WO2022119367A1 - 마이오스타틴 유전자가 변형된 형질전환 동물 - Google Patents
마이오스타틴 유전자가 변형된 형질전환 동물 Download PDFInfo
- Publication number
- WO2022119367A1 WO2022119367A1 PCT/KR2021/018176 KR2021018176W WO2022119367A1 WO 2022119367 A1 WO2022119367 A1 WO 2022119367A1 KR 2021018176 W KR2021018176 W KR 2021018176W WO 2022119367 A1 WO2022119367 A1 WO 2022119367A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- myostatin
- sequence
- protein
- seq
- animal
- Prior art date
Links
- 108010056852 Myostatin Proteins 0.000 title claims abstract description 276
- 241001465754 Metazoa Species 0.000 title claims abstract description 191
- 230000009261 transgenic effect Effects 0.000 title claims description 110
- 239000000203 mixture Substances 0.000 claims abstract description 61
- 238000012217 deletion Methods 0.000 claims abstract description 33
- 230000037430 deletion Effects 0.000 claims abstract description 33
- 102000004472 Myostatin Human genes 0.000 claims description 144
- 210000004027 cell Anatomy 0.000 claims description 94
- 241000283690 Bos taurus Species 0.000 claims description 80
- 108090000623 proteins and genes Proteins 0.000 claims description 75
- 150000001413 amino acids Chemical group 0.000 claims description 66
- 102000004169 proteins and genes Human genes 0.000 claims description 62
- 238000000034 method Methods 0.000 claims description 55
- 108020005004 Guide RNA Proteins 0.000 claims description 45
- 108020004999 messenger RNA Proteins 0.000 claims description 39
- 108091033409 CRISPR Proteins 0.000 claims description 31
- 210000001161 mammalian embryo Anatomy 0.000 claims description 28
- 108020004414 DNA Proteins 0.000 claims description 26
- 230000014509 gene expression Effects 0.000 claims description 26
- 238000004519 manufacturing process Methods 0.000 claims description 26
- 239000013598 vector Substances 0.000 claims description 24
- 230000000295 complement effect Effects 0.000 claims description 23
- 150000007523 nucleic acids Chemical group 0.000 claims description 23
- 241000124008 Mammalia Species 0.000 claims description 19
- 230000004048 modification Effects 0.000 claims description 19
- 238000012986 modification Methods 0.000 claims description 19
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 18
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 claims description 17
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 claims description 17
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 claims description 17
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 claims description 17
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 claims description 17
- 229960000310 isoleucine Drugs 0.000 claims description 17
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 claims description 17
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 claims description 15
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 claims description 15
- 210000001082 somatic cell Anatomy 0.000 claims description 13
- 241000282414 Homo sapiens Species 0.000 claims description 12
- 210000002308 embryonic cell Anatomy 0.000 claims description 11
- 210000002257 embryonic structure Anatomy 0.000 claims description 11
- 239000013603 viral vector Substances 0.000 claims description 10
- 238000000520 microinjection Methods 0.000 claims description 9
- 230000009466 transformation Effects 0.000 claims description 8
- 108010081734 Ribonucleoproteins Proteins 0.000 claims description 7
- 102000004389 Ribonucleoproteins Human genes 0.000 claims description 7
- 108700004991 Cas12a Proteins 0.000 claims description 6
- 241000193996 Streptococcus pyogenes Species 0.000 claims description 6
- 239000013612 plasmid Substances 0.000 claims description 6
- 241000191967 Staphylococcus aureus Species 0.000 claims description 5
- 210000001671 embryonic stem cell Anatomy 0.000 claims description 4
- 101150005393 CBF1 gene Proteins 0.000 claims description 3
- 101100329224 Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) cpf1 gene Proteins 0.000 claims description 3
- 241000702421 Dependoparvovirus Species 0.000 claims description 3
- 241000589601 Francisella Species 0.000 claims description 3
- 241000605861 Prevotella Species 0.000 claims description 3
- 241000700584 Simplexvirus Species 0.000 claims description 3
- 241000700618 Vaccinia virus Species 0.000 claims description 3
- 101150059443 cas12a gene Proteins 0.000 claims description 3
- 238000004520 electroporation Methods 0.000 claims description 3
- 239000002502 liposome Substances 0.000 claims description 3
- 230000001177 retroviral effect Effects 0.000 claims description 3
- 108020001507 fusion proteins Proteins 0.000 claims description 2
- 102000037865 fusion proteins Human genes 0.000 claims description 2
- 239000002105 nanoparticle Substances 0.000 claims description 2
- 239000013600 plasmid vector Substances 0.000 claims description 2
- 238000001814 protein method Methods 0.000 claims description 2
- 230000007398 protein translocation Effects 0.000 claims description 2
- 210000003205 muscle Anatomy 0.000 abstract description 31
- 230000001965 increasing effect Effects 0.000 abstract description 9
- 108050006583 Growth/differentiation factor 8 Proteins 0.000 description 35
- 102100039939 Growth/differentiation factor 8 Human genes 0.000 description 34
- 229940024606 amino acid Drugs 0.000 description 24
- 210000002459 blastocyst Anatomy 0.000 description 24
- 210000000582 semen Anatomy 0.000 description 23
- 238000000338 in vitro Methods 0.000 description 18
- 210000001519 tissue Anatomy 0.000 description 18
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 17
- 241000699666 Mus <mouse, genus> Species 0.000 description 13
- 102100039087 Peptidyl-alpha-hydroxyglycine alpha-amidating lyase Human genes 0.000 description 12
- 108020004707 nucleic acids Proteins 0.000 description 12
- 102000039446 nucleic acids Human genes 0.000 description 12
- 230000000694 effects Effects 0.000 description 11
- 238000010353 genetic engineering Methods 0.000 description 11
- 238000012350 deep sequencing Methods 0.000 description 10
- 210000004602 germ cell Anatomy 0.000 description 10
- 210000000287 oocyte Anatomy 0.000 description 10
- 241000283984 Rodentia Species 0.000 description 9
- 238000004458 analytical method Methods 0.000 description 9
- 238000003556 assay Methods 0.000 description 9
- 230000027455 binding Effects 0.000 description 9
- 244000309464 bull Species 0.000 description 9
- 201000010099 disease Diseases 0.000 description 9
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 9
- 230000004720 fertilization Effects 0.000 description 9
- 238000012239 gene modification Methods 0.000 description 9
- 230000035772 mutation Effects 0.000 description 9
- 241000894007 species Species 0.000 description 9
- 238000003776 cleavage reaction Methods 0.000 description 8
- 230000008569 process Effects 0.000 description 8
- 230000007017 scission Effects 0.000 description 8
- RWQNBRDOKXIBIV-UHFFFAOYSA-N thymine Chemical compound CC1=CNC(=O)NC1=O RWQNBRDOKXIBIV-UHFFFAOYSA-N 0.000 description 8
- 241000700159 Rattus Species 0.000 description 7
- 241000282887 Suidae Species 0.000 description 7
- 230000005540 biological transmission Effects 0.000 description 7
- 238000002474 experimental method Methods 0.000 description 7
- 230000005017 genetic modification Effects 0.000 description 7
- 235000013617 genetically modified food Nutrition 0.000 description 7
- 230000009437 off-target effect Effects 0.000 description 7
- 238000012163 sequencing technique Methods 0.000 description 7
- 238000002604 ultrasonography Methods 0.000 description 7
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 6
- 241000699670 Mus sp. Species 0.000 description 6
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical compound O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 description 6
- 210000001771 cumulus cell Anatomy 0.000 description 6
- 230000036541 health Effects 0.000 description 6
- 239000002609 medium Substances 0.000 description 6
- 210000000663 muscle cell Anatomy 0.000 description 6
- 239000002773 nucleotide Substances 0.000 description 6
- 125000003729 nucleotide group Chemical group 0.000 description 6
- 230000019491 signal transduction Effects 0.000 description 6
- 238000010354 CRISPR gene editing Methods 0.000 description 5
- 241000282898 Sus scrofa Species 0.000 description 5
- 238000010586 diagram Methods 0.000 description 5
- 230000035800 maturation Effects 0.000 description 5
- 229910052757 nitrogen Inorganic materials 0.000 description 5
- 230000035935 pregnancy Effects 0.000 description 5
- 238000011160 research Methods 0.000 description 5
- 210000003491 skin Anatomy 0.000 description 5
- 210000004291 uterus Anatomy 0.000 description 5
- 108091026890 Coding region Proteins 0.000 description 4
- 108091028113 Trans-activating crRNA Proteins 0.000 description 4
- 230000015572 biosynthetic process Effects 0.000 description 4
- 238000005516 engineering process Methods 0.000 description 4
- 210000000981 epithelium Anatomy 0.000 description 4
- 239000012530 fluid Substances 0.000 description 4
- 239000002480 mineral oil Substances 0.000 description 4
- 235000010446 mineral oil Nutrition 0.000 description 4
- 239000000523 sample Substances 0.000 description 4
- 230000008685 targeting Effects 0.000 description 4
- 229940113082 thymine Drugs 0.000 description 4
- 238000013518 transcription Methods 0.000 description 4
- 230000035897 transcription Effects 0.000 description 4
- 108091093088 Amplicon Proteins 0.000 description 3
- 108020004705 Codon Proteins 0.000 description 3
- 241000282412 Homo Species 0.000 description 3
- 210000001744 T-lymphocyte Anatomy 0.000 description 3
- 210000004504 adult stem cell Anatomy 0.000 description 3
- 210000003719 b-lymphocyte Anatomy 0.000 description 3
- 210000001185 bone marrow Anatomy 0.000 description 3
- 238000009395 breeding Methods 0.000 description 3
- 230000001488 breeding effect Effects 0.000 description 3
- 210000001612 chondrocyte Anatomy 0.000 description 3
- 238000003745 diagnosis Methods 0.000 description 3
- 210000002919 epithelial cell Anatomy 0.000 description 3
- 230000012173 estrus Effects 0.000 description 3
- 210000004700 fetal blood Anatomy 0.000 description 3
- 239000012091 fetal bovine serum Substances 0.000 description 3
- 230000001605 fetal effect Effects 0.000 description 3
- 210000002950 fibroblast Anatomy 0.000 description 3
- 210000001733 follicular fluid Anatomy 0.000 description 3
- 230000012010 growth Effects 0.000 description 3
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 3
- 238000002513 implantation Methods 0.000 description 3
- 210000002510 keratinocyte Anatomy 0.000 description 3
- 239000007788 liquid Substances 0.000 description 3
- 235000004213 low-fat Nutrition 0.000 description 3
- 210000002540 macrophage Anatomy 0.000 description 3
- 235000013372 meat Nutrition 0.000 description 3
- 230000001404 mediated effect Effects 0.000 description 3
- 210000002752 melanocyte Anatomy 0.000 description 3
- 210000001616 monocyte Anatomy 0.000 description 3
- 210000000472 morula Anatomy 0.000 description 3
- 210000001087 myotubule Anatomy 0.000 description 3
- 210000002569 neuron Anatomy 0.000 description 3
- 239000002777 nucleoside Substances 0.000 description 3
- 210000004940 nucleus Anatomy 0.000 description 3
- 210000000056 organ Anatomy 0.000 description 3
- 210000001672 ovary Anatomy 0.000 description 3
- 238000002559 palpation Methods 0.000 description 3
- 210000002826 placenta Anatomy 0.000 description 3
- 230000003169 placental effect Effects 0.000 description 3
- 239000013641 positive control Substances 0.000 description 3
- 108020003175 receptors Proteins 0.000 description 3
- 230000002441 reversible effect Effects 0.000 description 3
- 238000007480 sanger sequencing Methods 0.000 description 3
- 238000010374 somatic cell nuclear transfer Methods 0.000 description 3
- 210000001988 somatic stem cell Anatomy 0.000 description 3
- 210000000130 stem cell Anatomy 0.000 description 3
- 239000010902 straw Substances 0.000 description 3
- 238000001890 transfection Methods 0.000 description 3
- 229940035893 uracil Drugs 0.000 description 3
- VOXZDWNPVJITMN-ZBRFXRBCSA-N 17β-estradiol Chemical compound OC1=CC=C2[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 VOXZDWNPVJITMN-ZBRFXRBCSA-N 0.000 description 2
- 108010059616 Activins Proteins 0.000 description 2
- 101000886576 Bos taurus Growth/differentiation factor 8 Proteins 0.000 description 2
- 101710172824 CRISPR-associated endonuclease Cas9 Proteins 0.000 description 2
- 241000283707 Capra Species 0.000 description 2
- 241000282994 Cervidae Species 0.000 description 2
- 102100031181 Glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 description 2
- NYHBQMYGNKIUIF-UUOKFMHZSA-N Guanosine Chemical compound C1=NC=2C(=O)NC(N)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O NYHBQMYGNKIUIF-UUOKFMHZSA-N 0.000 description 2
- 101000886562 Homo sapiens Growth/differentiation factor 8 Proteins 0.000 description 2
- 102100026818 Inhibin beta E chain Human genes 0.000 description 2
- NNJVILVZKWQKPM-UHFFFAOYSA-N Lidocaine Chemical compound CCN(CC)CC(=O)NC1=C(C)C=CC=C1C NNJVILVZKWQKPM-UHFFFAOYSA-N 0.000 description 2
- 101001075141 Mus musculus Growth/differentiation factor 8 Proteins 0.000 description 2
- 241001494479 Pecora Species 0.000 description 2
- RJKFOVLPORLFTN-LEKSSAKUSA-N Progesterone Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H](C(=O)C)[C@@]1(C)CC2 RJKFOVLPORLFTN-LEKSSAKUSA-N 0.000 description 2
