 1-13 (1983) ) . Protein G is recommended for all mouse isotypes and for human gamma3 (Guss et al., EMBO J.
5: 1567 1575 (1986) ) . The matrix to which the affinity ligand is attached is most often agarose, but other matrices are available. Mechanically stable matrices such as controlled pore glass or poly (styrenedivinyl) benzene allow for faster flow rates and shorter processing times than can be achieved with agarose. Where the antibody comprises a CH3 domain, the Bakerbond ABX. TM. resin (J.T. Baker, Phillipsburg, N.J. ) is useful for purification. Other techniques for protein purification such as fractionation on an ion-exchange column, ethanol precipitation, Reverse Phase HPLC, chromatography on silica, chromatography on heparin SEPHAROSETM chromatography on an anion or cation exchange resin (such as a polyaspartic acid column) , chromatofocusing, SDS-PAGE, and ammonium sulfate precipitation are also available depending on the antibody to be recovered.
Following any preliminary purification step (s) , the mixture comprising the antibody of interest and contaminants may be subjected to low pH hydrophobic interaction chromatography using an elution buffer at a pH between about 2.5-4.5, preferably performed at low salt concentrations (e.g., from about 0-0.25M salt) .
Pharmaceutical Composition
The present disclosure further provides pharmaceutical compositions comprising the multi-specific antibodies or antigen-binding fragments thereof and one or more pharmaceutically acceptable carriers.
Pharmaceutical acceptable carriers for use in the pharmaceutical compositions disclosed herein may include, for example, pharmaceutically acceptable liquid, gel, or solid carriers, aqueous vehicles, nonaqueous vehicles, antimicrobial agents, isotonic agents, buffers, antioxidants, anesthetics, suspending/dispending agents, sequestering or chelating agents, diluents, adjuvants, excipients, or non-toxic auxiliary substances, other components known in the art, or various combinations thereof.
Suitable components may include, for example, antioxidants, fillers, binders, disintegrants, buffers, preservatives, lubricants, flavorings, thickeners,
coloring agents, emulsifiers or stabilizers such as sugars and cyclodextrins. Suitable antioxidants may include, for example, methionine, ascorbic acid, EDTA, sodium thiosulfate, platinum, catalase, citric acid, cysteine, thioglycerol, thioglycolic acid, thiosorbitol, butylated hydroxanisol, butylated hydroxytoluene, and/or propyl gallate. As disclosed herein, inclusion of one or more antioxidants such as methionine in a composition comprising an antibody or antigen-binding fragment and conjugates as provided herein decreases oxidation of the antibody or antigen-binding fragment. This reduction in oxidation prevents or reduces loss of binding affinity, thereby improving antibody stability and maximizing shelf-life. Therefore, in certain embodiments compositions are provided that comprise one or more multi-specific antibodies or antigen-binding fragments thereof as disclosed herein and one or more antioxidants such as methionine. Further provided are methods for preventing oxidation of, extending the shelf-life of, and/or improving the efficacy of an antibody or antigen-binding fragment as provided herein by mixing the antibody or antigen-binding fragment with one or more antioxidants such as methionine.
To further illustrate, pharmaceutical acceptable carriers may include, for example, aqueous vehicles such as sodium chloride injection, Ringer's injection, isotonic dextrose injection, sterile water injection, or dextrose and lactated Ringer's injection, nonaqueous vehicles such as fixed oils of vegetable origin, cottonseed oil, corn oil, sesame oil, or peanut oil, antimicrobial agents at bacteriostatic or fungistatic concentrations, isotonic agents such as sodium chloride or dextrose, buffers such as phosphate or citrate buffers, antioxidants such as sodium bisulfate, local anesthetics such as procaine hydrochloride, suspending and dispersing agents such as sodium carboxymethylcelluose, hydroxypropyl methylcellulose, or polyvinylpyrrolidone, emulsifying agents such as Polysorbate 80 (TWEEN-80) , sequestering or chelating agents such as EDTA (ethylenediaminetetraacetic acid) or EGTA (ethylene glycol tetraacetic acid) , ethyl alcohol, polyethylene glycol, propylene glycol, sodium hydroxide, hydrochloric acid, citric acid, or lactic acid. Antimicrobial agents utilized as carriers may be added to pharmaceutical compositions in multiple-dose
containers that include phenols or cresols, mercurials, benzyl alcohol, chlorobutanol, methyl and propyl p-hydroxybenzoic acid esters, thimerosal, benzalkonium chloride and benzethonium chloride. Suitable excipients may include, for example, water, saline, dextrose, glycerol, or ethanol. Suitable non-toxic auxiliary substances may include, for example, wetting or emulsifying agents, pH buffering agents, stabilizers, solubility enhancers, or agents such as sodium acetate, sorbitan monolaurate, triethanolamine oleate, or cyclodextrin.
The pharmaceutical compositions can be a liquid solution, suspension, emulsion, pill, capsule, tablet, sustained release formulation, or powder. Oral formulations can include standard carriers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, polyvinyl pyrollidone, sodium saccharine, cellulose, magnesium carbonate, etc.
In certain embodiments, the pharmaceutical compositions are formulated into an injectable composition. The injectable pharmaceutical compositions may be prepared in any conventional form, such as for example liquid solution, suspension, emulsion, or solid forms suitable for generating liquid solution, suspension, or emulsion. Preparations for injection may include sterile and/or non-pyretic solutions ready for injection, sterile dry soluble products, such as lyophilized powders, ready to be combined with a solvent just prior to use, including hypodermic tablets, sterile suspensions ready for injection, sterile dry insoluble products ready to be combined with a vehicle just prior to use, and sterile and/or non-pyretic emulsions. The solutions may be either aqueous or nonaqueous.
In certain embodiments, unit-dose parenteral preparations are packaged in an ampoule, a vial or a syringe with a needle. All preparations for parenteral administration should be sterile and not pyretic, as is known and practiced in the art.
In certain embodiments, a sterile, lyophilized powder is prepared by dissolving an antibody or antigen-binding fragment as disclosed herein in a suitable solvent. The solvent may contain an excipient which improves the stability or other
pharmacological components of the powder or reconstituted solution, prepared from the powder. Excipients that may be used include, but are not limited to, water, dextrose, sorbital, fructose, corn syrup, xylitol, glycerin, glucose, sucrose or other suitable agents. The solvent may contain a buffer, such as citrate, sodium or potassium phosphate or other such buffer known to those of skill in the art at, in one embodiment, about neutral pH. Subsequent sterile filtration of the solution followed by lyophilization under standard conditions known to those of skill in the art provides a desirable formulation. In one embodiment, the resulting solution will be apportioned into vials for lyophilization. Each vial can contain a single dosage or multiple dosages of the anti-CD276 antibody or antigen-binding fragment thereof or composition thereof. Overfilling vials with a small amount above that needed for a dose or set of doses (e.g., about 10%) is acceptable so as to facilitate accurate sample withdrawal and accurate dosing. The lyophilized powder can be stored under appropriate conditions, such as at about 4 ℃ to room temperature.
Reconstitution of a lyophilized powder with water for injection provides a formulation for use in parenteral administration. In one embodiment, for reconstitution the sterile and/or non-pyretic water or other liquid suitable carrier is added to lyophilized powder. The precise amount depends upon the selected therapy being given, and can be empirically determined.
Methods of Use
The present disclosure also provides therapeutic methods comprising: administering a therapeutically effective amount of the multi-specific antibody or antigen-binding fragment thereof as provided herein to a subject in need thereof, thereby treating or preventing a CD276 and/or PD-L1 related disease or condition. In some embodiment, the CD276-related disease or condition is cancer, autoimmune disease, inflammatory disease, adaptive immune disease or infectious disease.
Examples of cancer include but are not limited to, non-small cell lung cancer (squamous/nonsquamous) , small cell lung cancer, renal cell cancer, colorectal
cancer, colon cancer, ovarian cancer, breast cancer (including basal breast carcinoma, ductal carcinoma and lobular breast carcinoma) , pancreatic cancer, gastric carcinoma, bladder cancer, esophageal cancer, mesothelioma, melanoma, head and neck cancer, thyroid cancer, sarcoma, prostate cancer, glioblastoma, cervical cancer, thymic carcinoma, melanoma, myelomas, mycoses fungoids, merkel cell cancer, hepatocellular carcinoma (HCC) , fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma, osteogenic sarcoma, and other sarcomas, synovioma, mesothelioma, Ewing's tumor, leiomyosarcoma, rhabdomyosarcoma, lymphoid malignancy, basal cell carcinoma, adenocarcinoma, sweat gland carcinoma, medullary thyroid carcinoma, papillary thyroid carcinoma, pheochromocytomas sebaceous gland carcinoma, papillary carcinoma, papillary adenocarcinomas, medullary carcinoma, bronchogenic carcinoma, hepatoma, bile duct carcinoma, choriocarcinoma, Wilms' tumor, cervical cancer, testicular tumor, seminoma, classical Hodgkin lymphoma (CHL) , primary mediastinal large B-cell lymphoma, T-cell/histiocyte-rich B-cell lymphoma, acute lymphocytic leukemia, acute myelocytic leukemia, acute myelogenous leukemia, chronic myelocytic (granulocytic) leukemia, chronic myelogenous leukemia, chronic lymphocytic leukemia, polycythemia vera, mast cell derived tumors, EBV-positive and -negative PTLD, and diffuse large B-cell lymphoma (DLBCL) , plasmablastic lymphoma, extranodal NK/T-cell lymphoma, nasopharyngeal carcinoma, HHV8-associated primary effusion lymphoma, non-Hodgkin's lymphoma, multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, myelodysplastic syndrome, hairy cell leukemia and myelodysplasia, primary CNS lymphoma, spinal axis tumor, brain stem glioma, astrocytoma, medulloblastoma, craniopharyogioma, ependymoma, pinealoma, hemangioblastoma, acoustic neuroma, oligodendroglioma, menangioma, melanoma, neuroblastoma and retinoblastoma.
