WO2022119367A1 - 마이오스타틴 유전자가 변형된 형질전환 동물 - Google Patents

마이오스타틴 유전자가 변형된 형질전환 동물 Download PDF

Info

Publication number
WO2022119367A1
WO2022119367A1 PCT/KR2021/018176 KR2021018176W WO2022119367A1 WO 2022119367 A1 WO2022119367 A1 WO 2022119367A1 KR 2021018176 W KR2021018176 W KR 2021018176W WO 2022119367 A1 WO2022119367 A1 WO 2022119367A1
Authority
WO
WIPO (PCT)
Prior art keywords
myostatin
sequence
protein
seq
animal
Prior art date
Application number
PCT/KR2021/018176
Other languages
English (en)
French (fr)
Inventor
장구
김경민
권동혁
이지현
이원유
박지현
염수영
문준호
이준구
정대진
하재정
김대현
Original Assignee
㈜라트바이오
서울대학교산학협력단
경상북도 (관련부서:경상북도축산기술연구소장)
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by ㈜라트바이오, 서울대학교산학협력단, 경상북도 (관련부서:경상북도축산기술연구소장) filed Critical ㈜라트바이오
Priority to CN202180092749.1A priority Critical patent/CN116887671A/zh
Priority to KR1020237023068A priority patent/KR20230130639A/ko
Priority to JP2023558112A priority patent/JP2023554545A/ja
Priority to AU2021390998A priority patent/AU2021390998A1/en
Priority to GB2310105.8A priority patent/GB2617296A/en
Priority to CA3204090A priority patent/CA3204090A1/en
Publication of WO2022119367A1 publication Critical patent/WO2022119367A1/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K67/00—Rearing or breeding animals, not otherwise provided for; New or modified breeds of animals
    • A01K67/027—New or modified breeds of vertebrates
    • A—HUMAN NECESSITIES
    • A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K67/00—Rearing or breeding animals, not otherwise provided for; New or modified breeds of animals
    • A01K67/027—New or modified breeds of vertebrates
    • A01K67/0275—Genetically modified vertebrates, e.g. transgenic
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/475—Growth factors; Growth regulators
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14—Hydrolases (3)
    • C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
    • C12N9/22—Ribonucleases RNAses, DNAses
    • A—HUMAN NECESSITIES
    • A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2217/00—Genetically modified animals
    • A01K2217/07—Animals genetically altered by homologous recombination
    • A01K2217/075—Animals genetically altered by homologous recombination inducing loss of function, i.e. knock out
    • A—HUMAN NECESSITIES
    • A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2217/00—Genetically modified animals
    • A01K2217/15—Animals comprising multiple alterations of the genome, by transgenesis or homologous recombination, e.g. obtained by cross-breeding
    • A—HUMAN NECESSITIES
    • A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2227/00—Animals characterised by species
    • A01K2227/10—Mammal
    • A01K2227/101—Bovine
    • A—HUMAN NECESSITIES
    • A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2267/00—Animals characterised by purpose
    • A01K2267/02—Animal zootechnically ameliorated
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00—Structure or type of the nucleic acid
    • C12N2310/10—Type of nucleic acid
    • C12N2310/20—Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPRs]

