WO2022109403A1 - Antigen-binding molecules and uses thereof - Google Patents

Antigen-binding molecules and uses thereof Download PDF

Info

Publication number
WO2022109403A1
WO2022109403A1 PCT/US2021/060369 US2021060369W WO2022109403A1 WO 2022109403 A1 WO2022109403 A1 WO 2022109403A1 US 2021060369 W US2021060369 W US 2021060369W WO 2022109403 A1 WO2022109403 A1 WO 2022109403A1
Authority
WO
WIPO (PCT)
Prior art keywords
amino acid
acid sequence
seq
antigen
binding molecule
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2021/060369
Other languages
English (en)
French (fr)
Inventor
Samantha J. Busfield
Matthew J. Wilson
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Scout Bio Inc
Original Assignee
Scout Bio Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Scout Bio Inc filed Critical Scout Bio Inc
Priority to US18/037,938 priority Critical patent/US20230416356A1/en
Priority to EP21895765.2A priority patent/EP4247848A4/en
Priority to AU2021383841A priority patent/AU2021383841A1/en
Priority to KR1020237020496A priority patent/KR20230118864A/ko
Priority to CA3199586A priority patent/CA3199586A1/en
Priority to JP2023530833A priority patent/JP2023550628A/ja
Priority to CN202180091195.3A priority patent/CN116981691A/zh
Publication of WO2022109403A1 publication Critical patent/WO2022109403A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/24Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
    • C07K16/244Interleukins [IL]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/04Antipruritics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/567Framework region [FR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011Details
    • C12N2750/14011Parvoviridae
    • C12N2750/14111Dependovirus, e.g. adenoassociated viruses
    • C12N2750/14141Use of virus, viral particle or viral elements as a vector
    • C12N2750/14143Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector

Definitions

  • the invention relates generally to antigen-binding molecules.
  • the invention relates to antigen-binding molecules that specifically bind to and neutralise the activity of interleukin 31 (IL-31) and uses thereof for the treatment of conditions associated with abnormal IL-31 expression and/or activity, such as chronic inflammation, atopic dermatitis, eczema, pruritis, airway hypersensitivity and inflammatory bowel syndrome.
  • IL-31 interleukin 31
  • IL-31 is a cytokine that is expressed in many human tissues and has been implicated in Th2 -biased inflammatory responses. IL-31 signals through a receptor complex consisting of IL-31 receptor a and oncostatin M receptor [3. Studies have shown that IL-31 is strongly linked with chronic pruritic skin disorders, such as atopic eczema, and represents a novel target for directed drug therapy.
  • IL-31 belongs to the glycoprotein 130 (gpl30)/IL-6 cytokine family, which also include leukemia inhibitory factor, oncostatin M (OSM), cardiotrophin-1, ciliary neurotrophic factor, cardiotrophin-like cytokine, IL-6, and IL- 11.
  • OSM oncostatin M
  • cardiotrophin-1 ciliary neurotrophic factor
  • IL-6 cardiotrophin-like cytokine
  • IL-6 IL-6
  • IL- 11 members of this family share the common chain of gp 130 in their multiunit receptor and are involved in neuronal growth, bone metabolism, cardiac development, and immune regulation, such as T-cell differentiation.
  • IL-31 In humans, the gene encoding IL-31 is located on chromosome 12q24.31, and is composed of an open reading frame encoding a 164-amino-acid precursor and a predicted 141-amino-acid mature polypeptide containing the 4 a-helix structure. IL-31 has also been implicated in non-dermatological conditions, such as allergic asthma and rhinitis, inflammatory bowel diseases, malignancies (e.g., cancer), and osteoporosis.
  • non-dermatological conditions such as allergic asthma and rhinitis, inflammatory bowel diseases, malignancies (e.g., cancer), and osteoporosis.
  • the present disclosure is predicated, at least in part, on an anti-IL-31 binding molecule comprising complementarity determining regions (CDR) that are capable of binding specifically to native IL-31 and whose framework regions can be modified for compatibility with a target species without loss of binding specificity and selectivity to native IL-31.
  • CDR complementarity determining regions
  • the IL-31 -binding molecules disclosed herein are therefore amenable to use in the treatment and prevention of conditions associated with abnormal IL-31 levels and/or activity, illustrative examples of which include pruritis and atopic dermatitis.