In certain embodiments, the cancer is adrenal gland tumor, an AIDS-associated cancer, an alveolar soft part sarcoma, an astrocytic tumor, bladder cancer, bone cancer, a brain and spinal cord cancer, a metastatic brain tumor, a breast cancer,
a carotid body tumors, a cervical cancer, a chondrosarcoma, a chordoma, a chromophobe renal cell carcinoma, a clear cell carcinoma, a colon cancer, a colorectal cancer, a cutaneous benign fibrous histiocytoma, a desmoplastic small round cell tumor, an ependymoma, a Ewing's tumor, an extraskeletal myxoid chondrosarcoma, a fibrogenesis imperfecta ossium, a fibrous dysplasia of the bone, a gallbladder or bile duct cancer, gastric cancer, a gestational trophoblastic disease, a germ cell tumor, a head and neck cancer, hepatocellular carcinoma, an islet cell tumor, a Kaposi's Sarcoma, a kidney cancer, a leukemia, a lipoma/benign lipomatous tumor, a liposarcoma/malignant lipomatous tumor, a liver cancer, a lymphoma, a lung cancer, a medulloblastoma, a melanoma, a meningioma, a multiple endocrine neoplasia, a multiple myeloma, a myelodysplastic syndrome, a neuroblastoma, a neuroendocrine tumors, an ovarian cancer, a pancreatic cancer, a papillary thyroid carcinoma, a parathyroid tumor, a pediatric cancer, a peripheral nerve sheath tumor, a phaeochromocytoma, a pituitary tumor, a prostate cancer, a posterior uveal melanoma, a rare hematologic disorder, a renal metastatic cancer, a rhabdoid tumor, a rhabdomysarcoma, a sarcoma, a skin cancer, a soft-tissue sarcoma, a squamous cell cancer, a stomach cancer, a synovial sarcoma, a testicular cancer, a thymic carcinoma, a thymoma, a thyroid metastatic cancer, and a uterine cancer. In certain embodiments, the cancer is chemoresistant.
In certain embodiments, the disease or condition is hematological cancer chosen from B-cell lymphomas. Examples of B-cell lymphomas includes but not limited to, Hodgkin's lymphoma, non-Hodgkin's lymphoma (NHL) , acute lymphocytic leukemia (ALL) , acute myeloid leukemia (AML) , chronic lymphocytic leukemia (CLL) , chronic myelogenous leukemia (CML) , multiple myeloma (MM) , diffuse large B cell lymphoma (DLBCL) , Marginal zone B-cell lymphoma (MZL) , Mantle cell lymphoma (MCL) , Richter's syndrome, Burkitt's lymphoma or follicular lymphoma.
Autoimmune diseases include, but are not limited to, Acquired Immunodeficiency Syndrome (AIDS, which is a viral disease with an autoimmune
component) , alopecia areata, ankylosing spondylitis, antiphospholipid syndrome, autoimmune Addison's disease, autoimmune hemolytic anemia, autoimmune hepatitis, autoimmune inner ear disease (AIED) , autoimmune lymphoproliferative syndrome (ALPS) , autoimmune thrombocytopenic purpura (ATP) , Behcet's disease, cardiomyopathy, celiac sprue-dermatitis hepetiformis; chronic fatigue immune dysfunction syndrome (CFIDS) , chronic inflammatory demyelinating polyneuropathy (CIPD) , cicatricial pemphigold, cold agglutinin disease, crest syndrome, Crohn's disease, Degos'disease, dermatomyositis-juvenile, discoid lupus, essential mixed cryoglobulinemia, fibromyalgia-fibromyositis, Graves'disease, Guillain-Barre syndrome, Hashimoto's thyroiditis, idiopathic pulmonary fibrosis, idiopathic thrombocytopenia purpura (ITP) , IgA nephropathy, insulin-dependent diabetes mellitus, juvenile chronic arthritis (Still's disease) , juvenile rheumatoid arthritis, Meniere's disease, mixed connective tissue disease, multiple sclerosis, myasthenia gravis, pemacious anemia, polyarteritis nodosa, polychondritis, polyglandular syndromes, polymyalgia rheumatica, polymyositis and dermatomyositis, primary agammaglobulinemia, primary biliary cirrhosis, psoriasis, psoriatic arthritis, Raynaud's phenomena, Reiter's syndrome, rheumatic fever, rheumatoid arthritis, sarcoidosis, scleroderma (progressive systemic sclerosis (PSS) , also known as systemic sclerosis (SS) ) , Sjogren's syndrome, stiff-man syndrome, systemic lupus erythematosus, Takayasu arteritis, temporal arteritis/giant cell arteritis, ulcerative colitis, uveitis, vitiligo and Wegener's granulomatosis.
Inflammatory disorders, include, for example, chronic and acute inflammatory disorders. Examples of inflammatory disorders include Alzheimer's disease, asthma, atopic allergy, allergy, atherosclerosis, bronchial asthma, eczema, glomerulonephritis, graft vs. host disease, hemolytic anemias, osteoarthritis, sepsis, stroke, transplantation of tissue and organs, vasculitis, diabetic retinopathy and ventilator induced lung injury. In some embodiments, the CD276 associated conditions are inflammatory diseases such as systemic lupus erythematosus (SLE) , intestinal mucosal inflammation, wasting disease associated with colitis, multiple
sclerosis, viral infections, rheumatoid arthritis, osteoarthritis, Cohn's disease, and inflammatory bowel disease, psoriasis, systemic scleroderma, autoimmune diabetes and the like.
Infectious disease include, but are not limited to, fungus infection, parasite/protozoan infection or chronic viral infection, for example, malaria, coccidioiodmycosis immitis, histoplasmosis, onychomycosis, aspergilosis, blastomycosis, candidiasis albicans, paracoccidioiomycosis, microsporidiosis, Acanthamoeba keratitis, Amoebiasis, Ascariasis, Babesiosis, Balantidiasis, Baylisascariasis, Chagas disease, Clonorchiasis, Cochliomyia, Cryptosporidiosis, Diphyllobothriasis, Dracunculiasis, Echinococcosis, Elephantiasis, Enterobiasis, Fascioliasis, Fasciolopsiasis, Filariasis, Giardiasis, Gnathostomiasis, Hymenolepiasis, Isosporiasis, Katayama fever, Leishmaniasis, Lyme disease, Metagonimiasis, Myiasis, Onchocerciasis, Pediculosis, Scabies, Schistosomiasis, Sleeping sickness, Strongyloidiasis, Taeniasis, Toxocariasis, Toxoplasmosis, Trichinosis, Trichuriasis, Trypanosomiasis, helminth infection, infection of hepatitis B (HBV) , hepatitis C (HCV) , herpes virus, Epstein-Barr virus, HIV, cytomegalovirus, herpes simplex virus type I, herpes simplex virus type II, human papilloma virus, adenovirus, human immunodeficiency virus I, human immunodeficiency virus II, Kaposi West sarcoma associated herpes virus epidemics, thin ring virus (Torquetenovirus) , human T lymphotrophic viruse I, human T lymphotrophic viruse II, varicella zoster, JC virus or BK virus.
In certain embodiments, the subject is human.
In another aspect, methods are provided to treat a disease or condition in a subject that would benefit from modulation of CD276 activity, comprising administering a therapeutically effective amount of the multi-specific antibody or antigen-binding fragment thereof as provided herein to a subject in need thereof. In yet another aspect, methods are provided to treat a disease or condition in a subject that would benefit from modulation of PD-1/PD-L1 pathway activity, comprising administering a therapeutically effective amount of the multi-specific antibody or
antigen-binding fragment thereof as provided herein to a subject in need thereof. The term “disease or condition” as used herein can be used interchangeably with the term “CD276 and/or PD-L1 related disease or condition” .
The therapeutically effective amount of an antibody or antigen-binding fragment thereof as provided herein will depend on various factors known in the art, such as for example body weight, age, past medical history, present medications, state of health of the subject and potential for cross-reaction, allergies, sensitivities and adverse side-effects, as well as the administration route and extent of disease development. Dosages may be proportionally reduced or increased by one of ordinary skill in the art (e.g., physician or veterinarian) as indicated by these and other circumstances or requirements.
In certain embodiments, an multi-specific antibody or antigen-binding fragment thereof as provided herein may be administered at a therapeutically effective dosage of about 0.01 mg/kg to about 100 mg/kg (e.g., about 0.01 mg/kg, about 0.5 mg/kg, about 1 mg/kg, about 2 mg/kg, about 3 mg/kg, about 5 mg/kg, about 10 mg/kg, about 15 mg/kg, about 20 mg/kg, about 25 mg/kg, about 30 mg/kg, about 35 mg/kg, about 40 mg/kg, about 45 mg/kg, about 50 mg/kg, about 55 mg/kg, about 60 mg/kg, about 65 mg/kg, about 70 mg/kg, about 75 mg/kg, about 80 mg/kg, about 85 mg/kg, about 90 mg/kg, about 95 mg/kg, or about 100 mg/kg) . In certain of these embodiments, the antibody or antigen-binding fragment thereof is administered at a dosage of about 50 mg/kg or less, and in certain of these embodiments the dosage is 10 mg/kg or less, 5 mg/kg or less, 3 mg/kg or less, 1 mg/kg or less, 0.5 mg/kg or less, or 0.1 mg/kg or less. In certain embodiments, the administration dosage may change over the course of treatment. For example, in certain embodiments, the initial administration dosage may be higher than subsequent administration dosages. In certain embodiments, the administration dosage may vary over the course of treatment depending on the reaction of the subject.
Dosage regimens may be adjusted to provide the optimum desired response (e.g., a therapeutic response) . For example, a single dose may be administered, or several divided doses may be administered over time.
The multi-specific antibodies and antigen-binding fragments thereof disclosed herein may be administered by any route known in the art, such as for example parenteral (e.g., subcutaneous, intraperitoneal, intravenous, including intravenous infusion, intramuscular, or intradermal injection) or non-parenteral (e.g., oral, intranasal, intraocular, sublingual, rectal, or topical) routes.