Definitions

  • the present application relates to a transgenic animal or cell having a modified gene.
  • the transgenic animal or cell has a myostatin gene in which 12 base pairs are deleted in the second exon.
  • the present application relates to a technology related to the production of the transgenic animal or cell.
  • Myostatin means muscle (myo) + inhibitor (statin) from the name, and as research continues since then, it is already known that myostatin protein inhibits muscle differentiation and growth. Research on myostatin regulating the differentiation and growth of muscle cells through gene regulation by using a gene editing tool in several animal models has been conducted.
  • the present applicants tried to obtain a healthy, myostatin transgenic animal with increased muscle mass.
  • the transgenic cattle of the present application have a specific type of myostatin mutation, confirming that they are transgenic animals without conventional side effects, and completed the present invention.
  • Patent Document 1 CN 104531705A
  • Patent Document 2 CN 107034221A
  • Non-Patent Document 1 Am J Physiol Endocrinol Metab. 2017 Mar 1;312(3): E150-E160, Myostatin propeptide mutation of the hypermuscular Compact mice decreases the formation of myostatin and improves insulin sensitivity
  • One purpose of this application is, To provide an animal having a myostatin gene in which 12 base pairs of the second exon are deleted.
  • Another object of the present application is to provide an embryo having a myostatin gene in which 12 base pairs of the second exon are deleted.
  • Another object of the present application is to provide a composition for deleting 12 base pairs of the second exon of the myostatin gene.
  • Another object of the present application is to provide a use for inducing an increase in muscle in an animal's muscle using the composition.
  • the present specification provides a transgenic animal having a myostatin gene modified in a specific part.
  • the modification may occur in the second exon of the myostatin gene.
  • This modification is a deletion of 12 base pairs corresponding to the region encoding the amino acid sequence of the sequence of leucine, tryptophan, isoleucine, and tyrosine in the second exon compared to the myostatin gene sequence of a wild-type animal.
  • the nucleic acid encoding the amino acid sequence of the sequence of leucine, tryptophan, isoleucine, and tyrosine may include one or more sequences encoding each amino acid.
  • sequence encoding the leucine may be one selected from 5'-CTT-3', 5'-CTC-3', 5'-CTA-3', or 5'-CTG-3', and tryptophan
  • the coding sequence may be 5'-TGG-3'
  • the isoleucine coding sequence may be one selected from 5'-ATT-3', 5'-ATC-3', or 5'-ATA-3'
  • sequence encoding tyrosine may be one selected from 5'-TAT-3', or 5'-TAC-3'.
  • the transgenic animals have less myostatin mRNA expression than wild-type animals.
  • the transgenic animal may express a mature myostatin protein having the same amino acid sequence as that of a wild-type animal.
  • the transgenic animal may have an externally increased muscle mass than the wild-type animal.
  • the transgenic animal includes a mammal.
  • Such mammals include ungulates.
  • the ungulate includes artiodactyl.
  • the cows may include, but are not limited to, pigs, deer, cattle, sheep, and goats.
  • the mammal may include a rodent.
  • the rodent may include, but is not limited to, mice and rats.
  • the transgenic animal in the present application is a cow.
  • the cow expresses a pro-myostatin protein consisting of the amino acid sequence shown in SEQ ID NO: 30.
  • the present application provides a transformed cell having a myostatin gene in which a specific part is modified.
  • the modification of the transformed cell may occur in the second exon of the myostatin gene.
  • This modification is a deletion of 12 base pairs corresponding to the region encoding the amino acid sequence of the sequence of leucine, tryptophan, isoleucine, and tyrosine in the second exon compared to the myostatin gene sequence of the wild-type cell.
  • the nucleic acid encoding the amino acid sequence of the sequence of leucine, tryptophan, isoleucine, and tyrosine may include one or more sequences encoding each amino acid.
  • sequence encoding leucine may be one of 5'-CTT-3', 5'-CTC-3', 5'-CTA-3', or 5'-CTG-3'
  • sequence to be 5'-TGG-3' the sequence encoding isoleucine may be one of 5'-ATT-3', 5'-ATC-3', or 5'-ATA-3'
  • tyrosine The coding sequence may be either 5'-TAT-3' or 5'-TAC-3'.
  • the transgenic cells have less myostatin mRNA expression than the wild-type cells.
  • the transformed cell may express a mature myostatin protein having the same amino acid sequence as that of a wild-type animal.
  • the cells may be embryonic cells, somatic cells or stem cells.
  • the cells include, but are not limited to, cumulus cells, epithelial cells, fibroblasts, nerve cells, keratinocytes, hematopoietic cells, melanocytes, chondrocytes, macrophages, monocytes, muscle cells, B lymphocytes, T lymphocytes , embryonic stem cells, embryonic germ cells, fetal-derived cells, placental cells and embryonic cells.
  • tissue-derived stem cells such as fat, uterus, bone marrow, muscle, placenta, umbilical cord blood, or skin (epithelium) can be used.
  • a non-human host embryo may generally be an embryo comprising a 2-cell stage, a 4-cell stage, an 8-cell stage, a 16-cell stage, a 32-cell stage, a 64-cell stage, a morula, or a blastocyst. .
  • the cells may be obtained from a mammal.
  • the cells of the present application can be obtained from cattle.
  • the transformed cell may express the pro-myostatin protein of the amino acid sequence shown in SEQ ID NO: 30.
  • the present application provides a composition for modifying the myostatin gene.
  • composition is used to modify the myostatin gene
  • a guide RNA comprising a guide sequence that forms a complementary bond with a target sequence or a DNA encoding the guide RNA
  • It may include a Cas protein or a nucleic acid sequence encoding the same.
  • the target sequence may include at least one selected from SEQ ID NO: 38 to SEQ ID NO: 60.
  • the guide sequence may include at least one selected from SEQ ID NO: 624 to SEQ ID NO: 84.
  • the Cas protein is one selected from a Streptococcus pyogenes-derived Cas9 protein, a Staphylococcus aureus-derived Cas9 protein, or a Cas 12a protein (conventional CPF1: Prevotella and Francisella 1) protein.
  • the nucleic acid encoding the Cas protein is a Streptococcus pyogenes-derived Cas9 protein, Staphylococcus aureus-derived Cas9 protein, or Cas 12a protein (conventional CPF1: Prevotella and Francisella 1) protein. It may be one selected from among nucleic acids encoding
  • composition may be present in a plasmid vector in the form of DNA encoding a guide RNA and a Cas protein.
  • composition may be present in a viral vector in the form of DNA encoding a guide RNA and a Cas protein.
  • the viral vector may be one or more selected from the group consisting of a retroviral vector, a lentiviral vector, an adenovirus vector, an adeno-associated virus (AAV) vector, a vaccinia virus vector, a poxvirus vector, and a herpes simplex virus vector.
  • composition for genetic manipulation may be in the form of a complex (RNP: ribonucleoprotein) in which a guide RNA and a Cas protein are combined.
  • RNP ribonucleoprotein
  • the present application provides a method for preparing a cell or embryo having a myostatin gene modified with the composition.
  • contacting the cell or embryo with the composition may include The contacting may be performed in vivo or ex vivo.
  • the contacting step may be performed by one or more methods selected from microinjection, electroporation, liposomes, plasmids, viral vectors, nanoparticles, and protein translocation domain (PTD) fusion protein methods.
  • the present application provides a method for producing an animal having a modified myostatin gene.
  • the method for producing a myostatin transgenic animal of the present application includes the steps of contacting an embryo with the above-described composition to prepare a transgenic embryo having a transformed gene, and transplanting the transformed embryo into a surrogate mother can do.
  • Animals produced by the above production method express less myostatin mRNA than wild-type animals.
  • the animal may be a mammal other than a human.
  • the myostatin transgenic animal of the present application may have an increased amount of muscle compared to a wild-type animal due to a low myostatin mRNA expression level.
  • myostatin transgenic animals Conventional myostatin transgenic animals have a short lifespan and several side effects, but the myostatin transgenic animals of the present application can provide healthy myostatin transgenic animals without various side effects.
  • composition provided by the present application may be provided as a composition for increasing muscle when a composition capable of modifying the myostatin gene is injected into an animal tissue.
  • FIG. 1 is a schematic diagram of the modified position of the myostatin gene, and lists the protospacer sequence used as an example of the present application.
  • FIG. 2 is a schematic diagram of a method for constructing a transgenic embryo having a myostatin gene in which 12 base pairs of the second exon are deleted.
  • FIG. 3 is a view showing the myostatin gene modification of a transgenic embryo having a myostatin gene in which 12 base pairs of the second exon are deleted by T7E1 assay.
  • FIG. 4 shows the protospacer sequence of the myostatin gene, and Sanger sequencing was performed on the myostatin-transformed embryo with a guide RNA containing a sequence binding to its complementary target sequence. it has been confirmed
  • FIG. 5 shows that guide RNA and CAS9 mRNA amounts most appropriate for the present application are confirmed by varying the amounts of guide RNA or Cas9 mRNA used to induce deletion of 12 base pairs of the second exon of the myostatin gene.
  • 6 is a photograph taken to confirm the appearance once a month for 1 to 4 months after birth as a cow having a myostatin gene in which 12 base pairs of the second exon are deleted.
  • FIG. 8 is a T7E1 assay confirming five sequences for potential off-target positions in order to confirm the off-target effect that may be caused by CRISPR/Cas9. By mixing or not mixing wild-type DNA, it was confirmed that hetero knock-out or homo knock-out did not occur for all 5 off-target sites.
  • 9 is a result of deep sequencing of 17 cows born after implantation of the embryo generated by the method of the schematic diagram of FIG. 2 into the womb of a surrogate mother, confirming the deletion of 12 base pairs of the myostatin gene.
  • 10 is a list of deep sequencing results of wild-type cattle as a negative control of cattle having a myostatin gene in which 12 base pairs of the second exon are deleted.
  • Figure 11 lists the results of deep sequencing of cattle 6 having a myostatin gene in which 12 base pairs of the second exon are deleted.
  • 12 is a list of deep sequencing results of cattle 14 having a myostatin gene in which 12 base pairs of the second exon are deleted.
  • 13 is a list of deep sequencing results of cattle 17 having a myostatin gene in which 12 base pairs of the second exon are deleted.
  • FIG. 14 is a view illustrating the myostatin mRNA expression levels of cattle 14 and 17 having a myostatin gene in which 12 base pairs of the second exon are deleted.
  • 16 is an image of somatic cells derived from follicle fluid obtained during the OPU process.
  • Figure 19 shows the summary results of MSTN male founder semen by Computer Assisted Semen Analysis.
  • the conserved region of the myostatin gene refers to a nucleic acid sequence encoding a region in which the myostatin amino acid sequence conserved by species during evolution is not modified and conserved.
  • the 'species conserved region of the myostatin gene' includes a nucleic acid sequence encoding amino acids in the order of leucine, tryptophan, isoleucine, and tyrosine among the amino acid sequences of myostatin conserved by each species (Table see 3).
  • the amino acid sequence of myostatin conserved for each species may have the same amino acid sequence, but may have multiple codons for the base encoding the amino acid. That is, the sequence encoding leucine may be one of 5'-CTT-3', 5'-CTC-3', 5'-CTA-3', or 5'-CTG-3', and The sequence to be 5'-TGG-3', the sequence encoding isoleucine may be one of 5'-ATT-3', 5'-ATC-3', or 5'-ATA-3', and tyrosine The coding sequence may be either 5'-TAT-3' or 5'-TAC-3'.
  • nucleic acid sequence of the 'conserved region of the myostatin gene for each species' of the present application may be different.
  • conserved region of the myostatin gene is also abbreviated as 'conserved region' or the like.
  • the term 'transgenic animal' refers to an animal having a modified myostatin gene.
  • a 'transgenic animal' has a myostatin gene in which 12 base pairs of the second exon are deleted and expresses a mature myostatin protein of the same sequence as that of a wild-type animal.
  • the trait of the modified myostatin gene of the transgenic animal in the present application is inherited to the offspring.
  • the first-generation animal F0 has a modified myostatin gene.
  • the animal F0 is capable of producing progeny F1.
  • the myostatin gene included in the F1 and F1 descendants has the same nucleotide sequence as the modified myostatin gene.
  • the term 'transgenic animal' includes the above F0, F1, and F1 or less progeny. That is, even when direct artificial manipulation for transformation is not applied during the production process of animal F1 or after animal F1 is produced, if animal F1 has a modified myostatin gene, it is the transgenic animal of the present application. .
  • Animals in the present application include non-human animals.
  • Such animals include mammals.
  • Such mammals include ungulates.
  • the ungulate includes artiodactyl.
  • the cows may include, but are not limited to, pigs, deer, cattle, sheep, and goats.
  • the mammal may include a rodent.
  • the rodent may include, but is not limited to, mice and rats.
  • target region' of the present application means including a region to artificially manipulate a gene on a wild-type genome in order to construct a transgenic animal, and is a region including the protospacer sequence and the target sequence indicated below.
  • the term 'protospacer sequence' in the present application means 20 sequences adjacent to the PAM sequence by the position of the PAM sequence in the target region of the present application.
  • the protospacer sequence and the target sequence are complementary sequences. That is, it refers to a sequence identical to the guide sequence complementary to the target sequence. However, the guide sequence may have the same sequence in which T (thymine) of the protospacer sequence is substituted with U (uracil).
  • target sequence' of the present application is a sequence included in the target region of the present application, and is a sequence complementary to a protospacer sequence.
  • the target sequence may be complementary to a guide sequence.
  • the symbols A, T, C, G, and U are interpreted as meanings understood by those of ordinary skill in the art. It may be properly interpreted as a base, a nucleoside, or a nucleotide on DNA or RNA according to context and technology.
  • nucleoside when it means a base, it can be interpreted as adenine (A), thymine (T), cytosine (C), guanine (G), or uracil (U) itself, respectively, and when it means a nucleoside, It can be interpreted as adenosine (A), thymine (T), cytidine (C), guanosine (G) or uridine (U), respectively, and when it refers to a nucleotide in the sequence, it includes each of the nucleosides should be construed as meaning a nucleotide that
  • the present application relates to a transgenic animal having a myostatin gene in which 12 base pairs of the second exon are deleted.
  • the transgenic animal of the present application is characterized in that it comprises a modification of the myostatin gene.
  • the myostatin gene of higher organisms known to date is characterized by being composed of three exons and two introns. Most of the myostatin gene is known to be present in muscle.
  • Myostatin mRNA produces myostatin protein composed of about 375 amino acids, and myostatin protein has three major parts, namely, a signal peptide region, a propeptide (prodomain) region; 28 kDa, N-terminus] and a mature region (12 kDa, C-terminus).
  • the structure of promyostatin, a precursor protein, is two identical subunits, and the maturation region is disulfide-bonded with each other, thereby maintaining the form of a homodimeric protein.
  • the signal transduction pathway of the myostatin protein As for the signal transduction pathway of the myostatin protein, it is divided into a propeptide region and a maturation region after first cleavage by a furin enzyme in the structure of promyostatin, a precursor protein. After cleavage, in the latent complex, the propeptide region binds to the mature region through a non-covalent bond. Then, as it is secreted out of the cell, the second cleavage is carried out by BMP/Tolloid, and the myostatin maturation zone binds to activin type II receptors and is phosphorylated.
  • the signal is transmitted back to the activin type I receptor, and the signal is transmitted to Smed 2 and Smad 3, which are receptor-regulated proteins, and , Smed 2 and Smed 3 bind to co-Smad 4 to regulate the transcription of the target gene.
  • Smed 2 and Smad 3 are receptor-regulated proteins, and , Smed 2 and Smed 3 bind to co-Smad 4 to regulate the transcription of the target gene.
  • myostatin gene transgenic animals are genetically modified so that the myostatin protein, which inhibits muscle growth, is not expressed in somatic cells.
  • myostatin protein which inhibits muscle growth
  • it is a form in which the expression of the mature myostatin protein is suppressed.
  • the animal obtained by cloning the somatic cells by the nuclear transfer method has a double musling form with increased muscle mass than that of the wild-type animal.
  • the myostatin transgenic animals obtained by the above method have a disadvantage in that they have a short lifespan. Accordingly, there are disadvantages in that problems of reproduction and fatal side effects occur in health, especially in large animals.
  • the present application relates to a transgenic animal in which the side effects caused by the conventional myostatin genetic modification are minimized and the advantages of the myostatin gene modification are emphasized.
  • the expression of the mature myostatin protein was suppressed compared to that of the wild type, not not expressed. form of animals.
  • myostatin transgenic animal having a modified myostatin gene.
  • it may be an ungulate animal, such as a cow.
  • the transgenic animal of the present application may have a different configuration of the myostatin gene from that of the wild-type animal in the configuration of the myostatin gene.
  • the genetic modification of the present application means a deletion of a nucleic acid sequence encoding four amino acid sequences (amino acids in the order of leucine, tryptophan, isoleucine, and tyrosine) of a specific conserved region among the amino acid sequence of the myostatin protein.
  • the transgenic animal of the present application has a myostatin gene in which 12 base pairs of the second exon, which is a nucleic acid sequence encoding the amino acid sequence of the conserved region, are deleted.
  • the deletion of 12 base pairs is a base pair (5' to 3') of positions 93 to 104 of the sequence encoding the second exon of the wild-type myostatin gene. It may be a deletion of the sequence).
  • the deletion of 12 base pairs may be a deletion of the base pair at positions 94 to 105 of the sequence encoding the second exon of the wild-type myostatin gene.
  • the transgenic animal of the present application may have a different aspect from the myostatin mRNA of a wild-type animal.
  • the transgenic animal of the present application has myostatin mRNA in which 12 bases are deleted.
  • the amount of myostatin mRNA expression in the transgenic animal may be measured.
  • the transgenic animal of the present application has an amount of myostatin mRNA expression that is at least 60% less, or more, less than that of a wild-type animal.
  • the amount of myostatin mRNA expression in the transgenic animal of the present application is lower than that of the wild-type animal, but does not express the myostatin mRNA.
  • the deleted 12 base pairs of the transgenic animal of the present application is a nucleic acid encoding a conserved amino acid sequence in which the amino acid sequence of each species is not modified in the course of the evolution of the myostatin gene.
  • the conserved amino acid sequence is the amino acid sequence of leucine, tryptophan, isoleucine, and tyrosine.
  • the transgenic animal of the present application expresses the myostatin protein in which four amino acids in the order of leucine, tryptophan, isoleucine, and tyrosine are deleted compared to the wild-type promyostatin protein.
  • the pro myostatin protein in which the four amino acids are deleted may be one of SEQ ID NOs: 30 to 33.
  • the promyostatin protein of the transgenic animal may have some sequence modifications, it may have 90% or more homology with one of SEQ ID NOs: 30 to 33.
  • the transgenic animal when the transgenic animal is a cow, the promyostatin protein of SEQ ID NO: 30 in which 4 amino acids are deleted may be expressed.
  • the transgenic animal is a pig
  • the promyostatin protein of SEQ ID NO: 31 in which 4 amino acids are deleted may be expressed.
  • the transgenic animal when the transgenic animal is a mouse, the pro-myostatin protein of SEQ ID NO: 32 in which 4 amino acids are deleted may be expressed.
  • the transgenic animal when the transgenic animal is a human, the promyostatin protein of SEQ ID NO: 33 in which 4 amino acids are deleted may be expressed.
  • the four amino acids to be deleted do not overlap with the region to be cleaved in the process of forming the mature myostatin protein of the pro-myostatin protein.
  • the pro-myostatin protein becomes a mature myostatin protein through a normal signaling process. That is, the deletion of a specific amino acid of the present application does not affect the formation of a normal mature myostatin protein.
  • the mature myostatin protein expressed by the myostatin transgenic animal of the present application is the same as that of the wild type. That is, it is characterized in that it is identical to the amino acid sequence of the wild-type mature myostatin protein.
  • the mature myostatin protein of the transgenic animal may be one of SEQ ID NOs: 34 to 37.
  • the mature myostatin protein of the transgenic animal may be modified in some sequences, but may have 90% or more homology with one of SEQ ID NOs: 34 to 37.
  • the transgenic animal when the transgenic animal is a cow, the mature myostatin protein of SEQ ID NO: 34 identical to that of a wild-type cow may be expressed.
  • the transgenic animal when the transgenic animal is a pig, the mature myostatin protein of SEQ ID NO: 35 identical to that of a wild-type pig may be expressed.
  • the transgenic animal when the transgenic animal is a mouse, it is possible to express the mature myostatin protein of SEQ ID NO: 36 identical to that of a wild-type mouse.
  • the transgenic animal when the transgenic animal is a human, it may express the mature myostatin protein of SEQ ID NO: 37 identical to that of a wild-type human.
  • Mature myostatin protein may have a monomeric or dimeric form in the blood.
  • the transgenic animal of the present application may express the mature myostatin protein in the same form as that of the wild type. That is, the mature myostatin protein of the transgenic animal of the present application has the same amino acid sequence as the mature myostatin protein of the wild-type animal.
  • the mature myostatin protein of the transgenic animal can be compared and confirmed with the wild-type mature myostatin protein through mass spectrometry.
  • the expression amount of the mature myostatin protein in the transgenic animal of the present application may be reduced than the expression amount of the mature myostatin protein in the wild-type animal. This result can also be seen through the decrease in the amount of myostatin mRNA expression of the transgenic animal of the present application compared to the amount of myostatin mRNA expression of the wild type (see FIG. 14 ).
  • the transgenic animal of the present application exhibits a phenotype with developed muscles due to reduced expression of myostatin mRNA and mature myostatin protein compared to wild-type animals.
  • the muscle-developed phenotype refers to phenotypes such as an increase in muscle mass, an increase in the number of muscle cells, an increase in the size of muscle cells, and an increase in the rate of muscle cell differentiation.
  • the transgenic animal of the present application has an increase in muscle mass of at least 1%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, or 40% or more compared to a wild-type animal can be
  • the transgenic animal of the present application does not express myostatin mRNA and mature myostatin protein, unlike the conventional myostatin transgenic animal. That is, the expression of the myostatin mRNA and mature myostatin protein is reduced compared to a wild-type animal that does not express it.
  • cows having the myostatin gene in which 12 base pairs of the present application were deleted had no health and no abnormalities in health.
  • a cow having a myostatin gene with a deletion of 12 base pairs of the present application can reproduce offspring through reproduction.
  • Another aspect of the present application is a myostatin-transformed cell having a modified myostatin gene.
  • the cells may be embryonic cells, somatic cells or stem cells.
  • the cells include, but are not limited to, cumulus cells, epithelial cells, fibroblasts, neurons, keratinocytes, hematopoietic cells, melanocytes, chondrocytes, macrophages, monocytes, myocytes , B lymphocytes, T lymphocytes, embryonic stem cells, embryonic germ cells, fetal-derived cells, placental cells and embryonic cells.
  • tissue-derived stem cells such as fat, uterus, bone marrow, muscle, placenta, umbilical cord blood, or skin (epithelium) can be used.
  • a non-human host embryo may generally be an embryo comprising a 2-cell stage, a 4-cell stage, an 8-cell stage, a 16-cell stage, a 32-cell stage, a 64-cell stage, a morula, or a blastocyst. .
  • Characteristics of the transgenic cells of the present application are the same as characteristics 1 to 3 of the above transgenic animals.
  • the transformed cell has a myostatin gene in which 12 base pairs of the second exon are deleted.
  • the genetic modification of the transformed cell means a deletion of the nucleic acid sequence encoding the four amino acid sequences (amino acids in the order of leucine, tryptophan, isoleucine, and tyrosine) of a specific conserved region among the amino acid sequence of the myostatin protein. do. Accordingly, the transformed cell has a myostatin gene in which 12 base pairs of the second exon, which is a nucleic acid sequence encoding the amino acid sequence of the conserved region, are deleted.
  • the transformed cell may have a different aspect from the myostatin mRNA of wild-type cells.
  • the transformed cell of the present application has myostatin mRNA in which 12 bases are deleted.
  • the amount of myostatin mRNA expression is lower than that of wild-type animals.
  • Prepro-myostatin protein must go through a cleavage step in order to become a mature myostatin protein in an active state.
  • the pro-myostatin protein becomes a mature myostatin protein through a normal signaling process. That is, the deletion of a specific amino acid of the present application does not affect the formation of a normal mature myostatin protein.
  • the mature myostatin protein expressed by the cell in which 12 base pairs of the myostatin gene of the present application are deleted has the same amino acid sequence as the mature myostatin protein of the wild-type cell.
  • composition for genetic manipulation composition for genetic manipulation
  • composition for genetic manipulation of modifying a myostatin gene in another aspect of the invention provided in the present application, there is provided a composition for genetic manipulation of modifying a myostatin gene.
  • composition for genetic manipulation is to modify the myostatin gene
  • a guide RNA comprising a guide sequence that forms a complementary bond with a target sequence of the myostatin gene or a DNA encoding the guide RNA
  • It may include a Cas protein or a nucleic acid sequence encoding the same.
  • the target sequence is a target target of the composition, and has a sequence complementary to a protospacer sequence included in the target region.
  • the target sequence is located in the second exon (Exon 2) of the myostatin gene.
  • composition of the present application targets the myostatin gene in order to modify the myostatin gene.
  • the portion that the composition can target is referred to as a target region.
  • the target region is located in the second exon (Exon 2) of the myostatin gene.
  • the target region includes a target sequence and a protospacer sequence, and a sequence to which the guide sequence of the composition complementarily binds is referred to as a target sequence.
  • the target sequence is configured to include some or all of the sequence encoding the conserved amino acid sequence of the myostatin protein for each species described below.
  • conserved amino acid sequences of promyostatin proteins by species are described in detail.
  • the conserved amino acid sequence is described in comparison with humans, pigs, and mice based on cattle. Animals having the conserved amino acid sequence are not limited thereto.
  • the specific amino acid deletion position of the promyostatin protein of the present application is this conserved amino acid sequence, that is, the 156th to 159th amino acid sequence of the myostatin protein.
  • This amino acid sequence is located at positions 157 to 160 of the myostatin protein in the mouse, but the amino acid sequence is the same in the mouse as leucine, tryptophan, isoleucine, and tyrosine.
  • the region targeted by the composition in the present application may include a part or all of a region encoding such a conserved amino acid sequence.
  • a target sequence may be designed around one strand of the DNA double strand including the conserved region.
  • the target sequence is 5'-CTT-3', 5'-CTC-3', 5'-CTA-3', or 5'-CTG-3' encoding leucine of the amino acid sequence, 5' encoding tryptophan - TGG-3', 5'-ATT-3' encoding isoleucine, 5'-ATC-3', or 5'-ATA-3', 5'-TAT-3' encoding tyrosine, or 5 It may include part or all of the sequence of '-TAC-3', or part or all of the complementary sequence of this sequence.
  • the target sequence may include SEQ ID NO: 28 - 5'-ATATATCCACAG-3'.
  • the target sequence may include SEQ ID NO: 29-5'-CTGTGGATATAT-3'.
  • the PAM sequence in the target region should be considered.
  • the PAM sequence may differ depending on the origin of the Cas protein.
  • the PAM sequence and sequences adjacent thereto are referred to as protospacer sequences.
  • the protospacer sequence consists of 20 or less nucleotide sequences, excluding the PAM sequence.
  • the protospacer sequence and the target sequence are complementary sequences.
  • the target sequence of the myostatin gene may be at least one selected from SEQ ID NO: 38 to SEQ ID NO: 60 of [Table 4].
  • SEQ ID Nos: 38 to 43 may be target sequences of bovine myostatin gene.
  • SEQ ID NO: 42, SEQ ID NO: 43, and SEQ ID NO: 45 to SEQ ID NO: 48 may be target sequences of a porcine myostatin gene.
  • SEQ ID NO: 49 to SEQ ID NO: 55 may be a target sequence of a human myostatin gene.
  • SEQ ID NOs: 56 to 60 may be target sequences of a mouse myostatin gene.
  • the composition of the present application comprises a guide RNA comprising a guide sequence complementary to each of the target sequences or a DNA encoding the RNA; and a CAS protein or a nucleic acid sequence encoding the same.
  • the guide RNA of the present application includes a guide sequence complementary to the above-described target sequence.
  • the guide RNA may include a first sequence that is a guide sequence capable of complementary binding to the target sequence, and a second sequence that interacts with a Cas protein to form a complex.
  • the first sequence of the guide RNA of the present application is a sequence homologous to a protospacer sequence, which is a sequence complementary to the designed target sequence, and is an RNA sequence composed of U (uracil) instead of T (thymine) among the corresponding protospacer sequences.
  • the first sequence of the present application may be a part of crRNA, and the second sequence may include another part of crRNA and/or tracrRNA.
  • the guide RNA may be first and second sequences consisting of only crRNA, and as another example, the guide RNA may be first and second sequences including crRNA and tracrRNA.
  • the first sequence may be determined according to the target sequence, and a part of the second sequence may be determined according to the type of the microorganism derived from the Cas protein.
  • the first sequence may be a part of a crRNA sequence
  • the second sequence may include a tracrRNA
  • the second sequence is
  • the guide RNA of the present application may be in the form of a single sequence in which the first sequence and the second sequence are linked. Alternatively, it may be configured in the form of two separate sequences consisting of a sequence including the first sequence and a sequence including a portion of the second sequence, which may be comprised of crRNA and tracrRNA, respectively.
  • guide sequence shown in [Table 5] is an RNA sequence capable of complementary binding to the target sequence of the myostatin gene.
  • the guide sequences shown in Table 5 are guide sequences capable of targeting the sequences in Table 2, respectively.
  • the guide sequence of the present application may be one or more sequences selected from SEQ ID NO: 62 to SEQ ID NO: 84.
  • SEQ ID NOs: 62 to 68 are guide sequences capable of complementary binding to a target sequence of a bovine myostatin gene.
  • SEQ ID NO: 66, SEQ ID NO: 67, and SEQ ID NO: 69 to SEQ ID NO: 72 are guide sequences capable of complementary binding to a target sequence of a porcine myostatin gene.
  • SEQ ID NOs: 73 to 79 are guide sequences capable of complementary binding to a target sequence of a human myostatin gene.
  • SEQ ID NO: 80 to SEQ ID NO: 84 are guide sequences capable of complementary binding to a target sequence of a mouse myostatin gene.
  • the guide RNA including the guide sequence and the Cas protein may be injected into cells or embryos in the form of a conjugated complex (Ribonucleoprotein particle: RNP).
  • RNP conjugated complex
  • the present application may provide a DNA encoding the guide RNA.
  • the DNA sequence encoding the guide RNA is a sequence encoding a guide sequence that is a first sequence, and each SEQ ID NO: 38 a DNA sequence identical to the target sequence represented by to 60; and a DNA sequence encoding the second sequence.
  • the Cas protein of the present application is Streptococcus pyogenes-derived Cas9 protein, Campylobacter jejuni-derived Cas9 protein, Streptococcus thermophilus-derived Cas9 protein, star It may be at least one selected from the group consisting of a Cas9 protein derived from Staphylococcus aureus, a Cas9 protein derived from Neisseria meningitidis, and a Cas12a (Cpf1) protein.
  • the Cas protein may be a wild type or a mutant form thereof.
  • the Cas protein or a nucleic acid encoding the same may further include an element commonly used for intranuclear delivery of eukaryotic cells, for example, a Nuclear Localization Sequence (NLS).
  • NLS Nuclear Localization Sequence
  • the Cas protein may be a Cas9 protein derived from Streptococcus pyyogenes, a Cas9 protein derived from Staphylococcus aureus, or a Cas12a (Cpf1) protein.
  • the PAM sequence may vary depending on the Cas protein.
  • SpCas9 has a PAM sequence of NGG.
  • SaCas9 has a PAM sequence of NNGRR or NNGRRT.
  • Cas12a (Cpf1) has a PAM sequence of TTTN.
  • N is any one of A, T, G or C. wherein R is A or G.
  • composition for genetic manipulation of myostatin of the present application includes a guide RNA or a nucleic acid encoding the same; and Cas protein or a nucleic acid encoding the same, independently or together.
  • the guide RNA of the present application may be delivered into a cell in the form of RNA or DNA encoding the RNA.
  • the guide RNA may be in the form of an independent RNA, RNA contained in a viral vector, or encoded in a vector.
  • the Cas protein of the present application may be delivered into a cell in the form of RNA or DNA encoding the RNA.
  • the Cas protein may be in the form of an independent RNA, RNA contained in a viral vector, or encoded in a vector.
  • the viral vector may be one or more selected from the group consisting of a retroviral vector, a lentiviral vector, an adenovirus vector, an adeno-associated virus (AAV) vector, a vaccinia virus vector, a poxvirus vector, and a herpes simplex virus vector.
  • the guide RNA and the Cas protein may be in the form of plasmid DNA including a sequence encoding each RNA and a promoter, and plasmid DNA including a sequence encoding a protein and a promoter.
  • the guide RNA and the Cas protein may be configured in a form including the RNA or protein-encoding sequence and the promoter in one plasmid DNA.
  • it may be constructed in the form of a viral vector other than plasmid DNA.
  • the guide RNA and the Cas protein may be in the form of mRNA.
  • guide RNA may be prepared by in vitro transcription using any in vitro transcription system known in the art.
  • the guide RNA and Cas protein of the present application may preferably be composed of a ribonucleoprotein (RNP) form of a complex in which the guide RNA and the Cas protein are coupled.
  • RNP ribonucleoprotein
  • the guide RNA and the Cas protein may be configured in different forms.
  • the guide RNA may be configured in the form of an independent RNA
  • the Cas protein may be configured in the form of a vector including a protein-encoding sequence and a promoter.
  • composition may be configured in various forms. Therefore, no limitation is placed on it since it can be appropriately used by those skilled in the art from methods known in the art.
  • the cells may be embryonic cells, somatic cells or stem cells.
  • the cells include, but are not limited to, cumulus cells, epithelial cells, fibroblasts, neurons, keratinocytes, hematopoietic cells, melanocytes, chondrocytes, macrophages, monocytes, myocytes. , B lymphocytes, T lymphocytes, embryonic stem cells, embryonic germ cells, fetal-derived cells, placental cells and embryonic cells.
  • tissue-derived stem cells such as fat, uterus, bone marrow, muscle, placenta, umbilical cord blood, or skin (epithelium) can be used.
  • a non-human host embryo may generally be an embryo comprising a 2-cell stage, a 4-cell stage, an 8-cell stage, a 16-cell stage, a 32-cell stage, a 64-cell stage, a morula, or a blastocyst. .
  • the cell may be an embryonic cell.
  • the cell may be derived from an animal.
  • the animal includes a mammal.
  • Said mammals include ungulates.
  • the ungulates may include, but are not limited to, cattle and pigs.
  • Said mammals include rodents.
  • the rodent may include, but is not limited to, a mouse.
  • contacting the cell with the composition may include The contacting may be performed in vivo or ex vivo.
  • the contacting step may include transient transfection, microinjection, transduction, cell fusion, calcium phosphate precipitation, liposome-mediated transfection. ), DEAE Dextran-mediated transfection, polybrene-mediated transfection, electroporation, gene gun and nucleic acid into cells It can be introduced into cells by other known methods for introducing them.
  • an indel insertion and deletion occurs in the genome of a cell.
  • Index refers to a mutation in which some nucleotides are inserted or deleted in the middle of the nucleotide sequence of DNA.
  • the indel may be introduced into the target sequence during the process of cutting and repairing the nucleic acid (DNA, RNA) of the guide RNA-CRISPR complex, which is the composition.
  • the transformed cell of the present application has the myostatin gene in which 12 base pairs are deleted from the second exon by the composition.
  • the transformed cell of the present application has a genetic modification with an in frame deletion by the method for producing the myostatin transformed cell described above.
  • the transformed cell having the myostatin gene in which 12 base pairs of the second exon of the present application are deleted has a genetic modification with an in frame deletion.
  • the form of the deletion is an in-frame deletion, and no frame-shifted modification occurs.
  • the in-frame deletion takes the form of a protein in which four amino acids are deleted, and translation into other amino acids or changing the stop codon, which may occur in general frame shift modifications, does not occur. That is, the remaining amino acids except for the four amino acids can be normally translated into proteins through transcription in the myostatin gene.
  • Another aspect of the invention provided in the present application relates to a method for producing an animal using the transformed cell. Specifically, it relates to a method for producing an animal having a myostatin gene in which 12 base pairs of the second exon are deleted.
  • the production method comprises transplanting an embryonic cell having a myostatin gene in which the 12 base pairs of the second exon is deleted into a surrogate mother, and a trait having the myostatin gene in which the 12 base pairs of the second exon are deleted. It's about producing convertible animals.
  • the production method relates to a method for producing an animal having a transformed tissue or organ by injecting the composition into a tissue or organ of the animal. .
  • the animal includes a mammal.
  • Said mammals include ungulates.
  • the ungulates may include, but are not limited to, cattle and pigs.
  • the mammal includes rodents.
  • the rodent may include, but is not limited to, a mouse.
  • the method may include transplanting a cell having a myostatin gene in which 12 base pairs of the second exon generated in the above step are deleted into a surrogate mother.
  • the embryonic cells may develop into blastocysts during in vitro culture.
  • an animal having a myostatin gene in which 12 base pairs of the second exon are deleted can be prepared.
  • the present application relates to an animal having a myostatin gene in which 12 base pairs of the second exon are deleted by transplanting an embryo having a myostatin gene in which 12 base pairs of the second exon are deleted, preferably produced a cow having a myostatin gene in which 12 base pairs of the second exon were deleted.
  • the transgenic animal may be a chimeric or homologous transgenic animal.
  • Transgenic animals can be produced by somatic cell nuclear transfer (SCNT) method by transplanting somatic cells having the myostatin gene modified by the above method or a nucleus thereof into a denucleated egg.
  • SCNT somatic cell nuclear transfer
  • the transgenic animal may be a homologous transgenic animal.
  • a transgenic animal can be produced through crossing with a first transgenic animal having a myostatin gene in which 12 base pairs of the second exon are deleted.
  • the transgenic animal obtained through the crossing may contain the same myostatin gene as that in which 12 base pairs of the myostatin gene included in the animal genome of the first transgenic animal are deleted.
  • the transgenic animal of the present application may be an animal having a myostatin gene in which 12 base pairs of the second exon in some tissues of the animal are deleted.
  • the tissue may be epithelial tissue, connective tissue, or muscle tissue, but preferably a muscle tissue containing the myostatin gene.
  • the method comprises the steps of introducing the composition described above into a tissue of an animal; may include
  • composition When the composition is introduced into an animal tissue, an animal having a tissue-specifically modified myostatin gene can be produced.
  • the introduction may be performed by injection, implantation or transplantation.
  • the introduction is subretinal, subcutaneously, intradermaliy, intraocularly, intravitreally, intratumorally, intranodally, intramedullary, intramuscularly ( intramuscularly), or intraperitoneally
  • Animals having a myostatin gene in which 12 base pairs of the second exon are deleted can be used as breeding animals.
  • the breeding animal may be a cow, pig, mouse, or rat in which 12 base pairs of the myostatin gene are deleted, but is not limited thereto.
  • the breed-improved animal may be a breed-improved animal in a form in which muscles are developed compared to a wild-type animal.
  • the breed-improved animal may be a breed-improved animal with reduced fat compared to a wild-type animal.
  • Animals having the myostatin gene in which 12 base pairs of the second exon are deleted can be used as animals for disease model study.
  • the disease model study animal may be a cow, pig, mouse or rat in which 12 base pairs of the myostatin gene are deleted, but is not limited thereto.
  • the disease model may be a study including, but not limited to, muscular atrophy, sarcopenia, and muscle fiber reduction.
  • Animals with a myostatin gene in which 12 base pairs of the second exon are deleted can be used as disease resistant animals.
  • the disease-resistant animal may be a cow, pig, mouse or rat in which 12 base pairs of the myostatin gene are deleted, but is not limited thereto.
  • the disease may include, but is not limited to, muscular atrophy, sarcopenia, and muscle fiber loss.
  • the flesh, organs, hides, fur, and body fluids of animals having a myostatin gene in which 12 base pairs of the second exon are deleted can be used, but are not limited thereto.
  • the animal may be a cow, pig, mouse or rat in which 12 base pairs of the myostatin gene are deleted, but is not limited thereto.
  • the animal may have a lower content of fat and a higher content of muscle as compared to a wild-type animal. Therefore, it is possible to obtain high-quality meat with a low fat content and a high muscle content as a by-product of the animal.
  • Another aspect of the invention provided in the present application relates to the use of the composition for genetic manipulation of the present application.
  • composition described above it can be used for a purpose that can increase muscle, but is not limited thereto.
  • the subject to which the composition can be administered may be mammals including primates such as humans and monkeys, rodents such as mice and rats, and ungulates such as cattle, pigs and horses.
  • the composition may be administered to a specific body location of the subject to whom the composition is administered.
  • the specific body location may be in the vicinity of a tissue in need of muscle gain.
  • the specific body position may be in the vicinity of a tissue in which muscles are not developed in the state of infancy.
  • the administration may be performed by injection, transfusion, implantation, or transplantation.
  • the administration may be performed by an administration route selected from subcutaneously, intradermaliy, intramuscularly, or intraperitoneally.
  • One dose (effective amount for obtaining a predetermined desired effect) of the composition for genetic manipulation of myostatin is 10 4 -10 9 cells per kg body weight of the administered subject, for example, 10 5 to 10 6 cells/kg (body weight). It may be selected from all integer values within the numerical ranges, but is not limited thereto, and may be appropriately administered in consideration of the age, health and weight of the subject to be administered, and the like.
  • the sgRNA comprising a sequence complementary to each single strand of 12 base pairs of myostatin was designed by CHOPCHOP software (https://chopchop.cbu.uib.no/).
  • the complementary binding sequence was included and was used among the PAM sequences of CRISPR/SpCas9, CRISPR/SaCas9, or CRISPR/Cpf1 for myostatin gene.
  • the sgRNA used in the experiment was designed to include at least one of the guide sequences in Table 2.
  • 1 is a schematic illustration of the protospacer sequence of the myostatin gene.
  • the binding sequence of the guide RNA can be predicted from the sequence.
  • COC cumulus-oocyte complex
  • Motile sperm were purified by the Percoll gradient method.sperm from semen thawed at 35°C was filtered by centrifugation at 1500 rpm for 15 min in a Percoll discontinuous gradient (45-90%). To produce a 45% Percoll solution, add 1 ml volume TALP to 1 ml 90% Percoll. The sperm pellet was centrifuged at 1500 rpm for 5 minutes and washed twice with the addition of 3 ml of TALP. Motile sperm purified using the Percoll gradient method were used for fertilization.
  • Motile sperm/ml sperm were cultured together with mature oocytes in 45 ul of in vitro fertilization-TALP medium covered with mineral oil (Nidacon, Cat.no.NO-100) in a humidified atmosphere of 5% CO 2 . After 18 hours of in vitro fertilization, cumulus cells were removed from the zygote. This conjugate was incubated in a culture medium protected with two steps of chemically defined mineral oil at a temperature of 38.5° C. in an atmosphere of 5% O 2 , 5% CO 2 , and 90% N 2 . The zygote is cultured into an embryo.
  • Cas9 mRNA and sgRNA When performing the microinjection method, the most suitable concentration was found by dividing Cas9 mRNA and sgRNA into 4 groups.
  • CB TE only microinjection, RNA1X; Cas9 mRNA: 100 ng/ ⁇ l, sgRNA: 50 ng/ ⁇ l, RNA2X; Cas9 mRNA: 200 ng/ ⁇ l, sgRNA: 100 ng/ ⁇ l, RNA 4X; Cas9 mRNA: 400 ng / ⁇ l, sgRNA: 200 ng/ ⁇ l).
  • Cas9 mRNA (sigma-Aldrich, Cat.no.CAS9MRNA) and sgRNA in the zygote were synthesized by GeneArt Precision gRNA Synthesis Kit (Thermofisher, Cat.no.A29377) and microinjector machine (Eppendorf, Femtojet®) was injected with Seven days after microinjection, preimplantation stage embryos were collected and myostatin deletion was observed or implanted in the uterus of a surrogate mother.
  • the microinjection method was illustrated in FIG. 2 .
  • 5 is a schematic diagram showing the results of the experiment by dividing Cas9 mRNA and sgRNA into 4 groups.
  • the ratio of blastocysts was similar in both RNA1X and RNA2X compared to wild-type.
  • the RNA2X group showed a significantly higher modification rate than other RNA1X and RNA4X groups. Therefore, the concentration of RNA2X was judged to be the most suitable, so that in the experiment, the Cas9 mRNA used in the RNA2X group: 200 ng/ ⁇ l, sgRNA: 100 ng/ ⁇ l was used for the experiment.
  • FIG. 4 is a view showing the results of the myostatin modified form of embryos obtained by performing sanger sequencing.
  • the transformed cell of the present application means only a transformed cell having a myostatin gene in which 12 base pairs of the second exon are deleted.
  • the blastocysts were stored in PBS supplemented with 20% FBS.
  • Surrogate mothers were examined 50 days after estrus by rectal palpation and ultrasound to observe embryo survival and pregnancy. Pregnant cattle were then routinely checked by rectal palpation and ultrasound examination.
  • the 17th cow is the one in which 12 base pairs of the second exon of the myostatin gene are deleted, so that muscle development can be confirmed externally. It was possible to confirm the role of this developed form.
  • Genomic DNA obtained from transgenic primary cells was extracted with a DNA extraction kit (DNeasy Blood & Tissue kit, Qiagen, Cat. no. 69504). MSTN Primer was designed by PRIMER3 software. PCR conditions were 35-40 cycles at 94°C for 5 min, 94°C for 20 sec/57°C for 30 sec/72°C for 35 sec, and 72°C for 5 min.
  • the target site was first amplified to about 500 bp in the extracted genomic DNA using KAPA HiFi HotStart DNA polymerase (Roche, Cat. no. # KK2502) according to the manufacturer's protocol. Then, the amplicon was amplified again to a size of ⁇ 230 bp, and the amplicon was amplified using the TruSeq HT double index containing primer, and the adapter and index sequence for the Illumina sequencing platform were added to each sample.
  • the primers used in this study are listed in SEQ ID NO: 101 and SEQ ID NO: 102.
  • the pooled PCR amplicons were purified using a PCR purification kit (MGmed) and sequenced on a MiniSeq (Illumina) with a paired-end sequencing system (2x150 bp).
  • a Cas-Analyzer was used to quantify indel ratios in deep-sequencing data.
  • the target deep sequencing results can be confirmed in FIGS. 9 to 13 .
  • Gray boxes indicate PAM sequences.
  • the underlined sequence is the protospacer sequence. Gray boxes and underlines are used the same in FIGS. 10 to 13 .
  • MSTN-1 GAGGTGTTCGTTCGTTTTTC (SEQ ID NO: 101) TAAGCACAGGAAACTGGTAG (SEQ ID NO: 102) MSTN-2 ACACTCTTTCCCTACACGACGCTCTTCCGATCT aacgcaagtggaaggaaac (SEQ ID NO: 103) GTGACTGGAGTTCAGACGTG TGCTCTTCCGATCTtgctct gccaaataccagtg (SEQ ID NO: 104)
  • DMEM fetal bovine serum
  • Penicillin/streptomycin Gibco, Cat.no.15140148
  • Non-essential amino acids Gibco, Cat.no.11140050
  • 100 mM ⁇ -Mercaptoethanol Sigma-aldrich, Cat.no.M3418
  • FIG. 14 is a diagram illustrating the comparison of the myostatin mRNA expression amount of wild-type cattle and cattle 14 and 17 after culturing the primary cells of cattle 14 and 17 born in the present application.
  • the amount of myostatin mRNA expression in primary cells of cattle 14 and 17 was reduced by more than 60% in cattle 14 and by 80% or more in cattle 17. .
  • MSTN mutant donor cows with random estrus cycles inserted with an intravaginal progesterone device (Repro360, Cue-mate) were intramuscularly injected with 2.0 mg of estradiol benzoate.
  • Donors received 200 mg of Kawasaki Pharm, Antorin R-10 (FSH) divided into 4 doses (57, 57, 43 and 43 mg) every 12 hours on days 4 and 5.
  • the P4 device was removed immediately on day 7 before OPU.
  • OPU donor cows were restrained from cow crush. Epidural anesthesia was performed with 5 ml, 2% lidocaine (Daihan, DAIHAN Lidocaine, South Korea). The ovaries were fixed by transrectal manipulation and stayed on the probe of an ultrasound device.
  • One trained OPU technician performed the OPU procedure using an ultrasound device (Esaote, mylab one) coupled with a 7.5 MHz transrectal transducer probe with a follicular aspiration guide (WTA, catalog number 10283). Follicular puncture was performed using an 18G OPU tread needle (WTA, catalog number 17927) and follicular fluid was collected in a 50 ml tube. The oocytes of the follicular fluid were collected under a stereoscopic microscope and used for in vitro fertilization. The remaining hair follicle fragments were used for primary culture.
  • Semen samples were used for cryopreservation when they exhibited more than 60% general motility. Semen samples were expanded with Optixcell® (IMV Technologies) at 37°C. The expanded semen was equilibrated at 4° C. for 3 hours and then placed in a 0.5 ml straw. The filled straws were placed in a special rack 5 cm high above liquid nitrogen, exposed to liquid nitrogen vapor for 15 minutes, and then placed in a cryogenic tank filled with liquid nitrogen (-196°C). Cryopreserved sperm were thawed in a water bath at 37° C. for 45 seconds.
  • Optixcell® IMV Technologies
  • IVOS-II CASA Computer-Assisted Sperm Analysis Program
  • frozen semen was thawed, incubated and purified using the same protocol used for IVF.
  • 3 ⁇ l of sperm was loaded into a sperm analysis chamber (Leja slide) and analyzed by CASA. Frozen straws from three different bulls were used.
  • each semen was analyzed three times, and the average value of CASA results was used for statistical evaluation.
  • Motile sperm were selected using the Percoll gradient method as previously described. Briefly, freeze-thawed semen of F0 bulls at 35°C was filtered by centrifugation in a Percoll discontinuous gradient (45-90%) at 1680 rpm for 15 min. To produce a 45% Percoll solution, 1 mL of capacitation-Tyrode's albumin lactate pyruvic acid (TALP) medium was added to 1 mL of 90% Percoll.sperm pellets were washed twice with the addition of 3 mL of dose-TALP medium, and then centrifuged at 1680 rpm for 5 minutes. Washed motile sperm were used for IVF.
  • capacitation-Tyrode's albumin lactate pyruvic acid (TALP) medium was added to 1 mL of 90% Percoll.
  • FIG. 15 shows a representative photograph (b) of the production of MSTN mutant blastocysts derived from MSTN mutant bovine oocytes (a) and pregnancy diagnosis using an ultrasound machine on the 30th day as a result of verifying germline transmission of MSTN mutant females.
  • 16 is a somatic cell image derived from follicle fluid obtained during OPU process ((a): MSTN mutant female, (b): wild-type).
  • FIG 17 shows the results of T7E1 analysis (a) and sequencing data (b) of MSTN mutant female blastocysts (M: marker; WT: wild type; 1: MSTN mutant female; N: negative control; P: T7E1 positive control).
  • Figure 18 shows the results of T7E1 analysis (a) and sequencing data from somatic cells of the follicle fluid (b) (1: MSTN mutant female (no wild type); 2: MSTN mutant female (no wild type)).
  • Semen was collected by electro-ejaculation from a 10.5% mutant male bull (F0). Samples were frozen for in vitro fertilization and thawed for sperm motility. CASA showed significant differences in % advanced cells, VCL, ALH and BCF between F0 and wild-type samples. However, LIN and STR did not show a significant difference between F0 and wild-type samples (FIG. 19). In addition, no deleterious effects on embryonic development and ability were seen when semen samples were used for in vitro fertilization. Oocytes collected at the slaughterhouse were fertilized with frozen thawed semen and cultured to develop into blastocysts. A total of 335 oocytes (number of copies 3) were used.
  • Figure 19 shows the summary results of MSTN male founder semen by Computer Assisted Semen Analysis.
  • Figure 21 shows the mutation rates of MSTN genes in blastocysts derived from in vitro fertilized MSTN mutant bull semen (1-6: randomly selected blastocysts).
  • the upper panel (a) shows the results of T7E1
  • the lower panel (b) shows the sequencing results of the MSTN target site.