  • an antigen-binding molecule that specifically binds to interleukin-31 (IL-31), wherein the antigen-binding molecule comprises an immunoglobulin heavy chain variable domain (VH) and an immunoglobulin light chain variable domain (VL), wherein the VH comprises a complementarity determining region 1 (VH CDR1) comprising the amino acid sequence of SEQ ID NO:6 or an amino acid sequence having at least 80% sequence identity thereto, a VH CDR2 comprising the amino acid sequence of SEQ ID NO:7 or an amino acid sequence having at least 80% sequence identity thereto and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 8 or an amino acid sequence having at least 80% sequence identity thereto; and wherein the VL comprises a complementarity determining region 1 (VL CDR1) comprising the amino acid sequence of SEQ ID NOV or an amino acid sequence having at least 80% sequence identity thereto, a VL CDR2 compris
  • the present disclosure is also predicated, at least in part, on the inventor's finding that the IL-31 binding molecules disclosed herein bind specifically to a region of canine IL-31 that has not been identified as the binding region of known anti -IL-31 antibody molecules.
  • an antigenbinding molecule that does not compete for binding to IL-31 with (i) an IL-31 binding molecule that specifically binds to a region of IL-31 that corresponds to amino acid positions 13, 15, 20 and 26 of SEQ ID NO:1 or (ii) an IL-31 binding molecule that specifically binds to a region of IL-31 that corresponds to amino acid positions 76, 77, 80, 81, and 84 of SEQ ID NO:1.
  • the present disclosure also extends to nucleic acid sequences encoding the antigen-binding molecules described herein, including their heavy and light chain sequences and IL-31 -binding fragments thereof.
  • an isolated nucleic acid molecule comprising a nucleic acid sequence encoding the antigen-binding molecule described herein.
  • an expression construct comprising a nucleic acid sequence encoding the antigen-binding molecule described herein.
  • the nucleic acid sequence may be operably linked to one or more regulatory sequences.
  • the present disclosure also extends to a host cell comprising the expression construct described herein.
  • the present disclosure also extends to vector comprising a nucleic acid sequence encoding the antigen-binding molecule described herein.
  • the vector is an AAV vector.
  • the present disclosure also extends to a pharmaceutical composition
  • a pharmaceutical composition comprising the antigen-binding molecule described herein, and a pharmaceutically acceptable carrier.
  • a method of treating or preventing a condition associated with increased expression and/or increased activity of IL-31 comprising administering to a subject in need thereof the antigenbinding molecule, the vector or the pharmaceutical composition as described herein.
  • the present disclosure also extends to a kit comprising the antigen-binding molecule, the vector, or the pharmaceutical composition described herein.
  • the present disclosure also extends to the antigen-binding molecule, the vector, or the pharmaceutical composition as described herein for use in the treatment or prevention of a condition associated with increased expression and/or increased activity of IL-31 in a subject in need thereof.
  • the present disclosure also extends to the antigen-binding molecule, the vector, or the pharmaceutical composition as described herein for use in the treatment or prevention of a tumour induced to proliferate by IL-31 and conditions associated therewith in a subject in need thereof.
  • the present disclosure also extends to an antigen-binding molecule that specifically binds to an epitope of canine IL-31 comprising amino acid residues L29, Y32, Q33 and P40 of SEQ ID NO: 1.
  • the present disclosure also extends to an antigen-binding molecule that competes for binding to canine IL-31 of SEQ ID NO:1 with the antigen-binding molecule described herein.
  • the present disclosure also extends to an immunogenic composition capable of raising an immune response to IL-31, wherein the composition comprises (i) an immunogen comprising a B cell epitope of IL-31 and (ii) a pharmaceutically acceptable carrier, wherein the B cell epitope comprises an amino acid sequence corresponding to amino acid positions 29-40 of SEQ ID NO: 1, or an amino acid sequence that has at least 80% sequence identity thereto, and wherein the immunogen does not comprise the amino acid sequence of a native IL-31 molecule.
  • Figure 1 shows binding of RA4 to canine IL-31.
  • a dose response curve showing binding of the chimeric monoclonal antibody RA4 (chRA4) to canine IL-31 as determined by ELISA. Results shown are the ratio of absorbance at 405nm of specific binding over background.
  • Figure 2 shows inhibition of canine IL-31-induced STAT-3 phosphorylation in canine DH82 cells.
  • Different concentrations of the chRA4 monoclonal antibody were pre-incubated with canine IL-31 prior to addition to DH82 cells.
  • RA4 can potently inhibit IL-31-induced STAT-3 phosphorylation in a dose-dependent manner.
  • the observed IC50 was 1.5pg/mL.
  • Figure 3 shows binding of anti-IL-31 antibodies chRA4, M14 and 34D03 to canine IL-31 (caIL-31), feline IL-31 (feIL-31), canine IL-31 Mutants 1 and canine IL- 31 Mutant 2, as determined by ELISA.