- 230000004570 RNA-binding Effects 0.000 description 2
- 101000910035 Streptococcus pyogenes serotype M1 CRISPR-associated endonuclease Cas9/Csn1 Proteins 0.000 description 2
- 241001493546 Suina Species 0.000 description 2
- DRTQHJPVMGBUCF-XVFCMESISA-N Uridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-XVFCMESISA-N 0.000 description 2
- 230000005856 abnormality Effects 0.000 description 2
- 239000000488 activin Substances 0.000 description 2
- OIRDTQYFTABQOQ-KQYNXXCUSA-N adenosine Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O OIRDTQYFTABQOQ-KQYNXXCUSA-N 0.000 description 2
- 210000004369 blood Anatomy 0.000 description 2
- 239000008280 blood Substances 0.000 description 2
- 230000037396 body weight Effects 0.000 description 2
- 239000006227 byproduct Substances 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 238000005119 centrifugation Methods 0.000 description 2
- 230000008859 change Effects 0.000 description 2
- 239000002299 complementary DNA Substances 0.000 description 2
- 238000005138 cryopreservation Methods 0.000 description 2
- 238000012258 culturing Methods 0.000 description 2
- OPTASPLRGRRNAP-UHFFFAOYSA-N cytosine Chemical compound NC=1C=CNC(=O)N=1 OPTASPLRGRRNAP-UHFFFAOYSA-N 0.000 description 2
- 230000007423 decrease Effects 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 230000004069 differentiation Effects 0.000 description 2
- 230000003325 follicular Effects 0.000 description 2
- 108020004445 glyceraldehyde-3-phosphate dehydrogenase Proteins 0.000 description 2
- 239000001963 growth medium Substances 0.000 description 2
- UYTPUPDQBNUYGX-UHFFFAOYSA-N guanine Chemical compound O=C1NC(N)=NC2=C1N=CN2 UYTPUPDQBNUYGX-UHFFFAOYSA-N 0.000 description 2
- 238000001727 in vivo Methods 0.000 description 2
- 230000001939 inductive effect Effects 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 229960004194 lidocaine Drugs 0.000 description 2
- 238000002156 mixing Methods 0.000 description 2
- 201000000585 muscular atrophy Diseases 0.000 description 2
- 210000000107 myocyte Anatomy 0.000 description 2
- 239000013642 negative control Substances 0.000 description 2
- 150000003833 nucleoside derivatives Chemical class 0.000 description 2
- 239000008188 pellet Substances 0.000 description 2
- 239000002243 precursor Substances 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 230000001105 regulatory effect Effects 0.000 description 2
- 208000001076 sarcopenia Diseases 0.000 description 2
- 238000009612 semen analysis Methods 0.000 description 2
- 230000011664 signaling Effects 0.000 description 2
- 239000000243 solution Substances 0.000 description 2
- 230000019100 sperm motility Effects 0.000 description 2
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 2
- 238000012546 transfer Methods 0.000 description 2
- 238000002054 transplantation Methods 0.000 description 2
- 241000701161 unidentified adenovirus Species 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- GUAHPAJOXVYFON-ZETCQYMHSA-N (8S)-8-amino-7-oxononanoic acid zwitterion Chemical compound C[C@H](N)C(=O)CCCCCC(O)=O GUAHPAJOXVYFON-ZETCQYMHSA-N 0.000 description 1
- UHDGCWIWMRVCDJ-UHFFFAOYSA-N 1-beta-D-Xylofuranosyl-NH-Cytosine Natural products O=C1N=C(N)C=CN1C1C(O)C(O)C(CO)O1 UHDGCWIWMRVCDJ-UHFFFAOYSA-N 0.000 description 1
- BFSVOASYOCHEOV-UHFFFAOYSA-N 2-diethylaminoethanol Chemical compound CCN(CC)CCO BFSVOASYOCHEOV-UHFFFAOYSA-N 0.000 description 1
- VXUGVISSBXKUEL-UHFFFAOYSA-N 2-hydroxypropanoic acid;2-oxopropanoic acid Chemical compound CC(O)C(O)=O.CC(=O)C(O)=O VXUGVISSBXKUEL-UHFFFAOYSA-N 0.000 description 1
- 229930024421 Adenine Natural products 0.000 description 1
- GFFGJBXGBJISGV-UHFFFAOYSA-N Adenine Chemical compound NC1=NC=NC2=C1N=CN2 GFFGJBXGBJISGV-UHFFFAOYSA-N 0.000 description 1
- 108010088751 Albumins Proteins 0.000 description 1
- 102000009027 Albumins Human genes 0.000 description 1
- UYIFTLBWAOGQBI-BZDYCCQFSA-N Benzhormovarine Chemical compound C([C@@H]1[C@@H](C2=CC=3)CC[C@]4([C@H]1CC[C@@H]4O)C)CC2=CC=3OC(=O)C1=CC=CC=C1 UYIFTLBWAOGQBI-BZDYCCQFSA-N 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- 239000002126 C01EB10 - Adenosine Substances 0.000 description 1
- 238000010453 CRISPR/Cas method Methods 0.000 description 1
- 238000010443 CRISPR/Cpf1 gene editing Methods 0.000 description 1
- 241000589875 Campylobacter jejuni Species 0.000 description 1
- 206010007572 Cardiac hypertrophy Diseases 0.000 description 1
- 208000006029 Cardiomegaly Diseases 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 108020004635 Complementary DNA Proteins 0.000 description 1
- MIKUYHXYGGJMLM-GIMIYPNGSA-N Crotonoside Natural products C1=NC2=C(N)NC(=O)N=C2N1[C@H]1O[C@@H](CO)[C@H](O)[C@@H]1O MIKUYHXYGGJMLM-GIMIYPNGSA-N 0.000 description 1
- 229920000089 Cyclic olefin copolymer Polymers 0.000 description 1
- UHDGCWIWMRVCDJ-PSQAKQOGSA-N Cytidine Natural products O=C1N=C(N)C=CN1[C@@H]1[C@@H](O)[C@@H](O)[C@H](CO)O1 UHDGCWIWMRVCDJ-PSQAKQOGSA-N 0.000 description 1
- NYHBQMYGNKIUIF-UHFFFAOYSA-N D-guanosine Natural products C1=2NC(N)=NC(=O)C=2N=CN1C1OC(CO)C(O)C1O NYHBQMYGNKIUIF-UHFFFAOYSA-N 0.000 description 1
- 238000007400 DNA extraction Methods 0.000 description 1
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 1
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 1
- 101100228739 Danio rerio mstnb gene Proteins 0.000 description 1
- 101100206935 Danio rerio tll1 gene Proteins 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 1
- 102000002322 Egg Proteins Human genes 0.000 description 1
- 108010000912 Egg Proteins Proteins 0.000 description 1
- 102100031780 Endonuclease Human genes 0.000 description 1
- 108010042407 Endonucleases Proteins 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- 108700024394 Exon Proteins 0.000 description 1
- 102100035233 Furin Human genes 0.000 description 1
- 108090001126 Furin Proteins 0.000 description 1
- 229940121710 HMGCoA reductase inhibitor Drugs 0.000 description 1
- 229920000209 Hexadimethrine bromide Polymers 0.000 description 1
- 206010020772 Hypertension Diseases 0.000 description 1
- 206010022489 Insulin Resistance Diseases 0.000 description 1
- 108091092195 Intron Proteins 0.000 description 1
- 101150048453 MSTN gene Proteins 0.000 description 1
- 241000588650 Neisseria meningitidis Species 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- 229930182555 Penicillin Natural products 0.000 description 1
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 241000194017 Streptococcus Species 0.000 description 1
- 241000194020 Streptococcus thermophilus Species 0.000 description 1
- 101800005109 Triakontatetraneuropeptide Proteins 0.000 description 1
- 210000001015 abdomen Anatomy 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 229960000643 adenine Drugs 0.000 description 1
- 229960005305 adenosine Drugs 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 239000003855 balanced salt solution Substances 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- DRTQHJPVMGBUCF-PSQAKQOGSA-N beta-L-uridine Natural products O[C@H]1[C@@H](O)[C@H](CO)O[C@@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-PSQAKQOGSA-N 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 238000001574 biopsy Methods 0.000 description 1
- 210000001124 body fluid Anatomy 0.000 description 1
- 239000010839 body fluid Substances 0.000 description 1
- 238000010804 cDNA synthesis Methods 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 244000309466 calf Species 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 230000024245 cell differentiation Effects 0.000 description 1
- 230000007910 cell fusion Effects 0.000 description 1
- 210000000349 chromosome Anatomy 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 238000012790 confirmation Methods 0.000 description 1
- 210000002808 connective tissue Anatomy 0.000 description 1
- 238000011109 contamination Methods 0.000 description 1
- 238000009402 cross-breeding Methods 0.000 description 1
- 210000004748 cultured cell Anatomy 0.000 description 1
- UFULAYFCSOUIOV-UHFFFAOYSA-N cysteamine Chemical compound NCCS UFULAYFCSOUIOV-UHFFFAOYSA-N 0.000 description 1
- UHDGCWIWMRVCDJ-ZAKLUEHWSA-N cytidine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O1 UHDGCWIWMRVCDJ-ZAKLUEHWSA-N 0.000 description 1
- 210000000805 cytoplasm Anatomy 0.000 description 1
- 229940104302 cytosine Drugs 0.000 description 1
- 230000002939 deleterious effect Effects 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- 230000013020 embryo development Effects 0.000 description 1
- 238000002692 epidural anesthesia Methods 0.000 description 1
- 239000003797 essential amino acid Substances 0.000 description 1
- 229960005309 estradiol Drugs 0.000 description 1
- 229950002007 estradiol benzoate Drugs 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 238000010195 expression analysis Methods 0.000 description 1
- 210000003953 foreskin Anatomy 0.000 description 1
- 239000012634 fragment Substances 0.000 description 1
- 230000037433 frameshift Effects 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 238000010362 genome editing Methods 0.000 description 1
- 230000002710 gonadal effect Effects 0.000 description 1
- 229940029575 guanosine Drugs 0.000 description 1
- 210000003780 hair follicle Anatomy 0.000 description 1
- 230000005802 health problem Effects 0.000 description 1
- 125000005842 heteroatom Chemical group 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 238000007726 management method Methods 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 229960003151 mercaptamine Drugs 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- WIQKYZYFTAEWBF-UHFFFAOYSA-L motexafin lutetium hydrate Chemical compound O.[Lu+3].CC([O-])=O.CC([O-])=O.C1=C([N-]2)C(CC)=C(CC)C2=CC(C(=C2C)CCCO)=NC2=CN=C2C=C(OCCOCCOCCOC)C(OCCOCCOCCOC)=CC2=NC=C2C(C)=C(CCCO)C1=N2 WIQKYZYFTAEWBF-UHFFFAOYSA-L 0.000 description 1
- 230000004899 motility Effects 0.000 description 1
- 230000037257 muscle growth Effects 0.000 description 1
- 230000003387 muscular Effects 0.000 description 1
- 125000003835 nucleoside group Chemical group 0.000 description 1
- 230000030648 nucleus localization Effects 0.000 description 1
- 210000004681 ovum Anatomy 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 229940049954 penicillin Drugs 0.000 description 1
- 210000003899 penis Anatomy 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 229960003387 progesterone Drugs 0.000 description 1
- 239000000186 progesterone Substances 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 230000004853 protein function Effects 0.000 description 1
- 238000003753 real-time PCR Methods 0.000 description 1
- 210000000664 rectum Anatomy 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000008929 regeneration Effects 0.000 description 1
- 238000011069 regeneration method Methods 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 238000010972 statistical evaluation Methods 0.000 description 1
- 229960005322 streptomycin Drugs 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 238000010257 thawing Methods 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 238000003146 transient transfection Methods 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- NMEHNETUFHBYEG-IHKSMFQHSA-N tttn Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1[C@@H](CCC1)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)[C@@H](C)O)[C@@H](C)O)C1=CC=CC=C1 NMEHNETUFHBYEG-IHKSMFQHSA-N 0.000 description 1
- DRTQHJPVMGBUCF-UHFFFAOYSA-N uracil arabinoside Natural products OC1C(O)C(CO)OC1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-UHFFFAOYSA-N 0.000 description 1
- 229940045145 uridine Drugs 0.000 description 1
- 238000010200 validation analysis Methods 0.000 description 1
- 238000012795 verification Methods 0.000 description 1
- 108700026220 vif Genes Proteins 0.000 description 1
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K67/00—Rearing or breeding animals, not otherwise provided for; New or modified breeds of animals
- A01K67/027—New or modified breeds of vertebrates
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K67/00—Rearing or breeding animals, not otherwise provided for; New or modified breeds of animals
- A01K67/027—New or modified breeds of vertebrates
- A01K67/0275—Genetically modified vertebrates, e.g. transgenic
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/475—Growth factors; Growth regulators
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
- C12N9/22—Ribonucleases RNAses, DNAses
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2217/00—Genetically modified animals
- A01K2217/07—Animals genetically altered by homologous recombination
- A01K2217/075—Animals genetically altered by homologous recombination inducing loss of function, i.e. knock out
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2217/00—Genetically modified animals
- A01K2217/15—Animals comprising multiple alterations of the genome, by transgenesis or homologous recombination, e.g. obtained by cross-breeding
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2227/00—Animals characterised by species
- A01K2227/10—Mammal
- A01K2227/101—Bovine
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2267/00—Animals characterised by purpose
- A01K2267/02—Animal zootechnically ameliorated
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/20—Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPRs]
Definitions
- the present application relates to a transgenic animal or cell having a modified gene.