Landscapes

  • Life Sciences & Earth Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Zoology (AREA)
  • Organic Chemistry (AREA)
  • Molecular Biology (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • General Health & Medical Sciences (AREA)
  • General Engineering & Computer Science (AREA)
  • Environmental Sciences (AREA)
  • Biochemistry (AREA)
  • Microbiology (AREA)
  • Medicinal Chemistry (AREA)
  • Biophysics (AREA)
  • Biodiversity & Conservation Biology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Animal Husbandry (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Veterinary Medicine (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)

Abstract

본 출원은 두 번째 엑손의 12개 염기쌍이 결실된 마이오스타틴 유전자를 가지는 동물, 또는 세포 에 관한 것이다. 또한, 상기 동물또는 세포를 제작하기 위해 마이오스타틴 유전자의 12개 염기쌍의 결실을 조작할 수 있는 조성물을 포함할 수 있다. 또한 상기 조성물을 이용하여 근육 증가의 용도로 사용하는 것에 관한 것이다.

Description

마이오스타틴 유전자가 변형된 형질전환 동물
본 출원은 변형된 유전자를 가지는 형질전환 동물 또는 세포에 관한 것이다. 상기 형질전환 동물 또는 세포는 두 번째 엑손에서 12개의 염기쌍이 결실된 마이오스타틴 유전자를 가진다.
본 출원은 상기 형질전환 동물 또는 세포 제작에 관련된 기술에 관한 것이다.
'벨지안 블루(Belgian Blue)'는 근육이 발달된 우량 품종의 소로 유명하다. 이 소는 19세기 벨기에 육종업자들이 교배를 통해 우연히 만들어낸 품종이다. 야생형과 비교해 사료 소모량은 많지 않지만 유전적인 이유로 근육세포가 많이 증식되어 지방이 적고 단백질이 많은 것이 특징이다. 이러한 특징은 마이오스타틴 유전자의 변형에 의한 것임이 보고되어 있다(McPherron AC, Lawler AM, Lee SJ (1997) Nature 387:83-90))
마이오스타틴(myostatin)은 명칭부터 근육(myo)+ 저해제(statin)을 의미하며, 이후로 연구가 지속되면서 마이오스타틴 단백질이 근육의 분화와 성장을 억제하는 것은 이미 자명하게 알려진 사실이다. 이러한 마이오스타틴은 여러 동물 모델에서 유전자 편집 도구를 활용하여 유전자 조절을 통해 근육 세포의 분화와 성장을 조절하는 연구가 진행되어 왔다.
나아가, 상기 마이오스타틴 형질전환 동물의 경우 대형 동물일 경우 육질을 얻을 수 있어 활용성이 높은 편이다. 하지만, 아직까지 마이오스타틴 유전자를 결실 시킬 경우 심장 비대증, 혈압 증가 및 짧은 수명 등 여러 부작용을 지닌 기술적 한계가 있다.
상기 기술적 한계의 문제점으로 마이오스타틴 형질전환 동물은 아직까지 산업적으로 이용하기 어려운 한계가 있다.
이에 본 출원인들은 건강하며, 근육 양이 증가된 마이오스타틴 형질전환 동물을 얻고자 노력하였다. 그 결과 본 출원의 형질전환 소는 특정 형태의 마이오스타틴 돌연변이를 가짐으로써, 종래의 부작용이 없는 형질전환 동물임을 확인하고 본 발명을 완성하였다.
선행기술문헌
특허문헌
(특허문헌 1) CN 104531705A
(특허문헌 2) CN 107034221A
비특허문헌
(비특허문헌 1) Am J Physiol Endocrinol Metab. 2017 Mar 1;312(3): E150-E160, Myostatin propeptide mutation of the hypermuscular Compact mice decreases the formation of myostatin and improves insulin sensitivity
본 출원의 일 목적은, 두 번째 엑손의 염기쌍 12개가 결실된 마이오스타틴 유전자를 갖는 동물을 제공하는 것이다.
본 출원의 다른 일 목적은, 두 번째 엑손의 염기쌍 12개가 결실된 마이오스타틴 유전자를 갖는 배아를 제공하는 것이다.
본 출원의 또 다른 일 목적은, 마이오스타틴 유전자 중 두 번째 엑손의 염기쌍 12개를 결실시키기 위한 조성물을 제공하는 것이다.
본 출원의 또 다른 일 목적은, 상기 조성물을 이용하여 동물의 근육에서의 근육 증가를 유도하는 용도를 제공하는 것이다.
상기 과제를 해결하기 위하여, 본 명세서에는 특정 부분이 변형된 마이오스타틴 유전자를 가지는 형질 전환 동물을 제공한다.
상기 변형은 마이오스타틴 유전자의 두 번째 엑손에서 일어날 수 있다.
상기 변형은 야생형 동물의 마이오스타틴 유전자 서열과 비교하여, 두 번째 엑손 중 류신, 트립토판, 아이소류신, 및 타이로신의 순서의 아미노산 서열을 암호화하는 영역에 해당하는 12개 염기쌍의 결실이다.
상기 류신, 트립토판, 아이소류신, 및 타이로신의 순서의 아미노산 서열을 암호화하는 핵산은 각각의 아미노산을 암호화하는 서열이 하나 이상일 수 있다.
즉, 류신을 암호화하는 서열은 5'- CTT-3', 5'- CTC-3', 5'- CTA-3', 또는 5'- CTG-3'중 선택되는 하나일 수 있고, 트립토판을 암호화하는 하는 서열은 5'- TGG-3', 아이소류신을 암호화하는 서열은 5'- ATT-3', 5'- ATC-3', 또는 5'- ATA-3'중 선택되는 하나일 수 있으며, 타이로신을 암호화하는 서열은 5'- TAT-3', 또는 5'- TAC-3'중 선택되는 하나일 수 있다.
상기 형질 전환 동물은 야생형의 동물보다 마이오스타틴 mRNA 발현 양이 적다.
또한, 상기 형질 전환 동물은 야생형의 동물과 동일한 아미노산 서열의 성숙 마이오스타틴 단백질을 발현할 수 있다.
상기 형질 전환 동물은 야생형의 동물보다 외형적으로 근육 양이 증가될 수 있다.
상기 형질 전환 동물은 포유류 (mammal)를 포함한다.
상기 포유류는 유제류 (ungulate)를 포함한다.
상기 유제류는 우제류 (artiodactyl)를 포함한다. 상기 우제류는 돼지, 사슴, 소, 양, 염소를 포함할 수 있으나, 이에 제한되지 않는다.
상기 포유류는 설치류 (rodent)를 포함할 수 있다. 상기 설치류는 마우스 및 랫을 포함할 수 있으나, 이에 제한되지 않는다.
바람직하게는 본 출원에서의 상기 형질 전환 동물은 소 이다. 상기 소는 서열번호 30으로 표시되는 아미노산 서열로 이루어진 프로 마이오스타틴 단백질을 발현한다.
또한, 본 출원은 특정 부분이 변형된 마이오스타틴 유전자를 가지는 형질 전환 세포를 제공한다.
상기 형질 전환 세포의 상기 변형은 마이오스타틴 유전자의 두 번째 엑손에서 일어날 수 있다.
상기 변형은 야생형 세포의 마이오스타틴 유전자 서열과 비교하여, 두 번째 엑손 중 류신, 트립토판, 아이소류신, 및 타이로신의 순서의 아미노산 서열을 암호화하는 영역에 해당하는 12개 염기쌍을 결실이다.
상기 류신, 트립토판, 아이소류신, 및 타이로신의 순서의 아미노산 서열을 암호화하는 핵산은 각각의 아미노산을 암호화하는 서열이 하나 이상일 수 있다.
즉, 류신을 암호화하는 서열은 5'- CTT-3', 5'- CTC-3', 5'- CTA-3', 또는 5'- CTG-3'중 하나일 수 있고, 트립토판을 암호화하는 하는 서열은 5'- TGG-3', 아이소류신을 암호화하는 서열은 5'- ATT-3', 5'- ATC-3', 또는 5'- ATA-3'중 하나일 수 있으며, 타이로신을 암호화하는 서열은 5'- TAT-3', 또는 5'- TAC-3'중 하나일 수 있다.
상기 형질 전환 세포는 야생형의 세포보다 마이오스타틴 mRNA 발현 양이 적다.
또한, 상기 형질 전환 세포는 야생형의 동물과 동일한 아미노산 서열의 성숙 마이오스타틴 단백질을 발현할 수 있다.
상기 세포는 배아세포, 체세포 또는 줄기세포일 수 있다.
상기 세포는, 이에 한정되지는 않으나 예를 들면, 난구세포, 상피세포, 섬유아세포, 신경세포, 각질세포, 조혈세포, 멜라닌 세포, 연골세포, 마크로파지, 단구세포, 근육세포, B 림프구, T 림프구, 배아 줄기세포, 배아 생식세포, 태아 유래 세포, 태좌세포 및 배아세포 등이 있다. 또한, 다양한 기원 조직으로부터 유래된 성체 줄기세포, 예를 들어, 지방, 자궁, 골수, 근육, 태반, 제대혈 또는 피부(상피) 등의 조직 유래 줄기세포를 사용할 수 있다. 비-인간 숙주 배아는 일반적으로 2-세포 단계, 4-세포 단계, 8-세포 단계, 16-세포 단계, 32-세포 단계, 64-세포 단계, 상실배, 또는 배반포를 포함하는 배아 일 수 있다.
상기 세포는 포유류로부터 얻을 수 있다.
바람직하게는 본 출원의 상기 세포는 소로부터 얻을 수 있다.
상기 형질 전환 세포는 서열번호 30으로 표시되는 아미노산 서열의 프로 마이오스타틴 단백질을 발현할 수 있다.
본 출원은 마이오스타틴 유전자를 변형시키는 조성물을 제공한다.
상기 조성물은 마이오스타틴 유전자를 변형시키기 위하여,
표적 서열과 상보적인 결합을 형성하는 가이드 서열을 포함하는 가이드 RNA 또는 상기 가이드 RNA를 암호화하는 DNA;
및 Cas 단백질 또는 이를 암호화하는 핵산서열을 포함할 수 있다.
상기 표적 서열은 서열번호 38 내지 서열번호 60 중 선택된 하나 이상을 포함할 수 있다.
상기 가이드 서열은 서열번호 624 내지 서열번호 84 중 선택된 하나 이상을 포함할 수 있다.
상기 Cas 단백질은 스트렙토코커스 피오게네스 (streptococcus pyogenes) 유래 Cas9 단백질, 스타필로코커스 아우레우스 (staphylococcus aureus) 유래 Cas9 단백질, 또는 Cas 12a 단백질 (종래의 CPF1 :Prevotella and Francisella 1) 단백질 중 선택되는 하나일 수 있다. 상기 Cas 단백질을 암호화하는 핵산은 스트렙토코커스 피오게네스 (streptococcus pyogenes) 유래 Cas9 단백질, 스타필로코커스 아우레우스 (staphylococcus aureus) 유래 Cas9 단백질, 또는 Cas 12a 단백질 (종래의 CPF1 :Prevotella and Francisella 1) 단백질을 암호화하는 핵산 중 선택되는 하나일 수 있다.
상기 조성물은 가이드 RNA 및 Cas 단백질을 암호화하는 DNA 형태로 플라스미드 벡터에 존재할 수 있다.
상기 조성물은 가이드 RNA 및 Cas 단백질을 암호화하는 DNA 형태로 바이러스 벡터에 존재할 수 있다.
이때, 상기 바이러스 벡터는 레트로바이러스 벡터, 렌티바이러스 벡터, 아데노바이러스 벡터, 아데노-연관 바이러스(AAV) 벡터, 백시니아바이러스 벡터, 폭스바이러스 벡터 및 단순포진 바이러스 벡터로 구성된 군에서 선택된 하나 이상일 수 있다.
상기 유전자 조작용 조성물은 가이드 RNA와 Cas 단백질이 결합한 복합체(RNP :ribonucleoprotein) 형태일 수 있다.
또한, 본 출원은 상기 조성물로 변형된 마이오스타틴 유전자를 가지는 세포 또는 배아를 제작하는 방법을 제공한다.
본 출원의 마이오스타틴 형질 전환 세포 또는 배아를 제작하는 방법은,
세포 또는 배아에 조성물을 접촉시키는 단계; 를 포함할 수 있다. 상기 접촉시키는 단계는 생체 내 또는 생체 외에서 수행될 수 있다.
상기 접촉시키는 단계는 미세주입, 전기천공법 (electroporation), 리포좀, 플라스미드, 바이러스벡터, 나노파티클(nanoparticles) 및 PTD (Protein translocation domain) 융합 단백질 방법 중 선택되는 1이상의 방법으로 수행될 수 있다.
또한, 본 출원은 변형된 마이오스타틴 유전자를 가지는 동물을 제작하는 방법을 제공한다.
본 출원의 마이오스타틴 형질 전환 동물을 제작하는 방법은, 배아에 상기 서술된 조성물을 접촉하여 형질전환 된 유전자를 가지는 형진전환 배아를 제작하는 단계 및 형질전환된 배아를 대리모에 이식하는 단계를 포함할 수 있다.
상기 제작 방법으로 제작된 동물은 야생형 동물에 비해 마이오스타틴 mRNA 가 적게 발현된다.
상기 동물은 인간을 제외한 포유류일 수 있다.
본 출원의 마이오스타틴 형질 전환동물은 낮은 마이오스타틴 mRNA 발현량으로 야생형의 동물에 비해 근육의 양이 증가될 수 있다.
그로 인해, 지방의 함량이 낮고 단백질의 함량이 높은 양질의 육질을 제공할 수 있다.
종래의 마이오스타틴 형질 전환 동물은 짧은 수명 및 여러 부작용이 있었지만, 본 출원의 마이오스타틴 형질 전환 동물은 여러 부작용이 없는 건강한 마이오스타틴 형질전환 동물을 제공할 수 있다.
또한, 본 출원에 의해 제공되는 조성물은 마이오스타틴 유전자를 변형시킬 수 있는 조성물을 동물의 조직에 주입 시 근육을 증가시키는 조성물로 제공될 수 있다.
도 1은 마이오스타틴 유전자의 변형 위치를 도식화하였으며, 본 출원의 일 예로 사용된 프로토스페이서 서열을 나열한 것이다.
도 2는 두 번째 엑손의 12개 염기쌍이 결실된 마이오스타틴 유전자를 가진 형질 전환 배아를 제작하는 방법을 도식화한 것이다.
도 3은 두 번째 엑손의 12개 염기쌍이 결실된 마이오스타틴 유전자를 가진 형질 전환 배아의 마이오스타틴 유전자 변형을 확인하기 위해 T7E1 assay로 확인한 것이다.
도 4는 마이오스타틴 유전자의 프로토스페이서 서열을 표기하고, 이의 상보적인 표적 서열에 결합하는 서열을 포함하는 가이드 RNA로 마이오스타틴 형질전환된 배아에 Sanger sequencing을 진행한 것으로 여러가지 변형 형태가 나오는 것을 확인한 것이다.
도 5는 마이오스타틴 유전자의 두 번째 엑손의 12개 염기쌍의 결실을 유도하기 위해 사용되는 가이드 RNA 또는 Cas9의 mRNA 양을 다르게 하여 본 출원을 진행하는데 가장 적절한 가이드 RNA및 CAS9 mRNA 양을 확인한 것이다.
도 6은 두 번째 엑손의 12개 염기쌍이 결실된 마이오스타틴 유전자를 가진 소로 태어난 이후 1개월 내지 4개월 동안 한 달에 한 번씩 외형 확인을 위해 촬영한 것이다.
도 7은 두 번째 엑손의 12개 염기쌍이 결실된 마이오스타틴 유전자를 가진 소의 마이오스타틴 변형을 T7E1 assay로 확인한 것이다.
도 8은 CRISPR/Cas9에 의해 발생할 수 있는 오프 타겟 효과를 확인하기 위해 잠재적인 오프 타겟 위치에 대한 5개의 서열을 T7E1 assay로 확인한 것이다. 와일드 타입 DNA를 섞어주지 않거나 섞어줌으로써 hetero knock-out이나 homo knock-out이 5개의 모든 오프 타켓 위치에 대해서 일어나지 않은 것을 확인하였다.
도 9는 도 2의 모식도의 방법으로 생성된 배아를 대리모의 자궁에 착상 후 태어난 17마리의 소의 deep sequencing 결과로 마이오스타틴 유전자의 12개 염기쌍 결실을 확인한 것이다.
도 10은 두 번째 엑손의 12개 염기쌍이 결실된 마이오스타틴 유전자를 가진 소의 negative control로 야생형 소의 deep sequencing 결과를 나열한 것이다.
도 11은 두 번째 엑손의 12개 염기쌍이 결실된 마이오스타틴 유전자를 가진 6번 소의 deep sequencing 결과를 나열한 것이다.
도 12는 두 번째 엑손의 12개 염기쌍이 결실된 마이오스타틴 유전자를 가진 14번 소의 deep sequencing 결과를 나열한 것이다.
도 13은 두 번째 엑손의 12개 염기쌍이 결실된 마이오스타틴 유전자를 가진 17번 소의 deep sequencing 결과를 나열한 것이다.
도 14는 두 번째 엑손의 12개 염기쌍이 결실된 마이오스타틴 유전자를 가진 14번 및 17번 소의 마이오스타틴 mRNA 발현 양을 확인한 것이다.
도 15는 MSTN 돌연변이 암컷의 생식선 전달 검증한 결과로, MSTN 돌연변이 소 난모세포로부터 유래된 MSTN 돌연변이 배반포의 생산 및 30일째 초음파 기계를 이용한 임신 진단의 대표적인 사진을 나타낸다.
도 16은 OPU 과정에서 얻은 여포액에서 파생된 체세포 이미지이다.
도 17은 MSTN 돌연변이 암컷 배반포의 T7E1 분석 결과 및 시퀀싱 데이터를 보여준다.
도 18은 T7E1 분석 결과 및 여포액의 체세포로부터의 시퀀싱 데이터를 보여준다.
도 19는 Computer Assisted Semen Analysis에 의한 MSTN 남성 설립자의 정액 요약한 결과를 보여준다.
도 20은 MSTN 돌연변이 수컷 소로부터 생식선 전달의 검증한 결과로, 대표적인 배반포 사진을 보여준다.
도 21은 체외 수정된 MSTN 돌연변이 황소 정액에서 파생된 배반포에서 MSTN 유전자의 돌연변이율을 보여준다.
본 명세서에 개시된 내용을 기술하기 위하여, 본 명세서에 여러 용어들이 정의될 것이다. 이러한 용어들에 더하여, 필요한 경우 기타 용어들이 본 명세서 내의 다른 곳에서 정의된다. 본원에서 달리 명확하게 정의되지 않는 한, 본 명세서에서 사용된 업계 용어들은 업계에서 인정되는 의미를 가질 것이다. 상충되는 경우, 본 명세서의 정의에 의해 해석될 수 있다.
일반적인 용어의 정의
마이오스타틴 유전자의 보존된 영역
마이오스타틴 유전자의 보존된 영역은, 진화 과정 중 종 별로 보존된 마이오스타틴 아미노산 서열이 변형되지 않고 보존된 영역을 암호화하는 핵산 서열을 의미한다.
본 출원에서는 상기 '마이오스타틴 유전자의 종 별 보존된 영역'은 종 별 보존된 마이오스타틴의 아미노산 서열 중 류신, 트립토판, 아이소류신, 및 타이로신 순서의 아미노산을 암호화하는 핵산 서열을 포함한다 (표 3 참조).
상기 종 별 보존된 마이오스타틴의 아미노산 서열은, 아미노산 서열은 동일하지만 아미노산을 암호화하는 염기의 코돈은 여러 개 일 수 있다. 즉, 류신을 암호화하는 서열은 5'- CTT-3', 5'- CTC-3', 5'- CTA-3', 또는 5'- CTG-3'중 하나일 수 있고, 트립토판을 암호화하는 하는 서열은 5'- TGG-3', 아이소류신을 암호화하는 서열은 5'- ATT-3', 5'- ATC-3', 또는 5'- ATA-3'중 하나일 수 있으며, 타이로신을 암호화하는 서열은 5'- TAT-3', 또는 5'- TAC-3'중 하나일 수 있다.
따라서, 본 출원의 '마이오스타틴 유전자의 종 별 보존된 영역'의 핵산 서열은 상이 할 수 있다. 본 명세서에서 마이오스타틴 유전자의 보존된 영역'은 '보존된 영역(conserved region)'등으로 축약해서 나타내기도 한다.
형질전환 동물
본 출원의 용어 '형질전환 동물'은 변형된 마이오스타틴 유전자를 가진 동물을 의미한다.
본 출원에서 '형질전환 동물'은 두 번째 엑손의 12개 염기쌍이 결실 된 마이오스타틴 유전자를 가지고, 야생형 동물과 동일한 서열의 성숙 마이오스타틴 단백질을 발현한다
본 출원에서의 형질전환 동물의 변형된 마이오스타틴 유전자의 형질은 자손에게 유전된다.
1세대 동물 F0는 변형된 마이오스타틴 유전자를 가진다. 상기 동물 F0는 자손 F1을 생산할 수 있다. 상기 F1 및 F1 이하 자손이 포함하는 마이오스타틴 유전자는 상기 변형된 마이오스타틴 유전자와 동일한 염기 서열을 가진다. 본 출원의 용어 '형질전환 동물'은 상기 F0, F1, 및 F1 이하 자손을 포함한다. 즉, 동물 F1의 생산 과정 중 또는 동물 F1이 생산된 이후 형질전환을 위한 직접적인 인위적 조작이 가해지지 않은 경우에도, 동물 F1이 변형된 마이오스타틴 유전자를 가진 경우라면, 본 출원의 형질전환 동물이다.
동물
본 출원의 동물 (animal)은 비-인간 동물(non-human animal)을 포함한다.
상기 동물은 포유류 (mammal)를 포함한다.
상기 포유류는 유제류 (ungulate)를 포함한다.
상기 유제류는 우제류 (artiodactyl)를 포함한다. 상기 우제류는 돼지, 사슴, 소, 양, 염소를 포함할 수 있으나, 이에 제한되지 않는다.
상기 포유류는 설치류 (rodent)를 포함할 수 있다. 상기 설치류는 마우스 및 랫을 포함할 수 있으나, 이에 제한되지 않는다.
표적 영역
본 출원의 용어 '표적 영역'은 형질전환 동물을 제작하기 위해, 야생형의 게놈 상에서 유전자를 인위적으로 조작하려는 영역을 포함하는 의미로, 하기에서 표기된 프로토스페이서 서열과 표적 서열을 포함하는 영역이다.
프로토스페이서 (protospacer) 서열
본 출원의 용어 '프로토스페이서 서열'는 본 출원의 표적 영역에서 PAM 서열의 위치에 의한 PAM 서열에 인접한 20개 서열을 의미한다. 상기 프로토스페이서 서열과 표적 서열은 상보적인 서열이다. 즉, 표적 서열과 상보적으로 결합하는 가이드 서열과 동일한 서열을 의미한다. 단, 상기 가이드 서열은 프로토스페이서 서열의 T(thymine)이 U(uracil)으로 치환되어 동일한 서열을 가질 수 있다.
표적 서열
본 출원의 용어 '표적 서열'은 본 출원의 표적 영역에 포함되는 서열로, 프로토스페이서 서열과 상보적으로 결합하는 서열이다. 상기 표적 서열은 가이드 서열과 상보적으로 결합할 수 있다.
A, T, C, G 및 U의 의미
본 명세서에서 사용되는 A, T, C, G 및 U 기호는 당업계 통상의 기술자가 이해하는 의미로 해석된다. 문맥 및 기술에 따라 DNA 또는 RNA 상에서 염기, 뉴클레오사이드 또는 뉴클레오타이드로 적절히 해석될 수 있다. 예를 들어, 염기를 의미하는 경우는 각각 아데닌(A), 티민(T), 시토신(C), 구아닌(G) 또는 우라실(U) 자체로 해석될 수 있고, 뉴클레오사이드를 의미하는 경우는 각각 아데노신(A), 티민(T), 시티딘(C), 구아노신(G) 또는 유리딘(U)으로 해석될 수 있으며, 서열에서 뉴클레오타이드를 의미하는 경우는 상기 각각의 뉴클레오사이드를 포함하는 뉴클레오타이드를 의미하는 것으로 해석되어야 한다.
이하, 본 출원을 상세히 설명한다.
본 출원은 두 번째 엑손의 12개의 염기쌍이 결실된 마이오스타틴 유전자를 가진 형질전환 동물에 관한 것이다.
마이오스타틴
본 출원의 형질전환 동물은 마이오스타틴 유전자의 변형을 포함하는 것을 특징으로 한다.
하기에서 마이오스타틴의 구조 및 기능에 대해 자세히 설명하고자 한다.
마이오스타틴의 구조
현재까지 알려진 고등 생물의 마이오스타틴 유전자는 3개의 엑손(exon)과 2개의 인트론(intron)으로 구성된 것을 특징으로 한다. 마이오스타틴 유전자는 대부분 근육에 존재한다고 알려져 있다.
마이오스타틴 mRNA는 약 375개의 아미노산으로 구성된 마이오스타틴 단백질을 생산하며, 마이오스타틴 단백질은 크게 3부분 즉, 신호 펩타이드 구역(signal peptide region), 프로펩타이드 구역[propeptide(prodomain) region; 28kDa, N-terminus] 및 성숙 구역(mature region; 12kDa, C-terminus)으로 나누어 구성된다.
전구체 단백질인 프로마이오스타틴의 구조가 두 개의 동일한 서브 유닛으로 성숙 구역이 서로 디설파이드 결합을 하고 있으며, 그로 인하여 호머다이머 단백질(homodimeric protein)의 형태를 유지하는 것이 특징이다.
마이오스타틴 성숙 단백질 기능 및 신호전달 경로