  • the data show that the chimeric RA4 binds equally well to canine IL-31, feline IL-31 and to the two canine IL-31 mutants (Mutants 1 and 2).
  • M14 binds to canine IL-31 and to canine IL-31 Mutant 1, but not to canine IL-31 Mutant 2.
  • M14 binding to feline IL-31 was also diminished.
  • 34D03 also binds to canine IL-31 and to a lesser extent, feline IL-31, but did not bind to either of the canine IL-31 mutant proteins.
  • Figure 4A shows a schematic representation of the canine/human chimeric proteins ca/huIL-31_cl23_h4, cahuIL-31_cl2_h34 and cahuIL-31_cl_h234.
  • Figure 4B shows the dose response curve of monoclonal antibody RA4 binding to canine IL- 31 (caIL-31), human IL-31 (hIL-31) and the chimeric canine/human IL-31 proteins (cl23_h4, cl2_h34 and cl_h234), as determined by ELISA.
  • Figure 5A shows a schematic representation of truncated series of overlapping peptides covering the N-terminal sequence of canine IL-31.
  • Figure 5B shows the binding of RA4 and two previously described anti-IL-31 monoclonal antibodies, M14 and 34D03, to full length canine IL-31 (Full ca IL-31) and the overlapping peptides derived from the N-terminal of canine IL-31, as determined by ELISA.
  • Figure 6 shows the identification of residues in the N-terminal region of canine IL-31 that are important for RA4 mAh binding.
  • An alanine scanning library of a 25 amino acid region of the N-terminal domain of canine IL-31 was generated. Binding of RA4 mAh to each of the modified (alanine substituted) peptides was assessed by ELISA. Binding to each of the modified peptides was normalised to binding to the first peptide in the series to the far left of the X-axis (isoleucine).
  • Figure 7 shows that RA4 mAh binds to a distinct and unique region of the N- terminal of canine IL-31.
  • Full-length canine IL-31 proteins with either a single alanine substitution or a combination of all four alanine substitutions were used to evaluate the binding of RA4 mAb (A) or M14 mAb (B) by ELISA.
  • Wild-type canine IL-31 (calL- 31; SEQ ID NO:1) was included as a control.
  • an anti -IL-31 binding molecule comprising complementarity determining regions (CDR) that are capable of binding specifically to native IL-31 and whose framework regions can be modified for compatibility with a target species without loss of binding specificity and selectivity to native IL-31.
  • CDR complementarity determining regions
  • the IL-31-binding molecules disclosed herein are therefore amenable to use in the treatment and prevention of conditions associated with abnormal IL-31 levels and/or activity, illustrative examples of which include pruritis and atopic dermatitis.
  • an antigen-binding molecule that specifically binds to interleukin-31 (IL-31), wherein the antigen-binding molecule comprises an immunoglobulin heavy chain variable domain (VH) and an immunoglobulin light chain variable domain (VL), wherein the VH comprises a complementarity determining region 1 (VH CDR1) comprising the amino acid sequence of SEQ ID NO:6 or an amino acid sequence having at least 80% sequence identity thereto, a VH CDR2 comprising the amino acid sequence of SEQ ID NO:7 or an amino acid sequence having at least 80% sequence identity thereto and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 8 or an amino acid sequence having at least 80% sequence identity thereto; and wherein the VL comprises a complementarity determining region 1 (VL CDR1) comprising the amino acid sequence of SEQ ID NOV or an amino acid sequence having at least 80% sequence identity thereto, a VL CDR2 comprising the amino acid sequence of
  • an antigen-binding molecule that does not compete for binding to IL-31 with (i) an IL-31 binding molecule that specifically binds to a region ofIL-31 that corresponds to amino acid positions 13, 15, 20 and 26 of SEQ ID NO:1 or (ii) an IL-31 binding molecule that specifically binds to a region of IL-31 that corresponds to amino acid positions 76, 77, 80, 81, and 84 of SEQ ID NO:1.
  • the term "corresponds to” refers to the region of an IL-31 peptide sequence that, when aligned with the canine IL-31 peptide sequence of SEQ ID NO:1, comprises amino acid residues that align with the residues of SEQ ID NO: 1.
  • a region of IL-31 that corresponds to amino acid positions 13, 15, 20 and 26 of SEQ ID NO:1 refers to the region of an IL-31 peptide sequence that, when aligned with the canine IL- 31 peptide sequence of SEQ ID NO: 1, comprises amino acid residues that align with the residues at positions 13, 15, 20 and 26 of SEQ ID NO:1.