- the transgenic animal or cell has a myostatin gene in which 12 base pairs are deleted in the second exon.
- the present application relates to a technology related to the production of the transgenic animal or cell.
- Myostatin means muscle (myo) + inhibitor (statin) from the name, and as research continues since then, it is already known that myostatin protein inhibits muscle differentiation and growth. Research on myostatin regulating the differentiation and growth of muscle cells through gene regulation by using a gene editing tool in several animal models has been conducted.
- the present applicants tried to obtain a healthy, myostatin transgenic animal with increased muscle mass.
- the transgenic cattle of the present application have a specific type of myostatin mutation, confirming that they are transgenic animals without conventional side effects, and completed the present invention.
- Patent Document 1 CN 104531705A
- Patent Document 2 CN 107034221A
- Non-Patent Document 1 Am J Physiol Endocrinol Metab. 2017 Mar 1;312(3): E150-E160, Myostatin propeptide mutation of the hypermuscular Compact mice decreases the formation of myostatin and improves insulin sensitivity
- One purpose of this application is, To provide an animal having a myostatin gene in which 12 base pairs of the second exon are deleted.
- Another object of the present application is to provide an embryo having a myostatin gene in which 12 base pairs of the second exon are deleted.
- Another object of the present application is to provide a composition for deleting 12 base pairs of the second exon of the myostatin gene.
- Another object of the present application is to provide a use for inducing an increase in muscle in an animal's muscle using the composition.
- the present specification provides a transgenic animal having a myostatin gene modified in a specific part.
- the modification may occur in the second exon of the myostatin gene.
- This modification is a deletion of 12 base pairs corresponding to the region encoding the amino acid sequence of the sequence of leucine, tryptophan, isoleucine, and tyrosine in the second exon compared to the myostatin gene sequence of a wild-type animal.
- the nucleic acid encoding the amino acid sequence of the sequence of leucine, tryptophan, isoleucine, and tyrosine may include one or more sequences encoding each amino acid.
- sequence encoding the leucine may be one selected from 5'-CTT-3', 5'-CTC-3', 5'-CTA-3', or 5'-CTG-3', and tryptophan
- the coding sequence may be 5'-TGG-3'
- the isoleucine coding sequence may be one selected from 5'-ATT-3', 5'-ATC-3', or 5'-ATA-3'
- sequence encoding tyrosine may be one selected from 5'-TAT-3', or 5'-TAC-3'.
- the transgenic animals have less myostatin mRNA expression than wild-type animals.
- the transgenic animal may express a mature myostatin protein having the same amino acid sequence as that of a wild-type animal.
- the transgenic animal may have an externally increased muscle mass than the wild-type animal.
- the transgenic animal includes a mammal.
- Such mammals include ungulates.
- the ungulate includes artiodactyl.
- the cows may include, but are not limited to, pigs, deer, cattle, sheep, and goats.
- the mammal may include a rodent.
- the rodent may include, but is not limited to, mice and rats.
- the transgenic animal in the present application is a cow.
- the cow expresses a pro-myostatin protein consisting of the amino acid sequence shown in SEQ ID NO: 30.
- the present application provides a transformed cell having a myostatin gene in which a specific part is modified.
- the modification of the transformed cell may occur in the second exon of the myostatin gene.
- This modification is a deletion of 12 base pairs corresponding to the region encoding the amino acid sequence of the sequence of leucine, tryptophan, isoleucine, and tyrosine in the second exon compared to the myostatin gene sequence of the wild-type cell.
- the nucleic acid encoding the amino acid sequence of the sequence of leucine, tryptophan, isoleucine, and tyrosine may include one or more sequences encoding each amino acid.
- sequence encoding leucine may be one of 5'-CTT-3', 5'-CTC-3', 5'-CTA-3', or 5'-CTG-3'
- sequence to be 5'-TGG-3' the sequence encoding isoleucine may be one of 5'-ATT-3', 5'-ATC-3', or 5'-ATA-3'
- tyrosine The coding sequence may be either 5'-TAT-3' or 5'-TAC-3'.
- the transgenic cells have less myostatin mRNA expression than the wild-type cells.
- the transformed cell may express a mature myostatin protein having the same amino acid sequence as that of a wild-type animal.
- the cells may be embryonic cells, somatic cells or stem cells.
- the cells include, but are not limited to, cumulus cells, epithelial cells, fibroblasts, nerve cells, keratinocytes, hematopoietic cells, melanocytes, chondrocytes, macrophages, monocytes, muscle cells, B lymphocytes, T lymphocytes , embryonic stem cells, embryonic germ cells, fetal-derived cells, placental cells and embryonic cells.
- tissue-derived stem cells such as fat, uterus, bone marrow, muscle, placenta, umbilical cord blood, or skin (epithelium) can be used.
- a non-human host embryo may generally be an embryo comprising a 2-cell stage, a 4-cell stage, an 8-cell stage, a 16-cell stage, a 32-cell stage, a 64-cell stage, a morula, or a blastocyst. .
- the cells may be obtained from a mammal.
- the cells of the present application can be obtained from cattle.
- the transformed cell may express the pro-myostatin protein of the amino acid sequence shown in SEQ ID NO: 30.
- the present application provides a composition for modifying the myostatin gene.
- composition is used to modify the myostatin gene
- a guide RNA comprising a guide sequence that forms a complementary bond with a target sequence or a DNA encoding the guide RNA
- It may include a Cas protein or a nucleic acid sequence encoding the same.
- the target sequence may include at least one selected from SEQ ID NO: 38 to SEQ ID NO: 60.
- the guide sequence may include at least one selected from SEQ ID NO: 624 to SEQ ID NO: 84.
- the Cas protein is one selected from a Streptococcus pyogenes-derived Cas9 protein, a Staphylococcus aureus-derived Cas9 protein, or a Cas 12a protein (conventional CPF1: Prevotella and Francisella 1) protein.
- the nucleic acid encoding the Cas protein is a Streptococcus pyogenes-derived Cas9 protein, Staphylococcus aureus-derived Cas9 protein, or Cas 12a protein (conventional CPF1: Prevotella and Francisella 1) protein. It may be one selected from among nucleic acids encoding
- composition may be present in a plasmid vector in the form of DNA encoding a guide RNA and a Cas protein.
- composition may be present in a viral vector in the form of DNA encoding a guide RNA and a Cas protein.
- the viral vector may be one or more selected from the group consisting of a retroviral vector, a lentiviral vector, an adenovirus vector, an adeno-associated virus (AAV) vector, a vaccinia virus vector, a poxvirus vector, and a herpes simplex virus vector.
- composition for genetic manipulation may be in the form of a complex (RNP: ribonucleoprotein) in which a guide RNA and a Cas protein are combined.
- RNP ribonucleoprotein
- the present application provides a method for preparing a cell or embryo having a myostatin gene modified with the composition.
- contacting the cell or embryo with the composition may include The contacting may be performed in vivo or ex vivo.
- the contacting step may be performed by one or more methods selected from microinjection, electroporation, liposomes, plasmids, viral vectors, nanoparticles, and protein translocation domain (PTD) fusion protein methods.
- the present application provides a method for producing an animal having a modified myostatin gene.
- the method for producing a myostatin transgenic animal of the present application includes the steps of contacting an embryo with the above-described composition to prepare a transgenic embryo having a transformed gene, and transplanting the transformed embryo into a surrogate mother can do.
- Animals produced by the above production method express less myostatin mRNA than wild-type animals.
- the animal may be a mammal other than a human.
- the myostatin transgenic animal of the present application may have an increased amount of muscle compared to a wild-type animal due to a low myostatin mRNA expression level.
- myostatin transgenic animals Conventional myostatin transgenic animals have a short lifespan and several side effects, but the myostatin transgenic animals of the present application can provide healthy myostatin transgenic animals without various side effects.
- composition provided by the present application may be provided as a composition for increasing muscle when a composition capable of modifying the myostatin gene is injected into an animal tissue.
- FIG. 1 is a schematic diagram of the modified position of the myostatin gene, and lists the protospacer sequence used as an example of the present application.
- FIG. 2 is a schematic diagram of a method for constructing a transgenic embryo having a myostatin gene in which 12 base pairs of the second exon are deleted.
- FIG. 3 is a view showing the myostatin gene modification of a transgenic embryo having a myostatin gene in which 12 base pairs of the second exon are deleted by T7E1 assay.
- FIG. 4 shows the protospacer sequence of the myostatin gene, and Sanger sequencing was performed on the myostatin-transformed embryo with a guide RNA containing a sequence binding to its complementary target sequence. it has been confirmed
- FIG. 5 shows that guide RNA and CAS9 mRNA amounts most appropriate for the present application are confirmed by varying the amounts of guide RNA or Cas9 mRNA used to induce deletion of 12 base pairs of the second exon of the myostatin gene.
- 6 is a photograph taken to confirm the appearance once a month for 1 to 4 months after birth as a cow having a myostatin gene in which 12 base pairs of the second exon are deleted.
- FIG. 8 is a T7E1 assay confirming five sequences for potential off-target positions in order to confirm the off-target effect that may be caused by CRISPR/Cas9. By mixing or not mixing wild-type DNA, it was confirmed that hetero knock-out or homo knock-out did not occur for all 5 off-target sites.
- 9 is a result of deep sequencing of 17 cows born after implantation of the embryo generated by the method of the schematic diagram of FIG. 2 into the womb of a surrogate mother, confirming the deletion of 12 base pairs of the myostatin gene.
- 10 is a list of deep sequencing results of wild-type cattle as a negative control of cattle having a myostatin gene in which 12 base pairs of the second exon are deleted.
- Figure 11 lists the results of deep sequencing of cattle 6 having a myostatin gene in which 12 base pairs of the second exon are deleted.
- 12 is a list of deep sequencing results of cattle 14 having a myostatin gene in which 12 base pairs of the second exon are deleted.
- 13 is a list of deep sequencing results of cattle 17 having a myostatin gene in which 12 base pairs of the second exon are deleted.
- FIG. 14 is a view illustrating the myostatin mRNA expression levels of cattle 14 and 17 having a myostatin gene in which 12 base pairs of the second exon are deleted.
- 16 is an image of somatic cells derived from follicle fluid obtained during the OPU process.
- Figure 19 shows the summary results of MSTN male founder semen by Computer Assisted Semen Analysis.
- the conserved region of the myostatin gene refers to a nucleic acid sequence encoding a region in which the myostatin amino acid sequence conserved by species during evolution is not modified and conserved.
- the 'species conserved region of the myostatin gene' includes a nucleic acid sequence encoding amino acids in the order of leucine, tryptophan, isoleucine, and tyrosine among the amino acid sequences of myostatin conserved by each species (Table see 3).
- the amino acid sequence of myostatin conserved for each species may have the same amino acid sequence, but may have multiple codons for the base encoding the amino acid. That is, the sequence encoding leucine may be one of 5'-CTT-3', 5'-CTC-3', 5'-CTA-3', or 5'-CTG-3', and The sequence to be 5'-TGG-3', the sequence encoding isoleucine may be one of 5'-ATT-3', 5'-ATC-3', or 5'-ATA-3', and tyrosine The coding sequence may be either 5'-TAT-3' or 5'-TAC-3'.
- nucleic acid sequence of the 'conserved region of the myostatin gene for each species' of the present application may be different.
- conserved region of the myostatin gene is also abbreviated as 'conserved region' or the like.
- the term 'transgenic animal' refers to an animal having a modified myostatin gene.
- a 'transgenic animal' has a myostatin gene in which 12 base pairs of the second exon are deleted and expresses a mature myostatin protein of the same sequence as that of a wild-type animal.