In some embodiments, the multi-specific antibodies or antigen-binding fragments thereof disclosed herein may be administered alone or in combination with one or more additional therapeutic means or agents. In some embodiments, the multi-specific antibodies or antigen-binding fragments thereof disclosed herein may be administered alone or in combination with a second therapeutic agent. For example, the multi-specific antibodies or antigen-binding fragments thereof disclosed herein may be administered in combination with a second therapeutic agent, for example, a chemotherapeutic agent or an anti-cancer drug. In certain embodiments, the multi-specific antibodies or antigen-binding fragments thereof disclosed herein may be administered in combination with an antagonist of one or more immunoinhibitory molecule, e.g., CD24, CD47, SIRPα, PD-L1, or the beta-2 microglobulin subunit of the major histocompatibility class I complex (B2M) . The term “antagonist” as used herein comprises can refer to any small molecule, small or micro RNAs, or antibodies or antigen-binding fragments thereof that blocks or inhibits binding of CD24, CD47, SIRPα, PD-L1 or B2M to their respective binding partners so as to prevent elicit of immunoinhibitory signals.
In certain of these embodiments, a multi-specific antibody or antigen-binding fragment thereof as disclosed herein that is administered in combination with one or more additional therapeutic agents may be administered simultaneously with the one or more additional therapeutic agents, and in certain of these embodiments the multi-specific antibody or antigen-binding fragment thereof and the additional
therapeutic agent (s) may be administered as part of the same pharmaceutical composition. However, an antibody or antigen-binding fragment thereof administered “in combination” with another therapeutic agent does not have to be administered simultaneously with or in the same composition as the agent. An antibody or antigen-binding fragment thereof administered prior to or after another agent is considered to be administered “in combination” with that agent as the phrase is used herein, even if the antibody or antigen-binding fragment thereof and a second agent are administered via different routes. Where possible, additional therapeutic agents administered in combination with the antibodies or antigen-binding fragments thereof disclosed herein are administered according to the schedule listed in the product information sheet of the additional therapeutic agent, or according to the Physicians'Desk Reference 2003 (Physicians’ Desk Reference, 57th Edition; Medical Economics Company; ISBN: 1563634457; 57th Edition (November 2002) ) or protocols well known in the art.
In some embodiments, the present disclosure also provides use of the antibody or antigen-binding fragment thereof provided herein in the manufacture of a medicament for treating a CD276 and/or PD-L1 related disease or condition in a subject.
In another aspect, the present disclosure also provides a method of modulating CD276 activity in a CD276-expressing cell, comprising exposing the CD276-expressing cell to the multi-specific antibody or antigen-binding fragment thereof provided herein. In yet another aspect the present disclosure also provides a method of modulating PD-1/PD-L1 pathway activity in a PD-L1-expressing cell, comprising exposing the PD-L1-expressing cell to the multi-specific antibody or antigen-binding fragment thereof provided herein.
In another aspect, the present disclosure also provides use of the multi-specific antibody or antigen-binding fragment thereof provided herein in the manufacture of a medicament for treating a CD276 and/or PD-L1 related disease or condition in a subject.
The following examples are provided to better illustrate the claimed invention and are not to be interpreted as limiting the scope of the invention. All specific compositions, materials, and methods described below, in whole or in part, fall within the scope of the present invention. These specific compositions, materials, and methods are not intended to limit the invention, but merely to illustrate specific embodiments falling within the scope of the invention. One skilled in the art may develop equivalent compositions, materials, and methods without the exercise of inventive capacity and without departing from the scope of the invention. It will be understood that many variations can be made in the procedures herein described while still remaining within the bounds of the present invention. It is the intention of the inventors that such variations are included within the scope of the invention.
EXAMPLES
EXAMPLE 1: Hybridoma development
1. Methods
1.1 Immunization and serum titer determination
1.1.1 Immunogen and immunization strategies
Cell immunization
CHO-Scells overexpressing human CD276 protein (UniProt ID: Q5ZPR3, i.e. CHO-S-hCD276) or mouse CD276 protein (UniProt ID: Q8VE98, i.e. CHO-S-hCD276) were used as immunogen.
Protein immunization
Recombinant human CD276 protein (SEQ ID NO: 346) : the recombinant human CD276 protein was prepared by digesting the human CD276 protein with enterokinase, and the extracellular domain of human CD276 was fused with 6xHis tag and DDDDK (SEQ ID NO: 345) .
Recombinant human CD276 protein (SEQ ID NO: 346) :
Balb/c and SJL mice were immunized as shown below. The primary immunization was followed by several boosts until animals developed satisfactory antiserum titers suitable for hybridoma development.
1.1.2 Immunization schedules
Immunization schedule (Group 1)
Immunization schedule (Group 2)
Immunization schedule (Group 3)
Immunization schedule (Group 4)
Immunization schedule (Group 5)
1.1.3 Test bleed antiserum analysis
Screening-Test bleeds were performed and evaluated by testing using FACS on CHO-Scell line stably over-expressing human and/or mouse CD276 (CHO-S-hCD276 and/or CHO-S-mCD276) .
Screening-Test bleeds were performed and evaluated by testing using Elisa with extra-cellular domain of recombinant human CD276 protein.
1.2 Hybridoma Generation and screening
1.2.1 Cell fusion and screening
Fusion-Splenocyte fusions were performed on the mice which responded the best to the immunizations as determined by test bleed FACS. The lymphocytes from spleens and lymph nodes were fused to a Sp2/0 cell line using an optimized electrofusion protocol. Multiple fusions were performed to ensure success of the cell fusion.
Screening and expansion-The fusion was plated (2 x 104 to 105 per well) into a stack of 96-well plates. Plates were monitored for growth and fed weekly. Wells with cell growth were screened by primary screening assays in 10-14 days with FACS and/or other feasible assays such as Elisa. Multiple fusions for each targeting antigen were performed and screened. The positive parental clones which showed positive binding with CHO-S-CD276 and positive Elisa signal from primary screening were expanded into 24-well plates for secondary screening.
Additional antibody screening-Following primary screening, positive parental clones expanded into 24-well plates were screened again by the assay described in the hybridoma screening funnel below.
Hybridomas of interest were chosen to proceed to subcloning.
1.2.2 Hybridoma subcloning, screening and cryopreservation
Subcloning-The parental hybridomas with desired reactivity and isotypes from the screening funnel above were then subcloned by multiple rounds of limiting dilution or single cell sorting until monoclones were obtained.
Screening &Expansion-The subcloning plates were screened by protein or cell-based Elisa, and the subclones with good binding ability were expanded to 24-wells for confirmation tests. The specificity and cross-reactivity of these subclones were confirmed with FACS analysis. Briefly, parental CHO-Scells, CHO-S-hCD276, CHO-Scell line stably over-expressing Macaca_fascicularis CD276, CHO-
K1 S, cell line stably over-expressing mouse CD276 were incubated with antibodies produced by each subclone respectively. Fluorescent dye-conjugated secondary antibody was used to detect the binding of the primary antibody with the cells. Median fluorescence intensity was measured by FACS analysis.
Cryopreservation-The desired subclonal cell lines were sequenced and further expanded into culture flasks for cryopreservation. 4-6 vials per cell line at 0.5-13.0 x106 cells/vial were initially cryopreserved. Master cell bank and working cell bank were established for the selected most valuable cell lines if desired.
2. Results
We discovered 43 antibodies with unique sequences showing positive binding with CHO-Scell stably over-expressing human CD276 protein (CHO-S-hCD276) but not binding to parental CHO-Scells, suggesting these antibodies are human CD276 recognizing antibody. Among which 42 antibodies could bind with cynomolgus monkey CD276, and 11 antibodies could bind with mouse CD276 protein. The MFI of the mouse antibodies staining CHO-S, CHO-S-hCD276, CHO-S-mCD276, CHO-S-Macaca_fascicularis CD276 (CHO-S-cynoCD276) , detected by FACS were summarized in the table below (Table 7) .
Table 7. MFI of antibodies binding with different cell lines
EXAMPLE 2: Antibody characterization: Affinity
1. Methods
1.1 Cell based binding affinity on SKOV3 cancer cell line
Sequences of 31 mouse antibodies from Table 5 were selected to generate and produce human IgG1 chimeric antibodies. The binding affinity of these antibodies and bench mark antibody, Enoblituzumab (see US8802091, MGA271,
specifically with a construct designated as hBRCA84D-2) and MGC018 (an antibody-drug-conjugate, in which the mAb MGA017 (human IgG1) is conjugated via a cleavable linker to the prodrug seco-DUocarmycin hydroxyBenzamide Azaindole (DUBA) , an alkylating agent that can damage DNA in both dividing and non-dividing cells, thereby causing cell death) with human patient derived ovarian cancer cell line, SKOV3, was determined by FACS analysis.
The protocol for FACs analysis is described as follows:
1. Digested cells using Trypsin (1X) ; Centrifuged the harvested cells at 300g for 3 min and discarding the supernatant.
2. Washed the cells 2 times with FACS buffer by centrifuging at 300 g for 3 min and discarding the supernatant.
3. Resuspended the cells, and 2*105 cell/well was seeded into the assay plate in 50 μl FACS buffer, then added 50 μl primary antibody (primary antibody final concentration: (5.00, 1.67, 0.56, 0.19, 0.06, 0.02, 0.01, 0.00 μg/ml or 20.00, 6.67, 2.22, 0.74, 0.25, 0.08, 0.03, 0.00 μg/ml) . Incubated at 4℃ for 1 hour.
4. Washed the cells twice by using the condition in step 2. Resuspended the cells with 100 μl/well diluted 2nd antibody, incubated at 4℃ for 1 hour in the dark.
5. Washed the cells twice by using the condition in step 2. Resuspended the cells with 100 μl/well FACS buffer. Kept the cells in dark for FACS analysis.
The binding affinity of the selected antibodies on SKOV3 are higher, lower or comparable with bench mark antibody Enoblituzumab (see Table 8 and Figure 1) .
Table 8. Binding affinity of the chimeric antibodies on SKOV3
2. Protein based Affinity test by Biacore (ChemPartner)
Test condition:
Analyte: B7H3
Running buffer: HBS-EP+
Flow Rate: 30 μL/min
Capture: Abs, 10 μL/min for 60 s
Injection of serial diluted B7H3
Contact time: 180 s
Dissociation time: 400 s
Regeneration: pH=1.5 Gly, 30 μL/min for 30 s
Method: Multiple cycle kinetics/affinity using capture
Machine Model: Biacore 8K (GE)
Analysis Temperature: 25℃
Table 9. shows the binding affinity of the chimeric antibodies on hB7H3 by Biacore (ChemPartner)
3. B7H3’s expression pattern on several cancer cell lines
B7H3 expression were detected by FACS with 6-D8-E7-A11. High expression level of B7H3 on several cancer cell lines, such as BxPC3 (Pancreatic) , MCF7 (Breast) , Dentroit562 (Head and neck) , RKO (Colon) and SUN620 (Gastric) , were found (see Figure 2) .