  • a region of IL-31 that corresponds to amino acid positions 76, 77, 80, 81, and 84 of SEQ ID NO: 1 refers to the region of an IL-31 peptide sequence that, when aligned with the canine IL-31 peptide sequence of SEQ ID NO: 1, comprises amino acid residues that align with the residues at positions 76, 77, 80, 81, and 84 of SEQ ID NO:1.
  • the present inventors have also found that the IL- 31 binding molecules disclosed herein bind to an epitope of IL-31 comprising amino acid residues L29, Y32, Q33 and P40 of SEQ ID NO:1.
  • an antigen-binding molecule that specifically binds to an epitope of canine IL-31 comprising amino acid residues L29, Y32, Q33 and P40 of SEQ ID NO:1.
  • the present disclosure also extends to an antigen-binding molecule that competes for binding to canine IL-31 of SEQ ID NO:1 with the antigen-binding molecule described herein.
  • the term "competes with”, as used herein, denotes that the two or more antigenbinding molecules compete for binding to an antigen (e.g., IL-31).
  • an antigen e.g., IL-31.
  • IL-31 is coated on a solid substrate and allowed to bind a first antigen-binding molecule, after which a second antigen-binding molecule is added. If the presence of the first antigen-binding molecule reduces binding of the second antigen-binding molecule to the IL-31, then the antigen-binding molecule is identified as competing for binding to the IL-31.
  • the term "competes with” also includes combinations of antigenbinding molecules where one antigen-binding molecule reduces binding of another antigen-binding molecule, but where no competition is observed when the antigenbinding molecules are added in the reverse order.
  • the first and second antigen-binding molecules inhibit binding of each other to the antigen, regardless of the order in which they are added.
  • one antigen-binding molecule reduces binding of another antigen-binding molecule to the antigen by at least 20%, preferably by at least 30%, preferably by at least 40%, preferably by at least 50%, preferably by at least 60%, preferably by at least 70%, preferably by at least 80%, preferably by at least 90%, or more preferably by at least 95%.
  • antigen-binding molecule refers to a molecule that has binding specificity for a target antigen. It will be understood that this term extends to immunoglobulins, immunoglobulin fragments and non-immunoglobulin-derived protein frameworks that exhibit antigen-binding activity.
  • suitable antigen-binding molecules include antibodies and antigen-binding fragments thereof.
  • the antigen-binding molecule binds specifically to IL-31 so as to neutralise, or substantially neutralise, its activity.
  • neutralise is understood to mean that the antigen-binding molecule will bind to IL-31 and inhibit, reduce, abrogate, block or otherwise prevent the ability of the IL-31 molecule to bind to its native receptor.
  • the antigen-binding molecule will completely neutralise the activity of IL-31 (in vivo or in vitro) such that there is no or negligible IL- 31 activity when compared to the absence of the antigen-binding molecule.
  • the antigen-binding molecule will partially neutralise the activity of IL- 31 (in vivo or in vitro) such that there is less IL-31 activity when compared to the absence of the antigen-binding molecule.
  • antibody is understood to mean any antigen-binding molecule or molecular complex comprising at least one complementarity determining region (CDR) that binds specifically to, or interacts specifically with, the target antigen.
  • CDR complementarity determining region
  • the term “antibody” includes full-length immunoglobulin molecules comprising two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds, as well as multimers thereof (e.g., IgM).
  • Each heavy chain comprises a heavy chain variable region (which may be abbreviated as HCVR, VH or VH) and a heavy chain constant region.
  • the heavy chain constant region typically comprises three domains - CHI, CH2 and CH3.
  • Each light chain comprises a light chain variable region (which may be abbreviated as LCVR, VL, VK, VK or VL) and a light chain constant region.
  • the light chain constant region will typically comprise one domain (CLI).
  • CLI complementarity determining regions
  • FR framework regions
  • Each VH and VL typically comprises three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
  • the FRs of the antigen-binding molecules described herein may be identical to the FR of germline sequences of the target species (i.e., the species to which the antigen-binding molecules or antigen-binding fragments thereof, as described herein, will be administered). In some embodiments, the FR may be naturally or artificially modified.
  • each of the FR sequences are identical to FR sequences derived from immunoglobulin molecules of the target species, including to minimize an immune response being raised against the binding molecule upon administration to a subject of the target species
  • the antigen-binding molecule, or antigenbinding fragment thereof may comprise one or more amino acid residues across one or more of its FR sequences that would be foreign at a corresponding position in one or more FR from the target species.
  • the antigen-binding molecule, or antigen-binding fragment thereof comprises one or more amino acid residues across one or more of its FR sequences that would be foreign at a corresponding position in the target species, that "foreign" amino acid residue will not (i) adversely impact the binding specificity of the antigen-binding molecule or antigen-binding fragment thereof to IL- 31, including native IL-31 and/or (ii) cause an immune response to be raised against the antigen-binding molecule or to the antigen-binding fragment thereof when administered to a subject of the target species.
