WO2022125355A1 - Compositions for increasing half-life of a therapeutic agent in livestock animals and methods of use - Google Patents
Compositions for increasing half-life of a therapeutic agent in livestock animals and methods of use Download PDFInfo
- Publication number
- WO2022125355A1 WO2022125355A1 PCT/US2021/061409 US2021061409W WO2022125355A1 WO 2022125355 A1 WO2022125355 A1 WO 2022125355A1 US 2021061409 W US2021061409 W US 2021061409W WO 2022125355 A1 WO2022125355 A1 WO 2022125355A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- amino acid
- wild type
- corresponds
- livestock animal
- group
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/10—Immunoglobulins specific features characterized by their source of isolation or production
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/569—Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/72—Increased effector function due to an Fc-modification
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A40/00—Adaptation technologies in agriculture, forestry, livestock or agroalimentary production
- Y02A40/70—Adaptation technologies in agriculture, forestry, livestock or agroalimentary production in livestock or poultry
Definitions
- This disclosure relates generally to polypeptides (e.g., fusion polypeptides such as polypeptide-Fc region fusions; or binding molecules such as antibodies or ligand-binding portions of receptor-Fc fusions) that have increased half-life in livestock animals compared to their wild type counterparts.
- polypeptides e.g., fusion polypeptides such as polypeptide-Fc region fusions; or binding molecules such as antibodies or ligand-binding portions of receptor-Fc fusions
- the Fc region of antibodies plays a number of functional roles, including, but not limited to, protecting the antibody from degradation through the lysosomal pathway and mediating antibody effector functions.
- the increasing use of antibodies as therapeutic agents in livestock animals there has been an enhanced focus on not just selecting an optimal Fab, but also combining it with an appropriate Fc for desired half-life and effector functions.
- polypeptide therapeutics e.g., antibodies
- This disclosure remedies that failing by providing Fc region variants that improve the serum persistence of polypeptides (e.g., antibodies) in livestock animals.
- Fc e.g., IgG Fc region variant
- This disclosure features polypeptides that have increased binding to FcRn of livestock animals than control polypeptides (e.g., the wild type counterpart IgG Fc regions). In some instances, these polypeptides have increased binding to FcRn livestock animals when compared to control polypeptides at pH 5.5, pH 6.0 and/or pH 6.5.
- these polypeptides can, e.g., bind to FcRn of livestock animals at a higher level at acidic pH (e.g., pH 5.5, pH 6.0 or pH 6.5) than at a neutral pH (e.g., pH 7.0, 7.1, 7.2, 7.3, 7.4, or 7.5). In some instances, these polypeptides bind to FcRn of livestock animals at a higher level at pH 5.5 and/or 6.0 than at pH 7.4. This disclosure relates, in part, to polypeptides that have increased half-life in livestock animals than their wild type counterparts.
- binding molecules e.g., antibodies or ligand-binding portions of receptors
- binding molecules e.g., antibodies or ligand-binding portions of receptors
- enzyme-Fc region fusions, ligand-Fc region fusions, nanobody-Fc fusions, and peptide-Fc region fusions are also provided.
- the Fc regions in addition to having a substitution or substitutions (relative to the wild type Fc region of a livestock animal of the same species) that increase half-life, may also include other substitutions that, e.g., increase effector function, decrease effector function, increase binding to Protein A and/or decrease heterogeneity of the polypeptide (e.g., by removing one or more post-translational modifications in the Fc region).
- the Fc region sequences of livestock animals can be from any antibody of the livestock animal. In some instances, the Fc region sequences of the livestock animal are from an IgG, subclasses of which are described elsewhere herein.
- the disclosure features a recombinant protein comprising (1) a binding domain, or a fragment thereof, that specifically binds to a ligand, or an epitope of a protein, wherein the binding domain is attached to (2) a domain comprising an Fc region (CH2+ CH3 region) of a livestock animal, or an FcRn binding region thereof, as disclosed herein.
- the binding domain comprises (i) the six complementarity determining regions (CDRs), for example, of a livestock animal or human/humanized antibody; (ii) a nanobody; (iii] a soluble receptor-binding domain that binds a ligand, or a ligand-binding fragment thereof and (iv) an extracellular domain of a livestock animal receptor protein.
- CDRs complementarity determining regions
- the disclosure also provides a composition
- a composition comprising: (1) a first polypeptide comprising a first Fc region (e.g., a CH2 domain, a CH3 domain, a CH2+ CH3 domain) comprising a livestock animal IgG Fc region variant described herein; and (2) a second polypeptide comprising a second Fc region comprising a livestock animal IgG Fc region variant described herein.
- the first and second polypeptide can be associated through the first and second Fc regions.
- the amino acid sequences of the first and second Fc regions are the same.
- the amino acid sequences of the first and second Fc regions are different (e.g., by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 amino acids).
- the Fc region variant is an Fc variant of a porcine IgG selected from the group consisting of IgGla, IgGlb, IgG2a, IgG2b, IgG3, IgG4a, IgG4b, IgG5a, IgG5b, IgG6a and IgG6b.
- the Fc region variant is an Fc variant of a bovine IgG selected from the group consisting of IgGl, IgG2 and IgG3.
- the Fc region variant is an Fc variant of an equine IgG selected from the group consisting of IgGl, IgG2, IgG3, IgG4, IgG5, IgG6 and IgG7.
- the Fc region variant is an Fc variant of an ovine IgG selected from the group consisting of IgGl, IgG2 and IgG3.
- the Fc region variant is an Fc variant of a caprine IgG selected from the group consisting of IgGl, IgG2 and IgG3.
- a fusion molecule comprising a livestock animal IgG Fc region variant disclosed herein and a polypeptide.
- the livestock animal IgG Fc region variant is covalently attached to the polypeptide (e.g., through a hinge region or a linker).
- the polypeptide is a ligand binding domain of a livestock animal receptor protein, an extracellular domain of a livestock animal receptor protein, or an antigen-binding domain.
- the polypeptide is selected from the ligand binding domain or extracellular domain of an IL-13Ral, or IL-13Ra2, a livestock animal erythropoietin (EPO), a livestock animal CTLA4, a livestock animal LFA3, a livestock animal VEGFR1/VEGFR3, a livestock animal IL-1R, a livestock animal GLP-1 receptor agonist, and a livestock animal thrombopoietin binding peptide.
- the polypeptide is an scFv, a nanobody, or single domain antibody.
- the IgG Fc region variant is a variant of a livestock animal IgGla antibody Fc region.
- the IgG Fc region variant is a variant of a livestock animal IgGlb antibody Fc region.
- the IgG Fc region variant is a variant of a livestock animal IgG2 antibody Fc region.
- the disclosure provides a polypeptide comprising an IgGFc region variant of a livestock animal, or an FcRn-binding region thereof, wherein the polypeptide comprises an amino acid substitution at at least one position selected from the group consisting of:
- (ix) a position that corresponds to amino acid position 428 of a wild type IgG of the livestock animal, wherein the amino acid substitution is selected from the group consisting of M428L, M428Y, M428F, H428L, H428Y and H428F;
- the livestock animal is a porcine.
- the polypeptide comprises an amino acid substitution at at least one position selected from the group consisting of:
- (ix) a position that corresponds to amino acid position 428 of a wild type IgG of the livestock animal, wherein the amino acid substitution is selected from the group consisting of M428L, M428Y, M428F, H428L, H428Y and H428F;
- (x) a position that corresponds to amino acid position 434 of a wild type IgG of the livestock animal, wherein the amino acid substitution is selected from the group consisting of N434A, N434H, N434F, N434S, N434W, N434Y, H434A, H434F, H434S, H434W and H434Y; and
- (xi) a position that corresponds to amino acid position 436 of a wild type IgG of the livestock animal, wherein the amino acid substitution is selected from the group consisting of Y436H and T436H.
- the polypeptide comprises an amino acid substitution at at least one position selected from the group consisting of:
- the wild type IgG Fc is a porcine IgG Fc comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 1 to 11.
- the livestock animal is a bovine.
- the polypeptide comprises an amino acid substitution at at least one position selected from the group consisting of:
- (ix) a position that corresponds to amino acid position 434 of a wild type IgG of the livestock animal, wherein the amino acid substitution is selected from the group consisting of N434A, N434H, N434F, N434S, N434W and N434Y; and
- (x) a position that corresponds to amino acid position 436 of a wild type IgG of the livestock animal, wherein the amino acid substitution is Y436H.
- the polypeptide comprises an amino acid substitution at at least one position selected from the group consisting of:
- the wild type IgG Fc is a bovine IgG Fc comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 12 to 14.
- the livestock animal is an equine.
- the polypeptide comprises an amino acid substitution at at least one position selected from the group consisting of:
- (x) a position that corresponds to amino acid position 434 of a wild type IgG of the livestock animal, wherein the amino acid substitution is selected from the group consisting of N434A, N434H, N434F, N434S, N434W, N434Y, H434A, H434F, H434S, H434W and H434Y; and
- (xi) a position that corresponds to amino acid position 436 of a wild type IgG of the livestock animal, wherein the amino acid substitution is selected from the group consisting of Y436H, F436H and V436H.
- the polypeptide comprises an amino acid substitution at at least one position selected from the group consisting of:
- the wild type IgG Fc is an equine IgG Fc comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 15 to 21.
- the livestock animal is an ovine.
- the polypeptide comprises an amino acid substitution at at least one position selected from the group consisting of:
- the wild type IgG Fc is an ovine IgG Fc comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 22 to 24.
- the polypeptide comprises an amino acid substitution at at least one position selected from the group consisting of:
- the wild type IgG Fc is an ovine IgG Fc comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 22 to 24.
- the livestock animal is a caprine.
- the polypeptide comprises an amino acid substitution at at least one position selected from the group consisting of: (i) a position that corresponds to amino acid position 250 of a wild type IgG of the livestock animal, wherein the amino acid substitution is selected from the group consisting of S250Q, S250E, T250Q and T250E;
- the wild type IgG Fc is a caprine IgG Fc comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 25 to 27.
- the polypeptide comprises at two or more of the at least one amino acid substitutions, wherein the two or more amino acid substitutions are at different positions, and wherein the polypeptide has increased binding affinity to an FcRn of the livestock animal when compared to (a) an Fc domain of the wild type IgG of the livestock animal, and (b) a polypeptide comprising only one of the two or more amino acid substitutions.
- the polypeptide further comprises a binding domain.
- the binding domain comprises (i) six complementarity determining regions (CDRs) of an immunoglobulin molecule; (ii) a ligand binding domain of a receptor protein of the livestock animal, (iii) a nanobody, or (iv) an extracellular domain of a receptor protein of the livestock animal.
- the binding domain specifically binds to an antigen selected from the group consisting of NGF, TrKA, AD AMTS, IL-1, IL-2, IL-4, IL-4R, Angiotensin type 1 (ATI) receptor, Angiotensin type 2 (AT2) receptor, IL-5, IL-12, IL-13, IL-31, IL-33, CD3, CD20, CD47, CD52, and complement system complex.