EXAMPLE 3. Antibody characterization: ADCC
1. Methods
In order to determine the ADCC of the anti-CD276 antibodies, 1x105/well SKOV3 were seeded to 96 wells Flat-bottom sterile plate, then 2x104 Jurkat-NFAT-Luciferase-CD16 were added as effector cell. After that, serial diluted antibodies were added to each well and the plate were incubated at 37℃, 5%CO2 for 18 hours.
Finally, the luciferase activity was detected to evaluate the ADCC activity of antibodies.
2. Result
All our antibodies showed potent ADCC effect on SKOV3 cells (ahuman ovarian cancer cell line) . Some of the antibodies showed lower or comparable EC50 compared with bench mark antibody, Enoblituzumab (Table 10 and figure 3) , indicating that they are more potent in mediating ADCC effect on SKOV3 cells than Enoblituzumab (MGA271) .
Table 10. EC50 of antibody induced ADCC effect on SKOV3
EXAMPLE 4. Antibody characterization: CDC
1. Methods
In order to determine the CDC of the anti-CD276 antibodies, CHO-S-hCD276 cells were resuspended in cell culture medium at 4E5 cells/mL and were then added into a 96-well opaque wall plate at 50 μL/well. Anti-CD276 antibodies were diluted with complete F-12K medium and added to the 96-well opaque wall plate at 50 μL/well. Human serum complement was diluted with cell culture medium and was added to the same plate at 50 μL/well. The mixture was incubated for 2 hours in a CO2 incubator at 37℃. CellTiter-Glo reagent for determining the cell cytotoxicity was added at 50 μL/well and the mixture was incubated for 10 mins at R.T. Luminescence signal of viable cells on a microplate reader was recorded.
2. Result
All the anti-CD276 antibodies showed potent CDC effect on CHO-S-hCD276 cells and lower EC50 compared with benchmark antibody, Enoblituzumab (MGA271) (see Table 10 and Figure 4) .
Table 11. Max CHO-S-hCD276 killing percentage and EC50 of antibody induced CDC effect
EXAMPLE 5. Antibody characterization: Indirect ADC cytotoxicity
1. Methods
Fab-ZAP is a chemical conjugate of goat anti-human monovalent antibody (asecondary antibody) and the ribosome-inactivating protein, saporin. Fab-ZAP is used to determine the internalization ability of antibodies. In this assay, 80 μL SKOV-3 cells were plated at 2000 cells/well in a 96-well plate and incubated overnight at 37℃. Anti-CD276 antibodies were then added at 40 μL/well. Fab-ZAP human dilution were added at 40 μL/well and incubated for 96 hours in a CO2 incubator at 37℃. CellTiter-Glo reagent for determining the cell cytotoxicity were added at 100 μL/well and incubated for 10 mins at R.T. Luminescence signal of viable cells on a microplate reader were recorded.
2. Result
All the anti-CD276 antibodies showed potent indirect ADC effect on SKOV3 cells, with lower or comparable IC50 compared with bench mark antibody, MGC018 (Table 12, Figure 5) , indicating that they are potential candidates for making ADCs.
Table 12. IC50 of indirect ADC cytotoxicity on SKOV3
EXAMPLE 6. Antibody in vivo efficacy in the treatment of subcutaneous MC-38-hCD276 murine colon carcinoma in female C57BL/6 mice
1. Study design and Methods
Several monoclonal antibodies with mouse IgG2a Fc were constructed and expressed for the in vivo efficacy. A bispecific antibody using B7H3 mAb and PD-L1 mAb (SHANGHAI ORIGINCELL MEDICAL TECHNOLOGY CO., LTD; see WO2019196309A1, YN035) with mouse IgG2a was also constructed in the format of IgG (H) scFV. The N terminal of the anti-PD-L1 scFv VH followed by (GGGGS) 3-VL was linked to the C terminal of the Fc region of the B7H3 antibody. As for Bis-25-C8-D7-C5 reverse, the N terminal of the anti-B7H3 scFv VH followed by (GGGGS) 3-VL was linked to the C terminal of the Fc region of the PD-L1 antibody.
That is, the naming of the bi-specific antibodies follows the following pattern.
Taking the bispecific antibody based on the CD276 antibody 25-C8-D7-C5 and PD-L1 (i.e., YN035) for example, in the Bis-25-C8-D7-C5 antibody, the CD276 binding domain (i.e., the binding domain derived from 25-C8-D7-C5) is the first binding domain and the PD-L1 binding domain is the second binding domain, while in the Bis-25-C8-D7-C5-reverse antibody, the CD276 binding domain (i.e., the binding domain derived from 25-C8-D7-C5) is the second binding domain and the PD-L1 binding domain is the first binding domain.
The heavy chain variable region amino acid sequence of YN035 (with CDR regions underlined) :
The light chain variable region amino acid sequence of YN035 (with CDR regions underlined) :
1. The MC-38-hCD276 (B7H3) tumor cells were maintained in vitro with DMEM medium supplemented with 10%fetal bovine serum at 37℃ in an atmosphere of 5%CO2 in air. The cells in exponential growth phase were harvested and quantitated by cell counter before tumor inoculation.
2. Each mouse was inoculated subcutaneously in the right rear flank region with MC-38-hCD276 (B7H3) tumor cells (1 x 10^6) in 0.1 ml of PBS for tumor development. The date of randomization was denoted as day 0, and dosing starts from day 0.
3. The randomization will start when the mean tumor size reaches approximately 50-60 mm3.60 mice were enrolled in this study. All animals were randomly allocated to 7 study groups. Randomization was performed based on randomized block design.
4. Tumor volumes were measured twice per week in two dimensions using a caliper, and the volume were expressed in mm3 using the formula: V = (L x W x W) /2, where V is tumor volume, L is tumor length (the longest tumor dimension) and W is tumor width (the longest tumor dimension perpendicular to L) . Dosing as well as tumor size and body weight measurements were conducted in a Laminar Flow Cabinet (see Table 13, Figure 6) .
5. Atezolizumab (an anti-PD-L1 antibody, also named Tecentriq or MPDL3280A, see WO2010077634A1) and Antengene-084M (MGA271’s Fab sequence (see US8802091B) constructed with mouse IgG2a) were used as control.
Table 13. Study design for in vivo efficacy test.
2. Result
As shown in Figure 6, some of the anti-CD276 antibodies showed potent in vivo efficacy. In particular, 25-C8-D7-C5 mouse IgG2a and Bis-6-D8-E7-A11-reverse mouse IgG2a showed higher tumor inhibition than Antengene-084M mouse IgG2a.
EXAMPLE 7: ADC in vivo efficacy test of the antibodies
1. Study design and Methods
To evaluate the ADC potential of the antibodies, antibody conjugations with VC-MMAE in ChemPartner were performed. A serial of VC-MMAE conjugated antibodies were obtained. The details are shown in Table 14.
Table 14. Summary of the antibody conjugations
Each Balb/c nude mouse for Calu-6 study was inoculated subcutaneously in the right front flank region with Calu-6 tumor cells (5 x 106) in 0.1 ml of PBS for tumor development. The randomization starts when the mean tumor size reaches approximately 122 mm3. 60 mice were enrolled in the study. The date of randomization was denoted as day 0, dosing starts from day 0.
2. Results
The therapeutic efficacy of test articles in the treatment of subcutaneous human lung cancer Calu-6 in Balb/c nude mice was investigated in this study. No obvious body weight loss, mortality or toxic response was observed in the designed dosing regimens during the efficacy study. At day 24, MGC018, 10-G6-C4-B2, 16-C6-F7-F5, 15-C8-B5-G7 and 18-F9-D8-G7 at 3 mg/kg as a single agent show a
significant anti-tumor efficacy against Calu-6 model in Balb/c nude mice, respectively. The results are shown in Figure 7 and Table 15.
Table 15. Antitumor Activity of Test Compounds in Subcutaneous Calu-6 Model in Balb/c Nude Mice
Note: a: Mean ± SEM; b: TGI, T/C and p values were compared with group 1 tumor volume on day 24 by using Dunnett’s tests.
EXAMPLE 8: T cell activation (MLR assay) test of the antibodies
1. Study design and Methods
DC induction
Monocyte cells were re-suspended at 5 x 106 in 3 ml complete medium supplemented with 2 U/ml of dendritic cell culture factor and then culture cells in 6-well plate. At the second day, 2 ml/well of fresh complete medium supplemented with 2 U/ml of dendritic cell culture factor were added for another three days culture. Then monocytes differentiated into immature dendritic cells (iDC) . After stimulated 48 hours with 2 U/ml of dendritic cell mature factor, iDCs would differentiate into mature dendritic cells.
Antibody Digestion
Combined 25 μg of hIgG1 and 3 μl of 10X Glyco Buffer, and then added PBS to make a 30 μl total reaction volume. 1 μl of IdeZ Protease was added, then
incubated at 37℃ for 30 minutes. 10 μl protein A/G beads were added in 1 mL PBS, washed 2 times. The beads were resuspended with reaction solution from the above step.
The tube was put on a magnet for 1 min RT, the F (ab) 2 is in supernatant and the Fc was captured by beads.
MLR assay
0.2 million cells/well T cells and 0.02 million cells/well mDCs were seeded.
Cells were treated PBS, IgG1, 25-C8-D7-C5, 30-C7-C11-D4, BMK (MGA271) or their Fab (final concentration 5 μg/ml) . After 24 hours, supernatants were collected and human IL-2 and IFNγ was tested with Elisa.
2. Results
As shown in Figures 8 and 9, 30-C7-C11-D4 can activate T cell activation while 25-C8-D7-C5 and BMK (MGA271) cannot.
EXAMPLE 9: Antibody humanization and PTM optimization
9.1 Cell-based affinity test of the humanized antibodies by FACS
10-G6-C4-B2 and 30-C7-C11-D4 were chosen to perform humanization and PTM optimization. The affinity of humanized candidates and optimized PTM sequences were evaluated by FACS.