상기 마이오스타틴 단백질의 신호 전달 경로에 대해 알아보면, 전구체 단백질인 프로마이오스타틴 구조에서 퓨린(Furin) 효소에 의한 첫 번째 클리비지(cleavage) 후, 프로펩타이드 구역과 성숙 구역으로 나뉜다. 절단 후, 레이턴트 콤플렉스 (latent complex) 에서는 프로펩타이드 구역은 비공유성 결합을 통하여 성숙 구역과 결합하는 형태이다. 이후, 세포 바깥으로 분비가 되면서, 비엠피/톨로이드(BMP/Tolloid) 에 의해 두 번째 클리비지 가 진행 뒤 마이오스타틴 성숙 구역이 액티빈 II 형 수용체(activin type II receptors)와 결합하여 인산화 된다. 그 신호를 다시 액티빈 I 형 수용체(activin type I receptor)로 전달하고, 그 신호는 수용체 조절 단백질(receptor-regulated protein)인 스메드 2(Smad 2)와 스메드 3 (Smad 3)로 전달되고, 스메드 2와 스메드 3는 코 스메드 4(co-Smad 4)와 결합하여 목적 유전자의 전사를 조절한다. 상기 신호 전달 경로의 결과로, 성숙 마이오스타틴 단백질이 발현하게 된다.
종래 마이오스타틴 유전자 변형
종래의 마이오스타틴 유전자와 관련된 연구에서는 주로 성숙 마이오스타틴 단백질이 발현하지 않는 연구가 진행되었다. 상기 성숙 마이오스타틴 단백질의 발현을 억제함으로 많은 양의 근육이 생산되며 지방이 감소한 형태의 동물을 제조하는 연구를 하였다. 또한, 성숙 마이오스타틴 단백질이 발현하지 않는 연구를 통해 말기암 환자와 같이 급격히 근육양이 감소되는 질병, 근섬유의 재생 등에 활용하는 방향으로 마이오스타틴의 신호 전달 경로에 대한 연구도 진행되고 있다.
마이오스타틴 유전자 형질 전환 동물은 많은 경우 체세포에서 근육의 성장을 억제하는 마이오스타틴 단백질이 발현하지 않도록 유전자를 변형한다. 다시 말해, 위에서 서술된 성숙 마이오스타틴 단백질의 신호 전달 경로에서 클리비지 영역을 변형시켜, 성숙 마이오스타틴 단백질의 발현이 억제되는 형태이다. 상기 체세포를 핵이식 방법으로 복제한 동물은 야생형의 동물보다 근육량이 증가된 더블 머슬링 형태가 된다.
하지만, 상기 방법으로 수득한 마이오스타틴 형질전환 동물은 수명이 짧다는 단점이 있어 왔다. 따라서, 특히 대형동물에 있어 생식의 문제 및 건강상 치명적인 부작용이 발생된다는 단점이 있다.
본 출원에서는 종래의 마이오스타틴 유전자 변형에 있어 발생된 부작용을 최소화하며, 마이오스타틴 유전자 변형의 장점이 강조된 형질전환 동물에 관한 것이다.
구체적으로, 성숙 마이오스타틴 단백질의 신호 전달 과정의 cleavage 영역이 아닌 엑손 2의 특정 영역을 표적 하여 12개 염기쌍을 결실 시킴으로써, 성숙 마이오스타틴 단백질이 발현하지 않는 것이 아닌 야생형에 비해 발현이 억제된 형태의 동물을 제공한다.
마이오스타틴 형질전환 동물
본 출원의 일 태양은 변형된 마이오스타틴 유전자를 가진 마이오스타틴 형질전환 동물이다. 일 구현예로 유제류 동물, 예를 들어 소일 수 있다.
하기에서 본 출원의 변형된 마이오스타틴 유전자의 변형을 가지는 소를 예를 들어, 본 발명을 자세히 설명하고자 한다.
특징 1- 형질전환 동물의 게놈상 유전적 변형
본 출원의 형질전환 동물은 마이오스타틴 유전자 구성에 있어서 야생형 동물의 마이오스타틴 유전자와 다른 구성을 가질 수 있다.
본 출원의 유전적 변형은 마이오스타틴 단백질의 아미노산 서열 중 특정 보존된 영역의 4개의 아미노산 서열(류신, 트립토판, 아이소류신, 및 타이로신의 순서의 아미노산)을 암호화하는 핵산 서열의 결실을 의미한다.
본 출원의 형질전환 동물은, 상기 보존된 영역의 아미노산 서열을 암호화하는 핵산 서열인 두 번째 엑손의 12개 염기쌍이 결실된 마이오스타틴 유전자를 가진다.
상기 형질전환 동물이 소, 돼지 및 인간인 경우, 상기 12개 염기쌍의 결실은 야생형의 마이오스타틴 유전자의 두 번째 엑손을 암호화하는 서열의 93 번째 내지 104 번째의 위치의 염기쌍(5'에서 3'으로 서열을 표기함)의 결실일 수 있다.
상기 형질전환 동물이 마우스인 경우, 상기 12개 염기쌍의 결실은 야생형의 마이오스타틴 유전자의 두 번째 엑손을 암호화하는 서열의 94 번째 내지 105 번째의 위치의 염기쌍의 결실일 수 있다.
특징 2- 형질전환 동물의 마이오스타틴 유전자에 대한 mRNA 구성의 변화 및 발현량
본 출원의 형질전환 동물은 야생형 동물의 마이오스타틴 mRNA 와 다른 양태를 가질 수 있다. 본 출원의 형질전환 동물은 12개 염기가 결실 된 마이오스타틴 mRNA를 가진다.
본 출원의 일 구현예에서, 형질전환 동물의 마이오스타틴 mRNA 발현 양을 측정할 수 있다.
구체적인 실시 형태에서, 본 출원의 형질전환 동물은 마이오스타틴 mRNA 발현 양이 야생형 동물에 비해, 적어도 60%, 이상 적다. 바람직하게는, 본 출원의 형질전환 동물의 마이오스타틴 mRNA 발현 양은 야생형 동물의 마이오스타틴 mRNA 발현에 비해 적지만 발현을 하지 않는 것은 아니다.
특징 3- 형질전환 동물의 마이오스타틴 유전자에 대한 단백질 구성의 변화 및 성숙 마이오스타틴 단백질의 발현
본 출원의 형질전환 동물의 결실된 12개 염기쌍은 마이오스타틴 유전자의 진화 과정에서 종 별 아미노산 서열이 변형되지 않고, 보존된 아미노산 서열을 암호화하는 핵산이다. 상기 보존된 아미노산 서열은 류신, 트립토판, 아이소류신, 및 타이로신 순서의 아미노산 서열이다.
따라서, 본 출원의 형질전환 동물은 야생형 프로마이오스타틴 단백질과 비교하여 류신, 트립토판, 아이소류신, 및 타이로신 순서의 4개의 아미노산이 결실된 마이오스타틴 단백질이 발현된다.
상기 4개의 아미노산이 결실된 프로 마이오스타틴 단백질은 서열번호 30 내지 33 중 하나 일 수 있다.
상기 형질전환 동물의 프로 마이오스타틴 단백질은 일부 서열에 있어서 변형이 생길 수 있으나 서열번호 30 내지 33 중 하나의 서열과 90% 이상의 상동성을 가질 수 있다.
예를 들어, 상기 형질전환 동물이 소일 경우, 4개의 아미노산이 결실된 서열번호 30의 프로 마이오스타틴 단백질을 발현할 수 있다.
예를 들어, 상기 형질전환 동물이 돼지일 경우, 4개의 아미노산이 결실된 서열번호 31의 프로 마이오스타틴 단백질을 발현할 수 있다.
예를 들어, 상기 형질전환 동물이 마우스일 경우, 4개의 아미노산이 결실된 서열번호 32의 프로 마이오스타틴 단백질을 발현할 수 있다.
예를 들어, 상기 형질전환 동물이 인간일 경우, 4개의 아미노산이 결실된 서열번호 33의 프로 마이오스타틴 단백질을 발현할 수 있다.
서열번호 프로 마이오스타틴 단백질 서열
30 MQKLQISVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACLWRENTTSSRLEAIKIQILSKLRLETAPNISKDAIRQLLPKAPPLLELIDQFDVQRDASSDGSLEDDDYHARTETVITMPTESDLLTQVEGKPKCCFFKFSSKIQYNKLVKAQLRPVKTPATVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPEPGEDGLTPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGEGQIIYGKIPAMVVDRCGCS
31 MQKLQIYVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACMWRQNTKSSRLEAIKIQILSKLRLETAPNISKDAIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDLLMQVEGKPKCCFFKFSSKIQYNKVVKAQLRPVKTPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
32 MMQKLQMYVYIYLFMLIAAGPVDLNEGSEREENVEKEGLCNACAWRQNTRYSRIEAIKIQILSKLRLETAPNISKDAIRQLLPRAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQADGKPKCCFFKFSSKIQYNKVVKAQLRPVKTPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMSPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKGYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
33 MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
상기 결실되는 4개 아미노산은 프로 마이오스타틴 단백질의 성숙 마이오스타틴 단백질 형성과정에서의 클리비지 되는 영역과 겹치지 않는다.
상기 아미노산의 결실 위치는 클리비지가 일어나는 영역에 포함되지 않으므로, 상기 프로 마이오스타틴 단백질은 정상적인 시그널링 과정을 통해 성숙 마이오스타틴 단백질이 된다. 즉, 본 출원의 특정 아미노산의 결실은 정상적인 성숙 마이오스타틴 단백질의 형성 과정에 영향을 끼치지 않는다.
그러므로, 본 출원의 마이오스타틴 형질전환 동물이 발현하는 성숙 마이오스타틴 단백질은 야생형과 동일하다. 즉, 야생형의 성숙 마이오스타틴 단백질의 아미노산 서열과 동일한 것이 특징이다.
일 구현예에서, 상기 형질전환 동물의 성숙 마이오스타틴 단백질은 서열번호 34 내지 37 중 하나일수 있다.
상기 형질전환 동물의 성숙 마이오스타틴 단백질은 일부 서열에 있어서 변형이 생길 수 있으나 서열번호 34 내지 37 중 하나의 서열과 90% 이상의 상동성을 가질 수 있다.
예를 들어, 상기 형질전환 동물이 소일 경우, 야생형의 소와 동일한 서열번호 34의 성숙 마이오스타틴 단백질을 발현할 수 있다.
예를 들어, 상기 형질전환 동물이 돼지일 경우 야생형의 돼지와 동일한 서열번호 35의 성숙 마이오스타틴 단백질을 발현할 수 있다.
예를 들어, 상기 형질전환 동물이 마우스일 경우 야생형의 마우스와 동일한 서열번호 36의 성숙 마이오스타틴 단백질을 발현할 수 있다.
예를 들어, 상기 형질전환 동물이 인간일 경우 야생형의 인간과 동일한 서열번호 37의 성숙 마이오스타틴 단백질을 발현할 수 있다.
서열번호 성숙 마이오스타틴 단백질 서열
34 FGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGEGQIIYGKIPAMVVDRCGCS
35 CCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
36 CCRYPLTVDFEAFGWDWIIAPKGYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
37 CCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
성숙 마이오스타틴 단백질은 혈액 내에서 단량체 또는 이량체 형태를 가질 수 있다. 본 출원의 형질전환 동물은 야생형과 동일한 형태의 성숙 마이오스타틴 단백질을 발현할 수 있다. 즉, 본 출원의 형질전환 동물의 성숙 마이오스타틴 단백질은 야생형 동물의 성숙 마이오스타틴 단백질과 동일한 아미노산 서열이다.
본 출원의 일 구현예로, 상기 형질전환 동물의 성숙 마이오스타틴 단백질은 질량 분석법을 통해 야생형 성숙 마이오스타틴 단백질과 비교, 확인할 수 있다.
본 출원의 일 구현예로, 본 출원의 형질전환 동물의 성숙 마이오스타틴 단백질의 발현 양은, 야생형 동물의 성숙 마이오스타틴 단백질 발현 양보다 감소될 수 있다. 이 결과는 야생형의 마이오스타틴 mRNA 발현 양에 비해 본 출원의 형질전환 동물의 마이오스타틴 mRNA 발현 양이 감소된 것을 통해서도 알 수 있다 (도 14 참조).
특징 4- 근육 양의 증가
본 출원의 형질전환 동물은 마이오스타틴 mRNA, 및 성숙 마이오스타틴 단백질이 야생형 동물에 비해 발현이 감소됨으로 인해 근육이 발달된 표현형을 나타낸다. 상기 근육이 발달된 표현형이란, 근육 양의 증가, 근육 세포 수의 증가, 근육 세포의 크기 증가, 및 근육 세포 분화 속도의 증가와 같은 표현형을 나타낸다.
구체적인 실시 형태에서, 본 출원의 형질전환 동물은, 야생형 동물에 비해 근육 양이 적어도 1%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 또는 40% 이상 증가될 수 있다.
특징 5- 수명 단축 및 다른 부작용 없음
종래의 마이오스타틴 형질전환 동물은, 수명 단축 및 건강 이상과 연관되어 있음이 알려져 있다.
본 출원의 형질전환 동물은, 종래의 마이오스타틴 형질전환 동물과는 다르게 마이오스타틴 mRNA, 및 성숙 마이오스타틴 단백질이 발현을 하지 않는 것이 아니다. 즉, 발현을 안 하는 것이 아닌 야생형 동물에 비해 상기 마이오스타틴 mRNA, 및 성숙 마이오스타틴 단백질의 발현이 감소된 형태이다.
따라서, 마이오스타틴 mRNA, 및 성숙 마이오스타틴 단백질이 발현하지 않음으로 발생될 수 있는 수명 단축 및 건강 이상과는 달리, 건강하며 건강에서의 이상 증상이 없을 수 있다.
구체적인 실시 형태에서, 본 출원의 12개 염기쌍이 결실된 마이오스타틴 유전자를 가진 소의 건강함 및 건강에서의 이상 증상이 없는 것을 확인하였다.
일 구현예로, 본 출원의 12개 염기쌍이 결실된 마이오스타틴 유전자를 가진 소는 생식을 통해 자손을 번식할 수 있다.
마이오스타틴 형질전환 세포
본 출원의 다른 일 태양은 변형된 마이오스타틴 유전자를 가진 마이오스타틴 형질전환 세포이다.
상기 세포는 배아세포, 체세포 또는 줄기세포일 수 있다.
임의의 구체예에서, 상기 세포는, 예를 들면, 이에 한정되지는 않으나 난구세포, 상피세포, 섬유아세포, 신경세포, 각질세포, 조혈세포, 멜라닌 세포, 연골세포, 마크로파지, 단구세포, 근육세포, B 림프구, T 림프구, 배아 줄기세포, 배아 생식세포, 태아 유래 세포, 태좌세포 및 배아세포 등이 있다. 또한, 다양한 기원 조직으로부터 유래된 성체 줄기세포, 예를 들어, 지방, 자궁, 골수, 근육, 태반, 제대혈 또는 피부(상피) 등의 조직 유래 줄기세포를 사용할 수 있다. 비-인간 숙주 배아는 일반적으로 2-세포 단계, 4-세포 단계, 8-세포 단계, 16-세포 단계, 32-세포 단계, 64-세포 단계, 상실배, 또는 배반포를 포함하는 배아 일 수 있다.
본 출원의 형질전환 세포의 특징은 위의 형질전환 동물의 특징 1 내지 3과 동일하다.
요약하면 상기 형질전환 세포는 두 번째 엑손의 12개 염기쌍이 결실된 마이오스타틴 유전자를 가진다.
상기 형질전환 세포의 유전적 변형은 마이오스타틴 단백질의 아미노산 서열 중 특정 보존된 영역의 4개의 아미노산 서열(류신, 트립토판, 아이소류신, 및 타이로신의 순서의 아미노산)을 암호화하는 핵산 서열의 결실을 의미한다. 따라서 상기 형질전환 세포는, 상기 보존된 영역의 아미노산 서열을 암호화하는 핵산 서열인 두 번째 엑손의 12개 염기쌍이 결실된 마이오스타틴 유전자를 가진다.
상기 형질전환 세포는 야생형 세포의 마이오스타틴 mRNA 와 다른 양태를 가질 수 있다. 본 출원의 형질전환 세포는 12개 염기가 결실 된 마이오스타틴 mRNA를 가진다.
상기 형질전환 세포는 마이오스타틴 mRNA 발현 양이 야생형 동물에 비해 적다.
프리프로 마이오스타틴(prepro-myostatin) 단백질은 활성 상태의 성숙 마이오스타틴 단백질이 되기 위해서는 클리비지 (cleavage) 단계를 거쳐야 한다.
상기 형질전환 세포의 결실된 4개의 아미노산의 위치는 클리비지가 일어나는 영역에 포함되지 않으므로, 상기 프로 마이오스타틴 단백질은 정상적인 시그널링 과정을 통해 성숙 마이오스타틴 단백질이 된다. 즉, 본 출원의 특정 아미노산의 결실은 정상적인 성숙 마이오스타틴 단백질의 형성 과정에 영향을 끼치지 않는다.
즉, 본 출원의 마이오스타틴 유전자의 12개 염기쌍이 결실된 세포가 발현하는 성숙 마이오스타틴 단백질은 야생형 세포의 성숙 마이오스타틴 단백질과 동일한 아미노산 서열을 가진다.
유전자 조작용 조성물
본 출원에서 제공하는 발명의 다른 태양으로 마이오스타틴 유전자를 변형시키는 유전자 조작용 조성물을 제공한다.
상기 유전자 조작용 조성물은 마이오스타틴 유전자를 변형시키기 위하여,
마이오스타틴 유전자의 표적 서열과 상보적인 결합을 형성하는 가이드 서열을 포함하는 가이드 RNA 또는 상기 가이드 RNA를 암호화하는 DNA; 및
Cas 단백질 또는 이를 암호화하는 핵산서열을 포함할 수 있다.
상기 표적 서열은 상기 조성물이 표적 하는 대상으로, 표적 영역 내에 포함되어 있는, 프로토스페이서 서열과 상보적인 서열을 가진다.
상기 표적 서열은 마이오스타틴 유전자의 두 번째 엑손 (Exon 2)에 위치한다.
표적 서열
본 출원의 조성물은 마이오스타틴 유전자를 변형시키기 위하여, 마이오스타틴 유전자를 표적 한다.
상기 조성물이 표적 할 수 있는 부분을 표적 영역이라 한다.
상기 표적 영역은 마이오스타틴 유전자의 두 번째 엑손 (Exon 2)에 위치한다.
상기 표적 영역은 표적 서열 및 프로토스페이서 서열을 포함하고, 상기 조성물의 가이드 서열이 상보적으로 결합하는 서열을 표적 서열이라 한다.
본 출원에서는, 종 별 유전자 서열 차이가 있으므로, 유전자 조작용 조성물의 표적 영역으로 마이오스타틴 단백질의 아미노산 서열의 보존된 영역을 암호화하는 핵산을 표적 하는 것이 용이할 수 있다.
따라서, 상기 표적 서열은 하기에서 서술되는 종 별 마이오스타틴 단백질의 보존된 아미노산 서열을 암호화하는 서열의 일부 또는 전부를 포함할 수 있도록 구성되어 있다.
하기에서, 종 별 프로 마이오스타틴 단백질의 보존된 아미노산 서열에 대해 자세히 설명한다. 일 구체예에서, 상기 보존된 아미노산 서열은, 소를 기준으로 인간, 돼지, 마우스와 비교하여 설명한다. 상기 보존된 아미노산 서열을 가지는 동물은 이에 한정하지는 않는다.
소, 사람, 돼지, 및 마우스의 프로 마이오스타틴 단백질 서열을 비교하여 일부를 하기 [표 3]에 작성하였다. 각 프로 마이오스타틴 단백질의 156번 내지 159번째의 아미노산 서열이 보존되어 있고, 하기 보존된 아미노산 서열은 류신, 트립토판, 아이소류신, 및 타이로신 순서이다(아래 표 중 굵은 글씨의 칸 참조).
152 153 154 155 156 157 158 159 160 161 162 163 164 165
Cattle V K A Q L W I Y L R P V E T
Human " " " " " " " " " " " " K "
Pig " " " " " " " " " " " " K "
153 154 155 156 157 158 159 160 161 162 163 164 165 166
Mice V K A Q L W I Y L R P V K T
본 출원의 프로마이오스타틴 단백질의 특정 아미노산 결실 위치는 이러한 보존된 아미노산 서열, 즉 마이오스타틴 단백질의 156번 내지 159번째 아미노산 서열이다.
이러한 아미노산 서열은 마우스에서는 마이오스타틴 단백질의 157번 내지 160번째에 위치하고 있으나, 마우스에서도 아미노산 서열은 류신, 트립토판, 아이소류신, 및 타이로신으로 동일한다.
본 출원에서 조성물이 표적하는 영역은 이러한 보존된 아미노산 서열을 암호화하는 영역의 일부 또는 전부를 포함할 수 있다. 상기 보존된 영역을 포함하는 DNA 이중 가닥 중 하나의 가닥을 중심으로 표적서열을 설계할 수 있다.
상기 표적 서열은 아미노산 서열의 류신을 암호화하는 5'- CTT-3', 5'- CTC-3', 5'- CTA-3', 또는 5'- CTG-3', 트립토판을 암호화하는 5'- TGG-3', 아이소류신을 암호화하는 5'- ATT-3', 5'- ATC-3', 또는 5'- ATA-3', 타이로신을암호화하는 5'- TAT-3', 또는 5'- TAC-3',의 서열의 일부 또는 전부를 포함하거나 이러한 서열의 상보적인 서열의 일부 또는 전부를 포함할 수 있다. 본 출원의 일 실시예로, 상기 표적 서열은 서열번호 28 - 5'-ATATATCCACAG-3'을 포함할 수 있다. 본 출원이 다른 실시예로, 상기 표적 서열은 서열번호 29 - 5'- CTGTGGATATAT -3'을 포함할 수 있다.
표적 서열을 디자인하기 위해서는 상기 표적 영역에서 PAM 서열을 고려해야 한다. 상기 PAM 서열은 Cas 단백질 유래에 따라 다를 수 있다.
상기 PAM 서열 및 이에 인접한 서열을 프로토스페이서 서열이라 한다. 상기 프로토스페이서 서열은 PAM 서열을 제외하고, 20개 이하의 염기 서열로 구성되어 있다. 상기 프로토스페이서 서열과 상기 표적 서열은 상보적인 서열이다.
일 예에서, 상기 마이오스타틴 유전자의 표적 서열은 [표 4]의 서열번호 38 내지 서열번호 60 중 선택된 하나 이상일 수 있다.
예를 들어, 서열번호 38 내지 서열번호 43은 소의 마이오스타틴 유전자의 표적 서열일 수 있다.
예를 들어, 서열번호 42, 서열번호 43, 및 서열번호 45 내지 서열번호 48은 돼지의 마이오스타틴 유전자의 표적 서열일 수 있다.
예를 들어, 서열번호 49 내지 서열번호 55는 인간의 마이오스타틴 유전자의 표적 서열일 수 있다.
예를 들어, 서열번호 56 내지 서열번호 60은 마우스의 마이오스타틴 유전자의표적 서열일 수 있다.
표적 서열
CGGAGTCTATATAGGTGTCA (서열번호 38)
GGAGTCTATATAGGTGTCAA (서열번호 39)
GGGTTGACACCTATATAGAC (서열번호 40)
CCGGAGTCTATATAGGTGTC (서열번호 41)
TCCGGGTTGACACCTATATA (서열번호 42)
CTATATAGGTGTCAACCCGG (서열번호 43)
GTGTCAACCCGGAAATGATC (서열번호 44)
CAGAGTCTATATAGGTGTCA (서열번호 45)
AGAGTCTATATAGGTGTCAA (서열번호 46)
CCAGAGTCTATATAGGTGTC (서열번호 47)
GTGTCAACCCGGAAATGATG (서열번호 48)
CAGAGTTTATATAGGTATCA (서열번호 49)
AGAGTTTATATAGGTATCAA (서열번호 50)
TACCTATATAAACTCTGGGC (서열번호 51)
TCCGGGTTGATACCTATATA (서열번호 52)
CCAGAGTTTATATAGGTATC (서열번호 53)
TTATATAGGTATCAACCCGG (서열번호 54)
GTATCAACCCGGAAATGATG (서열번호 55)
CAGACTCTATATAGGTGTCA (서열번호 56)
AGACTCTATATAGGTGTCAA (서열번호 57)
CCAGACTCTATATAGGTGTC (서열번호 58)
TCTATATAGGTGTCAACCCG (서열번호 59)
GTGACAACCCGAAAATGATG (서열번호 60)
일 구체예에서, 본 출원의 조성물은 상기 각 표적서열에 상보적 결합을 하는 가이드 서열을 포함하는 가이드 RNA 또는 상기 RNA를 암호화하는 DNA; 및 CAS 단백질 또는 이를 암호화하는 핵산 서열을 포함한다.
가이드 RNA 또는 상기 가이드 RNA를 암호화하는 DNA
본 출원의 가이드 RNA는 위에서 서술한 상기 표적 서열과 상보적인 결합을 하는 가이드 서열을 포함한다.
상기 가이드 RNA는 상기 표적 서열에 상보적으로 결합할 수 있는 가이드 서열인 제1 서열 및 Cas단백질과 상호작용하여 복합체를 형성하는데 관여하는 제2 서열을 포함할 수 있다.
본 출원의 가이드 RNA의 제 1서열은 상기 설계된 표적서열과 상보적인 서열인 프로토스페이서 서열과 상동의 서열로서, 해당 프로토스페이서 서열 중 T (thymine) 대신 U(uracil)로 이루어져 있는 RNA 서열이다.