- an antigen selected from the group consisting of NGF, TrKA, AD AMTS, IL-1, IL-2, IL-4, IL-4R, Angiotensin type 1 (ATI) receptor, Angiotensin type 2 (AT2) receptor, IL-5, IL-12, IL-13, IL-31, IL-33, CD3, CD20, CD47, CD52, and complement system complex.
- a specific binding between a binding domain (e.g., a binding domain of an antibody) and an antigen is represented by a KD value.
- KD is the ratio of the antibody dissociation rate (k O ff) to the antibody association rate (k on ) of the antibody.
- the KD values can be determined by measuring the k on and k off rates of a specific antibody/antigen interaction and then using a ratio of these values to calculate the KD value. The smaller the KD value the greater the affinity of the antibody (or a binding domain thereof) for its target.
- the KD value for a specific binding ranges from about 10' 6 to about 10' 12 (e.g., 10' 6 , 10' 7 , 10' 8 , 10' 9 , IO' 10 , 10' 11 , or 10' 12 ).
- the polypeptide further comprises a protein selected from the group consisting of EPO, CTLA4, LFA3, VEGFR1/VEGFR3, IL-1R, IL-4R, GLP-1 receptor agonist, and Thrombopoietin binding peptide.
- the polypeptide binds to an FcRn of the livestock animal at a higher level at an acidic pH than at a neutral pH.
- the polypeptide binds to an FcRn of the livestock animal at a higher level at pH 5.5 than at pH 7.4.
- the polypeptide binds to an FcRn of the livestock animal at a higher level at pH 6.0 than at pH 7.4.
- composition comprising (i) the polypeptide as described herein, and (ii) a pharmaceutically acceptable excipient.
- the present disclosure also extends to a nucleic acid or nucleic acids encoding the polypeptide as described herein.
- an expression vector or expression vectors comprising the nucleic acid or nucleic acids as described herein.
- the present disclosure also extends to a host cell comprising the nucleic acid or nucleic acids disclosed herein or the expression vector or expression vectors disclosed herein.
- Also disclosed herein is a method of making a polypeptide, the method comprising:
- the method further comprises formulating the polypeptide as a pharmaceutical formulation.
- the present disclosure also extends to a method of treating a disease or disorder in a livestock animal in need thereof, the method comprising administering an effective amount of a composition comprising the pharmaceutical composition as disclosed herein to the livestock animal.
- the present disclosure also extends to a method of preventing a disease or disorder in a livestock animal in need thereof, the method comprising administering an effective amount of a composition comprising the pharmaceutical composition as disclosed herein to the livestock animal.
- the disease or disorder is an allergy, chronic pain, acute pain, an inflammatory disease, an autoimmune disease, an endocrine disease, a gastrointestinal disease, a cardiovascular disease, a renal disease, a fertility related disorder, an infectious disease or a cancer.
- the disease or disorder is atopic dermatitis, allergic dermatitis, osteoarthritic pain, arthritis, anemia, or obesity.
- FIG. 1 shows the alignment of the amino acid sequences of the wild-type Fc regions of porcine IgGla, ovine IgGl, bovine IgGl, equine IgGl, feline IgGla, canine IgGB and human IgGl. These sequences are assigned SEQ ID NOs.: 30-36, respectively.
- FIGs. 2A-2J show the purity of the porcine antibodies with the Fc variants determined by scanning densitometry of coomassie blue-stained SDS/PAGE gels. The purity of each antibody was >90%.
- FIGs. 3A-3J show the purity of the ovine antibodies with the Fc variants determined by scanning densitometry of coomassie blue-stained SDS/PAGE gels. The purity of each antibody was >90%.
- FIGs. 4A-4J show the purity of the bovine antibodies with the Fc variants determined by scanning densitometry of coomassie blue-stained SDS/PAGE gels. The purity of each antibody was >90%.
- FIGs. 5A-5J show the purity of the equine antibodies with the Fc variants determined by scanning densitometry of coomassie blue-stained SDS/PAGE gels. The purity of each antibody was >90%.
- FIGs. 6A-6J show the sensograms of kinetic binding data for the porcine IgG variants and wild-type.
- FIGs. 7A-7J show the sensograms of kinetic binding data for the ovine IgG variants and wild-type.
- FIGs. 8A-8J show the sensograms of kinetic binding data for the bovine IgG variants and wild-type.
- FIGs. 9A-9J show the sensograms of kinetic binding data for the equine IgG variants and wild-type.
- polypeptide e.g., antibodies, ligand-binding domains of receptors, enzymes, ligands, peptides
- polypeptides e.g., antibodies, ligand-binding domains of receptors, enzymes, ligands, peptides
- this disclosure features immunoglobulin Fc regions of livestock animals or FcRn-binding regions thereof comprising mutations that enhance the half-life of the polypeptide or polypeptides comprising these sequences in the livestock animal. Also disclosed are polypeptides comprising these domains and methods of their use. These peptides can be used for various therapeutic and diagnostic purposes.
- Pigs typically have eleven IgG heavy chains referred to as IgGla, IgGlb, IgG2a, IgG2b, IgG3, IgG4a, IgG4b, IgG5a, IgG5b, IgG6a and IgG6b. These heavy chains represent eleven different subclasses of porcine IgG. The amino acid and DNA sequences for these heavy chains are available from the GENBANK database.
- IgGla GenBank AAA52219.1
- IgG3 (GenBank AB Y85810.1)
- IgG4a GenBank AAA52220.1
- IgG4b (GenBank AB Y85806.1)
- GQTREPQVYTLPPPTEELSRSKVTLTCLVTGFYPPDIDVEWQRNGQPEPEGNYRT TPPQQDVDGTYFLYSKLAVDKASWQRGDTFQCAVMHEALHNHYT (SEQ ID NO: 7)
- IgG5a GenBank ABY85809.1
- IgG5b GenBank AB699687
- IgG6a GenBank AB699687
- IgG6b (GenBank AB Y85805.1) NO: 11)
- the CH2 region of a porcine antibody comprises or consists of amino acids 231 to 340 (according to EU numbering) of a porcine IgG antibody. It is to be understood that the CH2 region may include one to six (e.g., 1, 2, 3, 4, 5, 6) additional amino acids or deletions at their N and/or C-terminus.
- the CH3 region of a porcine antibody comprises or consists of amino acids 341 to 447 (according to EU numbering) of a porcine IgG antibody. It is to be understood that the CH3 region may include one to six (e.g., 1, 2, 3, 4, 5, 6) additional amino acids or deletions at their N and/or C-terminus.
- the Fc region of a porcine IgG antibody comprises or consists of amino acids 231 to 447 (according to EU numbering) of a porcine IgG antibody.
- Table 1 compares the amino acid sequences of the CH2 and CH3 domains of human IgGl, canine IgGB and feline IgGla with each of the eleven porcine IgG isotypes, based on EU numbering: Table 1:
- Increased serum persistence is a beneficial property for therapeutic polypeptides.
- This disclosure features substitutions in wild type porcine IgGla, IgGlb, IgG2a, IgG2b, IgG3, IgG4a, IgG4b, IgG5a, IgG5b, IgG6a and IgG6b Fc regions that enhance the half-life of a polypeptide or polypeptides comprising these Fc regions in a pig relative to a control polypeptide or control polypeptides, wherein the control polypeptide or control polypeptides are identical to the polypeptide or polypeptides except for having the corresponding wild type porcine IgG Fc region in place of the IgG Fc region variant.
- the substitutions to increase half-life may be made in one or more of a porcine CH2 region, a porcine CH3 region, or in the context of a porcine Fc (e.g., a CH2+CH3) region.
- the present disclosure provides a polypeptide comprising a porcine IgG Fc region variant, or a porcine FcRn-binding region thereof, wherein the polypeptide comprises an amino acid substitution at at least one (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or 11) position selected from the group consisting of
- (ix) a position that corresponds to amino acid position 428 of a wild type porcine IgG, wherein the amino acid substitution is selected from the group consisting of M428L, M428Y, M428F, H428L, H428Y and H428F;
- (x) a position that corresponds to amino acid position 434 of a wild type porcine IgG, wherein the amino acid substitution is selected from the group consisting of N434A, N434H, N434F, N434S, N434W, N434Y, H434A, H434F, H434S, H434W and H434Y; and
- (xi) a position that corresponds to amino acid position 436 of a wild type porcine IgG, wherein the amino acid substitution is selected from the group consisting of Y436H and T436H. wherein the amino acid positions are based on EU numbering, and wherein the polypeptide has increased binding affinity to bovine FcRn when compared to an Fc domain of the wild type porcine IgG.
- the polypeptide comprises an amino acid substitution at at least one (e.g., 1, 2, 3, 4, 5, 6, or 7) position selected from the group consisting of:
- the polypeptide has increased binding affinity to porcine FcRn at a pH of about 5.0 to about 6.5 (e.g., about 5.5 or about 6.0) when compared to an Fc domain of the wild type porcine IgG at the same pH.
- the polypeptide comprises an amino acid sequence that is at least 80% (e.g., at least 85%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99%) identical to an amino acid sequence selected from the group consisting of SEQ ID NOs: 1 to 11.
- porcine IgG CH2 domain variant comprising an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to the CH2 domains shown in any one of SEQ ID NOs.: l to 11.
- porcine IgG CH2 domain variants comprising an amino acid sequence that varies from any one of the CH2 domains shown in SEQ ID NOs.: l to 11 by 1 to 15 (e.g., by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15) amino acids.
- this disclosure features a porcine IgG CH3 domain variant comprising an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97% or at least 98% or at least 99%, identical to the amino acid sequence of the CH3 domain shown in any one of SEQ ID NOs. : 1 to 11. Also featured are porcine IgG CH3 domain variants comprising an amino acid sequence that varies from any one of the CH3 domain sequences shown in any one of SEQ ID NOs. : 1 to 11 by 1 to 15 (e.g., by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15) amino acids.
- porcine IgG Fc region variant comprising an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to the amino acid sequence set forth in any one of SEQ ID NOs.: l to 11. Also disclosed are porcine IgG Fc region variants comprising an amino acid sequence that varies from any one of SEQ ID NOs.:l to 11 by 1 to 20 (e.g., by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20) amino acids.
- a polypeptide or polypeptides comprising a porcine IgG Fc CH2 domain variant, the CH2 domain variant comprising an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, identical to the amino acid sequence of the CH2 domain shown in any one of SEQ ID NOs. : 1 to 11.
- a polypeptide or polypeptides comprising a porcine IgG Fc CH3 domain variant, the CH3 domain variant comprising an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to the amino acid sequence of the CH3 domain shown in any one of SEQ ID NOs. : 1 to 11.
- a polypeptide or polypeptides comprising a porcine IgG Fc region variant, the Fc region variant comprising an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to the amino acid sequence set forth in any one of SEQ ID NOs. : 1 to 11.
- Bovine typically have three IgG heavy chains referred to as IgGl, IgG2, and IgG3. These heavy chains represent three different subclasses of bovine IgG.