  • Suitable antibodies include canine IgGA, IgGB, IgGC and IgGD and feline IgGla, IgGlb and IgG2 (including sub-classes thereof).
  • the subunit structures and three-dimensional configurations of different classes of immunoglobulins will be well known to persons skilled in the art.
  • CDR complementarity determining region
  • Each variable domain may comprises up to three CDR sequences, identified as CDR1, CDR2 and CDR3.
  • the amino acid sequence of each CDR is often defined by Kabat numbering (e.g., about residues 24-34 (LI), 50-56 (L2) and 89-97 (L3) of the light chain variable domain and residues 31-35 (Hl), 50-65 (H2) and 95-102 (H3) of the heavy chain variable domain; Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed.
  • the antigen-binding molecule as described herein, is conjugated to another molecule or moiety, including functional moieties (e.g., toxins), detectable moieties (e.g., fluorescent molecules, radioisotopes), small molecule drugs and polypeptides.
  • functional moieties e.g., toxins
  • detectable moieties e.g., fluorescent molecules, radioisotopes
  • small molecule drugs e.g., small molecule drugs and polypeptides.
  • IL-31 -binding molecule comprising an amino acid sequence that differs from a parent or comparator sequence (.g., VH and/or VL) by one or more (e.g., by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 14, 15, 16, 17, 18, 19, 20, 21 and so on) amino acid deletions, insertions and/or substitutions, wherein said difference does not, or does not completely, abolish the ability of the variant to bind to IL-31.
  • a functional variant may comprise an amino acid sequence that differs from the comparator sequence (e.g., SEQ ID NOs:12 and 13).
  • the functional variant may comprise amino acid substitutions that enhance the binding affinity of the antigen-binding molecule to IL-31, as compared to the reference molecule to which the variation is compared (e.g., an antigen-binding molecule comprising the VH and VL or SEQ ID NOs:12 and 13).
  • the functional variant differs from the comparator by one or more conservative amino acid substitutions, as described elsewhere herein.
  • Reference to "at least 80% sequence identity” includes 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity the reference sequence (e.g, of any one of SEQ ID NOs:6-13), for example, after optimal alignment or best fit analysis.
  • the functional variant of the antigen-binding molecule comprises, consists or consists essentially of an amino acid sequence that has at least 80%, preferably at least 85%, preferably at least 86%, preferably at least 87%, preferably at least 88%, preferably at least 89%, preferably at least 90%, preferably at least 91%, preferably at least 92%, preferably at least 93%, preferably at least 94%, preferably at least 95%, preferably at least 96%, preferably at least 97%, preferably at least 98%, preferably at least 99% or preferably 100% sequence identity to SEQ ID NO: 12 or SEQ ID NO: 13, for example, after optimal alignment or best fit analysis.
  • the CDR sequences of the functional variant of the antigen-binding molecule comprise, consist or consist essentially of amino acid sequences having at least 80%, preferably at least 85%, preferably at least 86%, preferably at least 87%, preferably at least 88%, preferably at least 89%, preferably at least 90%, preferably at least 91%, preferably at least 92%, preferably at least 93%, preferably at least 94%, preferably at least 95%, preferably at least 96%, preferably at least 97%, preferably at least 98%, preferably at least 99% or preferably 100% sequence identity to any one of SEQ ID NOs:6-l 1, for example, after optimal alignment or best fit analysis.
  • the VH comprises a complementarity determining region 1 (VH CDR1) comprising an amino acid sequence that has at least 80%, preferably at least 85%, preferably at least 86%, preferably at least 87%, preferably at least 88%, preferably at least 89%, preferably at least 90%, preferably at least 91%, preferably at least 92%, preferably at least 93%, preferably at least 94%, preferably at least 95%, preferably at least 96%, preferably at least 97%, preferably at least 98%, preferably at least 99% or preferably 100% sequence identity to SEQ ID NO:6, a VH CDR2 comprising an amino acid sequence that has at least 80%, preferably at least 85%, preferably at least 86%, preferably at least 87%, preferably at least 88%, preferably at least 89%, preferably at least 90%, preferably at least 91%, preferably at least 92%, preferably at least 93%, preferably at least 94%, preferably at least 95%,
  • VH CDR1 complementarity
  • the VH comprises a complementarity determining region 1 (VH CDR1) comprising an amino acid sequence that has at least 80% sequence identity to SEQ ID NO:6, a VH CDR2 comprising an amino acid sequence that has at least 80% sequence identity to SEQ ID NO:7 and a VH CDR3 comprising an amino acid sequence that has at least 80% sequence identity to SEQ ID NO: 8; and the VL comprises a complementarity determining region 1 (VL CDR1) comprising an amino acid sequence that has at least 80% sequence identity to SEQ ID NOV, a VL CDR2 comprising an amino acid sequence that has at least 80% sequence identity to SEQ ID NO: 10, and a VL CDR3 comprising an amino acid sequence that has at least 80% sequence identity to SEQ ID NO: 11.