- the trait of the modified myostatin gene of the transgenic animal in the present application is inherited to the offspring.
- the first-generation animal F0 has a modified myostatin gene.
- the animal F0 is capable of producing progeny F1.
- the myostatin gene included in the F1 and F1 descendants has the same nucleotide sequence as the modified myostatin gene.
- the term 'transgenic animal' includes the above F0, F1, and F1 or less progeny. That is, even when direct artificial manipulation for transformation is not applied during the production process of animal F1 or after animal F1 is produced, if animal F1 has a modified myostatin gene, it is the transgenic animal of the present application. .
- Animals in the present application include non-human animals.
- Such animals include mammals.
- Such mammals include ungulates.
- the ungulate includes artiodactyl.
- the cows may include, but are not limited to, pigs, deer, cattle, sheep, and goats.
- the mammal may include a rodent.
- the rodent may include, but is not limited to, mice and rats.
- target region' of the present application means including a region to artificially manipulate a gene on a wild-type genome in order to construct a transgenic animal, and is a region including the protospacer sequence and the target sequence indicated below.
- the term 'protospacer sequence' in the present application means 20 sequences adjacent to the PAM sequence by the position of the PAM sequence in the target region of the present application.
- the protospacer sequence and the target sequence are complementary sequences. That is, it refers to a sequence identical to the guide sequence complementary to the target sequence. However, the guide sequence may have the same sequence in which T (thymine) of the protospacer sequence is substituted with U (uracil).
- target sequence' of the present application is a sequence included in the target region of the present application, and is a sequence complementary to a protospacer sequence.
- the target sequence may be complementary to a guide sequence.
- the symbols A, T, C, G, and U are interpreted as meanings understood by those of ordinary skill in the art. It may be properly interpreted as a base, a nucleoside, or a nucleotide on DNA or RNA according to context and technology.
- nucleoside when it means a base, it can be interpreted as adenine (A), thymine (T), cytosine (C), guanine (G), or uracil (U) itself, respectively, and when it means a nucleoside, It can be interpreted as adenosine (A), thymine (T), cytidine (C), guanosine (G) or uridine (U), respectively, and when it refers to a nucleotide in the sequence, it includes each of the nucleosides should be construed as meaning a nucleotide that
- the present application relates to a transgenic animal having a myostatin gene in which 12 base pairs of the second exon are deleted.
- the transgenic animal of the present application is characterized in that it comprises a modification of the myostatin gene.
- the myostatin gene of higher organisms known to date is characterized by being composed of three exons and two introns. Most of the myostatin gene is known to be present in muscle.
- Myostatin mRNA produces myostatin protein composed of about 375 amino acids, and myostatin protein has three major parts, namely, a signal peptide region, a propeptide (prodomain) region; 28 kDa, N-terminus] and a mature region (12 kDa, C-terminus).
- the structure of promyostatin, a precursor protein, is two identical subunits, and the maturation region is disulfide-bonded with each other, thereby maintaining the form of a homodimeric protein.
- the signal transduction pathway of the myostatin protein As for the signal transduction pathway of the myostatin protein, it is divided into a propeptide region and a maturation region after first cleavage by a furin enzyme in the structure of promyostatin, a precursor protein. After cleavage, in the latent complex, the propeptide region binds to the mature region through a non-covalent bond. Then, as it is secreted out of the cell, the second cleavage is carried out by BMP/Tolloid, and the myostatin maturation zone binds to activin type II receptors and is phosphorylated.
- the signal is transmitted back to the activin type I receptor, and the signal is transmitted to Smed 2 and Smad 3, which are receptor-regulated proteins, and , Smed 2 and Smed 3 bind to co-Smad 4 to regulate the transcription of the target gene.
- Smed 2 and Smad 3 are receptor-regulated proteins, and , Smed 2 and Smed 3 bind to co-Smad 4 to regulate the transcription of the target gene.
- myostatin gene transgenic animals are genetically modified so that the myostatin protein, which inhibits muscle growth, is not expressed in somatic cells.
- myostatin protein which inhibits muscle growth
- it is a form in which the expression of the mature myostatin protein is suppressed.
- the animal obtained by cloning the somatic cells by the nuclear transfer method has a double musling form with increased muscle mass than that of the wild-type animal.
- the myostatin transgenic animals obtained by the above method have a disadvantage in that they have a short lifespan. Accordingly, there are disadvantages in that problems of reproduction and fatal side effects occur in health, especially in large animals.
- the present application relates to a transgenic animal in which the side effects caused by the conventional myostatin genetic modification are minimized and the advantages of the myostatin gene modification are emphasized.
- the expression of the mature myostatin protein was suppressed compared to that of the wild type, not not expressed. form of animals.
- myostatin transgenic animal having a modified myostatin gene.
- it may be an ungulate animal, such as a cow.
- the transgenic animal of the present application may have a different configuration of the myostatin gene from that of the wild-type animal in the configuration of the myostatin gene.
- the genetic modification of the present application means a deletion of a nucleic acid sequence encoding four amino acid sequences (amino acids in the order of leucine, tryptophan, isoleucine, and tyrosine) of a specific conserved region among the amino acid sequence of the myostatin protein.
- the transgenic animal of the present application has a myostatin gene in which 12 base pairs of the second exon, which is a nucleic acid sequence encoding the amino acid sequence of the conserved region, are deleted.
- the deletion of 12 base pairs is a base pair (5' to 3') of positions 93 to 104 of the sequence encoding the second exon of the wild-type myostatin gene. It may be a deletion of the sequence).
- the deletion of 12 base pairs may be a deletion of the base pair at positions 94 to 105 of the sequence encoding the second exon of the wild-type myostatin gene.
- the transgenic animal of the present application may have a different aspect from the myostatin mRNA of a wild-type animal.
- the transgenic animal of the present application has myostatin mRNA in which 12 bases are deleted.
- the amount of myostatin mRNA expression in the transgenic animal may be measured.
- the transgenic animal of the present application has an amount of myostatin mRNA expression that is at least 60% less, or more, less than that of a wild-type animal.
- the amount of myostatin mRNA expression in the transgenic animal of the present application is lower than that of the wild-type animal, but does not express the myostatin mRNA.
- the deleted 12 base pairs of the transgenic animal of the present application is a nucleic acid encoding a conserved amino acid sequence in which the amino acid sequence of each species is not modified in the course of the evolution of the myostatin gene.
- the conserved amino acid sequence is the amino acid sequence of leucine, tryptophan, isoleucine, and tyrosine.
- the transgenic animal of the present application expresses the myostatin protein in which four amino acids in the order of leucine, tryptophan, isoleucine, and tyrosine are deleted compared to the wild-type promyostatin protein.
- the pro myostatin protein in which the four amino acids are deleted may be one of SEQ ID NOs: 30 to 33.
- the promyostatin protein of the transgenic animal may have some sequence modifications, it may have 90% or more homology with one of SEQ ID NOs: 30 to 33.
- the transgenic animal when the transgenic animal is a cow, the promyostatin protein of SEQ ID NO: 30 in which 4 amino acids are deleted may be expressed.
- the transgenic animal is a pig
- the promyostatin protein of SEQ ID NO: 31 in which 4 amino acids are deleted may be expressed.
- the transgenic animal when the transgenic animal is a mouse, the pro-myostatin protein of SEQ ID NO: 32 in which 4 amino acids are deleted may be expressed.
- the transgenic animal when the transgenic animal is a human, the promyostatin protein of SEQ ID NO: 33 in which 4 amino acids are deleted may be expressed.
- the four amino acids to be deleted do not overlap with the region to be cleaved in the process of forming the mature myostatin protein of the pro-myostatin protein.
- the pro-myostatin protein becomes a mature myostatin protein through a normal signaling process. That is, the deletion of a specific amino acid of the present application does not affect the formation of a normal mature myostatin protein.
- the mature myostatin protein expressed by the myostatin transgenic animal of the present application is the same as that of the wild type. That is, it is characterized in that it is identical to the amino acid sequence of the wild-type mature myostatin protein.
- the mature myostatin protein of the transgenic animal may be one of SEQ ID NOs: 34 to 37.
- the mature myostatin protein of the transgenic animal may be modified in some sequences, but may have 90% or more homology with one of SEQ ID NOs: 34 to 37.
- the transgenic animal when the transgenic animal is a cow, the mature myostatin protein of SEQ ID NO: 34 identical to that of a wild-type cow may be expressed.
- the transgenic animal when the transgenic animal is a pig, the mature myostatin protein of SEQ ID NO: 35 identical to that of a wild-type pig may be expressed.
- the transgenic animal when the transgenic animal is a mouse, it is possible to express the mature myostatin protein of SEQ ID NO: 36 identical to that of a wild-type mouse.
- the transgenic animal when the transgenic animal is a human, it may express the mature myostatin protein of SEQ ID NO: 37 identical to that of a wild-type human.
- Mature myostatin protein may have a monomeric or dimeric form in the blood.
- the transgenic animal of the present application may express the mature myostatin protein in the same form as that of the wild type. That is, the mature myostatin protein of the transgenic animal of the present application has the same amino acid sequence as the mature myostatin protein of the wild-type animal.
- the mature myostatin protein of the transgenic animal can be compared and confirmed with the wild-type mature myostatin protein through mass spectrometry.
- the expression amount of the mature myostatin protein in the transgenic animal of the present application may be reduced than the expression amount of the mature myostatin protein in the wild-type animal. This result can also be seen through the decrease in the amount of myostatin mRNA expression of the transgenic animal of the present application compared to the amount of myostatin mRNA expression of the wild type (see FIG. 14 ).
- the transgenic animal of the present application exhibits a phenotype with developed muscles due to reduced expression of myostatin mRNA and mature myostatin protein compared to wild-type animals.
- the muscle-developed phenotype refers to phenotypes such as an increase in muscle mass, an increase in the number of muscle cells, an increase in the size of muscle cells, and an increase in the rate of muscle cell differentiation.
- the transgenic animal of the present application has an increase in muscle mass of at least 1%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, or 40% or more compared to a wild-type animal can be
- the transgenic animal of the present application does not express myostatin mRNA and mature myostatin protein, unlike the conventional myostatin transgenic animal. That is, the expression of the myostatin mRNA and mature myostatin protein is reduced compared to a wild-type animal that does not express it.
- cows having the myostatin gene in which 12 base pairs of the present application were deleted had no health and no abnormalities in health.
- a cow having a myostatin gene with a deletion of 12 base pairs of the present application can reproduce offspring through reproduction.
- Another aspect of the present application is a myostatin-transformed cell having a modified myostatin gene.
- the cells may be embryonic cells, somatic cells or stem cells.
- the cells include, but are not limited to, cumulus cells, epithelial cells, fibroblasts, neurons, keratinocytes, hematopoietic cells, melanocytes, chondrocytes, macrophages, monocytes, myocytes , B lymphocytes, T lymphocytes, embryonic stem cells, embryonic germ cells, fetal-derived cells, placental cells and embryonic cells.
- tissue-derived stem cells such as fat, uterus, bone marrow, muscle, placenta, umbilical cord blood, or skin (epithelium) can be used.
- a non-human host embryo may generally be an embryo comprising a 2-cell stage, a 4-cell stage, an 8-cell stage, a 16-cell stage, a 32-cell stage, a 64-cell stage, a morula, or a blastocyst. .
- Characteristics of the transgenic cells of the present application are the same as characteristics 1 to 3 of the above transgenic animals.
- the transformed cell has a myostatin gene in which 12 base pairs of the second exon are deleted.
- the genetic modification of the transformed cell means a deletion of the nucleic acid sequence encoding the four amino acid sequences (amino acids in the order of leucine, tryptophan, isoleucine, and tyrosine) of a specific conserved region among the amino acid sequence of the myostatin protein. do. Accordingly, the transformed cell has a myostatin gene in which 12 base pairs of the second exon, which is a nucleic acid sequence encoding the amino acid sequence of the conserved region, are deleted.
- the transformed cell may have a different aspect from the myostatin mRNA of wild-type cells.
- the transformed cell of the present application has myostatin mRNA in which 12 bases are deleted.
- the amount of myostatin mRNA expression is lower than that of wild-type animals.
- Prepro-myostatin protein must go through a cleavage step in order to become a mature myostatin protein in an active state.
- the pro-myostatin protein becomes a mature myostatin protein through a normal signaling process. That is, the deletion of a specific amino acid of the present application does not affect the formation of a normal mature myostatin protein.
- the mature myostatin protein expressed by the cell in which 12 base pairs of the myostatin gene of the present application are deleted has the same amino acid sequence as the mature myostatin protein of the wild-type cell.
- composition for genetic manipulation composition for genetic manipulation
- composition for genetic manipulation of modifying a myostatin gene in another aspect of the invention provided in the present application, there is provided a composition for genetic manipulation of modifying a myostatin gene.