- the amino acid and DNA sequences for these heavy chains are available from the GENBANK database. Illustrative examples of the amino acid sequences of the CH2 and CH3 domains of each of the three bovine IgG heavy chain Fc regions are shown below (CH2 domains are underlined), and the GenBank accession number (for the amino acid sequence or mRNA sequence from which the amino acid sequence is derived) of each heavy chain Fc region is indicated:
- IgGl (GenBank ABE68619.1) (SEQ ID NO: 12)
- IgG2 GenBank AQT27057.1
- GK SEQ ID NO: 13
- IgG3 (GenBank AAC48761.1) (SEQ ID NO: 14)
- the CH2 region of a bovine antibody comprises or consists of amino acids 231 to 340 (according to EU numbering) of a bovine IgG antibody. It is to be understood that the CH2 region may include one to six (e.g., 1, 2, 3, 4, 5, 6) additional amino acids or deletions at their N and/or C-terminus.
- the CH3 region of a bovine antibody comprises or consists of amino acids 341 to 447 (according to EU numbering) of a bovine IgG antibody. It is to be understood that the CH3 region may include one to six (e.g., 1, 2, 3, 4, 5, 6) additional amino acids or deletions at their N and/or C-terminus.
- the Fc region of a bovine IgG antibody comprises or consists of amino acids 231 to 447 (according to EU numbering) of a bovine IgG antibody.
- Table 2 compares the amino acid sequences of the CH2 and CH3 domains of human IgGl, canine IgGB and feline IgGla with each of the three bovine IgG isotypes, based on EU numbering:
- Increased serum persistence is a beneficial property for therapeutic polypeptides.
- This disclosure features substitutions in wild type bovine IgGl, IgG2 and IgG3 Fc regions that enhance the half-life of a polypeptide or polypeptides comprising these Fc regions in a bovine relative to a control polypeptide or control polypeptides, wherein the control polypeptide or control polypeptides are identical to the polypeptide or polypeptides except for having the corresponding wild type bovine IgG Fc region in place of the IgG Fc region variant.
- substitutions to increase half-life may be made in one or more of a bovine CH2 domain, a bovine CH3 domain, or in the context of a bovine Fc (e.g., a CH2+CH3) region.
- the present disclosure provides a polypeptide comprising a bovine IgG Fc region variant, or a bovine FcRn-binding region thereof, wherein the polypeptide comprises an amino acid substitution at at least one (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or 11) position selected from the group consisting of
- (x) a position that corresponds to amino acid position 436 of a wild type bovine IgG, wherein the amino acid substitution is Y436H, wherein the amino acid positions are based on EU numbering, and wherein the polypeptide has increased binding affinity to bovine FcRn when compared to an Fc domain of the wild type bovine IgG.
- the polypeptide comprises an amino acid substitution at at least one (e.g., 1, 2, 3, 4, or 5) position selected from the group consisting of:
- the polypeptide has increased binding affinity to bovine FcRn at a pH of about 5.0 to about 6.5 (e.g., about 5.5 or about 6.0) when compared to an Fc domain of the wild type bovine IgG at the same pH.
- the polypeptide comprises an amino acid sequence that is at least 80% (e.g., at least 85%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99%) identical to an amino acid sequence selected from the group consisting of SEQ ID NOs: 12 to 14.
- this disclosure provides a bovine IgG CH2 domain variant comprising an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to the CH2 domains shown in any one of SEQ ID NOs. : 12 to 14. Also provided are bovine IgG CH2 domain variants comprising an amino acid sequence that varies from any one of the CH2 domains shown in SEQ ID NOs.: 12 to 14 by 1 to 15 (e.g., by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15) amino acids.
- this disclosure features a bovine IgG CH3 domain variant comprising an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97% or at least 98% or at least 99%, identical to the amino acid sequence of the CH3 domain shown in any one of SEQ ID NOs.: 12 to 14. Also featured are bovine IgG CH3 domain variants comprising an amino acid sequence that varies from any one of the CH3 domain sequences shown in any one of SEQ ID NOs.: 12 to 14 by 1 to 15 (e.g., by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15) amino acids.
- this disclosure features a bovine IgG Fc region variant comprising an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to the amino acid sequence set forth in any one of SEQ ID NOs.: 12 to 14. Also disclosed are bovine IgGFc region variants comprising an amino acid sequence that varies from any one of SEQ ID NOs : 12 to 14 by 1 to 20 (e.g., by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20) amino acids.
- a polypeptide or polypeptides comprising a bovine IgG Fc CH2 domain variant, the CH2 domain variant comprising an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, identical to the amino acid sequence of the CH2 domain shown in any one of SEQ ID NOs. : 12 to 14.
- a polypeptide or polypeptides comprising a bovine IgG Fc CH3 domain variant, the CH3 domain variant comprising an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to the amino acid sequence of the CH3 domain shown in any one of SEQ ID NOs.: 12 to 14.
- a polypeptide or polypeptides comprising a bovine IgG Fc region variant, the Fc region variant comprising an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to the amino acid sequence set forth in any one of SEQ ID NOs. : 12 to 14.
- Equine typically have seven IgG heavy chains referred to as IgGl, IgG2, IgG3, IgG4, IgG5, IgG6 and IgG7. These heavy chains represent seven different subclasses of equine IgG.
- the amino acid and DNA sequences for these heavy chains are available from the GENBANK database. Illustrative examples of the amino acid sequences of the CH2 and CH3 domains of each of the seven equine IgG heavy chain Fc regions are shown below (CH2 domains are underlined), and the GenBank accession number (for the amino acid sequence or mRNA sequence from which the amino acid sequence is derived) of each heavy chain Fc region is indicated:
- IgG2 (GenBank CAC44761.1) NO: 16)
- IgG4 GenBank AAS18415.1
- IgG6 GenBank CAC86341.1
- K SEQ ID NO:20
- IgG7 (GenBank AAS18414.1) K (SEQ ID NO:21)
- the CH2 region of an equine antibody comprises or consists of amino acids
- the CH2 region may include one to six (e.g., 1, 2, 3, 4, 5, 6) additional amino acids or deletions at their N and/or C-terminus.
- the CH3 region of an equine antibody comprises or consists of amino acids
- the CH3 region may include one to six (e.g., 1, 2, 3, 4, 5, 6) additional amino acids or deletions at their N and/or C-terminus.
- the Fc region of an equine IgG antibody comprises or consists of amino acids 231 to 447 (according to EU numbering) of an equine IgG antibody.
- Table 3 compares the amino acid sequences of the CH2 and CH3 domains of human IgGl, canine IgGB and feline IgGla with each of the seven equine IgG isotypes, based on EU numbering:
- Increased serum persistence is a beneficial property for therapeutic polypeptides.
- This disclosure features substitutions in wild type equine IgGl, IgG2, IgG3, IgG4, IgG5, IgG6 and IgG7 Fc regions that enhance the half-life of a polypeptide or polypeptides comprising these Fc regions in an equine relative to a control polypeptide or control polypeptides, wherein the control polypeptide or control polypeptides are identical to the polypeptide or polypeptides except for having the corresponding wild type equine IgG Fc region in place of the IgG Fc region variant.
- the substitutions to increase half-life may be made in one or more of an equine CH2 domain, an equine CH3 domain, or in the context of an equine Fc (e.g., a CH2+CH3) region.
- the present disclosure provides a polypeptide comprising an equine IgGFc region variant, or an equine FcRn-binding region thereof, wherein the polypeptide comprises an amino acid substitution at at least one (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or 11) position selected from the group consisting of
- (x) a position that corresponds to amino acid position 434 of a wild type equine IgG, wherein the amino acid substitution is selected from the group consisting of N434A, N434H, N434F, N434S, N434W, N434Y, H434A, H434F, H434S, H434W and H434Y; and
- (xi) a position that corresponds to amino acid position 436 of a wild type equine IgG, wherein the amino acid substitution is selected from the group consisting of Y436H, F436H and V436H, wherein the amino acid positions are based on EU numbering, and wherein the polypeptide has increased binding affinity to equine FcRn when compared to an Fc domain of the wild type equine IgG.
- the polypeptide comprises an amino acid substitution at at least one (e.g., 1, 2, 3, 4, 5, or 6) position selected from the group consisting of:
- the polypeptide has increased binding affinity to equine FcRn at a pH of about 5.0 to about 6.5 (e.g., about 5.5 or about 6.0) when compared to an Fc domain of the wild type equine IgG at the same pH.
- the polypeptide comprises an amino acid sequence that is at least 80% (e.g., at least 85%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99%) identical to an amino acid sequence selected from the group consisting of SEQ ID NOs: 15 to 21.
- this disclosure provides an equine IgG CH2 domain variant comprising an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to the CH2 domains shown in any one of SEQ ID NOs.: 15 to 21. Also provided are equine IgG CH2 domain variants comprising an amino acid sequence that varies from any one of the CH2 domains shown in SEQ ID NOs.: 15 to 21 by 1 to 15 (e.g., by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15) amino acids.
- this disclosure features an equine IgG CH3 domain variant comprising an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97% or at least 98% or at least 99%, identical to the amino acid sequence of the CH3 domain shown in any one of SEQ ID NOs.: 15 to 21. Also featured are equine IgG CH3 domain variants comprising an amino acid sequence that varies from any one of the CH3 domain sequences shown in any one of SEQ ID NOs.: 15 to 21 by 1 to 15 (e.g., by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15) amino acids.
- this disclosure features an equine IgG Fc region variant comprising an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to the amino acid sequence set forth in any one of SEQ ID NOs.:15 to 21. Also disclosed are equine IgG Fc region variants comprising an amino acid sequence that varies from any one of SEQ ID NOs.:15 to 21 by 1 to 20 (e.g., by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20) amino acids.
- a polypeptide or polypeptides comprising an equine IgG Fc CH2 domain variant, the CH2 domain variant comprising an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, identical to the amino acid sequence of the CH2 domain shown in any one of SEQ ID NOs.: 15 to 21.
- a polypeptide or polypeptides comprising an equine IgG Fc CH3 domain variant, the CH3 domain variant comprising an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to the amino acid sequence of the CH3 domain shown in any one of SEQ ID NOs.: 15 to 21.
- Ovine typically have three IgG heavy chains referred to as IgGl, IgG2 and IgG3. These heavy chains represent three different subclasses of ovine IgG.
- the amino acid and DNA sequences for these heavy chains are available from the GENBANK database. Illustrative examples of the amino acid sequences of the CH2 and CH3 domains of each of the three ovine IgG heavy chain Fc regions are shown below (CH2 domains are underlined), and the GenBank accession number (for the amino acid sequence or mRNA sequence from which the amino acid sequence is derived) of each heavy chain Fc region is indicated:
- IgGl (Genbank X69797) K (SEQ ID NO:22)
- IgG2 (Genbank X70983) (SEQ ID NO:23)
- the CH2 region of an ovine antibody comprises or consists of amino acids 231 to 340 (according to EU numbering) of an ovine IgG antibody. It is to be understood that the CH2 region may include one to six (e.g., 1, 2, 3, 4, 5, 6) additional amino acids or deletions at their N and/or C-terminus.