The results are shown in Figures 10 and 11. All sequence showed comparable affinity with parental antibody.
9.2 Protein based affinity test by Biacore (ChemPartner)
Test condition:
Analyte: B7H3. Running buffer: HBS-EP+. Flow Rate: 30 μL/min. Capture: Abs, 10 μL/min for 60 s. Injection of serial diluted B7H3. Contact time 180s, dissociation time 400 s. Regeneration: pH=1.5 Gly, 30 μL/min for 30 s.
Method: Multiple cycle kinetics/affinity using capture. Machine Model: Biacore 8K (GE) . Analysis Temperature: 25℃.
The results are shown in Table 16.
Table 16. Binding affinity of the humanized antibodies on hB7H3 by Biacore (ChemPartner)
9.3 ADC therapeutic capability test of the humanized 10-G6-C4-B2 antibodies in vivo
The in vivo ADC therapeutic capability of the humanized 10-G6-C4-B2 antibodies were evaluated. Antibody conjugations with VC-MMAE in ChemPartner were constructed. A serial of VC-MMAE conjugated antibodies were obtained, the details of which were shown in Table 17.
Table 17. Summary of the antibody conjugations
Each Balb/c nude mouse for Calu-6 study was inoculated subcutaneously in the right front flank region with Calu-6 tumor cells (5 x 106) in 0.1 ml of PBS for tumor development. The randomization starts when the mean tumor size reaches approximately 122 mm3.60 mice were enrolled in the study. The date of randomization was denoted as day 0, dosing starts from day 0.
The therapeutic efficacy of test articles in the treatment of subcutaneous human lung cancer Calu-6 in Balb/c nude mice was investigated in this study. No obvious body weight loss, mortality or toxic response was observed in the designed dosing regimens during the efficacy study.
The results are shown in Figure 12 and Table 18. At day 26, almost all the test articles at 3 mg/kg as a single agent show a significant anti-tumor efficacy against Calu-6 model in Balb/c nude mice, respectively.
Table 18. Antitumor activity of test compounds in subcutaneous Calu-6 model in Balb/c nude mice
Note: Mean ± SEM; TGI, T/C and p values were compared with group 1 tumor volume on day 26 using Kruskal-Wallis test.
EXAMPLE 10: In vivo efficacy of the bispecific antibodies
Each mouse (C57BL/6) was inoculated subcutaneously in the right rear flank region with MC-38-hCD276 (B7H3) tumor cells (1 x 106) in 0.1 ml of PBS for tumor development. The randomization starts when the mean tumor size reaches approximately 139 mm3.66 mice were enrolled in the study. The date of randomization was denoted as day 0, dosing starts from the day of randomization (day 0) .
At day 19, Bis-30-C7-C11-D4 at 3 mg/kg, 25-C8-D7-C5-igG2a at 2.25 mg/kg combined with YN035-IgG2a at 2.25 mg/kg show a significant anti-tumor efficacy against MC-38-hCD276 (B7H3) murine colon carcinoma in C57BL/6 mice, respectively, as shown in Table 19 and Figure 13.
Table 19. Antitumor activity of test compounds in subcutaneous MC-38-hCD276 (B7H3) model in C57BL/6 mice
Note: Mean ± SEM; TGI, T/C and p values were compared with group 1 tumor volume on day 19 using Kruskal-Wallis test.
Each mouse (C57BL/6) was inoculated subcutaneously in the right rear flank region with MC-38-hCD276 (B7H3) tumor cells (1 x 106) in 0.1 ml of PBS for tumor development. The randomization starts when the mean tumor size reaches approximately 100 mm3.30 mice were enrolled in the study. The date of randomization was denoted as day 0, dosing starts from the day of randomization (day 0) .
At day 19, Bis-25-C8-D7-C5 at 3 mg/kg and Bis-30-C7-C11-D4 at 3 mg/kg as a single agent showed a significant anti-tumor efficacy against MC-38-hCD276 (B7H3) murine colon carcinoma in C57BL/6 mice, respectively, as shown in Table 20 and Figure 14.
Table 20. Antitumor activity of test compounds in subcutaneous MC-38-hCD276 (B7H3) model in C57BL/6 mice
Note: Mean ± SEM; TGI, T/C and p values were compared with group 1 tumor volume on day 19 by using Dunnett’s tests.
EXAMPLE 11: In vivo efficacy of the bispecific antibodies incorporated with PTM optimization
The humanized antibodies incorporated PTM optimization were constructed and expressed for the in vivo efficacy. A bispecific antibody using B7H3 mAb 30-C7-C11-D4 and PD-L1 mAb (SHANGHAI ORIGINCELL MEDICAL TECHNOLOGY CO., LTD; see WO2019196309A1, YN035) with human IgG1 was also constructed in the format of IgG (H) scFV. The N terminal of the anti-PD-L1 scFv VH followed by (GGGGS) 3-VL was linked to the C terminal of the Fc region of the B7H3-antibody.
Each mouse (C57BL/6) was inoculated subcutaneously in the right rear flank region with MC-38-hCD276 (B7H3) tumor cells (1 x 106) in 0.1 ml of PBS for tumor development. The randomization starts when the mean tumor size reaches approximately 100 mm3.54 mice were enrolled in the study. The date of randomization was denoted as day 0, dosing starts from the day of randomization (day 0) .
Bis-30-C7-C11-D4_hVH3-hVL2-PTM and Bis-30-C7-C11-D4_hVH4-hVL5-PTM showed comparable tumor growth inhibition with parental Bis-30-C7-C11-D4, as shown in Table 21 and Figure 15.
Table 21. Antitumor activity of test compounds in subcutaneous MC-38-hCD276 (B7H3) model in C57BL/6 mice
Note: Mean ± SEM; TGI, T/C and p values were compared with group 1 tumor volume on day 19 by using Dunnett’s tests.
Claims (45)
- A multi-specific antibody or an antigen-binding fragment thereof, comprising a first binding domain and a second binding domain, wherein the first binding domain specifically binds to CD276 and the second binding domain specifically binds to a second target other than CD276.
- The multi-specific antibody or an antigen-binding fragment thereof of claim 1, wherein the first binding domain comprises 1, 2, or 3 heavy chain complementarity determining region (CDR) sequences selected from the group consisting of: SEQ ID NOs: 1-3, 9-11, 17-19, 25-27, 33-35, 41-43, 49-51, 57-59, 65-67, 73-75, 81-83, 89-91, 97-99, 105-107, 113-115, 121-123, 129-131, 137-139, 145-147, 153-155, 161-163, 169-171, 177-179, 185-187, 193-195, 201-203, 209-211, 217-219, 225-227, 233-235, 241-243, 249-251, 257-259, 265-267, 273-275, 281-283, 289-291, 297-299, 305-307, 313-315, 321-323, 329-331, 337-339 and 374-375, and/or 1, 2, or 3 light chain CDR sequences selected from the group consisting of: SEQ ID NOs: 4-6, 12-14, 20-22, 28-30, 36-38, 44-46, 52-54, 60-62, 68-70, 76-78, 84-86, 92-94, 100-102, 108-110, 116-118, 124-126, 132-134, 140-142, 148-150, 156-158, 164-166, 172-174, 180-181, 188-190, 196-198, 204-206, 212-214, 220-222, 228-230, 236-238, 244-246, 252-254, 260-262, 268-270, 276-278, 284-286, 292-294, 300-302, 308-310, 316-318, 324-326, 332-334, 340-342 and 376-377.
- The multi-specific antibody or antigen-binding fragment thereof of claim 1, wherein the first binding domain comprises a heavy chain variable region selected from the group consisting of:a) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 1-3;b) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 9-11;c) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 17-19;d) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 25-27;e) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 33-35;f) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 41-43;g) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 49-51;h) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 57-59;i) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 65-67;j) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 73-75;k) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 81-83;l) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 89-91;m) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 97-99;n) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 105-107;o) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 113-115;p) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 121-123;q) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 129-131;r) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 137-139;s) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 145-147;t) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 153-155;u) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 161-163;v) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 169-171;w) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 177-179;x) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 185-187;y) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 193-195;z) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 201-203;aa) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 209-211;bb) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 217-219;cc) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 225-227;dd) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 233-235;ee) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 241-243;ff) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 249-251;gg) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 257-259;hh) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 265-267;ii) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 273-275;jj) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 281-283;kk) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 289-291;ll) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 297-299;mm) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 305-307;nn) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 313-315;oo) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 321-323;pp) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 329-331;qq) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 337-339; andrr) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 9, 374 and 375.
- The multi-specific antibody or antigen-binding fragment thereof of any of the preceding claims, wherein the first binding domain comprises a light chain variable region selected from the group consisting of:a) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 4-6;b) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 12-14;c) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 20-22;d) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 28-30;e) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 36-38;f) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 44-46;g) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 52-54;h) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 60-62;i) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 68-70;j) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 76-78;k) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 84-86;l) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 92-94;m) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 100-102n) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 108-110;o) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 116-118;p) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 124-126;q) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 132-134;r) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 140-142;s) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 148-150;t) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 156-158;u) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 164-166;v) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 172-174;w) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 180-181;x) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 188-190;y) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 196-198;z) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 204-206;aa) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 212-214;bb) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 220-222;cc) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 228-230;dd) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 236-238;ee) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 244-246;ff) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 252-254;gg) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 260-262;hh) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 268-270, ;ii) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 276-278;jj) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 284-286;kk) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 292-294;ll) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 300-302;mm) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 308-310;nn) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 316-318;oo) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 324-326;pp) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 332-334;qq) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 340-342;rr) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 376, 13 and 14; andss) a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NOs: 377, 45 and 46.