- composition for genetic manipulation is to modify the myostatin gene
- a guide RNA comprising a guide sequence that forms a complementary bond with a target sequence of the myostatin gene or a DNA encoding the guide RNA
- It may include a Cas protein or a nucleic acid sequence encoding the same.
- the target sequence is a target target of the composition, and has a sequence complementary to a protospacer sequence included in the target region.
- the target sequence is located in the second exon (Exon 2) of the myostatin gene.
- composition of the present application targets the myostatin gene in order to modify the myostatin gene.
- the portion that the composition can target is referred to as a target region.
- the target region is located in the second exon (Exon 2) of the myostatin gene.
- the target region includes a target sequence and a protospacer sequence, and a sequence to which the guide sequence of the composition complementarily binds is referred to as a target sequence.
- the target sequence is configured to include some or all of the sequence encoding the conserved amino acid sequence of the myostatin protein for each species described below.
- conserved amino acid sequences of promyostatin proteins by species are described in detail.
- the conserved amino acid sequence is described in comparison with humans, pigs, and mice based on cattle. Animals having the conserved amino acid sequence are not limited thereto.
- the specific amino acid deletion position of the promyostatin protein of the present application is this conserved amino acid sequence, that is, the 156th to 159th amino acid sequence of the myostatin protein.
- This amino acid sequence is located at positions 157 to 160 of the myostatin protein in the mouse, but the amino acid sequence is the same in the mouse as leucine, tryptophan, isoleucine, and tyrosine.
- the region targeted by the composition in the present application may include a part or all of a region encoding such a conserved amino acid sequence.
- a target sequence may be designed around one strand of the DNA double strand including the conserved region.
- the target sequence is 5'-CTT-3', 5'-CTC-3', 5'-CTA-3', or 5'-CTG-3' encoding leucine of the amino acid sequence, 5' encoding tryptophan - TGG-3', 5'-ATT-3' encoding isoleucine, 5'-ATC-3', or 5'-ATA-3', 5'-TAT-3' encoding tyrosine, or 5 It may include part or all of the sequence of '-TAC-3', or part or all of the complementary sequence of this sequence.
- the target sequence may include SEQ ID NO: 28 - 5'-ATATATCCACAG-3'.
- the target sequence may include SEQ ID NO: 29-5'-CTGTGGATATAT-3'.
- the PAM sequence in the target region should be considered.
- the PAM sequence may differ depending on the origin of the Cas protein.
- the PAM sequence and sequences adjacent thereto are referred to as protospacer sequences.
- the protospacer sequence consists of 20 or less nucleotide sequences, excluding the PAM sequence.
- the protospacer sequence and the target sequence are complementary sequences.
- the target sequence of the myostatin gene may be at least one selected from SEQ ID NO: 38 to SEQ ID NO: 60 of [Table 4].
- SEQ ID Nos: 38 to 43 may be target sequences of bovine myostatin gene.
- SEQ ID NO: 42, SEQ ID NO: 43, and SEQ ID NO: 45 to SEQ ID NO: 48 may be target sequences of a porcine myostatin gene.
- SEQ ID NO: 49 to SEQ ID NO: 55 may be a target sequence of a human myostatin gene.
- SEQ ID NOs: 56 to 60 may be target sequences of a mouse myostatin gene.
- the composition of the present application comprises a guide RNA comprising a guide sequence complementary to each of the target sequences or a DNA encoding the RNA; and a CAS protein or a nucleic acid sequence encoding the same.
- the guide RNA of the present application includes a guide sequence complementary to the above-described target sequence.
- the guide RNA may include a first sequence that is a guide sequence capable of complementary binding to the target sequence, and a second sequence that interacts with a Cas protein to form a complex.
- the first sequence of the guide RNA of the present application is a sequence homologous to a protospacer sequence, which is a sequence complementary to the designed target sequence, and is an RNA sequence composed of U (uracil) instead of T (thymine) among the corresponding protospacer sequences.
- the first sequence of the present application may be a part of crRNA, and the second sequence may include another part of crRNA and/or tracrRNA.
- the guide RNA may be first and second sequences consisting of only crRNA, and as another example, the guide RNA may be first and second sequences including crRNA and tracrRNA.
- the first sequence may be determined according to the target sequence, and a part of the second sequence may be determined according to the type of the microorganism derived from the Cas protein.
- the first sequence may be a part of a crRNA sequence
- the second sequence may include a tracrRNA
- the second sequence is
- the guide RNA of the present application may be in the form of a single sequence in which the first sequence and the second sequence are linked. Alternatively, it may be configured in the form of two separate sequences consisting of a sequence including the first sequence and a sequence including a portion of the second sequence, which may be comprised of crRNA and tracrRNA, respectively.
- guide sequence shown in [Table 5] is an RNA sequence capable of complementary binding to the target sequence of the myostatin gene.
- the guide sequences shown in Table 5 are guide sequences capable of targeting the sequences in Table 2, respectively.
- the guide sequence of the present application may be one or more sequences selected from SEQ ID NO: 62 to SEQ ID NO: 84.
- SEQ ID NOs: 62 to 68 are guide sequences capable of complementary binding to a target sequence of a bovine myostatin gene.
- SEQ ID NO: 66, SEQ ID NO: 67, and SEQ ID NO: 69 to SEQ ID NO: 72 are guide sequences capable of complementary binding to a target sequence of a porcine myostatin gene.
- SEQ ID NOs: 73 to 79 are guide sequences capable of complementary binding to a target sequence of a human myostatin gene.
- SEQ ID NO: 80 to SEQ ID NO: 84 are guide sequences capable of complementary binding to a target sequence of a mouse myostatin gene.
- the guide RNA including the guide sequence and the Cas protein may be injected into cells or embryos in the form of a conjugated complex (Ribonucleoprotein particle: RNP).
- RNP conjugated complex
- the present application may provide a DNA encoding the guide RNA.
- the DNA sequence encoding the guide RNA is a sequence encoding a guide sequence that is a first sequence, and each SEQ ID NO: 38 a DNA sequence identical to the target sequence represented by to 60; and a DNA sequence encoding the second sequence.
- the Cas protein of the present application is Streptococcus pyogenes-derived Cas9 protein, Campylobacter jejuni-derived Cas9 protein, Streptococcus thermophilus-derived Cas9 protein, star It may be at least one selected from the group consisting of a Cas9 protein derived from Staphylococcus aureus, a Cas9 protein derived from Neisseria meningitidis, and a Cas12a (Cpf1) protein.
- the Cas protein may be a wild type or a mutant form thereof.
- the Cas protein or a nucleic acid encoding the same may further include an element commonly used for intranuclear delivery of eukaryotic cells, for example, a Nuclear Localization Sequence (NLS).
- NLS Nuclear Localization Sequence
- the Cas protein may be a Cas9 protein derived from Streptococcus pyyogenes, a Cas9 protein derived from Staphylococcus aureus, or a Cas12a (Cpf1) protein.
- the PAM sequence may vary depending on the Cas protein.
- SpCas9 has a PAM sequence of NGG.
- SaCas9 has a PAM sequence of NNGRR or NNGRRT.
- Cas12a (Cpf1) has a PAM sequence of TTTN.
- N is any one of A, T, G or C. wherein R is A or G.
- composition for genetic manipulation of myostatin of the present application includes a guide RNA or a nucleic acid encoding the same; and Cas protein or a nucleic acid encoding the same, independently or together.
- the guide RNA of the present application may be delivered into a cell in the form of RNA or DNA encoding the RNA.
- the guide RNA may be in the form of an independent RNA, RNA contained in a viral vector, or encoded in a vector.
- the Cas protein of the present application may be delivered into a cell in the form of RNA or DNA encoding the RNA.
- the Cas protein may be in the form of an independent RNA, RNA contained in a viral vector, or encoded in a vector.
- the viral vector may be one or more selected from the group consisting of a retroviral vector, a lentiviral vector, an adenovirus vector, an adeno-associated virus (AAV) vector, a vaccinia virus vector, a poxvirus vector, and a herpes simplex virus vector.
- the guide RNA and the Cas protein may be in the form of plasmid DNA including a sequence encoding each RNA and a promoter, and plasmid DNA including a sequence encoding a protein and a promoter.
- the guide RNA and the Cas protein may be configured in a form including the RNA or protein-encoding sequence and the promoter in one plasmid DNA.
- it may be constructed in the form of a viral vector other than plasmid DNA.
- the guide RNA and the Cas protein may be in the form of mRNA.
- guide RNA may be prepared by in vitro transcription using any in vitro transcription system known in the art.
- the guide RNA and Cas protein of the present application may preferably be composed of a ribonucleoprotein (RNP) form of a complex in which the guide RNA and the Cas protein are coupled.
- RNP ribonucleoprotein
- the guide RNA and the Cas protein may be configured in different forms.
- the guide RNA may be configured in the form of an independent RNA
- the Cas protein may be configured in the form of a vector including a protein-encoding sequence and a promoter.
- composition may be configured in various forms. Therefore, no limitation is placed on it since it can be appropriately used by those skilled in the art from methods known in the art.
- the cells may be embryonic cells, somatic cells or stem cells.
- the cells include, but are not limited to, cumulus cells, epithelial cells, fibroblasts, neurons, keratinocytes, hematopoietic cells, melanocytes, chondrocytes, macrophages, monocytes, myocytes. , B lymphocytes, T lymphocytes, embryonic stem cells, embryonic germ cells, fetal-derived cells, placental cells and embryonic cells.
- tissue-derived stem cells such as fat, uterus, bone marrow, muscle, placenta, umbilical cord blood, or skin (epithelium) can be used.
- a non-human host embryo may generally be an embryo comprising a 2-cell stage, a 4-cell stage, an 8-cell stage, a 16-cell stage, a 32-cell stage, a 64-cell stage, a morula, or a blastocyst. .
- the cell may be an embryonic cell.
- the cell may be derived from an animal.
- the animal includes a mammal.
- Said mammals include ungulates.
- the ungulates may include, but are not limited to, cattle and pigs.
- Said mammals include rodents.
- the rodent may include, but is not limited to, a mouse.
- contacting the cell with the composition may include The contacting may be performed in vivo or ex vivo.
- the contacting step may include transient transfection, microinjection, transduction, cell fusion, calcium phosphate precipitation, liposome-mediated transfection. ), DEAE Dextran-mediated transfection, polybrene-mediated transfection, electroporation, gene gun and nucleic acid into cells It can be introduced into cells by other known methods for introducing them.
- an indel insertion and deletion occurs in the genome of a cell.
- Index refers to a mutation in which some nucleotides are inserted or deleted in the middle of the nucleotide sequence of DNA.
- the indel may be introduced into the target sequence during the process of cutting and repairing the nucleic acid (DNA, RNA) of the guide RNA-CRISPR complex, which is the composition.
- the transformed cell of the present application has the myostatin gene in which 12 base pairs are deleted from the second exon by the composition.
- the transformed cell of the present application has a genetic modification with an in frame deletion by the method for producing the myostatin transformed cell described above.
- the transformed cell having the myostatin gene in which 12 base pairs of the second exon of the present application are deleted has a genetic modification with an in frame deletion.
- the form of the deletion is an in-frame deletion, and no frame-shifted modification occurs.
- the in-frame deletion takes the form of a protein in which four amino acids are deleted, and translation into other amino acids or changing the stop codon, which may occur in general frame shift modifications, does not occur. That is, the remaining amino acids except for the four amino acids can be normally translated into proteins through transcription in the myostatin gene.
- Another aspect of the invention provided in the present application relates to a method for producing an animal using the transformed cell. Specifically, it relates to a method for producing an animal having a myostatin gene in which 12 base pairs of the second exon are deleted.
- the production method comprises transplanting an embryonic cell having a myostatin gene in which the 12 base pairs of the second exon is deleted into a surrogate mother, and a trait having the myostatin gene in which the 12 base pairs of the second exon are deleted. It's about producing convertible animals.
- the production method relates to a method for producing an animal having a transformed tissue or organ by injecting the composition into a tissue or organ of the animal. .
- the animal includes a mammal.
- Said mammals include ungulates.
- the ungulates may include, but are not limited to, cattle and pigs.
- the mammal includes rodents.
- the rodent may include, but is not limited to, a mouse.
- the method may include transplanting a cell having a myostatin gene in which 12 base pairs of the second exon generated in the above step are deleted into a surrogate mother.
- the embryonic cells may develop into blastocysts during in vitro culture.
- an animal having a myostatin gene in which 12 base pairs of the second exon are deleted can be prepared.
- the present application relates to an animal having a myostatin gene in which 12 base pairs of the second exon are deleted by transplanting an embryo having a myostatin gene in which 12 base pairs of the second exon are deleted, preferably produced a cow having a myostatin gene in which 12 base pairs of the second exon were deleted.
- the transgenic animal may be a chimeric or homologous transgenic animal.
- Transgenic animals can be produced by somatic cell nuclear transfer (SCNT) method by transplanting somatic cells having the myostatin gene modified by the above method or a nucleus thereof into a denucleated egg.