- the CH3 region of an ovine antibody comprises or consists of amino acids 341 to 447 (according to EU numbering) of an ovine IgG antibody. It is to be understood that the CH3 region may include one to six (e.g., 1, 2, 3, 4, 5, 6) additional amino acids or deletions at their N and/or C-terminus.
- the Fc region of an ovine IgG antibody comprises or consists of amino acids 231 to 447 (according to EU numbering) of an ovine IgG antibody.
- Table 4 compares the amino acid sequences of the CH2 and CH3 domains of human IgGl, canine IgGB and feline IgGla with each of the three ovine IgG isotypes, based on EU numbering:
- Increased serum persistence is a beneficial property for therapeutic polypeptides.
- This disclosure features substitutions in wild type ovine IgGl, IgG2 and IgG3 Fc regions that enhance the half-life of a polypeptide or polypeptides comprising these Fc regions in an ovine relative to a control polypeptide or control polypeptides, wherein the control polypeptide or control polypeptides are identical to the polypeptide or polypeptides except for having the corresponding wild type ovine IgG Fc region in place of the IgG Fc region variant.
- the substitutions to increase half-life may be made in one or more of an ovine CH2 domain, an ovine CH3 domain, or in the context of an ovine Fc (e.g., a CH2+CH3) region.
- the present disclosure provides a polypeptide comprising an ovine IgG Fc region variant, or an ovine FcRn-binding region thereof, wherein the polypeptide comprises an amino acid substitution at at least one (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or 11) position selected from the group consisting of
- (x) a position that corresponds to amino acid position 434 of a wild type ovine IgG, wherein the amino acid substitution is selected from the group consisting of N434A, N434H, N434F, N434S, N434W and N434Y; and
- (xi) a position that corresponds to amino acid position 436 of a wild type ovine IgG, wherein the amino acid substitution is Y436H, wherein the amino acid positions are based on EU numbering, and wherein the polypeptide has increased binding affinity to ovine FcRn when compared to an Fc domain of the wild type ovine IgG.
- the polypeptide comprises an amino acid substitution at at least one (e.g., 1, 2, 3, 4, or 5) position selected from the group consisting of:
- the polypeptide has increased binding affinity to ovine FcRn at a pH of about 5.0 to about 6.5 (e.g., about 5.5 or about 6.0) when compared to an Fc domain of the wild type ovine IgG at the same pH.
- the polypeptide comprises an amino acid sequence that is at least 80% (e.g., at least 85%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99%) identical to an amino acid sequence selected from the group consisting of SEQ ID NOs: 22 to 24.
- this disclosure provides an ovine IgG CH2 domain variant comprising an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to the CH2 domains shown in any one of SEQ ID NOs.:22 to 24. Also provided are ovine IgG CH2 domain variants comprising an amino acid sequence that varies from any one of the CH2 domains shown in SEQ ID NOs.:22 to 24 by 1 to 15 (e.g., by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15) amino acids.
- this disclosure features an ovine IgG CH3 domain variant comprising an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97% or at least 98% or at least 99%, identical to the amino acid sequence of the CH3 domain shown in any one of SEQ ID NOs.:22 to 24. Also featured are ovine IgG CH3 domain variants comprising an amino acid sequence that varies from any one of the CH3 domain sequences shown in any one of SEQ ID NOs.:22 to 24 by 1 to 15 (e.g., by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15) amino acids.
- this disclosure features an ovine IgG Fc region variant comprising an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to the amino acid sequence set forth in any one of SEQ ID NOs.:22 to 24. Also disclosed are ovine IgG Fc region variants comprising an amino acid sequence that varies from any one of SEQ ID NOs.:22 to 24 by 1 to 20 (e.g., by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20) amino acids.
- a polypeptide or polypeptides comprising an ovine IgG Fc CH2 domain variant, the CH2 domain variant comprising an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, identical to the amino acid sequence of the CH2 domain shown in any one of SEQ ID NOs.:22 to 24.
- a polypeptide or polypeptides comprising an ovine IgG Fc CH3 domain variant, the CH3 domain variant comprising an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to the amino acid sequence of the CH3 domain shown in any one of SEQ ID NOs.:22 to 24.
- featured are a polypeptide or polypeptides comprising an ovine IgG Fc region variant, the Fc region variant comprising an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to the amino acid sequence set forth in any one of SEQ ID NOs.:22 to 24.
- Caprine typically have three IgG heavy chains referred to as IgGl, IgG2 and IgG3. These heavy chains represent three different subclasses of caprine IgG.
- the amino acid and DNA sequences for these heavy chains are available from the GENBANK database. Illustrative examples of the amino acid sequences of the CH2 and CH3 domains of each of the three caprine IgG heavy chain Fc regions are shown below (CH2 domains are underlined): Goat Capra hircus
- IgG3 (Schwartz et al, 2018, Immunogenetics, 70:317) (SEQ ID NO:27)
- the CH2 region of a caprine antibody comprises or consists of amino acids
- the CH2 region may include one to six (e.g., 1, 2, 3, 4, 5, 6) additional amino acids or deletions at their N and/or C-terminus.
- the CH3 region of a caprine antibody comprises or consists of amino acids
- the CH3 region may include one to six (e.g., 1, 2, 3, 4, 5, 6) additional amino acids or deletions at their N and/or C-terminus.
- the Fc region of a caprine IgG antibody comprises or consists of amino acids 231 to 447 (according to EU numbering) of a caprine IgG antibody.
- Table 5 compares the amino acid sequences of the CH2 and CH3 domains of human IgGl, canine IgGB and feline IgGla with each of the three caprine IgG isotypes, based on EU numbering:
- Increased serum persistence is a beneficial property for therapeutic polypeptides.
- This disclosure features substitutions in wild type caprine IgGl, IgG2 and IgG3 Fc regions that enhance the half-life of a polypeptide or polypeptides comprising these Fc regions in a caprine relative to a control polypeptide or control polypeptides, wherein the control polypeptide or control polypeptides are identical to the polypeptide or polypeptides except for having the corresponding wild type caprine IgG Fc region in place of the IgG Fc region variant.
- the substitutions to increase half-life may be made in one or more of a caprine CH2 domain, a caprine CH3 domain, or in the context of a caprine Fc (e.g., a CH2+CH3) region.
- the present disclosure provides a polypeptide comprising a caprine IgG Fc region variant, or a caprine FcRn-binding region thereof, wherein the polypeptide comprises an amino acid substitution at at least one (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or 11) position selected from the group consisting of
- (x) a position that corresponds to amino acid position 434 of a wild type caprine IgG, wherein the amino acid substitution is selected from the group consisting of N434A, N434H, N434F, N434S, N434W and N434Y; and
- (xi) a position that corresponds to amino acid position 436 of a wild type caprine IgG, wherein the amino acid substitution is Y436H, wherein the amino acid positions are based on EU numbering, and wherein the polypeptide has increased binding affinity to caprine FcRn when compared to an Fc domain of the wild type caprine IgG.
- the polypeptide has increased binding affinity to caprine FcRn at a pH of about 5.0 to about 6.5 (e.g., about 5.5 or about 6.0) when compared to an Fc domain of the wild type caprine IgG at the same pH.
- the polypeptide comprises an amino acid sequence that is at least 80% (e.g., at least 85%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, or 99%) identical to an amino acid sequence selected from the group consisting of SEQ ID NOs: 25 to 27.
- this disclosure provides a caprine IgG CH2 domain variant comprising an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to the CH2 domains shown in any one of SEQ ID NOs.:25 to 27. Also provided are caprine IgG CH2 domain variants comprising an amino acid sequence that varies from any one of the CH2 domains shown in SEQ ID NOs.:25 to 27 by 1 to 15 (e.g., by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15) amino acids.
- this disclosure features a caprine IgG CH3 domain variant comprising an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97% or at least 98% or at least 99%, identical to the amino acid sequence of the CH3 domain shown in any one of SEQ ID NOs.:25 to 27. Also featured are caprine IgG CH3 domain variants comprising an amino acid sequence that varies from any one of the CH3 domain sequences shown in any one of SEQ ID NOs.:25 to 27 by 1 to 15 (e.g., by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15) amino acids.
- this disclosure features a caprine IgG Fc region variant comprising an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to the amino acid sequence set forth in any one of SEQ ID NOs.:25 to 27. Also disclosed are caprine IgG Fc region variants comprising an amino acid sequence that varies from any one of SEQ ID NOs.:25 to 27 by 1 to 20 (e.g., by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20) amino acids.
- a polypeptide or polypeptides comprising a caprine IgG Fc CH2 domain variant, the CH2 domain variant comprising an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, identical to the amino acid sequence of the CH2 domain shown in any one of SEQ ID NOs.:25 to 27.
- a polypeptide or polypeptides comprising a caprine IgG Fc CH3 domain variant, the CH3 domain variant comprising an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to the amino acid sequence of the CH3 domain shown in any one of SEQ ID NOs.:25 to 27.
- a polypeptide or polypeptides comprising a caprine IgG Fc region variant, the Fc region variant comprising an amino acid sequence that is at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to the amino acid sequence set forth in any one of SEQ ID NOs.:25 to 27.
- the present disclosure extends to a polypeptide or polypeptides in which the amino acid substitutions are made on either one or both of a CH2 domain and a CH3 domain.
- the substitutions on the CH2 domain and / or the CH3 domain are identical.
- the substitutions on the CH2 domain and / or the CH3 domain are not identical.
- the Fc region includes one or more additional substitutions that increase or decrease effector function and/or improve product heterogeneity.
- substitutions are introduced to a wild type IgG Fc region of the livestock animal to enhance binding to Protein A so as to facilitate purification by protein A chromatography.
- substitutions will be familiar to persons skilled in the art and may be at one or more (e.g., 1, 2, 3, 4, 5, 6, or 7) positions of the IgG.
- additional amino acid substitutions can be made to alter binding affinity to FcRn as compared to a parent polypeptide or a wild-type polypeptide (e.g., to increase or reduce binding affinity with FcRn).
- the polypeptide comprises a hinge region of an antibody of the livestock animal.
- modifications can be made to the hinge region of the antibody of the livestock animal to increase half-life. Such modifications will be known to persons skilled in the art.
- the disclosure encompasses any polypeptide that may benefit from having an increased half-life in a livestock animal.
- these polypeptides are designed to include an Fc region variant (e.g., a CH2 region, a CH3 region, a CH2+CH3 region) disclosed above.
- Exemplary polypeptides include, but are not limited to, whole antibodies, scFvs, nanobodies, ligand-binding portions of a receptor, cytokines, growth factors, enzymes, and peptides.
- a CH3 domain variant disclosed above may be attached to an scFv nanobody, ligand-binding portion of a receptor (e.g., the ligand-binding portion of IL-13Ral or IL-13Ra2), a cytokine, a growth factor, an enzyme, or a peptide.