다른 관점에서, 본 출원의 상기 제1 서열은 crRNA의 일부일 수 있고, 제2 서열은 crRNA의 다른 일부 및/또는 tracrRNA를 포함할 수 있다. 일 예시로, 상기 가이드 RNA는 crRNA만으로 이루어진 제1 및 제2 서열일 수 있고, 다른 예시로, 상기 가이드 RNA는 crRNA 및 tracrRNA를 포함하는 제1 및 제2 서열일 수 있다.
이 때, 상기 제1서열은 표적 서열에 따라 결정될 수 있고, 상기 제2 서열 일부는 Cas 단백질 유래 미생물의 종류에 따라 결정될 수 있다.
예를 들어, 스트렙토코커스 피요게네스(Streptococcus pyogenes) 유래 Cas 단백질과 결합하는 가이드 RNA 일 경우, 상기 제1서열은 crRNA 서열의 일부일 수 있고, 상기 제2 서열은 tracrRNA를 포함할 수 있다.
일 구체예에서, 스트렙토코커스 피요게네스(Streptococcus pyogenes) 단백질과 결합하는 가이드 RNA 일 경우, 상기 제2 서열은
5'-GUUUUAGUCCCUGAAAAGGGACUAAAAUAAAGAGUUUGCGGGACUCUGCGGGGUUACAA
UCCCCUAAAACCGCUUUU-3' (서열번호 61)을 포함할 수 있다.
한편, 본 출원의 가이드 RNA는 상기 제1서열 및 제2서열이 연결된 단일 서열의 형태일 수 있다. 또는 상기 제1서열을 포함하는 서열 및 상기 제2서열 일부를 포함하는 서열로 구성된 2개의 분리된 서열 형태로 구성될 수 있고, 이는 각각 crRNA 및 tracrRNA로 구성될 수 있다.
이하, 본 출원의 일 구체예에서 사용할 수 있는 가이드 서열들의 예시들을 표로 나타낸다. [표 5]에 기재된 가이드 서열은 마이오스타틴 유전자의 표적 서열에 상보적으로 결합할 수 있는 RNA서열이다.
표 5에 기재된 가이드 서열은 표 2의 서열을 각각 표적 할 수 있는 가이드 서열이다.
본 출원의 가이드 서열은 서열번호 62 내지 서열번호 84 번 중 선택된 하나 이상의 서열일 수 있다.
예를 들어, 서열번호 62 내지 서열번호 68은 소의 마이오스타틴 유전자의 표적 서열에 상보적으로 결합할 수 있는 가이드서열이다.
예를 들어, 서열번호 66, 서열번호 67 및 서열번호 69 내지 서열번호 72는 돼지의 마이오스타틴 유전자의 표적 서열에 상보적으로 결합할 수 있는 가이드서열이다.
예를 들어, 서열번호 73 내지 서열번호 79은 사람의 마이오스타틴 유전자의 표적 서열에 상보적으로 결합할 수 있는 가이드서열이다. 예를 들어, 서열번호 80 내지 서열번호 84은 마우스의 마이오스타틴 유전자의 표적 서열에 상보적으로 결합할 수 있는 가이드서열이다.
본 출원의 일 구현예로, 상기 가이드 서열을 포함하는 가이드 RNA와 Cas 단백질이 결합된 복합체 (Ribonucleoprotein particle: RNP)의 형태로 세포 또는 배아에 주입될 수 있다.
가이드 서열
5'-GCCUCAGAUAUAUCCACAGU-3'(서열번호 62)
5'-CCUCAGAUAUAUCCACAGUU-3'(서열번호 63)
5'-CCCAACUGUGGAUAUAUCUG-3'(서열번호 64)
5'-GGCCUCAGAUAUAUCCACAG-3'(서열번호 65)
5'-AGGCCCAACUGUGGAUAUAU-3' (서열번호 66)
5'-GAUAUAUCCACAGUUGGGCC-3'(서열번호 67)
5'-CACAGUUGGGCCUUUACUAG-3'(서열번호 68)
5'-GUCUCAGAUAUAUCCACAGU-3'(서열번호 69)
5'-UCUCAGAUAUAUCCACAGUU-3'(서열번호 70)
5'-GGUCUCAGAUAUAUCCACAG-3'(서열번호 71)
5'-CACAGUUGGGCCUUUACUAC-3'(서열번호 72)
5'-GUCUCAAAUAUAUCCAUAGU-3'(서열번호 73)
5'-UCUCAAAUAUAUCCAUAGUU-3'(서열번호 74)
5'-AUGGAUAUAUUUGAGACCCG-3'(서열번호 75)
5'-AGGCCCAACUAUGGAUAUAU-3'(서열번호 76)
5'-GGUCUCAAAUAUAUCCAUAG-3'(서열번호 77)
5'-AAUAUAUCCAUAGUUGGGCC-3'(서열번호 78)
5'-CAUAGUUGGGCCUUUACUAC-3'(서열번호 79)
5'-GUCUGAGAUAUAUCCACAGU-3'(서열번호 80)
5'-UCUGAGAUAUAUCCACAGUU-3'(서열번호 81)
5'-GGUCUGAGAUAUAUCCACAG-3'(서열번호 82)
5'-AGAUAUAUCCACAGUUGGGC-3'(서열번호 83)
5'-CACAGUUGGGCUUUUACUAC-3'(서열번호 84)
한편, 본 출원은 다른 태양으로, 상기 가이드 RNA를 암호화하는 DNA를 제공할 수 있다.이 때, 상기 가이드 RNA를 암호화하는 DNA 서열은 제1서열인 가이드 서열을 암호화하는 서열로서, 각 서열번호 38 내지 60으로 표시되는 표적서열과 동일한 DNA 서열; 및 제2서열을 암호화하는 DNA 서열을 포함한다.
Cas 단백질 또는 이를 암호화하는 핵산
본 출원의 상기 Cas 단백질은 스트렙토코커스 피요게네스(Streptococcus pyogenes) 유래의 Cas9 단백질, 캄필로박터 제주니 (Campylobacter jejuni) 유래의 Cas9 단백질, 스트렙토코커스 써모필러스 (Streptococcus thermophilus) 유래의 Cas9 단백질, 스타필로코커스 아우레우스 (Staphylococcus aureus) 유래의 Cas9 단백질, 네이세리아 메닝기티디스 (Neisseria meningitidis)유래의 Cas9 단백질, 및 Cas12a (Cpf1) 단백질로 이루어진 군에서 선택된 하나 이상일 수 있다. 본 출원에서 상기 Cas 단백질은 야생형 또는 이의 돌연변이 형태일 수 있다.
본 출원에서, 상기 Cas 단백질 또는 이를 암호화하는 핵산은 진핵세포의 핵 내 전달을 위하여 통상적으로 사용되는 요소, 예를 들어 NLS(Nuclear localization sequence) 등을 추가로 포함할 수 있다.
일 구체예에서, 상기 Cas 단백질은 스트렙토코커스 피요게네스 유래의 Cas9 단백질, 스타필로코커스 아우레우스 유래의 Cas9 단백질, 또는 Cas12a(Cpf1) 단백질일 수 있다.
PAM 서열은 Cas 단백질 에 따라 달라질 수 있다. 일 구현예로 SpCas9 는 PAM 서열이 NGG이다. 일 구현예로 SaCas9는 PAM 서열이 NNGRR 또는 NNGRRT이다. 일 구현예로 Cas12a(Cpf1)는 PAM 서열이 TTTN이다. 상기 N은 A, T, G 또는 C 중 어느 하나이다. 상기 R은 A 또는 G이다.
유전자 조작용 조성물의 형태
본 출원의 마이오스타틴 유전자 조작용 조성물은 가이드 RNA 또는 이를 암호화하는 핵산; 및 Cas 단백질 또는 이를 암호화하는 핵산을 각각 독립적으로 또는 함께 포함할 수 있다.
본 출원의 가이드 RNA는 세포 내로 RNA 또는 상기 RNA를 암호화하는 DNA형태로 전달될 수 있다. 가이드 RNA는 독립된 RNA의 형태, 바이러스 벡터에 포함되어 있는 RNA, 또는 벡터에 암호화 되어있는 형태일 수 있다.
본 출원의 Cas 단백질은 세포 내로 RNA 또는 상기 RNA를 암호화하는 DNA형태로 전달될 수 있다. Cas 단백질은 독립된 RNA의 형태, 바이러스 벡터에 포함되어 있는 RNA, 또는 벡터에 암호화 되어있는 형태일 수 있다.
이때, 상기 바이러스 벡터는 레트로바이러스 벡터, 렌티바이러스 벡터, 아데노바이러스 벡터, 아데노-연관 바이러스(AAV) 벡터, 백시니아바이러스 벡터, 폭스바이러스 벡터 및 단순포진 바이러스 벡터로 구성된 군에서 선택된 하나 이상일 수 있다.
일 실시예로, 상기 가이드 RNA와 상기 Cas 단백질은 각각의 RNA를암호화하는 서열 및 프로모터를 포함하는 플라스미드 DNA, 단백질을 암호화하는 서열 및 프로모터를 포함하는 플라스미드 DNA의 형태로 구성될 수 있다.
다른 실시예로, 상기 가이드 RNA와 상기 Cas 단백질은 하나의 플라스미드 DNA 안에 RNA 또는 단백질을 암호화하는 서열 및 프로모터를 포함하는 형태로 구성될 수 있다.
다른 형태로는, 플라스미드 DNA가 아닌 바이러스 벡터의 형태로 구성될 수 있다.
다른 실시예로, 상기 가이드 RNA와 상기 Cas 단백질은 mRNA의 형태로 구성될 수 있다. 이 때, 당업계에 알려진 임의의 인 비트로 전사 시스템을 사용하여 인 비트로 전사함으로써 가이드 RNA를 제조할 수 있다.
본 출원의 가이드 RNA와 Cas 단백질은, 바람직하게, 가이드 RNA와 Cas 단백질이 결합된 복합체의 RNP (ribonucleoprotein)형태로 구성될 수 있다.
또 다른 실시예로, 상기 가이드 RNA와 상기 Cas 단백질은 각각 다른 형태로 구성될 수 있다. 예를 들어, 가이드 RNA는 독립된 RNA의 형태로 구성되며, Cas 단백질은 단백질을 암호화하는 서열 및 프로모터를 포함하는 벡터 형태로 구성될 수 있다.
이 밖에도, 상기 조성물은 여러 형태로 구성될 수 있다. 따라서 당업계에 공지된 방법으로부터 당업자가 적절히 이용할 수 있으므로 이제 제한을 두지는 않는다.
마이오스타틴 형질전환 세포 제작 방법
본 출원에서 제공하는 발명의 다른 일 태양으로 상기 조성물을 이용하여 두 번째 엑손의 12개 염기쌍이 결실된 마이오스타틴 유전자를 갖는 세포의 제작방법에 관한 것이다.
상기 세포는 배아세포, 체세포 또는 줄기세포일 수 있다.
임의의 구체예에서, 상기 세포는, 예를 들면, 이에 한정되지는 않으나 난구세포, 상피세포, 섬유아세포, 신경세포, 각질세포, 조혈세포, 멜라닌 세포, 연골세포, 마크로파지, 단구세포, 근육세포, B 림프구, T 림프구, 배아 줄기세포, 배아 생식세포, 태아 유래 세포, 태좌세포 및 배아세포 등이 있다. 또한, 다양한 기원 조직으로부터 유래된 성체 줄기세포, 예를 들어, 지방, 자궁, 골수, 근육, 태반, 제대혈 또는 피부(상피) 등의 조직 유래 줄기세포를 사용할 수 있다. 비-인간 숙주 배아는 일반적으로 2-세포 단계, 4-세포 단계, 8-세포 단계, 16-세포 단계, 32-세포 단계, 64-세포 단계, 상실배, 또는 배반포를 포함하는 배아 일 수 있다.
바람직하게는, 상기 세포는, 배아세포일 수 있다.
상기 세포는 동물에서 유래한 것일 수 있다.
상기 동물은 포유류를 포함한다.
상기 포유류는 유제류를 포함한다.
상기 유제류는 소, 돼지를 포함할 수 있으나, 이에 제한되지는 않는다.
상기 포유류는 설치류를 포함한다.
상기 설치류는 마우스를 포함할 수 있으나, 이에 제한되지는 않는다.
본 출원의 마이오스타틴 형질전환 세포를 제작하는 방법은,
세포에 상기 조성물을 접촉시키는 단계; 를 포함할 수 있다. 상기 접촉시키는 단계는 생체 내 또는 생체 외에서 수행될 수 있다.
예를 들어, 이에 한정되지는 않으나, 상기 접촉시키는 단계는 일시적 형질감염(transient transfection), 미세주입, 형질도입(transduction), 세포융합, 칼슘 포스페이트 침전법, 리포좀 매개된 형질감염(liposome-mediated transfection), DEAE 덱스트란-매개된 형질감염(DEAE Dextran-mediated transfection), 폴리브렌-매개된 형질감염(polybrene-mediated transfection), 전기천공법(electroporation), 유전자 총(gene gun) 및 세포 내로 핵산을 유입시키기 위한 다른 공지의 방법에 의해 세포 내로 도입할 수 있다.
상기 도입된 조성물에 의해, 세포의 게놈 내 인델 (indel: insertion and deletion)이 발생한다.
"인델(indel)"은 DNA의 뉴클레오타이드 배열에서 일부 뉴클레오타이드가 중간에 삽입 (insertion)되거나 결실 (deletion) 된 변이를 총칭한다. 인델은 상기 조성물인 가이드RNA-CRISPR 복합체가 핵산(DNA, RNA)를 절단하고 수선하는 과정에서 표적 서열에 도입되는 것일 수 있다.
상기 인델의 결과로, 본 출원의 형질전환 세포는 상기 조성물에 의해 두 번째 엑손에서 12개 염기쌍이 결실된 마이오스타틴 유전자를 가진다.
또한, 위의 서술된 마이오스타틴 형질전환 세포의 제작 방법에 의해 본 출원의 형질전환 세포는 인 프레임 결실 (In frame deletion)이 된 유전자 변형을 가진다.
하기에서 in frame deletion 효과에 대해 서술한다.
In frame deletion 효과
본 출원의 두 번째 엑손의 12개 염기쌍이 결실된 마이오스타틴 유전자를 갖는 형질전환 세포는 인 프레임 결실 (In frame deletion)이 된 유전자 변형을 가진다.
인 프레임 결실 (In frame deletion)은 적어도 3개의 DNA 염기 일반적으로 3의 배수의 염기로 결실이 되어야 전체 코돈이 결실되며, 그에 따른 단백질에서의 아미노산의 결실로 이어질 수 있다.
본 출원은 마이오스타틴 유전자의 12개의 염기의 결실이 특징이기 때문에, 결실의 형태가 인 프레임 결실이며, 프레임 시프트 된 변형은 일어나지 않는다.
상기 인 프레임 결실로 4개의 아미노산이 결실 된 단백질의 형태를 띄며 일반적인 프레임 시프트 변형에서 발생할 수 있는, 다른 아미노산으로 번역되거나, 정지 코돈을 변경하는 일은 발생되지 않는다. 즉, 4개의 아미노산을 제외한 나머지 아미노산은 정상적으로 마이오스타틴 유전자에서 전사를 거쳐 단백질로 번역될 수 있다.
마이오스타틴 형질전환 동물 제작 방법
본 출원에서 제공하는 발명의 다른 일 태양은, 상기 형질전환된 세포를 이용한 동물의 제작 방법에 관한 것이다. 구체적으로, 두 번째 엑손의 12개 염기쌍이 결실된 마이오스타틴 유전자를 갖는 동물의 제작방법에 관한 것이다.
임의의 구체예에서, 상기 제조 방법은 두 번째 엑손의 12개 염기쌍을 결실된 마이오스타틴 유전자를 가진 배아 세포를 대리모에 이식하여 두 번째 엑손의 12개 염기쌍이 결실된 마이오스타틴 유전자를 가진 형질전환 동물을 생산하는 것에 관한 것이다.
다른 구체예에서, 상기 제조 방법은 동물의 조직 또는 기관에 상기 조성물을 주입하여 형질전환된 조직 또는 기관을 갖는 동물을 제작하는 방법에 관한 것이다. .
상기 동물은 포유류를 포함한다.
상기 포유류는 유제류를 포함한다.
상기 유제류는 소, 돼지를 포함할 수 있으나, 이에 제한되지는 않는다.
상기 포유류는 설치류를 포함한다.
상기 설치류는 마우스를 포함할 수 있으나, 이에 제한되지는 않는다.
세포로부터 형질전환 동물을 제작하는 방법
본 출원의 마이오스타틴 형질전환 동물을 제작하는 방법은,
일 구체예를 들어, 위의 단계로 생성된 두 번째 엑손의 12개 염기쌍이 결실된 마이오스타틴 유전자를 가지는 세포를 대리모에 이식하는 단계를 포함할 수 있다.
각 단계에 관한 통상적 기술 내용은 당업계에 공지되어 있는 형질전환 동물의 제조방법 등을 참조하여 이해할 수 있을 것이다.
본 출원에서는 위의 '마이오스타틴 형질전환 세포 제작' 방법에서 서술한 방법으로 상기 세포에 조성물을 접촉시키는 단계까지 완료된 배아 세포를 제조할 수 있다.
상기 배아 세포는 체외 배양 과정에서 배반포로 발달할 수 있다.
상기 배반포를 대리모에 이식하여 두 번째 엑손의 12개 염기쌍이 결실된 마이오스타틴 유전자를 갖는 동물을 제작할 수 있다.
본 출원은 일 실시예에서, 두 번째 엑손의 12개 염기쌍이 결실된 마이오스타틴 유전자를 갖는 배아를 이식하여, 상기 두 번째 엑손의 12개 염기쌍이 결실된 마이오스타틴 유전자를 갖는 동물, 바람직하게는 두 번째 엑손의 12개 염기쌍이 결실된 마이오스타틴 유전자를 갖는 소를 제작하였다.
상기 형질전환 동물은 키메릭 또는 상동성 형질전환 동물일 수 있다.
본 출원의 마이오스타틴 형질전환 동물을 제작하는 방법은,
다른 일 구체예를 들어,
상기 설명한 형질전환된 체세포를 수득하는 단계; 동물의 난자로부터 핵을 제거하여 탈핵 난자를 제조하는 단계; 상기 탈핵 난자에 형질전환된 체세포 또는 이의 핵을 미세 주입하고 융합시키는 단계; 융합된 난자를 활성화시키는 단계; 및 활성화된 난자를 대리모에 이식하는 단계를 포함할 수 있다.
각 단계에 관한 통상적 기술 내용은 당업계에 공지되어 있는 종래의 체세포 핵이식 기술을 이용한 형질전환 동물의 제조방법 등을 참조하여 이해할 수 있을 것이다.
위의 방법으로 변형된 마이오스타틴 유전자를 가진 체세포 또는 이의 핵을, 탈핵된 난자에 이식하여 SCNT(Somatic cell nuclear transfer) 방법으로 형질전환 동물을 제작할 수 있다. 상기 형질전환 동물은 상동성 형질전환 동물 일 수 있다.
또 다른 실시예로, 상동성 형질전환 동물을 제작하는 방법으로 두 번째 엑손의 12개 염기쌍이 결실된 마이오스타틴 유전자를 갖는 제 1 형질 전환 동물과의 교배를 통해 형질 전환 동물이 제작 될 수 있다.
상기 교배를 통해 얻은 형질 전환 동물은 제 1 형질 전환 동물의 동물 게놈이 포함하는 마이오스타틴 유전자의 12개의 염기쌍이 결실된 것과 동일한 마이오스타틴 유전자를 포함할 수 있다.
일부 조직이 형질전환 된 동물을 제작하는 방법
본 출원의 형질전환 동물은 동물의 일부 조직에서의 두 번째 엑손의 12개 염기쌍이 결실된 마이오스타틴 유전자를 갖는 동물일 수 있다.
상기 조직은 상피조직, 결합조직 또는 근육조직일 수 있으나 바람직하게는 마이오스타틴 유전자를 포함하고 있는 근육조직일 수 있다.
상기 방법은, 위에서 서술된 상기 조성물을 동물의 조직에 도입하는 단계; 를 포함할 수 있다.
상기 조성물이 동물의 조직에 도입되면, 조직 특이적으로 변형된 마이오스타틴 유전자를 가진 동물이 제작될 수 있다.
상기 도입은 주사(injection), 삽입 (implantation) 또는 이식(transplantation)으로 수행될 수 있다.
상기 도입은 망막하(subretinal), 피하(subcutaneously), 피내(intradermaliy), 안구내(intraocularly), 유리체내(intravitreally) 종양내(intratumorally), 절내(intranodally), 골수내(intramedullary), 근육내(intramuscularly), 또는 복막내
(intraperitoneally)에서 선택된 투여 경로로 수행될 수 있다.
본 출원의 마이오스타틴 형질전환 동물의 이용
품종 개량 동물
두 번째 엑손의 12개 염기쌍이 결실된 마이오스타틴 유전자를 갖는 동물은 품종 개량 동물로 이용될 수 있다. 상기 품종 개량 동물은 마이오스타틴 유전자의 12개 염기쌍이 결실된 소, 돼지, 마우스, 또는 랫 일 수 있으나, 이에 제한되지 않는다. 상기 품종 개량 동물은 야생형 동물에 비해 근육이 발달된 형태의 품종 개량 동물일 수 있다. 상기 품종 개량 동물은 야생형 동물에 비해 지방이 감소된 형태의 품종 개량 동물일 수 있다.
질환 모델 연구용 동물
두 번째 엑손의 12개 염기쌍이 결실된 마이오스타틴 유전자를 갖는 동물은 질환 모델 연구용 동물로 이용될 수 있다. 상기 질환 모델 연구용 동물은 마이오스타틴 유전자의 12개 염기쌍이 결실된 소, 돼지, 마우스 또는 랫 일 수 있으나, 이에 제한되지 않는다. 상기 질환 모델은 근육 위축증, 근육 감소증 및 근섬유 감소를 포함하는 연구일 수 있으나, 이에 제한되지 않는다.
질병 저항성 동물
두 번째 엑손의 12개 염기쌍이 결실된 마이오스타틴 유전자를 갖는 동물은 질병 저항성 동물로 이용될 수 있다. 상기 질병 저항성 동물은 마이오스타틴 유전자의 12개 염기쌍이 결실된 소, 돼지, 마우스 또는 랫 일 수 있으나, 이에 제한되지 않는다. 상기 질병은 근육 위축증, 근육 감소증 및 근섬유 감소를 포함할 수 있으나, 이에 제한되지 않는다.
부산물 이용
두 번째 엑손의 12개 염기쌍이 결실된 마이오스타틴 유전자를 갖는 동물의 살, 장기, 가죽, 털, 및 체액이 이용될 수 있으나, 이에 제한되지 않는다. 상기 동물은 마이오스타틴 유전자의 12개 염기쌍이 결실된 소, 돼지, 마우스 또는 랫일 수 있으나, 이에 제한되지 않는다. 상기 동물은 야생형 동물과 비교하여, 지방의 함량이 낮고, 근육의 함량이 높을 수 있다. 따라서, 상기 동물의 부산물로 지방의 함량이 낮고 근육의 함량이 높은 양질의 고기를 얻을 수 있다.
본 출원의 유전자 조작용 조성물의 용도
본 출원에서 제공하는 발명의 또 다른 태양으로 본 출원의 유전자 조작용 조성물의 용도에 관한 것이다.
상기에서 전술된 조성물을 이용하여, 근육을 증가시킬 수 있는 용도로 사용할 수 있으나, 이에 한정되지는 않는다.
이때, 상기 조성물을 투여할 수 있는 대상은 인간, 원숭이 등의 영장류, 마우스, 랫 등의 설치류, 소, 돼지, 말 등의 유제류 등을 포함하는 포유동물 일 수 있다.
본 출원에서 제공하는 발명의 또 다른 태양으로 본 출원의 유전자 조작용 조성물을 투여하는 단계를 포함하는, 상기 투여된 조직의 근육을 증가를 시킬 수 있는 방법을 제공할 수 있다.
상기 조성물은 조성물 투여 대상의 특정 신체 위치에 투여될 수 있다.
상기 특정 신체 위치는 근육 증가를 필요로 하는 조직의 주변 일 수 있다.
상기 특정 신체 위치는 영유아기의 상태로 근육이 발달되지 못한 조직의 주변 일 수 있다.
상기 투여는 주사(injection), 수혈(transfusion), 삽입(implantation) 또는 이식(transplantation)으로 수행될 수 있다.
상기 투여는 피하(subcutaneously), 피내(intradermaliy), 근육내(intramuscularly), 또는 복막내 (intraperitoneally)에서 선택된 투여 경로로 수행될 수 있다.
마이오스타틴 유전자 조작용 조성물의 1회 투여량(소정의 소망하는 효과를 얻기 위한 유효량)은 투여 대상의 체중 kg 당 104-109 세포, 예컨대, 105 내지 106세포/kg(체중) 정도로 상기 수치 범위들 내의 모든 정수 값들 중에서 선택될 수 있으나, 이에 제한되는 것은 아니고, 투여 대상의 연령, 건강 및 체중, 등을 고려하여 적절히 투여될 수 있다.
본 명세서에 의해 개시되는 몇몇 구현예들의 방법, 조성물에 의해 마이오스타틴 유전자를 인위적으로 조작할 경우, 이를 통해 근육을 증가시키는 등의 효과를 얻을 수 있다.
이하, 실시예를 통하여 본 출원을 더욱 상세히 설명하고자 한다.
이들 이들 실시예는 오로지 본 출원을 보다 구체적으로 설명하기 위한 것으로서, 본 출원의 범위가 이들 실시예에 의해 제한되지 않는다는 것은 본 출원이 속하는 기술분야에서 통상의 지식을 가진 자에 있어 자명할 것이다.
[실시예]
[실시예 1] Single 가이드 RNA(sgRNA) 설계
마이오스타틴 12개 염기쌍의 각각의 단일가닥과 상보적 결합을 하는 서열을 포함하는 sgRNA 는 CHOPCHOP 소프트웨어 (https://chopchop.cbu.uib.no/) 에 의해 설계되었다. 상기 상보적 결합을 하는 서열을 포함하며 마이오스타틴 유전자에 대한 CRISPR/SpCas9, CRISPR/SaCas9, 또는 CRISPR/Cpf1 의 PAM 서열 중에서 사용하였다. 실험에 이용된 sgRNA는 표 2의 가이드 서열들 중 적어도 하나 이상을 포함하도록 설계하였다.
도 1에 마이오스타틴 유전자의 프로토스페이서 서열의 예시가 도식화되어 있다.
상기 도 1의 서열을 통해 상기 서열의 상보적인 서열(표적 서열)에 가이드 RNA가 결합함으로, 상기 서열에서 가이드 RNA의 결합 서열을 예측할 수 있다.
[실시예 2] 난모세포 체외성숙