  • VH CDR1 comprising an amino acid sequence that has at least 80% sequence identity to SEQ ID NO:6
  • VH CDR2 comprising an amino acid sequence that has at least 80% sequence identity to SEQ ID NO:7
  • the VH comprises a complementarity determining region 1 (VH CDR1) comprising, consisting or consisting essentially of an amino acid sequence of SEQ ID NO: 6, a VH CDR2 comprising, consisting or consisting essentially of an amino acid of SEQ ID NO:7 and a VH CDR3 comprising, consisting or consisting essentially of an amino acid sequence of SEQ ID NO: 8; and the VL comprising, consisting or consisting essentially of a complementarity determining region 1 (VL CDR1) comprising, consisting or consisting essentially of an amino acid sequence of SEQ ID NOV, a VL CDR2 comprising, consisting or consisting essentially of an amino acid sequence of SEQ ID NO: 10, and a VL CDR3 comprising, consisting or consisting essentially of an amino acid sequence of SEQ ID NO: 11.
  • VH CDR1 comprising, consisting or consisting essentially of an amino acid sequence of SEQ ID NO: 6
  • VH CDR2 comprising, consisting or consist
  • the antigen-binding molecule described herein comprises a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 12 or an amino acid sequence having at least 80%, preferably at least 85%, preferably at least 90%, preferably at least 95%, or more preferably at least 98% sequence identity thereto.
  • the antigen-binding molecule described herein comprises a light chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 13 or an amino acid sequence having at least 80%, preferably at least 85%, preferably at least 90%, preferably at least 95%, or more preferably at least 98% sequence identity thereto.
  • the antigen-binding molecule described herein comprises (a) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 12 or an amino acid sequence having at least 80%, preferably at least 85%, preferably at least 90%, preferably at least 95%, or more preferably at least 98% sequence identity thereto, and (b) a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 13 or an amino acid sequence having at least 80%, preferably at least 85%, preferably at least 90%, preferably at least 95%, or more preferably at least 98% sequence identity thereto.
  • VH heavy chain variable region
  • VL light chain variable region
  • the antigen-binding molecule described herein comprises (a) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 12 or an amino acid sequence having at least 80% sequence identity thereto, and (b) a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 13 or an amino acid sequence having at least 80% sequence identity thereto.
  • VH heavy chain variable region
  • VL light chain variable region
  • the heavy chain variable region (VH) comprises the amino acid sequence of SEQ ID NO: 12
  • the light chain variable region (VL) comprises the amino acid sequence of SEQ ID NO: 13.
  • the heavy chain variable region (VH) consists or consists essentially of the amino acid sequence of SEQ ID NO: 12
  • the light chain variable region (VL) consists or consists essentially of the amino acid sequence of SEQ ID
  • identity means that at any particular amino acid residue position in an aligned sequence, the amino acid residue is identical between the aligned sequences.
  • similarity or “sequence similarity” as used herein, indicates that, at any particular position in the aligned sequences, the amino acid residue is of a similar type between the sequences.
  • leucine may be substituted for an isoleucine or valine residue. This may be referred to as conservative substitution.
  • the amino acid sequences may be modified by way of conservative substitution of any of the amino acid residues contained therein, such that the modification has no effect on the binding specificity or functional activity of the modified polypeptide when compared to the unmodified polypeptide.
  • sequence identity with respect to a peptide sequence relates to the percentage of amino acid residues in the candidate sequence which are identical with the residues of the corresponding peptide sequence after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percentage homology, and not considering any conservative substitutions as part of the sequence identity. Neither N- or C-terminal extensions, nor insertions shall be construed as reducing sequence identity or homology. Methods and computer programs for performing an alignment of two or more amino acid sequences and determining their sequence identity or homology are well known to persons skilled in the art. For example, the percentage of identity or similarity of two amino acid sequences can be readily calculated using algorithms, for example, BLAST, FASTA, or the Smith- Waterman algorithm.
  • similarity means an exact amino acid to amino acid comparison of two or more peptide sequences or at the appropriate place, where amino acids are identical or possess similar chemical and/or physical properties such as charge or hydrophobicity. A so-termed “percent similarity” then can be determined between the compared peptide sequences. In general, “identity” refers to an exact amino acid to amino acid correspondence of two peptide sequences. [0061] Two or more peptide sequences can also be compared by determining their "percent identity”.