- nanobody As used herein, the terms “nanobody”, “VHH”, “VHH antibody fragment” and “single domain antibody” are used interchangeably herein to denote the variable domain of the single heavy chain of antibodies of the type of those found in Camelidae, which are typically found in nature to lack light chains. Suitable nanobodies will be familiar to persons skilled in the art, illustrated examples of which include nanobodies of camels, dromedaries, llamas and alpacas. Alternatively, an Fc region variant disclosed above may be attached to these polypeptides. In another embodiment, an antibody from the livestock animal is modified to include an Fc region variant disclosed herein.
- the polypeptides of this disclosure include an antibody hinge region.
- the hinge region may be placed between the antigen or ligandbinding domain of the polypeptide and the Fc region variant.
- the hinge region is attached to the C-terminus of a cytokine, a growth factor, an enzyme, or a peptide and the hinge region is attached to the N-terminus of the Fc region variant. Suitable hinge region sequences will be familiar to persons skilled in the art.
- the hinge region if used, in a polypeptide of this disclosure may include zero to six (i.e., 0, 1, 2, 3, 4, 5, or 6) amino acid substitutions relative to an amino acid sequence of the native hinge region.
- the hinge region used in a recombinant protein of this disclosure is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to an amino acid sequence of the native hinge region.
- the polypeptide or polypeptides of this disclosure may comprise a binding domain.
- the binding domain can specifically bind to a protein, subunit, domain, motif, and/or epitope of a selected target described herein.
- the polypeptide or polypeptides e.g., fusion polypeptide
- the target e.g., for the target of the binding domain
- the therapeutic protein e.g., for the fusion polypeptide
- the target is selected from the group consisting of: 17-IA, 4-1BB, 4Dc, 6-keto-PGFla, 8-iso-PGF2a, 8- oxo-dG, Al Adenosine Receptor, A33, ACE, ACE-2, Activin, Activin A, Activin AB, Activin B, Activin C, Activin RIA, Activin RIA ALK-2, Activin RIB ALK-4, Activin RIIA, Activin RUB, ADAM, ADAM10, ADAM12, ADAM15, ADAM17/TACE, ADAMS, ADAM9, ADAMTS, ADAMTS4, ADAMTS5, Addressins, aFGF, ALCAM, ALK, ALK-1, ALK-7, alpha- 1 -antitrypsin, alpha-
- the binding domain specifically binds to one or more therapeutic targets or antigens in the livestock animal, such as, but are not limited to, ACE, ACE-2, Activin, Activin A, Activin AB, Activin B, Activin C, Activin RIA, Activin RIA ALK-2, Activin RIB ALK-4, Activin RUA, Activin RUB, ADAM, ADAM10, ADAM12, ADAM15, ADAM17/TACE, ADAMS, ADAM9, ADAMTS, ADAMTS4, ADAMTS5, ANG, Ang, Angiotensin type 1 (ATI) receptor, Angiotensin type 2 (AT2) receptor, Atrial natriuretic factor, av/b3 integrin, b-ECGF, CD19, CD20, CD30, CD34, CD40, CD40L, CD47, COX, CTLA-4, EGFR (ErbB-1), EPO, Follicle stimulating hormone
- the polypeptide or polypeptides can comprise a protein, wherein the protein is a therapeutic protein, e.g., EPO, CTLA4, LFA3, VEGFR1/VEGFR3, IL-1R, IL-4R, GLP-1 receptor agonist, or Thrombopoietin binding peptide.
- a therapeutic protein e.g., EPO, CTLA4, LFA3, VEGFR1/VEGFR3, IL-1R, IL-4R, GLP-1 receptor agonist, or Thrombopoietin binding peptide.
- the therapeutic protein is ACE, ACE-2, Activin, Activin A, Activin AB, Activin B, Activin C, Activin RIA, Activin RIA ALK-2, Activin RIB ALK- 4, Activin RIIA, Activin RIIB, ADAM, ADAM10, ADAM12, ADAM15, ADAM17/TACE, ADAMS, ADAM9, ADAMTS, ADAMTS4, ADAMTS5, ANG, Ang, Angiotensin type 1 (ATI) receptor, Angiotensin type 2 (AT2) receptor, Atrial natriuretic factor, av/b3 integrin, b-ECGF, CD19, CD20, CD30, CD34, CD40, CD40L, CD47, COX, CTLA-4, EGFR (ErbB-1), EPO, Follicle stimulating hormone, GDF-8 (Myostatin), GLP1, GLP2, GnRH, Growth hormone releasing factor,
- polypeptide or polypeptides described herein can be admixed with a pharmaceutically acceptable carrier or excipient.
- a pharmaceutically acceptable carrier or excipient See, e.g., Remington's Pharmaceutical Sciences and U.S. Pharmacopeia: National Formulary, Mack Publishing Company, Easton, Pa. (1984)).
- Formulations of therapeutic and diagnostic agents may be prepared by mixing with acceptable carriers, excipients, or stabilizers in the form of, e.g., lyophilized powders, slurries, aqueous solutions or suspensions (see, e.g., Hardman, et al. (2001) Goodman and Gilman's The Pharmacological Basis of Therapeutics, McGraw-Hill, New York, N.Y.; Gennaro (2000) Remington: The Science and Practice of Pharmacy, Lippincott, Williams, and Wilkins, New York, N.Y.; Avis, et al. (eds.) (1993) Pharmaceutical Dosage Forms: Parenteral Medications, Marcel Dekker, NY; Lieberman, et al.
- the polypeptide or polypeptides of the present invention are diluted to an appropriate concentration in a sodium acetate solution pH 5-6, and NaCl or sucrose is added for tonicity. Additional agents, such as polysorbate 20 or polysorbate 80, may be added to enhance stability.
- Toxicity and therapeutic efficacy of the polypeptide compositions, administered alone or in combination with another agent can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LDso (the dose lethal to 50% of the population) and the ED50 (the dose therapeutically effective in 50% of the population).
- the dose ratio between toxic and therapeutic effects is the therapeutic index (LD50/ED50).
- a polypeptide or polypeptides exhibiting high therapeutic indices are desirable.
- the data obtained from these cell culture assays and animal studies can be used in formulating a range of dosage for use in the livestock animal.
- the dosage of such compounds lies preferably within a range of circulating concentrations that include the ED50 with little or no toxicity.
- the dosage may vary within this range depending upon the dosage form employed and the route of administration.
- the mode of administration can vary. Suitable routes of administration include oral, rectal, transmucosal, intestinal, parenteral; intramuscular, subcutaneous, intradermal, intramedullary, intrathecal, direct intraventricular, intravenous, intraperitoneal, intranasal, intraocular, inhalation, insufflation, topical, cutaneous, transdermal, or intra-arterial.
- the polypeptide or polypeptides can be administered by an invasive route such as by injection.
- the polypeptide or polypeptides is administered intravenously, subcutaneously, intramuscularly, intraarterially, intratumorally, or by inhalation, aerosol delivery.
- compositions disclosed herein may also be administered by infusion.
- implants and modules form administering pharmaceutical compositions include: U.S. Pat. No. 4,487,603, which discloses an implantable micro-infusion pump for dispensing medication at a controlled rate; U.S. Pat. No. 4,447,233, which discloses a medication infusion pump for delivering medication at a precise infusion rate; U.S. Pat. No. 4,447,224, which discloses a variable flow implantable infusion apparatus for continuous drug delivery; U.S. Pat. No. 4,439,196, which discloses an osmotic drug delivery system having multi-chamber compartments. Many other such implants, delivery systems, and modules are well known to those skilled in the art.
- polypeptide or polypeptides may also administer in a local manner, for example, via injection of the antibody directly into an arthritic joint or pathogen-induced lesion characterized by immunopathology, often in a depot or sustained release formulation.
- a targeted drug delivery system for example, in a liposome coated with a tissue-specific antibody, targeting, for example, arthritic joint or pathogen-induced lesion characterized by immunopathology.
- the liposomes will be targeted to and taken up selectively by the afflicted tissue.
- the administration regimen depends on several factors, including, without limitation, the age, weight, and physical condition of the livestock animal to be or being treated, the serum or tissue turnover rate of the therapeutic antibody, the level of symptoms, the immunogenicity of the therapeutic polypeptide or polypeptides, and the accessibility of the target cells in the biological matrix.
- the administration regimen delivers sufficient therapeutic polypeptide or polypeptides to effect improvement in the target disease state, while simultaneously minimizing undesired side effects.
- the amount of biologic delivered depends in part on the particular therapeutic polypeptide or polypeptides and the severity of the condition being treated. Guidance in selecting appropriate doses of therapeutic antibodies is available (see, e.g., Wawrzynczak Antibody Therapy, Bios Scientific Pub.
- Determination of the appropriate dose of the polypeptide or polypeptides is made by one skilled in the art, e.g., using parameters or factors known or suspected in the art to affect treatment. Generally, the dose begins with an amount somewhat less than the optimum dose and it is increased by small increments thereafter until the desired or optimum effect is achieved relative to any negative side effects. Important diagnostic measures include those of symptoms of, e.g., the inflammation or level of inflammatory cytokines produced.
- the disclosure also encompasses nucleic acid or nucleic acids encoding the polypeptide or polypeptides described herein, a vector or vectors comprising the nucleic acid or nucleic acids, and host cells comprising the nucleic acid or nucleic acids or the vector or vectors.
- polypeptide or polypeptides described herein may be produced in bacterial or eukaryotic cells.
- Some polypeptides, e.g., Fab’s can be produced in bacterial cells, e.g., E. coli cells.
- Polypeptides can also be produced in eukaryotic cells such as transformed cell lines (e.g., CHO, 293E, COS, 293T, Hela).
- polypeptides e.g., scFv’s
- yeast cell such as Pichia (see, e.g., Powers et al., J Immunol Methods. 251 : 123-35 (2001)), Hanseula, or Saccharomyces.
- a polynucleotide or polynucleotides encoding the polypeptide or polypeptides is/are constructed, introduced into an expression vector or expression vectors, and then expressed in suitable host cells.
- the nucleotide sequences of the genes can be recoded without changing (or minimally changing - e.g., removal of a C- terminal residue of the heavy or light chain) the amino acid sequence.
- the areas for potential recoding include those associated with translation initiation, codon usage, and possible unintended mRNA splicing.
- Polynucleotides encoding an Fc region variant described herein would be readily envisioned by the ordinarily skilled artisan. [00189] Standard molecular biology techniques can be used to prepare the recombinant expression vector(s), transfect the host cells, select for transformants, culture the host cells, and recover the polypeptide (e.g., antibody).
- the expression vector should have characteristics that permit amplification of the vector in the bacterial cells. Additionally, when E. coli such as JM109, DH5a, HB101, or XL 1 -Blue is used as a host, the vector must have a promoter, for example, a lacZ promoter (Ward et al., 341 :544-546 (1989), araB promoter (Better et al., Science, 240:1041-1043 (1988)), or T7 promoter that can allow efficient expression in E. coli.