난소는 지역 도축장에서 채취하여 2시간 이내에 실험실로 전달되었다. 도축장에서 전달 된 난소는 직경 2-8mm의 난포에서 난구세포-난모세포 복합체 (cumulus-oocyte complex :COC)를 얻기 위해 18게이지 바늘 주사기로 흡인되었다. COC는 3층 이상의 난구세포와 고르게 분포된 세포질로 둘러싸여 분류되었다. 체외성숙 과정 중, COC는 0.005 AU / ml FSH (Antrin, Teikoku, Cat. no. F2293), 1 μg / ml 17β-estradiol (Sigma-Aldrich, Cat. no. E4389) 100μM 시스 테 아민 (Sigma-Aldrich, 카탈로그 번호 M6500) 및 10 % FBS (Gibco, 카탈로그 번호 GIB-16000-044), 가 포함된 화학적으로 정의된 TCM-199 배지에서 38.5℃에서 5 % CO2의 가습 대기에서 배양되었다.
[실시예 3] 정자 정제, 체외 수정 및 배아의 체외 배양
운동성 정자는 Percoll 그래디언트 방법으로 정제되었다. 35℃에서 해동 된 정액의 정자를 1500 rpm에서 15분 동안 Percoll 불연속 구배 (45-90%)에서 원심 분리하여 여과하였다. 45% Percoll 용액을 생성하려면 1 ml 용량 TALP를 90% Percoll 1 ml에 추가한다. 정자 펠렛을 5분 동안 1500 rpm에서 원심분리하여 3 ml의 TALP를 첨가하여 2회 세척하였다. Percoll 그래디언트 방법을 통해 정제된 운동성 정자를 수정에 사용하였다. 1 내지 2 Х 106 운동성 정자/ml 의 정자를 성숙 난모세포와 함께 5% CO2의 가습 대기에서 미네랄 오일 (Nidacon, Cat.no.NO-100) 덮인 체외수정-TALP 배지 45 ul로 배양되었다. 체외 수정 18시간 후에는, 접합체로부터 난구세포는 제거되었다. 이 접합체는 5% O2, 5% CO2, 90% N2 대기에서 38.5℃의 온도로 2단계의 화학적으로 정의된 미네랄 오일로 보호된 배양 배지에서 배양되었다. 상기 접합체는 배아로 배양된다.
[실시예 4] 미세주입법
미세주입법 수행시 Cas9 mRNA와 sgRNA를 4개 그룹으로 나누어 가장 적합한 농도를 찾아냈다. (CB; TE 만 미세주입, RNA1X; Cas9 mRNA : 100 ng/㎕, sgRNA : 50 ng/㎕, RNA2X; Cas9 mRNA : 200 ng/㎕, sgRNA : 100 ng/㎕, RNA 4X; Cas9 mRNA : 400 ng/㎕, sgRNA : 200 ng/㎕). 체외 수정 18시간 후 접합체에 Cas9 mRNA (sigma-Aldrich, Cat.no.CAS9MRNA) 및 sgRNA는 GeneArt쪠 Precision gRNA Synthesis Kit (Thermofisher, Cat.no.A29377)에 의해 합성되어 microinjector machine (Eppendorf, Femtojet®)로 주입되었다. 미세 주입 7일 후, 착상 전 단계의 배아를 수집하고 마이오스타틴 결실을 관찰하거나 대리모의 자궁에 착상하였다.
도 2에서 상기 미세주입법을 그림으로 설명하였다.
도 5에서는 Cas9 mRNA와 sgRNA를 4개 그룹으로 나누어 실험한 결과를 도식화한 것 이다.
상기 결과에서 보면 배반포화 되는 비율은 야생형과 비교하여 RNA1X 와 RNA2X 모두에서 비슷한 양상의 비율을 보였다. 변형 비율을 보면, RNA2X의 그룹에서 다른 RNA1X, RNA4X 그룹보다 현저히 높은 변형 비율을 보였다. 따라서 RNA2X의 농도가 가장 적합한 것으로 판단하여 이후, 실험에서는 RNA2X 그룹에서 사용한 Cas9 mRNA : 200 ng/㎕, sgRNA : 100 ng/㎕의 농도로 실험을 진행하였다.
도 3 및 도 4에서는 미세 주입 후의 배아의 마이오스타틴 변형을 관찰한 것이다.
도 3은 T7E1 assay 를 수행하여 배아의 마이오스타틴이 변형된 경우에 positive control과 동일하게 야생형과는 달리 530bp 아래쪽의 밴드가 하나 더 관찰되는 것을 확인 할 수 있다. 상기의 결과로 상기 배아는 마이오스타틴 유전자가 변형됨을 확인 할 수 있다.
도 4는 sanger sequencing을 수행하여 나온 배아의 마이오스타틴 변형 형태의 결과를 나타낸 도면이다.
상기 결과에서 볼 수 있듯이, 배아에서는 마이오스타틴 유전자의 두번째 엑손의 1, 2, 3, 10, 12 염기쌍이 결실되는 형태와 1개의 염기쌍이 삽입되는 형태를 확인할 수 있다.
이와 같이, 배아에서는 동물과는 달리 인델의 결과로 마이오스타틴 유전자의 두 번째 엑손의 12개 염기쌍만 결실 되는 형태가 아닌 여러 변형 형태를 가질 수 있음을 확인하였다. 하지만, 본 출원의 형질전환 세포는 두 번째 엑손의 12개의 염기쌍이 결실된 마이오스타틴 유전자를 가지는 형질전환 세포만을 의미한다.
[실시예 5] 배아 이식 및 임신 진단
배반포는 20% FBS가 보충된 PBS 에 보관되었다. 상기 배반포는 비수술적 접근에 의해 7일경 (발정=0일=융합일) 에 경부 방법에 의해 각 대리모 소의 자궁으로 옮겨졌다. 배아 생존 및 임신을 관찰하기 위해 발정 후 50일째에 직장 촉진 및 초음파 검사에 의해 대리모를 검사하였다. 임신한 소는 그 후 정기적으로 직장 촉진 및 초음파 검사로 확인하였다.
출생 이후에는, 도 6에서 17번 소의 성장 과정에서의 외형 변화를 확인하기 위해 출생 후 한달 이후부터 1개월 간격으로 4개월 까지의 외형 변화를 촬영하였다.
상기의 사진에서 확인할 수 있듯이, 17번 소는 마이오스타틴 유전자의 두 번째 엑손의 12개 염기쌍이 결실된 소임으로 외형적으로 근육 발달을 확인할 수 있으며, 3개월 이후부터는 더욱 분명하게 외형적으로 근육이 발달된 형태의 소임을 확인할 수 있었다.
[실시예 6] T7E1 assay
트랜스 제닉 일차 세포에서 얻은 게놈 DNA는 DNA 추출 키트 (DNeasy Blood & Tissue kit, Qiagen, Cat. no. 69504)로 추출하였다. MSTN Primer는 PRIMER3 소프트웨어에 의해 설계되었다. PCR 조건은 94℃에서 5 분, 94℃에서 20 초 / 57℃에서 30 초 / 72℃에서 35 초, 72℃에서 5 분 동안 35-40 사이클이었다.
도 7에서는 상기 실시예 5에서 탄생한 소 중 17번 소의 마이오스타틴 유전자의 12개 염기쌍의 결과를 T7E1 assay로 확인한 것이다.
상기 결과를 통해, 17번 소는 야생형과 달리 T7E1 assay 결과 잘린 밴드의 위치가 상이함을 확인할 수 있고, 상기 결과로 17번 소는 마이오스타틴 유전자가 변형된 형태임을 확인할 수 있었다.
[실시예 7] Real-time PCR에 의한 유전자 발현
RNeasy® Mini Kit (Qiagen, Cat. no. 74106)를 사용하여 1 차 배양 된 세포에서 total RNA를 추출하고, RNA를 사용하여 RNA 1μg에서 cDNA EcoDryTM Premix (Oligo dT)로 보완 DNA를 합성하였다 (Takara, Cat. 639543). 유전자 발현 분석은 QuantStudio 3 (Applied Biosystems, 모델 번호 A28132)에서 SYBR Green 방법을 사용하여 수행되었으며, 상대적주기 임계 값 (CT) 값은 GAPDH에 의해 정규화 되었다. 상기 실시예에서 사용된 프라이머는 서열번호 87 내지 서열번호 90에 나열되어 있다.
유전자 Forward　primer Reverse primer　 Size 　
MSTN AACAGCGAGCAGAAGGAAAA (서열번호 85) CCAGGCGAAGTTTACTGAGG (서열번호 86) 124
GAPDH GGCGTGAACCACGAGAAGTA(서열번호 87) CCCTCCACGATGCCAAAGT
(서열번호 88) 		120
[실시예 8] MSTN 오프타겟 효과 분석
3 개의 MSTN 돌연변이 송아지에서 CRISPR / Cas9로 인한 잠재적인 오프 타겟 효과는 Cas9 RNA 유도 엔도 뉴클레아제의 잠재적인 오프 타겟 사이트를 검색하는 빠르고 다재다능한 알고리즘 인 Cas-OFFinder 소프트웨어를 사용하여 스캔 되었다. 실험에 사용된 MSTN 표적 부위에서는 미스 매치 수를 3으로 설정하여 소의 전체 유전자를 표적으로 하는 5 개의 염기 서열을 찾았다. 각 5개의 염기 서열을 표적으로 하는 프라이머를 각각 서열번호 89 내지 서열번호 100로 명명하고 상기 프라이머의 위치에 따른 오프 타겟 효과를 T7E1 분석을 통해 확인하였다.
도 8에서는 하기의 잠재적인 오프 타겟 효과 위치에 대한 프라이머 서열로 T7E1 assay를 진행하였다.
결과에서 볼 수 있듯이, positive control과는 다르게 오프 타겟 효과를 확인하는 5개의 위치 모두에서 잘린 밴드는 확인되지 않았다. 따라서, 이 결과로 잠재적인 오프 타겟 위치에 대한 CRISPR/Cas 9의 오프 타겟 효과는 없음을 확인하고, 본 출원의 일 실시예에서 사용된 가이드 RNA 및 Cas 9 mRNA 가 표적 특이적으로 작동함을 확인하였다.
　유전자 염색체　 위치　 Forward　primer Reverse primer　 Size 　
　MSTN 　2 6281284　 GAGGTGTTCGTTCGTTTTTC (서열번호 89) CTACCAGTTTCCTGTGCTTA　
(서열번호 90) 		　538
　Off-target 1 　2 6590416 TCAGCACAGAAAAGGTGAGG(서열번호 91) GAGACGGACACAACTGAGCA
(서열번호 92) 		　515
　Off -target 2　 　4 14356304 TGAGCCCCTACTTTGTGGAC(서열번호 93) GTTTTCTGGTAAGGGGTGCA
(서열번호 94) 　		 　580
　Off -target 3 　8 51204411 TTGAAAACCTAGTGGGGAAAAA(서열번호 95) GCACTCTCAAACACTGTGGC
(서열번호 96) 		　591
　Off -target 4 　9 88117377 TCCTTGCACCTTCCAAAATC(서열번호 97) ATCTGCGTGTAACTCCAGCC
(서열번호 98) 		　520
　Off -target 5 　2 46946387 　TCACCCATTCCAGTCCATTT(서열번호 99) 　CCTCTAATGCCCTCTTGCAG
(서열번호 100) 		　542
[실시예 9] 표적 심층 시퀀싱 (Targeted deep sequencing)
제조업체의 프로토콜에 따라 KAPA HiFi HotStart DNA 중합 효소 (Roche, Cat. no. # KK2502) 를 사용하여 추출 된 게놈 DNA에서 표적 부위를 약 500bp 크기로 먼저 증폭하였다. 그런 다음 앰플리콘을 ~ 230bp의 크기로 다시 증폭한 후 TruSeq HT 이중 인덱스 포함 프라이머를 사용하여 앰플리콘을 증폭하여 Illumina 시퀀싱 플랫폼 용 어댑터 및 인덱스 시퀀스를 각 샘플에 추가하였다. 이 연구에 사용된 프라이머 는 서열번호 101 및 서열번호 102에 나열되어 있다. 풀링 된 PCR 앰플 리콘은 PCR 정제 키트 (MGmed)를 사용하여 정제하고 페어 드 엔드 시퀀싱 시스템 (2x150 bp)이있는 MiniSeq (Illumina)에서 시퀀싱되었다. Cas-Analyzer는 deep-sequencing 데이터에서 indel 비율을 정량화하는 데 사용되었다.
도 9 내지 도 13에서 표적 심층 시퀀싱 결과를 확인할 수 있다.
도 9에서는 본 출원의 마이오스타틴 형질전환 유도된 배아를 대리모에 이식하여 태어난 17마리 소 및 야생형 소를 대상으로 표적 심층 시퀀싱을 한 결과이다. 이 결과에서 볼 수 있듯이, 야생형의 소와는 달리 6번, 14번 및 17번 소에서는 indel 비율이 10.45% 45.4% 및 99.98%로 나타난 것을 확인할 수 있다.
도 9의 결과를 좀 더 자세히 풀어서 나열한 결과를 도 10 내지 도 13에서 확인할 수 있다.
도 10에서 보면, 야생형의 소에서는 마이오스타틴 유전자의 두 번째 엑손의 염기쌍이 변형되지 않은 것을 확인하였다. 회색의 박스는 PAM 서열을 의미한다. 밑줄이 그어진 서열은 프로토스페이서 서열이다. 회색의 박스와 밑줄은 도 10 내지 도 13에서 동일하게 사용되었다.
도 11에서는, 6번 소의 마이오스타틴 유전자의 두 번째 엑손의 염기쌍 중 12개의 염기쌍이 결실 됨을 확인하였다. Indel의 비율을 확인하였을 때, 10.45%로 12개 염기쌍이 결실되어 읽힌 결과를 확인할 수 있다.
도 12에서도 도 11과 동일한 형태의 마이오스타틴 유전자의 두 번째 엑손의 염기쌍 중 12개 염기쌍이 결심됨을 14번 소에서 확인할 수 있다. 상기 14번 소의 Indel 비율은 45.4%로 나타났다.
도 13에서는 17번 소의 마이오스타틴 유전자의 두 번째 엑손의 염기쌍 중 12개의 염기쌍이 결실됨을 확인하였다. 상기 17번 소의 indel 비율은 99.98%로 확인하였다.
상기 결과를 통해, 본 출원에서 마이오스타틴 두 번째 엑손의 변형을 유도한 뒤 태어난 소를 표적 심층 시퀀싱 한 결과에서 마이오스타틴 두 번째 엑손의 염기가 변형되지 않은 소를 확인할 수 있었다. 하지만, 변형이 확인된 3마리의 소에서는 모두 두번째 엑손의 12개 염기쌍이 결실된 경우만 나타나는 것을 확인하였다.
　유전자 Forward　primer Reverse primer　
　MSTN-1 GAGGTGTTCGTTCGTTTTTC(서열번호 101) TAAGCACAGGAAACTGGTAG
(서열번호 102)
　MSTN-2 ACACTCTTTCCCTACACGACGCTCTTCCGATCT
aacgcaagtggaaggaaaac
(서열번호 103) 		GTGACTGGAGTTCAGACGTG
TGCTCTTCCGATCTtgctct
gccaaataccagtg
(서열번호 104)
[실시예 10] 일차 세포 배양
생검 펀치로 소의 귀 피부에서 유래된 일차 세포를 얻었다. 소에서 얻은 귀 껍질을 멸균 메스로 작은 조각으로 자른 다음 여러 번 세척하고 collagenase (Collagenase type I, Gibco, Cat.no.17-100-017)가 보충된 HANK의 균형 잡힌 소금 용액 (Gibco, Cat.no.14175095) 38℃에서 4-18 시간 동안 배양하였다. 하룻밤 후, 분산된 세포를 DMEM (Gibco, Cat.no.21068028) 배지에서 여러 번 세척하고 10% 우태아 혈청(Gibco, Cat.no.GIB-11150-059), 1% Penicillin/streptomycin (Gibco, Cat.no.15140148), 1% Non-essential amino acids (Gibco, Cat.no.11140050), 및 100 mM β-Mercaptoethanol (Sigma-aldrich, Cat.no.M3418)에서 배양하였다.
상기 실시예의 과정 중 T7E1 assay를 진행하였던, 도 7에서도 상기 일차 세포 배양 이후, 진행하였다.
도 14에서는 본 출원에서 태어난 14번, 17번 소의 일차 세포를 배양한 후, 야생형의 소와 14번, 및 17번 소의 마이오스타틴 mRNA발현 양을 비교하여 도식화한 것이다.
상기 결과에서 확인할 수 있듯이, 야생형 소에 비해 14번 및 17번 소의 일차 세포의 마이오스타틴 mRNA 발현 양은 14번 소의 경우 60% 이상 감소된 형태, 17번 소의 경우 80% 이상 감소된 결과를 확인하였다.
따라서, 본 출원의 마이오스타틴 유전자의 두 번째 엑손의 12개의 염기쌍이 결실된 소에서는 야생형과 비교하여 마이오스타틴 mRNA 발현이 감소됨을 확인할 수 있었다.
[실시예 11] MSTN 녹아웃 소의 생식선 전달
실험방법
1) 도너 관리 및 난자 수거(Ovum Pick Up; OPU)
질내 프로게스테론 장치(Repro360, Cue-mate)가 삽입된 무작위 발정 주기를 갖는 MSTN 돌연변이 도너 암소에 2.0mg의 에스트라디올 벤조에이트를 근육내 주사하였다. 도너는 4일차와 5일차에 12시간마다 4회(57, 57, 43 및 43mg)로 나누어 FSH(Kawasaki Pharm, Antorin R-10) 200mg을 제공받았다. P4 장치는 OPU 전에 7일차에 즉시 제거되었다.
OPU를 위해 도너 암소는 소 호감에서 자제되었다. 경막외 마취는 5ml, 2% 리도카인(Daihan, DAIHAN Lidocaine, South Korea)으로 시행하였다. 경직장 수기법으로 난소를 고정하고 초음파 장치의 탐침에 머물렀다. 한 명의 훈련된 OPU 기술자가 난포 흡인 가이드(WTA, 카탈로그 번호 10283)가 있는 7.5MHz 경직장 변환기 프로브와 결합된 초음파 장치(Esaote, mylab one)를 사용하여 OPU 절차를 수행하였다. 난포 천자는 18G OPU 트레드 바늘(WTA, 카탈로그 번호 17927)을 사용하여 수행하고 난포액을 50ml 튜브에 수집하였다. 난포액의 난모세포를 실체현미경으로 채취하여 시험관 수정에 사용하였다. 남은 모낭 파편은 1차 배양에 사용되었다.
2) 정액 채취
정액은 전기 사정을 사용하여 MSTN 돌연변이 황소에서 수집되었다. (황소당 3회). 정액을 채취하기 전에 포피를 자르고 오리피스를 깨끗한 물로 세척한 후 깨끗한 종이 타월로 건조하여 오염을 최소화하였다. 전기 사정은 6.5cm 직경의 직장 탐침이 부착된 수동 제어 전기 사정기 ElectroJac6(Ideal® Instruments Neogen Corporation, Lansing, MI, USA)을 사용하여 수행되었으며, 3개의 복부 방향 전극이 약 1cm 간격으로 떨어져 있고 전극이 복부를 향하는 직장에 완전히 삽입되었다. 황소가 사정할 때까지 전기적 자극의 수를 증가시켰다. 각 자극은 8-10초 지속되었고 다음 자극이 적용되기 전에 약 2.0초 동안 일시 중지되었다. 정액 분비물이 탁해지면 수집 튜브를 음경 위에 대어 정액을 수집하였다. 사정된 정액은 30분 이내에 25℃에서 실험실로 이송되었다.
3) 정액 냉동보존 및 해동
정액 샘플은 60% 이상의 일반적인 운동성을 나타낼 때 냉동보존에 사용되었다. 정액 샘플은 37℃에서 Optixcell®(IMV Technologies)로 확장되었다. 확장된 정액을 4℃에서 3시간 동안 평형을 유지한 후 0.5ml 빨대에 넣었다. 채워진 빨대를 액체 질소 위 5cm 높이의 특수 랙에 배치하고 액체 질소 증기에 15분 동안 노출시킨 다음 액체 질소(-196℃)로 채워진 극저온 탱크에 넣었다. 냉동보존 정자를 37℃의 수조에서 45초 동안 해동시켰다.
4) 정자 운동성 분석
정자 운동성을 분석하고 정량화하기 위해 IVOS-II CASA(컴퓨터 보조 정자 분석 프로그램) 시스템을 제조업체의 지침으로 사용하였다. 간단히 말해서, 냉동 정액을 해동하고 인큐베이션하고 IVF에서 사용된 것과 동일한 프로토콜을 사용하여 정제하였다. 그 후 3㎕의 정자를 정자 분석 챔버(Leja 슬라이드)에 로딩하고 CASA로 분석하였다. 세 가지 다른 황소의 냉동 빨대가 사용되었다. 기술적 오류를 배제하기 위해 각 정액을 3회 분석하였고 CASA 결과의 평균값을 통계적 평가에 사용하였다.
5) 체외 수정 및 배양
운동성 정자는 이전에 설명한 대로 Percoll 구배 방법을 사용하여 선택되었다. 간단히 설명하면, 35℃에서 F0 황소의 냉동 해동된 정액을 1680rpm에서 15분 동안 Percoll 불연속 구배(45-90%)에서 원심분리하여 여과하였다. 45% Percoll 용액을 생산하기 위해 1mL의 capacitation-Tyrode의 알부민 젖산 피루브산(TALP) 배지를 1mL의 90% Percoll에 첨가하였다. 정자 펠릿은 용량화-TALP 배지 3mL를 첨가하여 2회 세척한 후 1680rpm에서 5분 동안 원심분리하였다. 세척된 운동성 정자를 IVF에 사용하였다. 정자(1-2 × 106 정자/mL)를 5%의 습한 대기에서 미네랄 오일(Nidacon, 카탈로그 번호 NO-100)로 덮인 50μL IVF-TALP 배지에서 18시간 동안 성숙한 난모세포와 함께 배양하였다. 38.5℃에서 CO2 18시간의 공동 배양 후, 추정 접합체에서 난구 세포를 제거하였다. 접합체는 38.5℃에서 5% O2, 5% CO2 및 90% N2 분위기에서 광유로 덮인 2단계 화학적으로 정의된 배양 배지에서 배양되었다.
실험결과
1) MSTN 돌연변이 암소의 생식선 전달(Germline transmission of MSTN mutant female cattle)
OPU를 시행한 후 총 45개의 난모세포를 채취하였다(n=3). 야생형 동결-해동 정액으로 시험관 수정 후, 45개의 난모세포가 배양되었고 5개의 배반포(12.5 ± 10.9%)가 형성되었다(도 15a). 선택된 배반포는 5마리의 수혜자에게 전달되었다. 임신은 직장 촉진과 초음파에 의해 한 마리의 수혜자에서 확인되었습다(도 15b). 또한, OPU 동안 얻은 난포액을 배양하여 MSTN 돌연변이를 확인하였다(도 16). T7E1 분석과 Sanger 시퀀싱은 남은 배아와 여포액에서 유래한 세포 모두에서 F0 암컷에서와 동일한 돌연변이를 확인하였다(도 17 및 18). 이러한 결과는 OPU 절차를 사용하여 MSTN 돌연변이 암소에서 성공적인 생식계열 전달을 보여준다.
도 15는 MSTN 돌연변이 암컷의 생식선 전달 검증한 결과로, MSTN 돌연변이 소 난모세포로부터 유래된 MSTN 돌연변이 배반포의 생산(a) 및 30일째 초음파 기계를 이용한 임신 진단의 대표적인 사진(b)을 나타낸다.
도 16은 OPU 과정에서 얻은 여포액에서 파생된 체세포 이미지이다 ((a): MSTN 돌연변이 암컷, (b): 야생형).
도 17은 MSTN 돌연변이 암컷 배반포의 T7E1 분석 결과(a) 및 시퀀싱 데이터(b)를 보여준다(M: 마커; WT: 야생형; 1: MSTN 돌연변이 암컷; N: 음성 대조군; P: T7E1 양성 대조군).
도 18은 T7E1 분석 결과(a) 및 여포액의 체세포로부터의 시퀀싱 데이터(b)를 보여준다(1: MSTN 돌연변이 암컷(야생형 없음); 2: MSTN 돌연변이 암컷(야생형 없음)).
2) MSTN 돌연변이 남성의 생식선 전달(Germline transmission of MSTN mutant male)
정액은 10.5% 돌연변이가 있는 수컷 황소(F0)로부터 전기 사정에 의해 수집되었다. 시험관 수정을 위해 샘플을 동결하고 정자 운동성을 위해 해동하였다. CASA는 F0와 야생형 샘플 사이의 진행성 세포(%), VCL, ALH 및 BCF에서 상당한 차이를 나타냈다. 그러나 LIN과 STR은 F0와 야생형 샘플 사이에 유의미한 차이를 나타내지 않았다(도 19). 또한, 정액 샘플을 시험관 수정에 사용할 때 배아 발달 및 능력에 대한 해로운 영향은 나타나지 않았다. 도축장에서 채취한 난모세포를 냉동해동한 정액으로 수정하고 배양하여 배반포로 발달시켰다. 총 335개의 난모세포(복제 수 = 3)가 사용되었다. 이 중 261개(78.9 ± 10.8%)가 절단되었고 166개의 배반포(50.5 ± 6.8%)가 형성되었다(도 20). 총 세포 수는 81.3 ± 20.6(n = 20)이었다. 117개의 배반포에서 돌연변이를 분석한 결과 15개의 배반포에서 MSTN 돌연변이가 나타났다(12.7 ± 3.1%)(도 21).
도 19는 Computer Assisted Semen Analysis에 의한 MSTN 남성 설립자의 정액 요약한 결과를 보여준다.
도 20은 MSTN 돌연변이 수컷 소로부터 생식선 전달의 검증한 결과로, 대표적인 배반포 사진(MSTN 돌연변이 황소 정액으로 수정된 시험관 내에서 생산된 배반포)을 보여준다.
도 21은 체외 수정된 MSTN 돌연변이 황소 정액에서 파생된 배반포에서 MSTN 유전자의 돌연변이율을 보여준다(1-6: 무작위로 선택된 배반포). 상단 패널(a)은 T7E1 결과를 나타내고 하단 패널(b)은 MSTN 표적 부위의 시퀀싱 결과를 나타낸다.