- The multi-specific antibody or antigen-binding fragment thereof of any of the preceding claims, wherein the first binding domain comprises:a) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 3; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 4, SEQ ID NO: 5, and SEQ ID NO: 6;b) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 9, SEQ ID NO: 10, and SEQ ID NO: 11; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 12, SEQ ID NO: 13, and SEQ ID NO: 14;c) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 17, SEQ ID NO: 18, and SEQ ID NO: 19; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 20, SEQ ID NO: 21 and SEQ ID NO: 22;d) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 25, SEQ ID NO: 26, and SEQ ID NO: 27; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 28, SEQ ID NO: 29, and SEQ ID NO: 30;e) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 33, SEQ ID NO: 34, and SEQ ID NO: 35; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 36, SEQ ID NO: 37, and SEQ ID NO: 38;f) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 41, SEQ ID NO: 42, and SEQ ID NO: 43; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 44, SEQ ID NO: 45, and SEQ ID NO: 46;g) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 49, SEQ ID NO: 50, and SEQ ID NO: 51; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 52, SEQ ID NO: 53, and SEQ ID NO: 54;h) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 57, SEQ ID NO: 58, and SEQ ID NO: 59; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID SEQ ID NO: 60, SEQ ID NO: 61, and SEQ ID NO: 62;i) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 65, SEQ ID NO: 66, and SEQ ID NO: 67; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 68, SEQ ID NO: 69, and SEQ ID NO: 70;j) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 73, SEQ ID NO: 74, and SEQ ID NO: 75; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 76, SEQ ID NO: 77, and SEQ ID NO: 78;k) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 81, SEQ ID NO: 82, and SEQ ID NO: 83; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 84, SEQ ID NO: 85, and SEQ ID NO: 86;l) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 89, SEQ ID NO: 90, and SEQ ID NO: 91; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 92, SEQ ID NO: 93, and SEQ ID NO: 94;m) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 97, SEQ ID NO: 98, and SEQ ID NO: 99; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 100, SEQ ID NO: 101, and SEQ ID NO: 102;n) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 105, SEQ ID NO: 106, and SEQ ID NO: 107; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 108, SEQ ID NO: 109 and SEQ ID NO: 110;o) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 113, SEQ ID NO: 114, and SEQ ID NO: 115; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 116, SEQ ID NO: 117, and SEQ ID NO: 118;p) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 121, SEQ ID NO: 122, and SEQ ID NO: 123; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 124, SEQ ID NO: 125, and SEQ ID NO: 126;q) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 129, SEQ ID NO: 130, and SEQ ID NO: 131; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 132, SEQ ID NO: 133, and SEQ ID NO: 134;r) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 137, SEQ ID NO: 138, and SEQ ID NO: 139; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 140, SEQ ID NO: 141, and SEQ ID NO: 142;s) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 145, SEQ ID NO: 146, and SEQ ID NO: 147; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID SEQ ID NO: 148, SEQ ID NO: 149, and SEQ ID NO: 150;t) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 153, SEQ ID NO: 154, and SEQ ID NO: 155; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 156, SEQ ID NO: 157, and SEQ ID NO: 158;u) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 161, SEQ ID NO: 162, and SEQ ID NO: 163; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 164, SEQ ID NO: 165, and SEQ ID NO: 166;v) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 169, SEQ ID NO: 170, and SEQ ID NO: 171; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 172, SEQ ID NO: 173, and SEQ ID NO: 174;w) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 177, SEQ ID NO: 178, and SEQ ID NO: 179; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 180, SEQ ID NO: 181, and SEQ ID NO: 182;x) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 185, SEQ ID NO: 186, and SEQ ID NO: 187; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 188, SEQ ID NO: 189, and SEQ ID NO: 190;y) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 193, SEQ ID NO: 194, and SEQ ID NO: 195; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 196, SEQ ID NO: 197 and SEQ ID NO: 198;z) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 201, SEQ ID NO: 202, and SEQ ID NO: 203; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 204, SEQ ID NO: 205, and SEQ ID NO: 206;aa) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 209, SEQ ID NO: 210, and SEQ ID NO: 211; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 212, SEQ ID NO: 213, and SEQ ID NO: 214;bb) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 217, SEQ ID NO: 218, and SEQ ID NO: 219; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 220, SEQ ID NO: 221, and SEQ ID NO: 222;cc) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 225, SEQ ID NO: 226, and SEQ ID NO: 227; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 228, SEQ ID NO: 229, and SEQ ID NO: 230;dd) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 233, SEQ ID NO: 234, and SEQ ID NO: 235; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID SEQ ID NO: 236, SEQ ID NO: 237, and SEQ ID NO: 238;ee) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 241, SEQ ID NO: 242, and SEQ ID NO: 243; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 244, SEQ ID NO: 245, and SEQ ID NO: 246;ff) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 249, SEQ ID NO: 250, and SEQ ID NO: 251; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 252, SEQ ID NO: 253, and SEQ ID NO: 254;gg) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 257, SEQ ID NO: 258, and SEQ ID NO: 259; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 260, SEQ ID NO: 261, and SEQ ID NO: 262;hh) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 265, SEQ ID NO: 266, and SEQ ID NO: 267; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 268, SEQ ID NO: 269, and SEQ ID NO: 270;ii) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 273, SEQ ID NO: 274, and SEQ ID NO: 275; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 276, SEQ ID NO: 277, and SEQ ID NO: 278;jj) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 281, SEQ ID NO: 282, and SEQ ID NO: 283; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 284, SEQ ID NO: 285 and SEQ ID NO: 286;kk) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 289, SEQ ID NO: 290, and SEQ ID NO: 291; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 292, SEQ ID NO: 293, and SEQ ID NO: 294;ll) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 297, SEQ ID NO: 298, and SEQ ID NO: 299; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 300, SEQ ID NO: 301, and SEQ ID NO: 302;mm) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 305, SEQ ID NO: 306, and SEQ ID NO: 307; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 308, SEQ ID NO: 309, and SEQ ID NO: 310;nn) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 313, SEQ ID NO: 314, and SEQ ID NO: 315; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 316, SEQ ID NO: 317, and SEQ ID NO: 318;oo) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 321, SEQ ID NO: 322, and SEQ ID NO: 323; and a light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID SEQ ID NO: 324, SEQ ID NO: 325, and SEQ ID NO: 326;pp) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 329, SEQ ID NO: 330, and SEQ ID NO: 331; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 332, SEQ ID NO: 333, and SEQ ID NO: 334;qq) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 337, SEQ ID NO: 338, and SEQ ID NO: 339; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 340, SEQ ID NO: 341, and SEQ ID NO: 342;rr) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 9, SEQ ID NO: 374, and SEQ ID NO: 375; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 376, SEQ ID NO: 13, and SEQ ID NO: 14; orss) a heavy chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 41, SEQ ID NO: 42, and SEQ ID NO: 43; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences selected from SEQ ID NO: 377, SEQ ID NO: 45, and SEQ ID NO: 46.
- The multi-specific antibody or antigen-binding fragment thereof of any of the preceding claims, wherein the first binding domain comprises a heavy chain variable region selected from the group consisting of: SEQ ID NO: 7, SEQ ID NO: 15, SEQ ID NO: 23, SEQ ID NO: 31, SEQ ID NO: 39, SEQ ID NO: 47, SEQ ID NO: 55, SEQ ID NO: 63, SEQ ID NO: 71, SEQ ID NO: 79, SEQ ID NO: 87, SEQ ID NO: 95, SEQ ID NO: 103, SEQ ID NO: 111, SEQ ID NO: 119, SEQ ID NO: 127, SEQ ID NO: 135, SEQ ID NO: 143, SEQ ID NO: 151, SEQ ID NO: 159, SEQ ID NO: 167, SEQ ID NO: 175, SEQ ID NO: 183, SEQ ID NO: 191, SEQ ID NO: 199, SEQ ID NO: 207, SEQ ID NO: 215, SEQ ID NO: 223, SEQ ID NO: 231, SEQ ID NO: 239, SEQ ID NO: 247, SEQ ID NO: 255, SEQ ID NO: 263, SEQ ID NO: 271, SEQ ID NO: 279, SEQ ID NO: 287, SEQ ID NO: 295, SEQ ID NO: 303, SEQ ID NO: 311, SEQ ID NO: 319, SEQ ID NO: 327, SEQ ID NO: 335, SEQ ID NO: 343, SEQ ID NO: 347, and SEQ ID NO: 349 and the homologue sequences of at least 80%sequence identity thereof.
- The multi-specific antibody or antigen-binding fragment thereof of any of the preceding claims, wherein the first binding domain comprises a light chain variable region selected from the group consisting of: SEQ ID NO: 8, SEQ ID NO: 16, SEQ ID NO: 24, SEQ ID NO: 32, SEQ ID NO: 40, SEQ ID NO: 48, SEQ ID NO: 56, SEQ ID NO: 64, SEQ ID NO: 72, SEQ ID NO: 80, SEQ ID NO: 88, SEQ ID NO: 96, SEQ ID NO: 104, SEQ ID NO: 112, SEQ ID NO: 120, SEQ ID NO: 128, SEQ ID NO: 136, SEQ ID NO: 144, SEQ ID NO: 152, SEQ ID NO: 160, SEQ ID NO: 168, SEQ ID NO: 1756, SEQ ID NO: 184, SEQ ID NO: 192, SEQ ID NO: 200, SEQ ID NO: 208, SEQ ID NO: 216, SEQ ID NO: 224, SEQ ID NO: 232, SEQ ID NO: 240, SEQ ID NO: 248, SEQ ID NO: 256, SEQ ID NO: 264, SEQ ID NO: 272, SEQ ID NO: 280, SEQ ID NO: 288, SEQ ID NO: 296, SEQ ID NO: 304, SEQ ID NO: 312, SEQ ID NO: 320, SEQ ID NO: 328, SEQ ID NO: 336, SEQ ID NO: 344, SEQ ID NO: 348, and SEQ ID NO: 350 and the homologue sequences of at least 80%sequence identity thereof.