- a promoter for example, a lacZ promoter (Ward et al., 341 :544-546 (1989), araB promoter (Better et al., Science, 240:1041-1043 (1988)), or T7 promoter that can allow efficient expression in E. coli.
- Such vectors include, for example, M13-series vectors, pUC-series vectors, pBR322, pBluescript, pCR-Script, pGEX-5X-l (Pharmacia), “QIAexpress system” (QIAGEN), pEGFP, and pET (when this expression vector is used, the host is preferably BL21 expressing T7 RNA polymerase).
- the expression vector may contain a signal sequence for antibody secretion.
- the pelB signal sequence Lei etal., J. Bacteriol., 169:4379 (1987)
- calcium chloride methods or electroporation methods may be used to introduce the expression vector into the bacterial cell.
- the expression vector includes a promoter necessary for expression in these cells, for example, an SV40 promoter (Mulligan etal., Nature, 277: 108 (1979)) (e.g., early simian virus 40 promoter), MMLV-LTR promoter, EFla promoter (Mizushima et al., Nucleic Acids Res., 18:5322 (1990)), or CMV promoter (e.g., human cytomegalovirus immediate early promoter).
- SV40 promoter Mulligan etal., Nature, 277: 108 (1979)
- MMLV-LTR promoter e.g., MMLV-LTR promoter
- EFla promoter e.g., EFla promoter
- CMV promoter e.g., human cytomegalovirus immediate early promoter
- the recombinant expression vectors may carry additional sequences, such as sequences that regulate replication of the vector in host cells (e.g., origins of replication) and selectable marker genes.
- the selectable marker gene facilitates selection of host cells into which the vector has been introduced (see, e.g., U.S. Pat. Nos. 4,399,216, 4,634,665 and 5,179,017).
- the selectable marker gene confers resistance to drugs, such as G418, hygromycin, or methotrexate, on a host cell into which the vector has been introduced.
- vectors with selectable markers include pMAM, pDR2, pBK-RSV, pBK-CMV, pOPRSV, and pOP13.
- the polypeptide or polypeptides are produced in mammalian cells.
- exemplary mammalian host cells for expressing polypeptide or polypeptides include Chinese Hamster Ovary (CHO cells) (including dhfr- CHO cells, described in Urlaub and Chasin (1980) Proc. Natl. Acad. Sci. USA 77:4216-4220, used with a DHFR selectable marker, e.g., as described in Kaufman and Sharp (1982) Mol. Biol.
- human embryonic kidney 293 cells e.g., 293, 293E, 293T
- COS cells e.g., NIH3T3 cells
- lymphocytic cell lines e.g., NS0 myeloma cells and SP2 cells
- a cell from a transgenic animal e.g., a transgenic mammal.
- the cell is a mammary epithelial cell.
- a recombinant expression vector encoding both the antibody heavy chain and the antibody light chain of the antibody is introduced into dhfr- CHO cells by calcium phosphate-mediated transfection.
- the antibody heavy and light chain genes are each operatively linked to enhancer/promoter regulatory elements (e.g., derived from SV40, CMV, adenovirus and the like, such as a CMV enhancer/ AdMLP promoter regulatory element or an SV40 enhancer/ AdMLP promoter regulatory element) to drive high levels of transcription of the genes.
- enhancer/promoter regulatory elements e.g., derived from SV40, CMV, adenovirus and the like, such as a CMV enhancer/ AdMLP promoter regulatory element or an SV40 enhancer/ AdMLP promoter regulatory element
- the recombinant expression vector also carries a DHFR gene, which allows for selection of CHO cells that have been transfected with the vector using methotrexate selection/amplification.
- the selected transformant host cells are cultured to allow for expression of the antibody heavy and light chains and the antibody is recovered from the culture medium.
- polypeptide or polypeptides disclosed herein can be used to treat or prevent any disease or disorder in a livestock animal in need thereof. This invention is particularly helpful in the treatment of chronic conditions where repeated dosing is required. Because of the increased half-life of the protein therapeutic, less frequent dosing and/or reduced dose levels may be possible.
- the disease, disorder, condition or symptoms being treated or prevented is an allergic disease, a chronic pain, an acute pain, an inflammatory disease, an autoimmune disease, an endocrine disease, a gastrointestinal disease, a skeletal/musculoskeletal disease, a cardiovascular disease, a neurological disease, a renal disease, a metabolic disease, a immunological disease, a genetic/inherited disease, a fertility related disorder, an infectious disease or a cancer.
- the disease or disorder being treated or prevented is atopic dermatitis, allergic dermatitis, food allergy, osteoarthritic pain, perioperative pain, dental pain, cancer pain, arthritis, anemia, obesity, or diabetes.
- Antibodies may not only be used to treat or prevent disease but also to modulate normal biological function, for example, to manage fertility or behavior.
- polypeptide or polypeptides disclosed herein can also be used for various diagnostic purposes, for example, to determine whether the livestock animal has any particular disease or disorder.
- the polypeptide or polypeptides may comprise a binding domain.
- the binding domain can specifically bind to a protein, subunit, domain, motif, and/or epitope as described herein (e.g., a maker for cancer cells).
- the polypeptide or polypeptides further comprises a labeling group.
- label groups fall into a variety of classes, depending on the assay in which they are to be detected: a) isotopic labels, which may be radioactive or heavy isotopes; b) magnetic labels (e.g., magnetic particles); c) redox active moieties; d) optical dyes; enzymatic groups (e.g. horseradish peroxidase, P-galactosidase, luciferase, alkaline phosphatase); e) biotinylated groups; and f) predetermined polypeptide epitopes recognized by a secondary reporter (e.g., leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags, etc.).
- a secondary reporter e.g., leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags, etc.
- the labelling group is coupled to the antibody via spacer arms of various lengths to reduce potential steric hindrance.
- the labeling group is a probe, a dye (e.g., a fluorescent dye), or a radioactive isotope (e.g., 3 H, 14 C, 22 Na, 36 C1, 35 S, 33 P, or 125 I).
- Specific labels can also include optical dyes, including, but not limited to, chromophores, phosphors and fluorophores, with the latter being specific in many instances.
- Fluorophores can be either “small molecule” fluores, or proteinaceous fluores.
- the fluorescent label can be any molecule that may be detected via its inherent fluorescent properties. Suitable fluorescent labels include, but are not limited to, fluorescein, rhodamine, tetramethylrhodamine, eosin, erythrosin, coumarin, methylcoumarins, pyrene, Malacite green, stilbene, Lucifer Yellow, Cascade BlueJ, Texas Red, IAEDANS, EDANS, BODIPY FL, LC Red 640, Cy 5, Cy 5.5, LC Red 705, Oregon green, the Alexa-Fluor dyes (Alexa Fluor 350, Alexa Fluor 430, Alexa Fluor 488, Alexa Fluor 546, Alexa Fluor 568, Alexa Fluor 594, Alexa Fluor 633, Alexa Fluor 660, Alexa Fluor 680), Cascade Blue, Cascade Yellow and R-phycoerythrin (PE) (Molecular Probes, Eugene, Oreg.), FITC, Rhodamine
- Suitable proteinaceous fluorescent labels also include, but are not limited to, green fluorescent protein, including a Renilla, Ptilosarcus, or Aequorea species of GFP (Chalfie et al., 1994, Science 263:802-805), EGFP (Clontech Laboratories, Inc., GenBank Accession Number U55762), blue fluorescent protein (BFP, Quantum Biotechnologies, Inc. 1801 de Maisonneuve Blvd. West, 8th Floor, Montreal, Quebec, Canada H3H1J9; Stauber, 1998, Biotechniques 24:462-471; Heim et al., 1996, Curr. Biol.
- green fluorescent protein including a Renilla, Ptilosarcus, or Aequorea species of GFP (Chalfie et al., 1994, Science 263:802-805), EGFP (Clontech Laboratories, Inc., GenBank Accession Number U55762), blue fluorescent protein (BFP, Quantum Biotechnologies, Inc. 1801 de Maisonneuve Blvd
- EYFP enhanced yellow fluorescent protein
- luciferase Rhoplasminogen activatories, Inc.
- P galactosidase Nolan et al., 1988, Proc. Natl. Acad. Sci. U.S.A. 85:2603-2607
- Renilla WO92/15673, WO95/07463, WO98/14605, WO98/26277, WO99/49019, U.S. Pat. Nos.
- Binding to FcyRI and FcyRIII is a measure of the ability of an antibody to mediate ADCC. In order to assess this property for an antibody an assay to measure binding of the antibody to FcyRI and FcyRIII can be conducted using methods known in the art. Clq Binding'.
- Binding to the first component of complement, Clq is a measure of the ability of an antibody to mediate complement-dependent cytotoxicity (CDC).
- CDC complement-dependent cytotoxicity
- the half-life of an antibody can be measured by injection of the antibody into the species from which the Fc is derived (target species) and measuring levels of the antibody in the serum over a certain period of time.
- a transgenic mouse model could be used that is null for murine FcRn alpha chain and express the target species FcRn alpha transgene.
- the target species FcRn alpha chain could either be paired with mouse P2-microglobulin protein or the mouse P2-microglobulin gene could be substituted with the target species P2- microglobulin gene thereby forming a native FcRn alpha chain - P2-microglobulin heterodimer protein.
- the wild-type (wt) sequences of the CH2 and CH3 domains of porcine, bovine, equine, ovine and caprine IgG are synthesized and used as templates for NNK mutagenesis.
- the NNK saturation mutagenesis method is an effective strategy to generate all 20 possible amino acids at a desired position (Hogrefe etal., Biotechniques . 33: 1158-1165 [2002]; the content of which is incorporated herein by reference in its entirety).
- Individual NNK libraries at positions 250, 252, 254, 256, 286, 309, 311, 426, 428, 434 and 436 are generated.
- the PCR-product is subcloned into the GenScript FASEBA plasmid, transformed into E. coli and sequenced verified for the presence of the variant.
- Downstream of the CH2 domain is the SASA (single-domain antibody against serum albumin) tag (Zhang, J.; Wu, S.; Liu, J. Methods and systems for increasing protein stability.
- the SASA antibody enables the capture of the Fc to the sensor chip surface described below.
- the PelB (pectate lyase B) signal peptide is at the N-terminus to facilitate secretion of the Fc into the medium.
- the expression of CH2-CH3 protein is regulated by the Lac promoter.
- the supernatants from conditioned medium are analyzed for binding to the FcRn of the target livestock animal / species at pH 6.0 for variants using surface plasmon resonance (SPR).
- the supernatants from multiple individual transformants from each library are assayed for binding to the FcRn of the livestock animal / species at pH 6.0 using the Biacore method, as described below.
- bovine serum albumin (BSA) is immobilized to CM5 sensor chip.
- the sensor chip surface of flow cells 1 and 2 are activated by freshly mixed 50 mmol/L N-Hydroxysuccinimide and 200 mmol/L l-ethyl-3- (3 -dimethylaminopropyl) carbodiimide hydrochloride for 420s (10 pL/min).