  • the percent identity of two sequences may be described as the number of exact matches between two aligned sequences divided by the length of the shorter sequence and multiplied by 100.
  • An approximate alignment for nucleic acid sequences is provided by the local homology algorithm of Smith and Waterman, Advances in Applied Mathematics 2:482-489 (1981). This algorithm can be extended to use with peptide sequences using the scoring matrix developed by Dayhoff, Atlas of Protein Sequences and Structure, M. O. Dayhoff ed., 5 suppl. 3:353-358, National Biomedical Research Foundation, Washington, D.C., USA, and normalized by Gribskov, Nucl. Acids Res. 14(6):6745-6763 (1986). Suitable programs for calculating the percent identity or similarity between sequences are generally known in the art.
  • Optimal alignment of sequences for aligning a comparison window may be conducted by computerized implementations of algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package Release 7.0, Genetics Computer Group, 575 Science Drive Madison, WI, USA) or by inspection and the best alignment (i.e., resulting in the highest percentage homology over the comparison window) generated by any of the various methods selected.
  • GAP Garnier et al.
  • BESTFIT Pearson FASTA
  • FASTA Pearson's Alignment of sequences
  • TFASTA Pearson's Alpha-1
  • the functional variant comprises at least one (e.g., 1, 2, 3, 4 or 5) amino acid substitutions, preferably conservative amino acid substitutions, in any one or more of the CDR sequences.
  • the antigen-binding molecule comprises 1, 2 or 3 amino acid substitutions in any one or more of the CDR sequences.
  • the functional variant comprises one or more amino acid substitutions, insertions and/or deletions in the non-CDR regions (e.g., in the framework regions) of the VH and/or VL sequences.
  • amino acid substitutions are conservative amino acid substitutions.
  • a “conservative amino acid substitution” is to be understood as meaning a substitution in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art, which can be generally sub-classified as shown in the table "Amino Acid Classification” , below:
  • Conservative amino acid substitution also includes groupings based on side chains.
  • a group of amino acids having aliphatic side chains is glycine, alanine, valine, leucine, and isoleucine; a group of amino acids having aliphatic- hydroxyl side chains is serine and threonine; a group of amino acids having amide- containing side chains is asparagine and glutamine; a group of amino acids having aromatic side chains is phenylalanine, tyrosine, and tryptophan; a group of amino acids having basic side chains is lysine, arginine, and histidine; and a group of amino acids having sulfur-containing side chains is cysteine and methionine.
  • Amino acid substitutions falling within the scope of the invention are, in general, accomplished by selecting substitutions that do not differ significantly in their effect on maintaining (a) the structure of the peptide backbone in the area of the substitution, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulk of the side chain. After the substitutions are introduced, the variants can be screened for their ability to bind specifically to IL-31 using methods known to persons skilled in the art, including those methods described elsewhere herein.
  • the antigen-binding molecules described herein bind specifically to canine IL-31. In an embodiment, the antigen-binding molecules described herein bind specifically to feline IL-31.
  • the present disclosure extends to antigen binding molecules that bind specifically to native IL-31 (i.e., naturally-occurring IL-31), as well as to variants thereof.
  • variants may include IL-31 molecules that differ from a naturally- occurring (wild-type) molecule by one or more amino acid substitutions, deletions and/or insertions.
  • variant IL-31 molecules of this type may be naturally-occurring or synthetic (e.g, recombinant) forms. It is to be understood, however, that in a preferred embodiment, the antigen-binding molecules described herein bind specifically to a native form of IL-31.
  • antigen-binding fragment As used interchangeably herein to refer to a part of an antigen-binding molecule that retains the ability to bind to the target antigen; that is, to IL-31, including native IL-31. These terms include naturally occurring, enzymatically obtainable, synthetic or genetically engineered (recombinant) polypeptides and glycoproteins that specifically bind to IL-31 to form a complex.
  • Antigen-binding fragments may be derived, for example, from naturally-derived immunoglobulin molecules using any suitable method known to persons skilled in the art, illustrative examples of which include proteolytic digestion or recombinant genetic engineering techniques involving the manipulation and expression of nucleic acid sequences encoding antibody variable and optionally constant domains. Suitable nucleic acid sequences are known and/or are readily available from, e.g., commercial sources, DNA libraries (including, e.g, phage-antibody libraries), or can be synthesized.
  • nucleic acid sequences may be sequenced and manipulated chemically or by using molecular biology techniques, for example, to arrange one or more variable and/or constant domains into a suitable configuration, or to introduce codons, create cysteine residues, modify, add or delete amino acids, etc.