- SCNT somatic cell nuclear transfer
- the transgenic animal may be a homologous transgenic animal.
- a transgenic animal can be produced through crossing with a first transgenic animal having a myostatin gene in which 12 base pairs of the second exon are deleted.
- the transgenic animal obtained through the crossing may contain the same myostatin gene as that in which 12 base pairs of the myostatin gene included in the animal genome of the first transgenic animal are deleted.
- the transgenic animal of the present application may be an animal having a myostatin gene in which 12 base pairs of the second exon in some tissues of the animal are deleted.
- the tissue may be epithelial tissue, connective tissue, or muscle tissue, but preferably a muscle tissue containing the myostatin gene.
- the method comprises the steps of introducing the composition described above into a tissue of an animal; may include
- composition When the composition is introduced into an animal tissue, an animal having a tissue-specifically modified myostatin gene can be produced.
- the introduction may be performed by injection, implantation or transplantation.
- the introduction is subretinal, subcutaneously, intradermaliy, intraocularly, intravitreally, intratumorally, intranodally, intramedullary, intramuscularly ( intramuscularly), or intraperitoneally
- Animals having a myostatin gene in which 12 base pairs of the second exon are deleted can be used as breeding animals.
- the breeding animal may be a cow, pig, mouse, or rat in which 12 base pairs of the myostatin gene are deleted, but is not limited thereto.
- the breed-improved animal may be a breed-improved animal in a form in which muscles are developed compared to a wild-type animal.
- the breed-improved animal may be a breed-improved animal with reduced fat compared to a wild-type animal.
- Animals having the myostatin gene in which 12 base pairs of the second exon are deleted can be used as animals for disease model study.
- the disease model study animal may be a cow, pig, mouse or rat in which 12 base pairs of the myostatin gene are deleted, but is not limited thereto.
- the disease model may be a study including, but not limited to, muscular atrophy, sarcopenia, and muscle fiber reduction.
- Animals with a myostatin gene in which 12 base pairs of the second exon are deleted can be used as disease resistant animals.
- the disease-resistant animal may be a cow, pig, mouse or rat in which 12 base pairs of the myostatin gene are deleted, but is not limited thereto.
- the disease may include, but is not limited to, muscular atrophy, sarcopenia, and muscle fiber loss.
- the flesh, organs, hides, fur, and body fluids of animals having a myostatin gene in which 12 base pairs of the second exon are deleted can be used, but are not limited thereto.
- the animal may be a cow, pig, mouse or rat in which 12 base pairs of the myostatin gene are deleted, but is not limited thereto.
- the animal may have a lower content of fat and a higher content of muscle as compared to a wild-type animal. Therefore, it is possible to obtain high-quality meat with a low fat content and a high muscle content as a by-product of the animal.
- Another aspect of the invention provided in the present application relates to the use of the composition for genetic manipulation of the present application.
- composition described above it can be used for a purpose that can increase muscle, but is not limited thereto.
- the subject to which the composition can be administered may be mammals including primates such as humans and monkeys, rodents such as mice and rats, and ungulates such as cattle, pigs and horses.
- the composition may be administered to a specific body location of the subject to whom the composition is administered.
- the specific body location may be in the vicinity of a tissue in need of muscle gain.
- the specific body position may be in the vicinity of a tissue in which muscles are not developed in the state of infancy.
- the administration may be performed by injection, transfusion, implantation, or transplantation.
- the administration may be performed by an administration route selected from subcutaneously, intradermaliy, intramuscularly, or intraperitoneally.
- One dose (effective amount for obtaining a predetermined desired effect) of the composition for genetic manipulation of myostatin is 10 4 -10 9 cells per kg body weight of the administered subject, for example, 10 5 to 10 6 cells/kg (body weight). It may be selected from all integer values within the numerical ranges, but is not limited thereto, and may be appropriately administered in consideration of the age, health and weight of the subject to be administered, and the like.
- the sgRNA comprising a sequence complementary to each single strand of 12 base pairs of myostatin was designed by CHOPCHOP software (https://chopchop.cbu.uib.no/).
- the complementary binding sequence was included and was used among the PAM sequences of CRISPR/SpCas9, CRISPR/SaCas9, or CRISPR/Cpf1 for myostatin gene.
- the sgRNA used in the experiment was designed to include at least one of the guide sequences in Table 2.
- 1 is a schematic illustration of the protospacer sequence of the myostatin gene.
- the binding sequence of the guide RNA can be predicted from the sequence.
- COC cumulus-oocyte complex
- Motile sperm were purified by the Percoll gradient method.sperm from semen thawed at 35°C was filtered by centrifugation at 1500 rpm for 15 min in a Percoll discontinuous gradient (45-90%). To produce a 45% Percoll solution, add 1 ml volume TALP to 1 ml 90% Percoll. The sperm pellet was centrifuged at 1500 rpm for 5 minutes and washed twice with the addition of 3 ml of TALP. Motile sperm purified using the Percoll gradient method were used for fertilization.
- Motile sperm/ml sperm were cultured together with mature oocytes in 45 ul of in vitro fertilization-TALP medium covered with mineral oil (Nidacon, Cat.no.NO-100) in a humidified atmosphere of 5% CO 2 . After 18 hours of in vitro fertilization, cumulus cells were removed from the zygote. This conjugate was incubated in a culture medium protected with two steps of chemically defined mineral oil at a temperature of 38.5° C. in an atmosphere of 5% O 2 , 5% CO 2 , and 90% N 2 . The zygote is cultured into an embryo.
- Cas9 mRNA and sgRNA When performing the microinjection method, the most suitable concentration was found by dividing Cas9 mRNA and sgRNA into 4 groups.
- CB TE only microinjection, RNA1X; Cas9 mRNA: 100 ng/ ⁇ l, sgRNA: 50 ng/ ⁇ l, RNA2X; Cas9 mRNA: 200 ng/ ⁇ l, sgRNA: 100 ng/ ⁇ l, RNA 4X; Cas9 mRNA: 400 ng / ⁇ l, sgRNA: 200 ng/ ⁇ l).
- Cas9 mRNA (sigma-Aldrich, Cat.no.CAS9MRNA) and sgRNA in the zygote were synthesized by GeneArt Precision gRNA Synthesis Kit (Thermofisher, Cat.no.A29377) and microinjector machine (Eppendorf, Femtojet®) was injected with Seven days after microinjection, preimplantation stage embryos were collected and myostatin deletion was observed or implanted in the uterus of a surrogate mother.
- the microinjection method was illustrated in FIG. 2 .
- 5 is a schematic diagram showing the results of the experiment by dividing Cas9 mRNA and sgRNA into 4 groups.
- the ratio of blastocysts was similar in both RNA1X and RNA2X compared to wild-type.
- the RNA2X group showed a significantly higher modification rate than other RNA1X and RNA4X groups. Therefore, the concentration of RNA2X was judged to be the most suitable, so that in the experiment, the Cas9 mRNA used in the RNA2X group: 200 ng/ ⁇ l, sgRNA: 100 ng/ ⁇ l was used for the experiment.
- FIG. 4 is a view showing the results of the myostatin modified form of embryos obtained by performing sanger sequencing.
- the transformed cell of the present application means only a transformed cell having a myostatin gene in which 12 base pairs of the second exon are deleted.
- the blastocysts were stored in PBS supplemented with 20% FBS.
- Surrogate mothers were examined 50 days after estrus by rectal palpation and ultrasound to observe embryo survival and pregnancy. Pregnant cattle were then routinely checked by rectal palpation and ultrasound examination.
- the 17th cow is the one in which 12 base pairs of the second exon of the myostatin gene are deleted, so that muscle development can be confirmed externally. It was possible to confirm the role of this developed form.
- Genomic DNA obtained from transgenic primary cells was extracted with a DNA extraction kit (DNeasy Blood & Tissue kit, Qiagen, Cat. no. 69504). MSTN Primer was designed by PRIMER3 software. PCR conditions were 35-40 cycles at 94°C for 5 min, 94°C for 20 sec/57°C for 30 sec/72°C for 35 sec, and 72°C for 5 min.
- the target site was first amplified to about 500 bp in the extracted genomic DNA using KAPA HiFi HotStart DNA polymerase (Roche, Cat. no. # KK2502) according to the manufacturer's protocol. Then, the amplicon was amplified again to a size of ⁇ 230 bp, and the amplicon was amplified using the TruSeq HT double index containing primer, and the adapter and index sequence for the Illumina sequencing platform were added to each sample.
- the primers used in this study are listed in SEQ ID NO: 101 and SEQ ID NO: 102.
- the pooled PCR amplicons were purified using a PCR purification kit (MGmed) and sequenced on a MiniSeq (Illumina) with a paired-end sequencing system (2x150 bp).
- a Cas-Analyzer was used to quantify indel ratios in deep-sequencing data.
- the target deep sequencing results can be confirmed in FIGS. 9 to 13 .
- Gray boxes indicate PAM sequences.
- the underlined sequence is the protospacer sequence. Gray boxes and underlines are used the same in FIGS. 10 to 13 .
- MSTN-1 GAGGTGTTCGTTCGTTTTTC (SEQ ID NO: 101) TAAGCACAGGAAACTGGTAG (SEQ ID NO: 102) MSTN-2 ACACTCTTTCCCTACACGACGCTCTTCCGATCT aacgcaagtggaaggaaac (SEQ ID NO: 103) GTGACTGGAGTTCAGACGTG TGCTCTTCCGATCTtgctct gccaaataccagtg (SEQ ID NO: 104)
- DMEM fetal bovine serum
- Penicillin/streptomycin Gibco, Cat.no.15140148
- Non-essential amino acids Gibco, Cat.no.11140050
- 100 mM ⁇ -Mercaptoethanol Sigma-aldrich, Cat.no.M3418
- FIG. 14 is a diagram illustrating the comparison of the myostatin mRNA expression amount of wild-type cattle and cattle 14 and 17 after culturing the primary cells of cattle 14 and 17 born in the present application.
- the amount of myostatin mRNA expression in primary cells of cattle 14 and 17 was reduced by more than 60% in cattle 14 and by 80% or more in cattle 17. .
- MSTN mutant donor cows with random estrus cycles inserted with an intravaginal progesterone device (Repro360, Cue-mate) were intramuscularly injected with 2.0 mg of estradiol benzoate.
- Donors received 200 mg of Kawasaki Pharm, Antorin R-10 (FSH) divided into 4 doses (57, 57, 43 and 43 mg) every 12 hours on days 4 and 5.
- the P4 device was removed immediately on day 7 before OPU.
- OPU donor cows were restrained from cow crush. Epidural anesthesia was performed with 5 ml, 2% lidocaine (Daihan, DAIHAN Lidocaine, South Korea). The ovaries were fixed by transrectal manipulation and stayed on the probe of an ultrasound device.
- One trained OPU technician performed the OPU procedure using an ultrasound device (Esaote, mylab one) coupled with a 7.5 MHz transrectal transducer probe with a follicular aspiration guide (WTA, catalog number 10283). Follicular puncture was performed using an 18G OPU tread needle (WTA, catalog number 17927) and follicular fluid was collected in a 50 ml tube. The oocytes of the follicular fluid were collected under a stereoscopic microscope and used for in vitro fertilization. The remaining hair follicle fragments were used for primary culture.
- Semen samples were used for cryopreservation when they exhibited more than 60% general motility. Semen samples were expanded with Optixcell® (IMV Technologies) at 37°C. The expanded semen was equilibrated at 4° C. for 3 hours and then placed in a 0.5 ml straw. The filled straws were placed in a special rack 5 cm high above liquid nitrogen, exposed to liquid nitrogen vapor for 15 minutes, and then placed in a cryogenic tank filled with liquid nitrogen (-196°C). Cryopreserved sperm were thawed in a water bath at 37° C. for 45 seconds.
- Optixcell® IMV Technologies
- IVOS-II CASA Computer-Assisted Sperm Analysis Program
- frozen semen was thawed, incubated and purified using the same protocol used for IVF.
- 3 ⁇ l of sperm was loaded into a sperm analysis chamber (Leja slide) and analyzed by CASA. Frozen straws from three different bulls were used.
- each semen was analyzed three times, and the average value of CASA results was used for statistical evaluation.
- Motile sperm were selected using the Percoll gradient method as previously described. Briefly, freeze-thawed semen of F0 bulls at 35°C was filtered by centrifugation in a Percoll discontinuous gradient (45-90%) at 1680 rpm for 15 min. To produce a 45% Percoll solution, 1 mL of capacitation-Tyrode's albumin lactate pyruvic acid (TALP) medium was added to 1 mL of 90% Percoll.sperm pellets were washed twice with the addition of 3 mL of dose-TALP medium, and then centrifuged at 1680 rpm for 5 minutes. Washed motile sperm were used for IVF.
- capacitation-Tyrode's albumin lactate pyruvic acid (TALP) medium was added to 1 mL of 90% Percoll.