- The multi-specific antibody or antigen-binding fragment thereof of any of the preceding claims, wherein the first binding domain comprises SEQ ID NO: 378 (EVQLVESGGGLXQPGXSLRLSCXTSGFTLSDYYMSWVRQXPGKGLEWV XFMRNKANXYTTEYSASVRGRFTISRDTSKSXIYLQMNSLXXEDTAVYY CVRDRXGRPFAYWGQGTLVTVSS) , wherein the X at position i (i=12, 16, 23, 40, 49, 57, 80, 89, 90 and 103) of SEQ ID NO: 378 is referred as XHi, wherein XH12 is V or I, XH16 is G or R, XH23 is A or T, XH40 is A or P, XH49 is G or S, XH57 is A or G, XH80 is I or T, XH89 is R or K, XH90 is A or T, XH103 is D or E; and a light chain variable region comprising SEQ ID NO: 379 (DIXMTQSPXSLXXXXGXXXXIXCKSSQSLLNXINQKNFLTWYXQKPGX XPXLLIYWASTRESGVPXRFSGSGSGTDFTLXISXXXXEDLXXYYCQNDY TYPLTFGQGTKLEIK) , wherein the X at position i (i=3, 9, 12, 13, 14, 15, 17, 18, 19, 20, 22, 32, 43, 48, 49, 51, 66, 80, 83, 84, 85, 86, 90 and 91) of SEQ ID NO: 379 is referred as XLi, wherein XL3 is V or Q, XL9 is D, L or S, XL12 is A, S or P, XL13 is A or V, XL14 is S or T, XL15 is L, V or P, XL17 is D or E, XL18 is R or P, XL19 is A or V, XL20 is S or T, XL22 is N, T or S, XL32 is A or S, XL43 is Q or L, XL48 is Q or K, XL49 is A, P or S, XL51 is K or Q, XL66 is S or D, XL80 is K or T, XL83 is R or S, XL84 is L or V, XL85 is Q or E, XL86 is A or P, XL90 is A or G, XL91 is T or V.
- The multi-specific antibody or antigen-binding fragment thereof of claim 9, wherein the first binding domain comprises a heavy chain variable region comprising SEQ ID NO: 380 (QVQLQESGPGLVKPSXTLSLTCXVXGYSITSDYAWNWIRQXPGKGLEWI GYISHSGSTSYNPSLKSRVTISRDTSKNQFSLKLSSVTAADTAVYYCARSL GRRWYFDVWGQGTTVTVSS) , wherein the X at position i (i=16, 23, 25 and 41) of SEQ ID NO: 380 is referred as XHi, wherein XH16 is E or Q, XH23 is A or T, XH25 is S or Y, XH41 is H or P; anda light chain variable region comprising SEQ ID NO: 381 (DIXMTQSPXSLXXXXGXXXXIXCKSSQSLLXSSTQKNYLAWYXQKPGX XPXLLIYFASTRDSGVPXRFSGSGSGTDFTLXISXXXXEDLXXYFCQQHYI IPFTFGQGTKLEIK) , wherein the X at position i (i=3, 9, 12, 13, 14, 15, 17, 18, 19, 20, 22, 31, 43, 48, 49, 51, 66, 80, 83, 84, 85, 86, 90 and 91) of SEQ ID NO: 381 is referred as XLi, wherein XL3 is V or Q, XL9 is D, L or S, XL12 is A, S or P, XL13 is A or V, XL14 is S or T, XL15 is L, V or P, XL17 is D or E, XL18 is R or P, XL19 is A or V, XL20 is S or T, XL22 is N, T or S, XL31 is N or Q, XL43 is Q or L, XL48 is Q or K, XL49 is A, P or S, XL51 is K or Q, XL66 is S or D, XL80 is K or T, XL83 is R or S, XL84 is L or V, XL85 is Q or E, XL86 is A or P, XL90 is A or G, XL91 is T or V.
- The multi-specific antibody or antigen-binding fragment thereof of claim 9, wherein the first binding domain comprises:(i) a heavy chain variable region comprising 1, 2, or 3 CDR sequences shown as SEQ ID NO: 9, SEQ ID NO: 10 or 374 (MRNKANAYTT) , and SEQ ID NO: 11 or 375 (VRDREGRPFAY) , respectively; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences shown as SEQ ID NO: 12 or 376 (QSLLNAINQKNF) , SEQ ID NO: 13, and SEQ ID NO: 14, respectively; or(ii) a heavy chain variable region comprising 1, 2, or 3 CDR sequences shown as SEQ ID NO: 41, SEQ ID NO: 42, and SEQ ID NO: 43, respectively; and a kappa light chain variable region comprising 1, 2, or 3 CDR sequences shown as SEQ ID NO: 44 or 377 (QSLLQSSTQKNY) , SEQ ID NO: 45, and SEQ ID NO: 46, respectively.
- The multi-specific antibody or antigen-binding fragment thereof of claim 9, wherein the first binding domain comprises a heavy chain variable region comprising a sequence selected from SEQ ID NO: 351, 353, 355, 357, 358, 360, 362, 364, 365, 367 and 370; and a light chain variable region comprising a sequence selected from SEQ ID NO: 352, 354, 356, 359, 361, 363, 366, 368, 369, 371, 372 and 373.
- The multi-specific antibody or antigen-binding fragment thereof of any of the preceding claims, wherein the first binding domain comprises:a) a heavy chain variable region comprising SEQ ID NO: 7 and a light chain variable region comprising SEQ ID NO: 8;b) a heavy chain variable region comprising SEQ ID NO: 15 and a light chain variable region comprising SEQ ID NO: 16;c) a heavy chain variable region comprising SEQ ID NO: 23 and a light chain variable region comprising SEQ ID NO: 24;d) a heavy chain variable region comprising SEQ ID NO: 31 and a light chain variable region comprising SEQ ID NO: 32;e) a heavy chain variable region comprising SEQ ID NO: 39 and a light chain variable region comprising SEQ ID NO: 40;f) a heavy chain variable region comprising SEQ ID NO: 47 and a light chain variable region comprising SEQ ID NO: 48;g) a heavy chain variable region comprising SEQ ID NO: 55 and a light chain variable region comprising SEQ ID NO: 56;h) a heavy chain variable region comprising SEQ ID NO: 63 and a light chain variable region comprising SEQ ID NO: 64;i) a heavy chain variable region comprising SEQ ID NO: 71 and a light chain variable region comprising SEQ ID NO: 72;j) a heavy chain variable region comprising SEQ ID NO: 79 and a light chain variable region comprising SEQ ID NO: 80;k) a heavy chain variable region comprising SEQ ID NO: 87 and a light chain variable region comprising SEQ ID NO: 88;l) a heavy chain variable region comprising SEQ ID NO: 95 and a light chain variable region comprising SEQ ID NO: 96;m) a heavy chain variable region comprising SEQ ID NO: 103 and a light chain variable region comprising SEQ ID NO: 104;n) a heavy chain variable region comprising SEQ ID NO: 111 and a light chain variable region comprising SEQ ID NO: 112;o) a heavy chain variable region comprising SEQ ID NO: 119 and a light chain variable region comprising SEQ ID NO: 120;p) a heavy chain variable region comprising SEQ ID NO: 127 and a light chain variable region comprising SEQ ID NO: 128;q) a heavy chain variable region comprising SEQ ID NO: 135 and a light chain variable region comprising SEQ ID NO: 136;r) a heavy chain variable region comprising SEQ ID NO: 143 and a light chain variable region comprising SEQ ID NO: 144;s) a heavy chain variable region comprising SEQ ID NO: 151 and a light chain variable region comprising SEQ ID NO: 152;t) a heavy chain variable region comprising SEQ ID NO: 159 and a light chain variable region comprising SEQ ID NO: 160;u) a heavy chain variable region comprising SEQ ID NO: 167 and a light chain variable region comprising SEQ ID NO: 168;v) a heavy chain variable region comprising SEQ ID NO: 175 and a light chain variable region comprising SEQ ID NO: 176;w) a heavy chain variable region comprising SEQ ID NO: 183 and a light chain variable region comprising SEQ ID NO: 184;x) a heavy chain variable region comprising SEQ ID NO: 191 and a light chain variable region comprising SEQ ID NO: 192;y) a heavy chain variable region comprising SEQ ID NO: 199 and a light chain variable region comprising SEQ ID NO: 200;z) a heavy chain variable region comprising SEQ ID NO: 207 and a light chain variable region comprising SEQ ID NO: 208;aa) a heavy chain variable region comprising SEQ ID NO: 215 and a light chain variable region comprising SEQ ID NO: 216;bb) a heavy chain variable region comprising SEQ ID NO: 223 and a light chain variable region comprising SEQ ID NO: 224;cc) a heavy chain variable region comprising SEQ ID NO: 231 and a light chain variable region comprising SEQ ID NO: 232;dd) a heavy chain variable region comprising SEQ ID NO: 239 and a light chain variable region comprising SEQ ID NO: 240;ee) a heavy chain variable region comprising SEQ ID NO: 247 and a light chain variable region comprising SEQ ID NO: 248;ff) a heavy chain variable region comprising SEQ ID NO: 255 and a light chain variable region comprising SEQ ID NO: 256;gg) a heavy chain variable region comprising SEQ ID NO: 263 and a light chain variable region comprising SEQ ID NO: 264;hh) a heavy chain variable region comprising SEQ ID NO: 271 and a light chain variable region comprising SEQ ID NO: 272;ii) a heavy chain variable region comprising SEQ ID NO: 279 and a light chain variable region comprising SEQ ID NO: 280;jj) a heavy chain variable region comprising SEQ ID NO: 287 and a light chain variable region comprising SEQ ID NO: 288;kk) a heavy chain variable region comprising SEQ ID NO: 295 and a light chain variable region comprising SEQ ID NO: 296;ll) a heavy chain variable region comprising SEQ ID NO: 303 and a light chain variable region comprising SEQ ID NO: 304;mm) a heavy chain variable region comprising SEQ ID NO: 311 and a light chain variable region comprising SEQ ID NO: 312;nn) a heavy chain variable region comprising SEQ ID NO: 319 and a light chain variable region comprising SEQ ID NO: 320;oo) a heavy chain variable region comprising SEQ ID NO: 327 and a light chain variable region comprising SEQ ID NO: 328;pp) a heavy chain variable region comprising SEQ ID NO: 335 and a light chain variable region comprising SEQ ID NO: 336;qq) a heavy chain variable region comprising SEQ ID NO: 343 and a light chain variable region comprising SEQ ID NO: 344;rr) a heavy chain variable region comprising SEQ ID NO: 347 and a light chain variable region comprising SEQ ID NO: 348; orss) a heavy chain variable region comprising SEQ ID NO: 349 and a light chain variable region comprising SEQ ID NO: 350.
- The multi-specific antibody or antigen-binding fragment thereof of any one of the preceding claims, wherein the first binding domain further comprises one or more amino acid residue substitutions or modifications yet retains specific binding affinity to human CD276.