Claims (19)

  1. 게놈 내 인위적으로 변형된 마이오스타틴 유전자를 가지는 형질전환 동물로서,
    상기 변형은 마이오스타틴 유전자의 두 번째 엑손 내에 위치하며,
    상기 변형은 야생형 동물의 마이오스타틴 유전자의 서열과 비교하여, 두번째 엑손 중 류신, 트립토판, 아이소류신, 및 타이로신의 순서의 아미노산 서열을 암호화하는 영역에 해당하는 12개의 염기쌍의 결실이며
    상기 형질전환 동물은 야생형 동물보다 마이오스타틴 mRNA 발현량이 적고,
    상기 형질전환 동물은 야생형 동물과 동일한 서열의 성숙 마이오스타틴 단백질을 발현하는 것을 특징으로 하는 형질전환 동물.
  2. 제1항에 있어서,
    상기 형질전환 동물은 인간을 제외한 포유류 (mammal)를 포함하는 것을 특징으로 하는 형질전환 동물.
  3. 제1항에 있어서,
    상기 형질전환 동물은 소 (cattle) 인 것을 특징으로 하는 형질전환 동물.
  4. 제3항에 있어서,
    상기 소가 체내에 발현하는 프로 마이오스타틴 단백질은 서열번호 30으로 표시되는 아미노산 서열로 이루어진 것을 특징으로 하는 형질전환 동물.
  5. 게놈 내 인위적으로 변형된 마이오스타틴 유전자를 가지는 형질전환 세포로서,
    상기 변형은 마이오스타틴 유전자의 두 번째 엑손 내에 위치하며,
    상기 변형은 야생형 세포의 마이오스타틴 유전자의 서열과 비교하여, 두번째 엑손 중 류신, 트립토판, 아이소류신, 및 타이로신의 순서의 아미노산 서열을 암호화하는 영역에 해당하는 12개의 염기쌍의 결실이며
    상기 형질전환 세포는 야생형 세포보다 마이오스타틴 mRNA 발현량이 적고,
    상기 형질전환 세포는 야생형 세포와 동일한 서열의 성숙 마이오스타틴 단백질을 발현하는 것을 특징으로 하는 형질전환 세포.
  6. 제5항에 있어서,
    상기 세포는 배아세포, 줄기세포 또는 체세포 중 선택되는 1 이상의 세포인 것을 특징으로 하는 형질전환 세포.
  7. 제5항에 있어서,
    상기 세포는 포유류로부터 얻는 것을 특징으로 하는 형질전환 세포.
  8. 제5항에 있어서,
    상기 세포는 소로부터 얻는 것을 특징으로 하는 형질전환 세포.
  9. 제8항에 있어서,
    상기 형질전환 세포가 체내에 발현하는 프로 마이오스타틴 단백질은 서열번호 30으로 표시되는 아미노산 서열로 이루어진 것을 특징으로 하는 형질전환 세포.
  10. 마이오스타틴 유전자를 변형시키기 위한 조성물로,
    상기 조성물은 표적 서열과 상보적인 결합을 형성하는 가이드 서열을 포함하는 가이드 RNA 또는 상기 가이드 RNA를 암호화하는 DNA;
    및 Cas 단백질 또는 이를 암호화하는 핵산서열을 포함하며,
    상기 표적 서열은 서열번호 38 내지 서열번호 60 중 선택된 1 이상의 서열을 포함하며,
    상기 가이드 서열은 서열번호 62 내지 서열번호 84 중 선택된 1 이상의 서열을 포함하는 것을 특징으로 하는 마이오스타틴 유전자 형질전환 조성물.
  11. 제10항에 있어서,
    상기 Cas 단백질은 스트렙토코커스 피오게네스 (streptococcus pyogenes) 유래 Cas9 단백질, 스타필로코커스 아우레우스 (staphylococcus aureus) 유래 Cas9 단백질, 또는 Cas 12a 단백질 (종래의 CPF1 :Prevotella and Francisella 1) 단백질 중 하나인 것을 특징으로 하는 마이오스타틴 유전자 형질전환 조성물.
  12. 제10항에 있어서,
    상기 조성물은 가이드 RNA를 암호화하는 DNA 및 Cas 단백질을 암호화하는 DNA 형태로 플라스미드 벡터에 존재하는 것을 특징으로 하는 마이오스타틴 유전자 형질전환 조성물.
  13. 제10항에 있어서,
    상기 조성물은 가이드 RNA를 암호화하는 DNA 및 Cas 단백질을 암호화하는 DNA 형태로 바이러스 벡터에 존재하는 것을 특징으로 하는 마이오스타틴 유전자 형질전환 조성물.
  14. 제13항에 있어서,
    상기 바이러스 벡터는 레트로바이러스 벡터, 렌티바이러스 벡터, 아데노바이러스 벡터, 아데노-연관 바이러스(AAV) 벡터, 백시니아바이러스 벡터, 폭스바이러스 벡터 및 단순포진 바이러스 벡터로 구성된 군에서 선택된 하나 이상인 것을 특징으로 하는 마이오스타틴 유전자 형질전환 조성물.
  15. 제10항에 있어서,
    상기 조성물은 가이드 RNA와 Cas단백질이 결합한 복합체 (RNP :ribonucleoprotein) 형태인 것을 특징으로 하는 마이오스타틴 유전자 형질전환 조성물.
  16. 마이오스타틴 형질전환 세포 또는 배아를 제작하는 방법으로,
    상기 방법은 제10항의 조성물을 세포 또는 배아에 접촉시키는 단계를 포함하는,
    형질전환 세포 또는 배아를 제작하는 방법.
  17. 제16항에 있어서,
    상기 접촉시키는 단계는 미세주입, 전기천공법 (electroporation), 리포좀, 플라스미드, 바이러스벡터, 나노파티클(nanoparticles) 및 PTD (Protein translocation domain) 융합 단백질 방법 중 선택되는 1이상의 방법으로 수행되는 것을 특징으로 하는 형질전환 세포 또는 배아를 제작하는 방법.
  18. 마이오스타틴 유전자 형질전환 동물을 제작하는 방법으로,
    상기 방법은
    제10항의 조성물을 배아에 접촉하여 형질전환 된 유전자를 가지는 형질전환 배아제작; 및
    형질전환 배아를 대리모에 이식하는 단계를 포함하며,
    제작된 동물은 야생형 동물에 비해 마이오스타틴 mRNA가 적게 발현되는 형질전환 동물을 제작하는 방법.
  19. 제18항에 있어서,
    상기 동물은 인간을 제외한 포유류인 것을 특징으로 하는 형질전환 동물을 제작하는 방법.
PCT/KR2021/018176 2020-12-03 2021-12-03 마이오스타틴 유전자가 변형된 형질전환 동물 WO2022119367A1 (ko)