- FIG. 15 shows a representative photograph (b) of the production of MSTN mutant blastocysts derived from MSTN mutant bovine oocytes (a) and pregnancy diagnosis using an ultrasound machine on the 30th day as a result of verifying germline transmission of MSTN mutant females.
- 16 is a somatic cell image derived from follicle fluid obtained during OPU process ((a): MSTN mutant female, (b): wild-type).
- FIG 17 shows the results of T7E1 analysis (a) and sequencing data (b) of MSTN mutant female blastocysts (M: marker; WT: wild type; 1: MSTN mutant female; N: negative control; P: T7E1 positive control).
- Figure 18 shows the results of T7E1 analysis (a) and sequencing data from somatic cells of the follicle fluid (b) (1: MSTN mutant female (no wild type); 2: MSTN mutant female (no wild type)).
- Semen was collected by electro-ejaculation from a 10.5% mutant male bull (F0). Samples were frozen for in vitro fertilization and thawed for sperm motility. CASA showed significant differences in % advanced cells, VCL, ALH and BCF between F0 and wild-type samples. However, LIN and STR did not show a significant difference between F0 and wild-type samples (FIG. 19). In addition, no deleterious effects on embryonic development and ability were seen when semen samples were used for in vitro fertilization. Oocytes collected at the slaughterhouse were fertilized with frozen thawed semen and cultured to develop into blastocysts. A total of 335 oocytes (number of copies 3) were used.
- Figure 19 shows the summary results of MSTN male founder semen by Computer Assisted Semen Analysis.
- Figure 21 shows the mutation rates of MSTN genes in blastocysts derived from in vitro fertilized MSTN mutant bull semen (1-6: randomly selected blastocysts).
- the upper panel (a) shows the results of T7E1
- the lower panel (b) shows the sequencing results of the MSTN target site.
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Chemical & Material Sciences (AREA)
- Genetics & Genomics (AREA)
- Zoology (AREA)
- Organic Chemistry (AREA)
- Molecular Biology (AREA)
- Wood Science & Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biotechnology (AREA)
- Biomedical Technology (AREA)
- General Health & Medical Sciences (AREA)
- General Engineering & Computer Science (AREA)
- Environmental Sciences (AREA)
- Biochemistry (AREA)
- Microbiology (AREA)
- Medicinal Chemistry (AREA)
- Biophysics (AREA)
- Biodiversity & Conservation Biology (AREA)
- Animal Behavior & Ethology (AREA)
- Animal Husbandry (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Veterinary Medicine (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Abstract
Description
서열번호 | 프로 마이오스타틴 단백질 서열 |
30 | MQKLQISVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACLWRENTTSSRLEAIKIQILSKLRLETAPNISKDAIRQLLPKAPPLLELIDQFDVQRDASSDGSLEDDDYHARTETVITMPTESDLLTQVEGKPKCCFFKFSSKIQYNKLVKAQLRPVKTPATVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPEPGEDGLTPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGEGQIIYGKIPAMVVDRCGCS |
31 | MQKLQIYVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACMWRQNTKSSRLEAIKIQILSKLRLETAPNISKDAIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDLLMQVEGKPKCCFFKFSSKIQYNKVVKAQLRPVKTPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS |
32 | MMQKLQMYVYIYLFMLIAAGPVDLNEGSEREENVEKEGLCNACAWRQNTRYSRIEAIKIQILSKLRLETAPNISKDAIRQLLPRAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQADGKPKCCFFKFSSKIQYNKVVKAQLRPVKTPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMSPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKGYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS |
33 | MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS |
서열번호 | 성숙 마이오스타틴 단백질 서열 |
34 | FGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGEGQIIYGKIPAMVVDRCGCS |
35 | CCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS |
36 | CCRYPLTVDFEAFGWDWIIAPKGYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS |
37 | CCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS |
152 | 153 | 154 | 155 | 156 | 157 | 158 | 159 | 160 | 161 | 162 | 163 | 164 | 165 | |
Cattle | V | K | A | Q | L | W | I | Y | L | R | P | V | E | T |
Human | " | " | " | " | " | " | " | " | " | " | " | " | K | " |
Pig | " | " | " | " | " | " | " | " | " | " | " | " | K | " |
153 | 154 | 155 | 156 | 157 | 158 | 159 | 160 | 161 | 162 | 163 | 164 | 165 | 166 | |
Mice | V | K | A | Q | L | W | I | Y | L | R | P | V | K | T |
표적 서열 |
CGGAGTCTATATAGGTGTCA (서열번호 38) |
GGAGTCTATATAGGTGTCAA (서열번호 39) |
GGGTTGACACCTATATAGAC (서열번호 40) |
CCGGAGTCTATATAGGTGTC (서열번호 41) |
TCCGGGTTGACACCTATATA (서열번호 42) |
CTATATAGGTGTCAACCCGG (서열번호 43) |
GTGTCAACCCGGAAATGATC (서열번호 44) |
CAGAGTCTATATAGGTGTCA (서열번호 45) |
AGAGTCTATATAGGTGTCAA (서열번호 46) |
CCAGAGTCTATATAGGTGTC (서열번호 47) |
GTGTCAACCCGGAAATGATG (서열번호 48) |
CAGAGTTTATATAGGTATCA (서열번호 49) |
AGAGTTTATATAGGTATCAA (서열번호 50) |
TACCTATATAAACTCTGGGC (서열번호 51) |
TCCGGGTTGATACCTATATA (서열번호 52) |
CCAGAGTTTATATAGGTATC (서열번호 53) |
TTATATAGGTATCAACCCGG (서열번호 54) |
GTATCAACCCGGAAATGATG (서열번호 55) |
CAGACTCTATATAGGTGTCA (서열번호 56) |
AGACTCTATATAGGTGTCAA (서열번호 57) |
CCAGACTCTATATAGGTGTC (서열번호 58) |
TCTATATAGGTGTCAACCCG (서열번호 59) |
GTGACAACCCGAAAATGATG (서열번호 60) |
가이드 서열 |
5'-GCCUCAGAUAUAUCCACAGU-3'(서열번호 62) |
5'-CCUCAGAUAUAUCCACAGUU-3'(서열번호 63) |
5'-CCCAACUGUGGAUAUAUCUG-3'(서열번호 64) |
5'-GGCCUCAGAUAUAUCCACAG-3'(서열번호 65) |
5'-AGGCCCAACUGUGGAUAUAU-3' (서열번호 66) |
5'-GAUAUAUCCACAGUUGGGCC-3'(서열번호 67) |
5'-CACAGUUGGGCCUUUACUAG-3'(서열번호 68) |
5'-GUCUCAGAUAUAUCCACAGU-3'(서열번호 69) |
5'-UCUCAGAUAUAUCCACAGUU-3'(서열번호 70) |
5'-GGUCUCAGAUAUAUCCACAG-3'(서열번호 71) |
5'-CACAGUUGGGCCUUUACUAC-3'(서열번호 72) |
5'-GUCUCAAAUAUAUCCAUAGU-3'(서열번호 73) |
5'-UCUCAAAUAUAUCCAUAGUU-3'(서열번호 74) |
5'-AUGGAUAUAUUUGAGACCCG-3'(서열번호 75) |
5'-AGGCCCAACUAUGGAUAUAU-3'(서열번호 76) |
5'-GGUCUCAAAUAUAUCCAUAG-3'(서열번호 77) |
5'-AAUAUAUCCAUAGUUGGGCC-3'(서열번호 78) |
5'-CAUAGUUGGGCCUUUACUAC-3'(서열번호 79) |
5'-GUCUGAGAUAUAUCCACAGU-3'(서열번호 80) |
5'-UCUGAGAUAUAUCCACAGUU-3'(서열번호 81) |
5'-GGUCUGAGAUAUAUCCACAG-3'(서열번호 82) |
5'-AGAUAUAUCCACAGUUGGGC-3'(서열번호 83) |
5'-CACAGUUGGGCUUUUACUAC-3'(서열번호 84) |
유전자 | Forward primer | Reverse primer | Size |
MSTN | AACAGCGAGCAGAAGGAAAA (서열번호 85) | CCAGGCGAAGTTTACTGAGG (서열번호 86) | 124 |
GAPDH | GGCGTGAACCACGAGAAGTA(서열번호 87) | CCCTCCACGATGCCAAAGT (서열번호 88) |
120 |
유전자 | 염색체 | 위치 | Forward primer | Reverse primer | Size |
MSTN | 2 | 6281284 | GAGGTGTTCGTTCGTTTTTC (서열번호 89) | CTACCAGTTTCCTGTGCTTA (서열번호 90) |
538 |
Off-target 1 | 2 | 6590416 | TCAGCACAGAAAAGGTGAGG(서열번호 91) | GAGACGGACACAACTGAGCA (서열번호 92) |
515 |
Off -target 2 | 4 | 14356304 | TGAGCCCCTACTTTGTGGAC(서열번호 93) | GTTTTCTGGTAAGGGGTGCA (서열번호 94) |
580 |
Off -target 3 | 8 | 51204411 | TTGAAAACCTAGTGGGGAAAAA(서열번호 95) | GCACTCTCAAACACTGTGGC (서열번호 96) |
591 |
Off -target 4 | 9 | 88117377 | TCCTTGCACCTTCCAAAATC(서열번호 97) | ATCTGCGTGTAACTCCAGCC (서열번호 98) |
520 |
Off -target 5 | 2 | 46946387 | TCACCCATTCCAGTCCATTT(서열번호 99) | CCTCTAATGCCCTCTTGCAG (서열번호 100) |
542 |
유전자 | Forward primer | Reverse primer |
MSTN-1 | GAGGTGTTCGTTCGTTTTTC(서열번호 101) | TAAGCACAGGAAACTGGTAG (서열번호 102) |
MSTN-2 | ACACTCTTTCCCTACACGACGCTCTTCCGATCT aacgcaagtggaaggaaaac (서열번호 103) |
GTGACTGGAGTTCAGACGTG TGCTCTTCCGATCTtgctct gccaaataccagtg (서열번호 104) |
Claims (19)
- 게놈 내 인위적으로 변형된 마이오스타틴 유전자를 가지는 형질전환 동물로서,상기 변형은 마이오스타틴 유전자의 두 번째 엑손 내에 위치하며,상기 변형은 야생형 동물의 마이오스타틴 유전자의 서열과 비교하여, 두번째 엑손 중 류신, 트립토판, 아이소류신, 및 타이로신의 순서의 아미노산 서열을 암호화하는 영역에 해당하는 12개의 염기쌍의 결실이며상기 형질전환 동물은 야생형 동물보다 마이오스타틴 mRNA 발현량이 적고,상기 형질전환 동물은 야생형 동물과 동일한 서열의 성숙 마이오스타틴 단백질을 발현하는 것을 특징으로 하는 형질전환 동물.
- 제1항에 있어서,상기 형질전환 동물은 인간을 제외한 포유류 (mammal)를 포함하는 것을 특징으로 하는 형질전환 동물.
- 제1항에 있어서,상기 형질전환 동물은 소 (cattle) 인 것을 특징으로 하는 형질전환 동물.
- 제3항에 있어서,상기 소가 체내에 발현하는 프로 마이오스타틴 단백질은 서열번호 30으로 표시되는 아미노산 서열로 이루어진 것을 특징으로 하는 형질전환 동물.
- 게놈 내 인위적으로 변형된 마이오스타틴 유전자를 가지는 형질전환 세포로서,상기 변형은 마이오스타틴 유전자의 두 번째 엑손 내에 위치하며,상기 변형은 야생형 세포의 마이오스타틴 유전자의 서열과 비교하여, 두번째 엑손 중 류신, 트립토판, 아이소류신, 및 타이로신의 순서의 아미노산 서열을 암호화하는 영역에 해당하는 12개의 염기쌍의 결실이며상기 형질전환 세포는 야생형 세포보다 마이오스타틴 mRNA 발현량이 적고,상기 형질전환 세포는 야생형 세포와 동일한 서열의 성숙 마이오스타틴 단백질을 발현하는 것을 특징으로 하는 형질전환 세포.
- 제5항에 있어서,상기 세포는 배아세포, 줄기세포 또는 체세포 중 선택되는 1 이상의 세포인 것을 특징으로 하는 형질전환 세포.
- 제5항에 있어서,상기 세포는 포유류로부터 얻는 것을 특징으로 하는 형질전환 세포.
- 제5항에 있어서,상기 세포는 소로부터 얻는 것을 특징으로 하는 형질전환 세포.
- 제8항에 있어서,상기 형질전환 세포가 체내에 발현하는 프로 마이오스타틴 단백질은 서열번호 30으로 표시되는 아미노산 서열로 이루어진 것을 특징으로 하는 형질전환 세포.