- The multi-specific antibody or antigen-binding fragment thereof of claim 13, wherein the substitution is in one or more CDR sequences, and/or in one or more of the VH or VL sequences but not in any of the CDR sequences.
- The multi-specific antibody or antigen-binding fragment thereof of any of the preceding claims, which further comprises an activating receptor binding domain, and, optionally, the activating receptor binding domain is a constant region of human Ig, or a constant region of human IgG, and, optionally, the first binding domain is an intact antibody.
- The multi-specific antibody or antigen-binding fragment thereof of claim 15, wherein the constant region comprises a constant region of human IgG1, IgG2, IgG3, or IgG4.
- The multi-specific antibody or antigen-binding fragment thereof of any one of the preceding claims, wherein the second target is PD-L1.
- The multi-specific antibody or antigen-binding fragment thereof of any one of the preceding claims, wherein the second binding domain comprises 1, 2, or 3 heavy chain complementarity determining region (CDR) sequences selected from the group consisting of: SEQ ID NOs: 384-386, and/or 1, 2, or 3 light chain CDR sequences selected from the group consisting of: SEQ ID NOs: 387-389.
- The multi-specific antibody or antigen-binding fragment thereof of any one of the preceding claims, wherein the second binding domain comprises a heavy chain variable region comprising three CDR sequences set forth as SEQ ID NOs: 384, 385 and 386, respectively; and a light chain variable region comprising three CDR sequences set forth as SEQ ID NOs: 387, 388 and 389, respectively.
- The multi-specific antibody or antigen-binding fragment thereof of any one of the preceding claims, wherein the second binding domain comprises a heavy chain variable set forth as SEQ ID NO: 382, and/or a light chain variable region set forth as SEQ ID NO: 383.
- The multi-specific antibody or antigen-binding fragment thereof of any one of the preceding claims, wherein the second binding domain further comprises one or more amino acid residue substitutions or modifications yet retains specific binding affinity to human PD-L1.
- The multi-specific antibody or antigen-binding fragment thereof of claim 16, wherein the substitution is in one or more CDR sequences, and/or in one or more of the VH or VL sequences but not in any of the CDR sequences.
- The multi-specific antibody or antigen-binding fragment thereof of claim 16, wherein the second binding domain comprising an scFv structure of VH-linker-VL.
- The multi-specific antibody or antigen-binding fragment thereof of any one of the preceding claims, wherein the linker comprises a sequence of (GGGGS) 3 (SEQ ID NO: 390) .
- The multi-specific antibody or antigen-binding fragment thereof of claim 16, wherein the N-termination of the second binding domain is operably linked to the C-termination of the activating receptor binding domain.
- The multi-specific antibody or antigen-binding fragment thereof of any one of the preceding claims, which is a bi-specific or tri-specific antibody.
- The multi-specific antibody or antigen-binding fragment thereof of any one of the preceding claims, which is linked to one or more conjugates, optionally, wherein the conjugate is covalently attached either directly or via a linker.
- The multi-specific antibody or antigen-binding fragment thereof of claim 25, wherein the conjugate comprises a clearance-modifying agent, a chemotherapeutic agent, a toxin, a radioactive isotope, a lanthanide, a luminescent label, a fluorescent label, an enzyme-substrate label, a DNA-alkylators, a topoisomerase inhibitor, a tubulin-binders, or other anticancer drugs.
- A pharmaceutical composition comprising the multi-specific antibody or antigen-binding fragment thereof of any one of the preceding claims, and a pharmaceutically acceptable carrier.
- An isolated polynucleotide encoding the multi-specific antibody or antigen-binding fragment thereof of any one of claims 1-27.
- A vector comprising the isolated polynucleotide of claim 31.
- A host cell comprising the vector of claim 32.
- A method of expressing the multi-specific antibody or antigen-binding fragment thereof of any one of claims 1-27, comprising culturing the host cell of claim 33 under the condition at which the vector of claim 32 is expressed
- A method of treating a disease or condition in a subject that would benefit from modulation of CD276 activity and/or PD-L1, comprising administering to the subject a therapeutically effective amount of the multi-specific antibody or antigen-binding fragment thereof of any of claims 1-27 or the pharmaceutical composition of any one of claims 28-30.
- The method of claim 35, wherein the disease or condition is a CD276 and/or PD-L1 related disease or condition.
- The method of claim 35, wherein the disease or condition is cancer, adaptive immune disease, autoimmune disease, inflammatory disease, or infectious disease.
- The method of claim 37, wherein the cancer is adrenal gland tumor, an AIDS-associated cancer, an alveolar soft part sarcoma, an astrocytic tumor, bladder cancer, bone cancer, a brain and spinal cord cancer, a metastatic brain tumor, a breast cancer, a carotid body tumors, a cervical cancer, a chondrosarcoma, a chordoma, a chromophobe renal cell carcinoma, a clear cell carcinoma, a colon cancer, a colorectal cancer, a cutaneous benign fibrous histiocytoma, a desmoplastic small round cell tumor, an ependymoma, a Ewing's tumor, an extraskeletal myxoid chondrosarcoma, a fibrogenesis imperfecta ossium, a fibrous dysplasia of the bone, a gallbladder or bile duct cancer, gastric cancer, a gestational trophoblastic disease, a germ cell tumor, a head and neck cancer, hepatocellular carcinoma, an islet cell tumor, a Kaposi's Sarcoma, a kidney cancer, a leukemia, a lipoma/benign lipomatous tumor, a liposarcoma/malignant lipomatous tumor, a liver cancer, a lymphoma, a lung cancer, a medulloblastoma, a melanoma, a meningioma, a multiple endocrine neoplasia, a multiple myeloma, a myelodysplastic syndrome, a neuroblastoma, a neuroendocrine tumors, an ovarian cancer, a pancreatic cancer, a papillary thyroid carcinoma, a parathyroid tumor, a pediatric cancer, a peripheral nerve sheath tumor, a phaeochromocytoma, a pituitary tumor, a prostate cancer, a posterior uveal melanoma, a rare hematologic disorder, a renal metastatic cancer, a rhabdoid tumor, a rhabdomysarcoma, a sarcoma, a skin cancer, a soft-tissue sarcoma, a squamous cell cancer, a stomach cancer, a synovial sarcoma, a testicular cancer, a thymic carcinoma, a thymoma, a thyroid metastatic cancer, and a uterine cancer, optionally, wherein the cancer is chemoresistant.
- The method of claim 37, wherein the disease or condition is hematological cancer chosen from B-cell lymphomas, optionally Hodgkin's lymphoma, non-Hodgkin's lymphoma (NHL) , acute lymphocytic leukemia (ALL) , acute myeloid leukemia (AML) , chronic lymphocytic leukemia (CLL) , chronic myelogenous leukemia (CML) , multiple myeloma (MM) , diffuse large B cell lymphoma (DLBCL) , Marginal zone B-cell lymphoma (MZL) , Mantle cell lymphoma (MCL) , Richter's syndrome, Burkitt’s lymphoma or follicular lymphoma.
- The method of claim 35, wherein the subject is human.
- The method of claim 35, comprising administering to the subject a therapeutically effective amount of one or more therapeutic agent.
- The method of claim 35, wherein said therapeutic agent is a chemotherapeutic agent, a radiation therapeutic agent, a hormonal therapeutic agent, a toxin or an immunotherapeutic agent.
- The method of any of claims 35-42, wherein the administration is via oral, nasal, intravenous, subcutaneous, sublingual, or intramuscular administration.
- The method of claim 35-43, wherein said method further comprises administration of one or more additional cancer therapies selected from the group consisting of chemotherapy, immunotherapy, radiation therapy, hormonal therapy, and surgery.
- Use of the multi-specific antibody or antigen-binding fragment thereof of any one of claims 1-27 in the manufacture of a medicament for treating a CD276 and/or PD-L1 related disease or condition in a subject.
- Use of the multi-specific antibody or antigen-binding fragment thereof of any one of claims 1-27 in a method for treating a CD276 and/or PD-L1 related disease or condition in a subject.
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CNPCT/CN2022/131463 | 2022-11-11 | ||
CN2022131463 | 2022-11-11 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2024099295A1 true WO2024099295A1 (en) | 2024-05-16 |
Family
ID=91031932
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/CN2023/130106 WO2024099295A1 (en) | 2022-11-11 | 2023-11-07 | Novel multi-specific antibodies and uses thereof |
Country Status (1)
Country | Link |
---|---|
WO (1) | WO2024099295A1 (en) |
-
2023
- 2023-11-07 WO PCT/CN2023/130106 patent/WO2024099295A1/en unknown
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20230192850A1 (en) | Novel anti-cd3epsilon antibodies | |
WO2019179391A1 (en) | Novel bispecific pd-1/ctla-4 antibody molecules | |
WO2019179388A1 (en) | Novel anti-ctla-4 antibody polypeptide | |
WO2019179434A1 (en) | Novel bispecific pd-1/cd47 antibody molecules | |
WO2019179390A1 (en) | Novel bispecific pd-1/egfr antibody molecules | |
WO2019179422A1 (en) | Novel bispecific pd-1/lag-3 antibody molecules | |
WO2020192709A1 (en) | Novel bispecific polypeptide complexes | |
KR20230110546A (en) | bifunctional molecule | |
WO2019179420A1 (en) | Novel anti-tim-3 antibodies | |
WO2024099295A1 (en) | Novel multi-specific antibodies and uses thereof | |
WO2022237820A1 (en) | Novel anti-cd276 antibodies and the uses thereof | |
WO2019179421A1 (en) | Novel bispecific pd-1/ctla-4 antibody molecules | |
US20240052052A1 (en) | Novel anti-cd24 antibodies | |
TW202342514A (en) | Novel anti-cd276 antibodies and the uses thereof | |
US20230203159A1 (en) | Novel anti-cd3epsilon antibodies | |
TW202317618A (en) | Novel anti-cd276 antibodies and the uses thereof | |
WO2023236891A1 (en) | Novel anti-lilrb4 antibodies and uses thereof | |
TW202313699A (en) | Novel anti-sirpa antibodies | |
KR20240039005A (en) | Novel multi-specific molecules | |
TW202348630A (en) | Novel anti-cd3 antibodies and uses thereof |