- BSA diluted in 10 mM sodium acetate (pH 4.5) is injected into the flow cell 2 to achieve conjugation, while flow cell 1 is set as blank.
- the running buffer for the binding experiment is HBS-EP (10 mM HEPES, 500 mM NaCl, 3 mM EDTA, 0.05% Tween 20, pH 5.5) and run at 25°C.
- Supernatants from the variants are injected over chip surface and captured via the SASA tag onto the immobilized BSA for 60 sec.
- FcRn of the livestock animal / species at 200 nM is injected for 120 sec and the dissociation is complete with running buffer for 120 sec.
- the flow rate for the immobilization phase of BSA is 10 Dl/min and the flow rate for the association and dissociation phase is 30 Dl/min. All of the data is processed using the Biacore 8K evaluation software version 1.1. The results will show that the IgG Fc variants tested possess increased binding affinity for an FcRn of the corresponding livestock animal / species at pH 6.0 when compared to wild type IgG Fc of the same livestock animal / species.
- a phage display library approach is used to identify IgGl Fc variants that possess increased affinity to an FcRn of the same livestock animal or species at pH 6.0.
- the IgG Fc (comprising the CH2+CH3 domains of SEQ ID NO: 1-27) are synthesized by Twist Bioscience to produce multiple variants with amino acid mutations (substitutions) at one or more positions. At each of the mutated positions, eight possible amino acids are substituted. These amino acids are arginine and lysine (positively charged side chain), aspartic acid and glutamic acid (negatively charged side chain), threonine and glutamine (polar uncharged side chain), and leucine and valine (hydrophobic side chain).
- the Fc DNA library is designed to have an average of two variants per Fc molecule.
- the Fc variants with the desired site-specific mutations are printed as mutagenic oligonucleotides on Twist's silicon-based platform.
- the oligonucleotides are then assembled to create a full-length Fc gene fragment pool using assembly PCR.
- the assembled Fc gene fragment pool is then cloned into the pADL-22c phagemid vector from Antibody Design Labs into the Sfi cut-sites.
- the cloned DNA library is transformed into electrocompetent TGI E. coll cells to create an experimental diversity of typically > 10 10 variants.
- the phagemid transformed E.coli cells are then co-transfected with M13K07 helper phage to generate a phage pool that is used for protein-based panning.
- the library is resuspended into 20 mM MES buffer, pH 6.0, 0.05% Tween 20 and 3% milk.
- the quality of the library is determined by picking 96 random phage clones and sequenced by the Sanger method.
- a Protein A capture step is used to eliminate any Fc variants that have lost Protein A binding.
- the phage library is captured onto Protein A beads and washed with PBS, pH 7.4.
- the phage are eluted with 0.1M glycine, pH 2.7 and the pH is immediately neutralized with 1 M Tris-HCl, pH 7.5.
- the neutralized phage is precipitated with polyethylene glycol/NaCl and centrifuged.
- the pelleted phage are resuspended in 20 mM MES, pH 6.0, 0.05% Tween 20, 3% milk.
- next phage selections are based on the protocol described by Borrok et al., 2015, J Biol. Chem., 290:4282, the content of which is incorporated herein by reference in its entirety. Briefly, Nunc 96 multi-well plates are coated with Neutravidin and then blocked with 5% bovine serum albumin, PBS, pH 7.4. Biotinylated FcRn of the target livestock animal or species is immobilized in the well at a concentration of about 0.30 pg/ml in PBS, pH 6.0.
- the phage library in PBS, pH 6.0 is incubated with the immobilized FcRn and then washed with PBS, pH 6.0, 0.05% Tween 20, 0.3 M NaCl.
- the phage is eluted with PBS, pH 7.4 by incubating at 37°C for 30 minutes.
- the eluted phage are depleted with about 0.30 ⁇ g/ml of the FcRn of the same livestock animal or species at pH 7.4.
- the unbound phage is amplified in TGI cells.
- Unique variants may be reformatted into IgG and mini-prep plasmid DNA transfected into Expi293 cells with ExpiFectamine 293 transfection reagent.
- the Ig variants can then be purified from the conditioned medium with Protein A chromatography and formulated into 43 mM sodium citrate, 130 mM sodium bicarbonate, pH 6.0.
- a Carterra instrument For determining the affinities of the IgG variants to the FcRn of the corresponding livestock animal / species, a Carterra instrument can be used to determine the binding kinetics.
- the antibodies ⁇ 5 pg/ml
- the antibodies are typically amine- coupled to the HC30M sensor chip by EDC/NHS activation, followed by ethanolamine HC1 quenching.
- Table 6 Summary of the amino acid substitutions for livestock animal IgG Fc variants that increase binding affinity to FcRn of the corresponding livestock animal
- a set of Fc variants was expressed and purified for porcine, ovine, bovine and equine IgGs.
- the variable domain for the heavy and light chain for each of the IgGs was previously described by Gearing et al. (2016, J Vet Intern Med, 30: 1129).
- the heavy and light chain constant domains used for the different species IgGs were as follows: for porcine it was IgGla (Genbank AAA52219.1 SEQ ID NO: 1) and the porcine kappa chain (Genbank AHB17990.1), for ovine it was IgGl (Genbank X69797, SEQ ID NO: 22) and the ovine kappa chain (Genbank AU45094.1), for bovine it was IgGl (Genbank ABE68619.1, SEQ ID NO: 12) and the bovine kappa chain (Genbank AEM45004.1), and for equine it was IgGl (Genbank CAC44760.1, SEQ ID NO: 15) and the equine kappa chain (Genbank CAA53284.1).
- the variants were made in the Fc of each species at positions 252, 286, 309, 311, 426, 428, 434, and 436 (FIG. 1) (EU numbering).
- the synthesized DNAs for each variant and wild-type were subcloned into pcDNA3.4 expression vector (Life Technologies) and expressed in HEK293 cells.
- the conditioned medium for each variant and wild-type were purified with the resins shown in Table 7 and the purified antibodies were formulated in PBS, pH 7.2. All of the resins were acquired from Cytiva with the exception of RoboColumn Eshmuno A which was purchased from EMD Millipore.
- the purity of the antibodies was determined by scanning densitometry of coomassie blue-stained SDS/PAGE gels and each was >90% (FIGs. 2A-2J, 3 A-3 J, 4A-4J, 5A-5J).
- the FcRn complex consists of a large subunit p51 and beta-2-microglobulin.
- the Avi-tag sequence (SEQ ID NO: 28, GLNDIFEAQKIEWHE) and an 8X His tag was fused to the C-terminus of the extracellular domain of the large subunit p51 (porcine: Genbank E9LK24; ovine: Genbank Q8HZV2; bovine: Genbank AAF60956.1; equine: Genbank XP 023505908.1) and subcloned into pcDNA3.4 expression vector (Life Technologies).
- the Flag tag (SEQ ID NO: 29, DYKDDDDK) was fused to the C-terminus of the beta-2- microglobulin (porcine: Genbank L13854.1; ovine: Genbank AY549962.1; bovine: Genbank X69084.1; equine: Genbank X69083.1) and subcloned into the pcDNA3.4 expression vector.
- the large subunit p51 expression vector was cotransfected with the beta-2-microglobulin into HEK293 cells.
- the FcRn complexes were purified from conditioned medium using HisTrap fast flow chromatography (Cytiva) and the proteins were then formulated into PBS, pH 7.2.
- the proteins were analyzed by SDS/PAGE and analytical SEC (size exclusion chromatography) using a TSKgel G3000SWxl column.
- the purity of the proteins was >95% by SDS/PAGE and >95% of the FcRn complex was a heterodimer of the large subunit p51 and beta-2-microglobulin by analytical SEC.
- the FcRn binding experiments were completed on a Biacore 8K+ system at 25oC.
- a polyclonal antibody against the His tag was coupled to the CM5 biosensor chip using the His Capture Kit (Cytiva, Cat 28995056) following the manufacturer’s instructions.
- the His- tagged FcRn from the different species were flowed on the anti-His polyclonal biosensor chip at 10 pl/min until approximately 100 RU were captured.
- the different porcine, ovine, bovine and equine IgG variants and wild-type were the analytes for the pig, cow, horse and sheep FcRn proteins biosensor chips, respectively.
- concentrations of IgGs were injected for 90 seconds at 30 pl/min with a 30 second dissociation time.
- concentrations of IgG were 6.2 nM, 18 nM, 55 nM, 167 nM, and 500 nM.
- concentrations of IgG were 1.2 nM, 3.7 nM, 11 nM, 33 nM, and 100 nM.
- the running buffer was 1 X PBS-P+ (Cytiva, Cat # 28995084) adjusted to pH 5.9.
- the surface was regenerated with 10 mM glycine, pH 1.5 at 30 pl/min for 30 seconds. Data were evaluated using Insight Evaluation Software by fitting to a 1 : 1 kinetic interaction model, or by fitting to steady state affinity.
- Table 12 shows a species comparison of the fold increase of each Fc variant compared to the wild-type Fc.