- 마이오스타틴 유전자를 변형시키기 위한 조성물로,상기 조성물은 표적 서열과 상보적인 결합을 형성하는 가이드 서열을 포함하는 가이드 RNA 또는 상기 가이드 RNA를 암호화하는 DNA;및 Cas 단백질 또는 이를 암호화하는 핵산서열을 포함하며,상기 표적 서열은 서열번호 38 내지 서열번호 60 중 선택된 1 이상의 서열을 포함하며,상기 가이드 서열은 서열번호 62 내지 서열번호 84 중 선택된 1 이상의 서열을 포함하는 것을 특징으로 하는 마이오스타틴 유전자 형질전환 조성물.
- 제10항에 있어서,상기 Cas 단백질은 스트렙토코커스 피오게네스 (streptococcus pyogenes) 유래 Cas9 단백질, 스타필로코커스 아우레우스 (staphylococcus aureus) 유래 Cas9 단백질, 또는 Cas 12a 단백질 (종래의 CPF1 :Prevotella and Francisella 1) 단백질 중 하나인 것을 특징으로 하는 마이오스타틴 유전자 형질전환 조성물.
- 제10항에 있어서,상기 조성물은 가이드 RNA를 암호화하는 DNA 및 Cas 단백질을 암호화하는 DNA 형태로 플라스미드 벡터에 존재하는 것을 특징으로 하는 마이오스타틴 유전자 형질전환 조성물.
- 제10항에 있어서,상기 조성물은 가이드 RNA를 암호화하는 DNA 및 Cas 단백질을 암호화하는 DNA 형태로 바이러스 벡터에 존재하는 것을 특징으로 하는 마이오스타틴 유전자 형질전환 조성물.
- 제13항에 있어서,상기 바이러스 벡터는 레트로바이러스 벡터, 렌티바이러스 벡터, 아데노바이러스 벡터, 아데노-연관 바이러스(AAV) 벡터, 백시니아바이러스 벡터, 폭스바이러스 벡터 및 단순포진 바이러스 벡터로 구성된 군에서 선택된 하나 이상인 것을 특징으로 하는 마이오스타틴 유전자 형질전환 조성물.
- 제10항에 있어서,상기 조성물은 가이드 RNA와 Cas단백질이 결합한 복합체 (RNP :ribonucleoprotein) 형태인 것을 특징으로 하는 마이오스타틴 유전자 형질전환 조성물.
- 마이오스타틴 형질전환 세포 또는 배아를 제작하는 방법으로,상기 방법은 제10항의 조성물을 세포 또는 배아에 접촉시키는 단계를 포함하는,형질전환 세포 또는 배아를 제작하는 방법.
- 제16항에 있어서,상기 접촉시키는 단계는 미세주입, 전기천공법 (electroporation), 리포좀, 플라스미드, 바이러스벡터, 나노파티클(nanoparticles) 및 PTD (Protein translocation domain) 융합 단백질 방법 중 선택되는 1이상의 방법으로 수행되는 것을 특징으로 하는 형질전환 세포 또는 배아를 제작하는 방법.
- 마이오스타틴 유전자 형질전환 동물을 제작하는 방법으로,상기 방법은제10항의 조성물을 배아에 접촉하여 형질전환 된 유전자를 가지는 형질전환 배아제작; 및형질전환 배아를 대리모에 이식하는 단계를 포함하며,제작된 동물은 야생형 동물에 비해 마이오스타틴 mRNA가 적게 발현되는 형질전환 동물을 제작하는 방법.
- 제18항에 있어서,상기 동물은 인간을 제외한 포유류인 것을 특징으로 하는 형질전환 동물을 제작하는 방법.
Priority Applications (6)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202180092749.1A CN116887671A (zh) | 2020-12-03 | 2021-12-03 | 具有经修饰的肌肉生长抑制素基因的转基因动物 |
KR1020237023068A KR20230130639A (ko) | 2020-12-03 | 2021-12-03 | 마이오스타틴 유전자가 변형된 형질전환 동물 |
JP2023558112A JP2023554545A (ja) | 2020-12-03 | 2021-12-03 | 改変ミオスタチン遺伝子を有するトランスジェニック動物 |
AU2021390998A AU2021390998A1 (en) | 2020-12-03 | 2021-12-03 | Transgenic animal having modified myostatin gene |
GB2310105.8A GB2617296A (en) | 2020-12-03 | 2021-12-03 | Transgenic animal having modified myostatin gene |
CA3204090A CA3204090A1 (en) | 2020-12-03 | 2021-12-03 | Transgenic animal having modified myostatin gene |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR10-2020-0167296 | 2020-12-03 | ||
KR20200167296 | 2020-12-03 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2022119367A1 true WO2022119367A1 (ko) | 2022-06-09 |
Family
ID=81853277
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/KR2021/018176 WO2022119367A1 (ko) | 2020-12-03 | 2021-12-03 | 마이오스타틴 유전자가 변형된 형질전환 동물 |
Country Status (7)
Country | Link |
---|---|
JP (1) | JP2023554545A (ko) |
KR (1) | KR20230130639A (ko) |
CN (1) | CN116887671A (ko) |
AU (1) | AU2021390998A1 (ko) |
CA (1) | CA3204090A1 (ko) |
GB (1) | GB2617296A (ko) |
WO (1) | WO2022119367A1 (ko) |
Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US6103466A (en) * | 1997-07-14 | 2000-08-15 | University Of Liege | Double-muscling in mammals |
WO2020207002A1 (zh) * | 2019-04-08 | 2020-10-15 | 中国农业大学 | 一种肌肉生长抑制素mstn的突变体及其应用 |
CN111808887A (zh) * | 2020-09-10 | 2020-10-23 | 中国农业大学 | 一种制备与自然突变比利时蓝牛类似的双肌臀肉牛的方法 |
Family Cites Families (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN104531705A (zh) | 2014-12-09 | 2015-04-22 | 中国农业大学 | 利用CRISPR-Cas9系统敲除动物myostatin基因的方法 |
CN107034221A (zh) | 2017-06-02 | 2017-08-11 | 内蒙古大学 | 一种能在小鼠体内表达的部分碱基缺失肌肉抑制素基因及应用 |
-
2021
- 2021-12-03 WO PCT/KR2021/018176 patent/WO2022119367A1/ko active Application Filing
- 2021-12-03 CA CA3204090A patent/CA3204090A1/en active Pending
- 2021-12-03 AU AU2021390998A patent/AU2021390998A1/en active Pending
- 2021-12-03 KR KR1020237023068A patent/KR20230130639A/ko unknown
- 2021-12-03 CN CN202180092749.1A patent/CN116887671A/zh active Pending
- 2021-12-03 GB GB2310105.8A patent/GB2617296A/en active Pending
- 2021-12-03 JP JP2023558112A patent/JP2023554545A/ja active Pending
Patent Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US6103466A (en) * | 1997-07-14 | 2000-08-15 | University Of Liege | Double-muscling in mammals |
WO2020207002A1 (zh) * | 2019-04-08 | 2020-10-15 | 中国农业大学 | 一种肌肉生长抑制素mstn的突变体及其应用 |
CN111808887A (zh) * | 2020-09-10 | 2020-10-23 | 中国农业大学 | 一种制备与自然突变比利时蓝牛类似的双肌臀肉牛的方法 |
Non-Patent Citations (3)
Title |
---|
GIM GYEONG‐MIN, KWON DONG‐HYEOK, EOM KYEONG‐HYUN, MOON JOONHO, PARK JI‐HYUN, LEE WON‐WU, JUNG DAE‐JIN, KIM DAE‐HYUN, YI JUN‐KOO, H: "Production of MSTN ‐mutated cattle without exogenous gene integration using CRISPR‐Cas9", BIOTECHNOLOGY JOURNAL,, DE , pages 2100198, XP055936037, ISSN: 1860-6768, DOI: 10.1002/biot.202100198 * |
KAMBADUR RAVI, SHARMA MRIDULA, SMITH TIMOTHY P.L., BASS JOHN J.: "Mutations in myostatin ( GDF8 ) in Double-Muscled Belgian Blue and Piedmontese Cattle", GENOME RESEARCH, vol. 7, no. 9, 1 September 1997 (1997-09-01), US , pages 910 - 915, XP055936036, ISSN: 1088-9051, DOI: 10.1101/gr.7.9.910 * |
ZOU YUN-LONG, LI ZHI-YUAN, ZOU YUN-JING, HAO HAI-YANG, HU JIA-XIANG, LI NING, LI QIU-YAN: "Generation of pigs with a Belgian Blue mutation in MSTN using CRISPR/Cpf1-assisted ssODN-mediated homologous recombination", JOURNAL OF INTEGRATIVE AGRICULTURE, vol. 18, no. 6, 1 June 2019 (2019-06-01), AMSTERDAM, NL, pages 1329 - 1336, XP055936035, ISSN: 2095-3119, DOI: 10.1016/S2095-3119(19)62694-8 * |
Also Published As
Publication number | Publication date |
---|---|
GB2617296A (en) | 2023-10-04 |
KR20230130639A (ko) | 2023-09-12 |
GB202310105D0 (en) | 2023-08-16 |
CA3204090A1 (en) | 2022-06-09 |
CN116887671A (zh) | 2023-10-13 |
JP2023554545A (ja) | 2023-12-27 |
AU2021390998A1 (en) | 2023-06-29 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
WO2020085788A1 (ko) | Igf-1 유전자 돌연변이 왜소증 동물모델 및 그 제조방법 | |
WO2016111546A9 (ko) | 혈액 응고인자 viii 유전자를 타겟으로 하는 엔도뉴클레아제 및 이를 포함하는 혈우병 치료용 조성물 | |
WO2018062866A2 (en) | CELL-PERMEABLE (CP)-Cas9 RECOMBINANT PROTEIN AND USES THEREOF | |
WO2014065596A1 (en) | Composition for cleaving a target dna comprising a guide rna specific for the target dna and cas protein-encoding nucleic acid or cas protein, and use thereof | |
WO2019009682A2 (ko) | 표적 특이적 crispr 변이체 | |
WO2017188797A1 (ko) | In vivo에서 rna-가이드 뉴클레아제의 활성을 고처리량 방식으로 평가하는 방법 | |
CN101310015A (zh) | 在两个功能性亚结构域中具有突变的laglidadg归巢核酸内切酶变体及其用途 | |
WO2017026779A1 (en) | Improved cell-permeable cre (icp-cre) recombinant protein and use thereof | |
WO2018208067A1 (ko) | 인위적으로 조작된 조작면역세포 | |
WO2011043584A2 (ko) | 형질전환 식물 유래의 고병원성 조류독감 바이러스 단백질 백신 및 그 제조방법 | |
WO2019066490A2 (ko) | 유전자 발현 조절을 위한 인위적인 게놈 조작 | |
WO2018231018A2 (ko) | 간에서 목적하는 단백질 발현하기 위한 플랫폼 | |
WO2012115454A2 (ko) | 뉴클레아제에 의해 유전자 변형된 세포를 농축시키는 방법 | |
WO2019066549A2 (ko) | 망막 기능장애 질환 치료를 위한 유전자 조작 | |
WO2010002160A2 (ko) | 돼지의 알파에스 1 카제인 유전자, 그 프로모터 및 그의 용도 | |
WO2022119367A1 (ko) | 마이오스타틴 유전자가 변형된 형질전환 동물 | |
WO2020197242A1 (ko) | 혈우병b 질환 모델 랫드 | |
WO2020209458A1 (ko) | 인공 재조합 염색체 및 이의 이용 | |
WO2011081343A2 (ko) | HO-1 유전자 및 TNFR1-Fc 유전자를 동시에 발현하는 형질전환 돼지 및 그의 제조 방법 | |
WO2009088189A2 (ko) | 형질전환된 복제개의 생산방법 | |
WO2020022802A1 (ko) | 인위적인 유전자 조작을 통한 자가면역질환 치료 | |
WO2020022803A1 (ko) | 항응고 인자들의 유전자 에디팅 | |
WO2018230976A1 (ko) | 반복 확장 돌연변이에 대한 게놈 편집 시스템 | |
WO2020091471A1 (ko) | 근육 특이적 pck1 과발현 형질전환 개 생산 | |
WO2023282552A1 (ko) | Human mutant presenilin-1 발현 인지장애 모델 개의 생산 |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 21901055 Country of ref document: EP Kind code of ref document: A1 |
|
ENP | Entry into the national phase |
Ref document number: 3204090 Country of ref document: CA |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2023558112 Country of ref document: JP |
|
ENP | Entry into the national phase |
Ref document number: 2021390998 Country of ref document: AU Date of ref document: 20211203 Kind code of ref document: A |
|
ENP | Entry into the national phase |
Ref document number: 202310105 Country of ref document: GB Kind code of ref document: A Free format text: PCT FILING DATE = 20211203 |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
WWE | Wipo information: entry into national phase |
Ref document number: 202180092749.1 Country of ref document: CN |
|
32PN | Ep: public notification in the ep bulletin as address of the adressee cannot be established |
Free format text: NOTING OF LOSS OF RIGHTS PURSUANT TO RULE 112(1) EPC (EPO FORM 1205A DATED 16.10.2023) |