Priority Applications (6)

Application Number Priority Date Filing Date Title
CN202180092749.1A CN116887671A (zh) 2020-12-03 2021-12-03 具有经修饰的肌肉生长抑制素基因的转基因动物
KR1020237023068A KR20230130639A (ko) 2020-12-03 2021-12-03 마이오스타틴 유전자가 변형된 형질전환 동물
JP2023558112A JP2023554545A (ja) 2020-12-03 2021-12-03 改変ミオスタチン遺伝子を有するトランスジェニック動物
AU2021390998A AU2021390998A1 (en) 2020-12-03 2021-12-03 Transgenic animal having modified myostatin gene
GB2310105.8A GB2617296A (en) 2020-12-03 2021-12-03 Transgenic animal having modified myostatin gene
CA3204090A CA3204090A1 (en) 2020-12-03 2021-12-03 Transgenic animal having modified myostatin gene

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR10-2020-0167296 2020-12-03
KR20200167296 2020-12-03

Publications (1)

Publication Number Publication Date
WO2022119367A1 true WO2022119367A1 (ko) 2022-06-09

Family

ID=81853277

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2021/018176 WO2022119367A1 (ko) 2020-12-03 2021-12-03 마이오스타틴 유전자가 변형된 형질전환 동물

Country Status (7)

Country Link
JP (1) JP2023554545A (ko)
KR (1) KR20230130639A (ko)
CN (1) CN116887671A (ko)
AU (1) AU2021390998A1 (ko)
CA (1) CA3204090A1 (ko)
GB (1) GB2617296A (ko)
WO (1) WO2022119367A1 (ko)

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6103466A (en) * 1997-07-14 2000-08-15 University Of Liege Double-muscling in mammals
WO2020207002A1 (zh) * 2019-04-08 2020-10-15 中国农业大学 一种肌肉生长抑制素mstn的突变体及其应用
CN111808887A (zh) * 2020-09-10 2020-10-23 中国农业大学 一种制备与自然突变比利时蓝牛类似的双肌臀肉牛的方法

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN104531705A (zh) 2014-12-09 2015-04-22 中国农业大学 利用CRISPR-Cas9系统敲除动物myostatin基因的方法
CN107034221A (zh) 2017-06-02 2017-08-11 内蒙古大学 一种能在小鼠体内表达的部分碱基缺失肌肉抑制素基因及应用

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6103466A (en) * 1997-07-14 2000-08-15 University Of Liege Double-muscling in mammals
WO2020207002A1 (zh) * 2019-04-08 2020-10-15 中国农业大学 一种肌肉生长抑制素mstn的突变体及其应用
CN111808887A (zh) * 2020-09-10 2020-10-23 中国农业大学 一种制备与自然突变比利时蓝牛类似的双肌臀肉牛的方法

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
GIM GYEONG‐MIN, KWON DONG‐HYEOK, EOM KYEONG‐HYUN, MOON JOONHO, PARK JI‐HYUN, LEE WON‐WU, JUNG DAE‐JIN, KIM DAE‐HYUN, YI JUN‐KOO, H: "Production of MSTN ‐mutated cattle without exogenous gene integration using CRISPR‐Cas9", BIOTECHNOLOGY JOURNAL,, DE , pages 2100198, XP055936037, ISSN: 1860-6768, DOI: 10.1002/biot.202100198 *
KAMBADUR RAVI, SHARMA MRIDULA, SMITH TIMOTHY P.L., BASS JOHN J.: "Mutations in myostatin ( GDF8 ) in Double-Muscled Belgian Blue and Piedmontese Cattle", GENOME RESEARCH, vol. 7, no. 9, 1 September 1997 (1997-09-01), US , pages 910 - 915, XP055936036, ISSN: 1088-9051, DOI: 10.1101/gr.7.9.910 *
ZOU YUN-LONG, LI ZHI-YUAN, ZOU YUN-JING, HAO HAI-YANG, HU JIA-XIANG, LI NING, LI QIU-YAN: "Generation of pigs with a Belgian Blue mutation in MSTN using CRISPR/Cpf1-assisted ssODN-mediated homologous recombination", JOURNAL OF INTEGRATIVE AGRICULTURE, vol. 18, no. 6, 1 June 2019 (2019-06-01), AMSTERDAM, NL, pages 1329 - 1336, XP055936035, ISSN: 2095-3119, DOI: 10.1016/S2095-3119(19)62694-8 *

Also Published As

Publication number Publication date
GB2617296A (en) 2023-10-04
KR20230130639A (ko) 2023-09-12
GB202310105D0 (en) 2023-08-16
CA3204090A1 (en) 2022-06-09
CN116887671A (zh) 2023-10-13
JP2023554545A (ja) 2023-12-27
AU2021390998A1 (en) 2023-06-29

Similar Documents

Publication Publication Date Title
WO2020085788A1 (ko) Igf-1 유전자 돌연변이 왜소증 동물모델 및 그 제조방법
WO2016111546A9 (ko) 혈액 응고인자 viii 유전자를 타겟으로 하는 엔도뉴클레아제 및 이를 포함하는 혈우병 치료용 조성물
WO2018062866A2 (en) CELL-PERMEABLE (CP)-Cas9 RECOMBINANT PROTEIN AND USES THEREOF
WO2014065596A1 (en) Composition for cleaving a target dna comprising a guide rna specific for the target dna and cas protein-encoding nucleic acid or cas protein, and use thereof
WO2019009682A2 (ko) 표적 특이적 crispr 변이체
WO2017188797A1 (ko) In vivo에서 rna-가이드 뉴클레아제의 활성을 고처리량 방식으로 평가하는 방법
CN101310015A (zh) 在两个功能性亚结构域中具有突变的laglidadg归巢核酸内切酶变体及其用途
WO2017026779A1 (en) Improved cell-permeable cre (icp-cre) recombinant protein and use thereof
WO2018208067A1 (ko) 인위적으로 조작된 조작면역세포
WO2011043584A2 (ko) 형질전환 식물 유래의 고병원성 조류독감 바이러스 단백질 백신 및 그 제조방법
WO2019066490A2 (ko) 유전자 발현 조절을 위한 인위적인 게놈 조작
WO2018231018A2 (ko) 간에서 목적하는 단백질 발현하기 위한 플랫폼
WO2012115454A2 (ko) 뉴클레아제에 의해 유전자 변형된 세포를 농축시키는 방법
WO2019066549A2 (ko) 망막 기능장애 질환 치료를 위한 유전자 조작
WO2010002160A2 (ko) 돼지의 알파에스 1 카제인 유전자, 그 프로모터 및 그의 용도
WO2022119367A1 (ko) 마이오스타틴 유전자가 변형된 형질전환 동물
WO2020197242A1 (ko) 혈우병b 질환 모델 랫드
WO2020209458A1 (ko) 인공 재조합 염색체 및 이의 이용
WO2011081343A2 (ko) ＨＯ-1 유전자 및 ＴＮＦＲ1-Ｆｃ 유전자를 동시에 발현하는 형질전환 돼지 및 그의 제조 방법
WO2009088189A2 (ko) 형질전환된 복제개의 생산방법
WO2020022802A1 (ko) 인위적인 유전자 조작을 통한 자가면역질환 치료
WO2020022803A1 (ko) 항응고 인자들의 유전자 에디팅
WO2018230976A1 (ko) 반복 확장 돌연변이에 대한 게놈 편집 시스템
WO2020091471A1 (ko) 근육 특이적 pck1 과발현 형질전환 개 생산
WO2023282552A1 (ko) Human mutant presenilin-1 발현 인지장애 모델 개의 생산

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21901055

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3204090

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2023558112

Country of ref document: JP

ENP Entry into the national phase

Ref document number: 2021390998

Country of ref document: AU

Date of ref document: 20211203

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 202310105

Country of ref document: GB

Kind code of ref document: A

Free format text: PCT FILING DATE = 20211203

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 202180092749.1

Country of ref document: CN

32PN Ep: public notification in the ep bulletin as address of the adressee cannot be established

Free format text: NOTING OF LOSS OF RIGHTS PURSUANT TO RULE 112(1) EPC (EPO FORM 1205A DATED 16.10.2023)