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Life Sciences & Earth Sciences (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Immunology (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicinal Preparation (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Priority Applications (7)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP21904137.3A EP4255933A4 (en) | 2020-12-07 | 2021-12-01 | COMPOSITIONS FOR INCREASING THE HALF-LIFE OF A THERAPEUTIC AGENT IN LIVESTOCK ANIMALS AND METHODS OF USE |
| CA3201120A CA3201120A1 (en) | 2020-12-07 | 2021-12-01 | Compositions for increasing half-life of a therapeutic agent in livestock animals and methods of use |
| MX2023006639A MX2023006639A (es) | 2020-12-07 | 2021-12-01 | Composiciones para aumentar la semivida de un agente terapeutico en ganado y metodos de uso. |
| JP2023534323A JP2023552456A (ja) | 2020-12-07 | 2021-12-01 | 治療薬の家畜動物における半減期を増加させるための組成物及びその使用方法 |
| AU2021397693A AU2021397693A1 (en) | 2020-12-07 | 2021-12-01 | Compositions for increasing half-life of a therapeutic agent in livestock animals and methods of use |
| CN202180092133.4A CN117043190A (zh) | 2020-12-07 | 2021-12-01 | 延长治疗剂在家畜动物中的半衰期的组合物和使用方法 |
| KR1020237021674A KR20230128283A (ko) | 2020-12-07 | 2021-12-01 | 가축에서 치료제의 반감기를 증가시키기 위한 조성물및 사용 방법 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202063122365P | 2020-12-07 | 2020-12-07 | |
| US63/122,365 | 2020-12-07 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2022125355A1 true WO2022125355A1 (en) | 2022-06-16 |
Family
ID=81848817
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2021/061409 Ceased WO2022125355A1 (en) | 2020-12-07 | 2021-12-01 | Compositions for increasing half-life of a therapeutic agent in livestock animals and methods of use |
Country Status (10)
| Country | Link |
|---|---|
| US (2) | US12103961B2 (https=) |
| EP (1) | EP4255933A4 (https=) |
| JP (1) | JP2023552456A (https=) |
| KR (1) | KR20230128283A (https=) |
| CN (1) | CN117043190A (https=) |
| AU (1) | AU2021397693A1 (https=) |
| CA (1) | CA3201120A1 (https=) |
| MX (1) | MX2023006639A (https=) |
| TW (1) | TW202237641A (https=) |
| WO (1) | WO2022125355A1 (https=) |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN119730881A (zh) * | 2022-08-05 | 2025-03-28 | 硕腾服务有限责任公司 | 牛抗体突变体 |
| KR20250084941A (ko) * | 2022-10-07 | 2025-06-11 | 조에티스 서비시즈 엘엘씨 | 돼지 항체 돌연변이체 |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2005123780A2 (en) * | 2004-04-09 | 2005-12-29 | Protein Design Labs, Inc. | Alteration of fcrn binding affinities or serum half-lives of antibodies by mutagenesis |
| US20190185557A1 (en) * | 2011-09-30 | 2019-06-20 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecule promoting disappearance of antigens having plurality of biological activities |
| WO2020142625A2 (en) * | 2019-01-03 | 2020-07-09 | Invetx Inc. | Compositions for increasing half-life of a therapeutic agent in canines and methods of use |
| US20200223938A1 (en) * | 2017-04-07 | 2020-07-16 | Kookmin University Industry Academy Cooperation Foundation | Antibody fc variants for increased blood half-life |
Family Cites Families (33)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5179017A (en) | 1980-02-25 | 1993-01-12 | The Trustees Of Columbia University In The City Of New York | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US4634665A (en) | 1980-02-25 | 1987-01-06 | The Trustees Of Columbia University In The City Of New York | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US4399216A (en) | 1980-02-25 | 1983-08-16 | The Trustees Of Columbia University | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US4447233A (en) | 1981-04-10 | 1984-05-08 | Parker-Hannifin Corporation | Medication infusion pump |
| US4439196A (en) | 1982-03-18 | 1984-03-27 | Merck & Co., Inc. | Osmotic drug delivery system |
| US4447224A (en) | 1982-09-20 | 1984-05-08 | Infusaid Corporation | Variable flow implantable infusion apparatus |
| US4487603A (en) | 1982-11-26 | 1984-12-11 | Cordis Corporation | Implantable microinfusion pump system |
| US5683888A (en) | 1989-07-22 | 1997-11-04 | University Of Wales College Of Medicine | Modified bioluminescent proteins and their use |
| US5292658A (en) | 1989-12-29 | 1994-03-08 | University Of Georgia Research Foundation, Inc. Boyd Graduate Studies Research Center | Cloning and expressions of Renilla luciferase |
| ES2142801T3 (es) | 1991-03-11 | 2000-05-01 | Univ Georgia Res Found | Clonacion y expresion de luciferasa de renilla. |
| EP0759170B1 (en) | 1993-09-10 | 2008-07-09 | The Trustees Of Columbia University In The City Of New York | Uses of green fluorescent protein |
| WO1995021191A1 (en) | 1994-02-04 | 1995-08-10 | William Ward | Bioluminescent indicator based upon the expression of a gene for a modified green-fluorescent protein |
| US5777079A (en) | 1994-11-10 | 1998-07-07 | The Regents Of The University Of California | Modified green fluorescent proteins |
| US5874304A (en) | 1996-01-18 | 1999-02-23 | University Of Florida Research Foundation, Inc. | Humanized green fluorescent protein genes and methods |
| US5804387A (en) | 1996-02-01 | 1998-09-08 | The Board Of Trustees Of The Leland Stanford Junior University | FACS-optimized mutants of the green fluorescent protein (GFP) |
| US5876995A (en) | 1996-02-06 | 1999-03-02 | Bryan; Bruce | Bioluminescent novelty items |
| US5925558A (en) | 1996-07-16 | 1999-07-20 | The Regents Of The University Of California | Assays for protein kinases using fluorescent protein substrates |
| US5976796A (en) | 1996-10-04 | 1999-11-02 | Loma Linda University | Construction and expression of renilla luciferase and green fluorescent protein fusion genes |
| IL129767A0 (en) | 1996-12-12 | 2000-02-29 | Prolume Ltd | Apparatus and method for detecting and identifying infectious agents |
| JP2002507410A (ja) | 1998-03-27 | 2002-03-12 | プロルーム・リミテッド | ルシフェラーゼ、蛍光タンパク質、ルシフェラーゼおよび蛍光タンパク質をコードする核酸および、診断、高処理スクリーニングおよび新規アイテムにおけるその使用 |
| US7083784B2 (en) * | 2000-12-12 | 2006-08-01 | Medimmune, Inc. | Molecules with extended half-lives, compositions and uses thereof |
| WO2005047327A2 (en) * | 2003-11-12 | 2005-05-26 | Biogen Idec Ma Inc. | NEONATAL Fc RECEPTOR (FcRn)-BINDING POLYPEPTIDE VARIANTS, DIMERIC Fc BINDING PROTEINS AND METHODS RELATED THERETO |
| US20060074225A1 (en) * | 2004-09-14 | 2006-04-06 | Xencor, Inc. | Monomeric immunoglobulin Fc domains |
| AU2005304624B2 (en) * | 2004-11-12 | 2010-10-07 | Xencor, Inc. | Fc variants with altered binding to FcRn |
| US20130129727A1 (en) | 2011-11-17 | 2013-05-23 | Nanjingjinsirui Science & Technology Biology Corporation | Methods and systems for increasing protein stability |
| KR20230143201A (ko) * | 2011-11-30 | 2023-10-11 | 추가이 세이야쿠 가부시키가이샤 | 면역 복합체를 형성하는 세포내로의 운반체(캐리어)를 포함하는 의약 |
| NZ631007A (en) * | 2014-03-07 | 2015-10-30 | Alexion Pharma Inc | Anti-c5 antibodies having improved pharmacokinetics |
| DK3484514T3 (da) * | 2016-05-23 | 2024-01-29 | Momenta Pharmaceuticals Inc | Compositions and methods related to engineered fc constructs |
| WO2018151841A1 (en) * | 2017-02-17 | 2018-08-23 | Sanofi | Multispecific binding molecules having specificity to dystroglycan and laminin-2 |
| US20210388053A1 (en) * | 2018-10-18 | 2021-12-16 | Kindred Biosciences, Inc. | Fc Variants with Altered Binding to Neonatal Fc Receptor (FCRN) for Veterinary Use |
| CN120590527A (zh) * | 2020-05-11 | 2025-09-05 | 因外泰克斯公司 | 用于增加治疗剂在犬中的半衰期的组合物和使用方法 |
| KR20230038522A (ko) * | 2020-07-10 | 2023-03-20 | 인베티엑스 인코포레이티드 | 고양이에서 치료제의 반감기를 증가시키기 위한 조성물 및 사용 방법 |
| JP2023551194A (ja) | 2020-11-20 | 2023-12-07 | ゾエティス・サービシーズ・エルエルシー | ウシ科動物抗体バリアント |
-
2021
- 2021-12-01 EP EP21904137.3A patent/EP4255933A4/en active Pending
- 2021-12-01 CA CA3201120A patent/CA3201120A1/en active Pending
- 2021-12-01 US US17/540,044 patent/US12103961B2/en active Active
- 2021-12-01 KR KR1020237021674A patent/KR20230128283A/ko active Pending
- 2021-12-01 JP JP2023534323A patent/JP2023552456A/ja active Pending
- 2021-12-01 CN CN202180092133.4A patent/CN117043190A/zh active Pending
- 2021-12-01 AU AU2021397693A patent/AU2021397693A1/en active Pending
- 2021-12-01 WO PCT/US2021/061409 patent/WO2022125355A1/en not_active Ceased
- 2021-12-01 MX MX2023006639A patent/MX2023006639A/es unknown
- 2021-12-06 TW TW110145549A patent/TW202237641A/zh unknown
-
2024
- 2024-08-27 US US18/816,282 patent/US20250197478A1/en active Pending
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2005123780A2 (en) * | 2004-04-09 | 2005-12-29 | Protein Design Labs, Inc. | Alteration of fcrn binding affinities or serum half-lives of antibodies by mutagenesis |
| US20190185557A1 (en) * | 2011-09-30 | 2019-06-20 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecule promoting disappearance of antigens having plurality of biological activities |
| US20200223938A1 (en) * | 2017-04-07 | 2020-07-16 | Kookmin University Industry Academy Cooperation Foundation | Antibody fc variants for increased blood half-life |
| WO2020142625A2 (en) * | 2019-01-03 | 2020-07-09 | Invetx Inc. | Compositions for increasing half-life of a therapeutic agent in canines and methods of use |
Non-Patent Citations (1)
| Title |
|---|
| See also references of EP4255933A4 * |
Also Published As
| Publication number | Publication date |
|---|---|
| US20250197478A1 (en) | 2025-06-19 |
| US12103961B2 (en) | 2024-10-01 |
| CA3201120A1 (en) | 2022-06-16 |
| CN117043190A (zh) | 2023-11-10 |
| AU2021397693A1 (en) | 2023-07-13 |
| JP2023552456A (ja) | 2023-12-15 |
| MX2023006639A (es) | 2023-08-16 |
| TW202237641A (zh) | 2022-10-01 |
| EP4255933A4 (en) | 2025-07-23 |
| US20220177549A1 (en) | 2022-06-09 |
| EP4255933A1 (en) | 2023-10-11 |
| KR20230128283A (ko) | 2023-09-04 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20240239897A1 (en) | Compositions for increasing half-life of a therapeutic agent in canines and methods of use | |
| US12344650B2 (en) | Compositions for increasing half-life of a therapeutic agent in felines and methods of use | |
| EP4149969A1 (en) | Compositions for increasing half-life of a therapeutic agent in canines and methods of use | |
| US20250197478A1 (en) | Compositions for increasing half-life of a therapeutic agent in livestock animals and methods of use | |
| HK40127007A (zh) | 用於增加治疗剂在犬中的半衰期的组合物及使用方法 | |
| HK40085105B (zh) | 用於延长治疗剂在猫科动物中的半衰期的组合物和使用方法 | |
| HK40102570A (zh) | 延长治疗剂在家畜动物中的半衰期的组合物和使用方法 | |
| HK40085105A (en) | Compositions for increasing half-life of a therapeutic agent in felines and methods of use | |
| HK40063007B (zh) | 用於增加治疗剂在犬中的半衰期的组合物及使用方法 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 21904137 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3201120 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2023534323 Country of ref document: JP |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112023011298 Country of ref document: BR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202347044533 Country of ref document: IN |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2021904137 Country of ref document: EP Effective date: 20230707 |
|
| ENP | Entry into the national phase |
Ref document number: 2021397693 Country of ref document: AU Date of ref document: 20211201 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202180092133.4 Country of ref document: CN |
|
| ENP | Entry into the national phase |
Ref document number: 112023011298 Country of ref document: BR Kind code of ref document: A2 Effective date: 20230607 |
|
| WWP | Wipo information: published in national office |
Ref document number: 202347044533 Country of ref document: IN |