  • Non-limiting examples of suitable antigen-binding fragments include: (i) Fab fragments; (ii) F(ab’)2 fragments; (iii) Fd fragments; (iv) Fv fragments; (v) single-chain Fv (scFv) molecules; (vi) dAb fragments; and (vii) minimal recognition units consisting of the amino acid residues that mimic the hypervariable region of an antibody (e.g., an isolated CDR such as a CDR3 peptide), or a constrained FR3-CDR3-FR4 peptide.
  • an antibody e.g., an isolated CDR such as a CDR3 peptide
  • a constrained FR3-CDR3-FR4 peptide e.g., an isolated CDR such as a CDR3 peptide
  • engineered molecules such as domain-specific antibodies, single domain antibodies, domain-deleted antibodies, chimeric antibodies, CDR-grafted antibodies, one-armed antibodies, diabodies, triabodies, tetrabodies, minibodies, nanobodies (e.g, monovalent nanobodies, bivalent nanobodies, etc.), and small modular immunopharmaceuticals (SMIPs), are also encompassed by the term “antigen-binding fragment,” as used herein.
  • SIPs small modular immunopharmaceuticals
  • an antigen-binding fragment comprises at least one immunoglobulin variable domain.
  • the variable domain may comprise an amino acid sequence of any suitable length or composition and will generally comprise at least one CDR which is adjacent to or in frame with one or more framework sequences.
  • the antigen-binding fragment comprises a VH domain and a VL domain
  • the VH and VL domains may be situated relative to one another in any suitable arrangement.
  • the variable region may be dimeric and contain VH-VH, VH-VL or VL-VL dimers.
  • the antigen-binding fragment of an antibody may contain a monomeric VH or VL domain.
  • an antigen-binding fragment may comprise at least one variable domain covalently linked to at least one constant domain.
  • variable and constant domains that may be found within an antigenbinding fragment include: (i) VH-CHI; (ii) VH-CH2; (iii) VH-CH3; (iv) VH-CH1-CH2; (V) VH-CH1-CH2-CH3, (vi) VH-CH2-CH3; (vii) VH-CL; (viii) VL-CH1; (ix) VL-CH2, (X) VL- CH3; (xi) VL-CH1-CH2; (xii) VL-CH1-CH2-CH3; (xiii) VL-CH2-CH3; and (xiv) VL-CL.
  • variable and constant domains may be either directly linked to one another or may be linked by a full or partial hinge or linker region.
  • a hinge region may consist of at least 2 (e.g., 5, 10, 15, 20, 40, 60 or more) amino acids which result in a flexible or semi-flexible linkage between adjacent variable and/or constant domains in a single polypeptide molecule.
  • the antigen-binding fragment may comprise a homo-dimer or hetero-dimer (or other multimer) of any of the variable and constant domain configurations listed above in non- covalent association with one another and/or with one or more monomeric VH or VL domains (e.g., by disulfide bond(s)).
  • a multispecific antigen-binding molecule will typically comprise at least two different variable domains, wherein each variable domain is capable of specifically binding to a separate antigen or to a different epitope on the same antigen.
  • Any multispecific antigen-binding molecule format including bispecific antigen-binding molecule formats, may be adapted for use in the context of an antigen-binding fragment of an antibody of the present disclosure using routine techniques available in the art.
  • variable region refers to the domain of an immunoglobulin heavy or light chain that is involved in binding to the target antigen.
  • the variable domains of the heavy chain and light chain (VH and VL, respectively) of a native immunoglobulin molecule will generally have similar structures, with each domain comprising four conserved framework regions and three hypervariable regions (HVRs). See, e.g., Kindl e/ al., Kuby Immunology, 6th ed., W.H. Freeman and Co., page 91 (2007).
  • a single VH or VL domain may be sufficient to confer antigen-binding specificity.
  • the antigen-binding molecules described herein may suitably be modified for compatibility with the target species, for example, to minimise or otherwise avoid an immune response being generated towards the antigen-binding molecule following administration to that species.
  • the antigen-binding molecule is caninized, felinized or equinized.
  • the antigen-binding molecule comprises an amino acid sequence that is compatible with canine, such that the amino acid sequence is unlikely to be seen as foreign by the immune system of a canine subject.
  • the caninized antigen-binding molecule comprises one or more immunoglobulin framework regions derived from one or more canine immunoglobulin molecules. In some embodiments, all of the framework regions of the caninized antigenbinding molecule will be derived from one or more canine immunoglobulin molecules.
  • the caninized antibody may optionally comprise an immunoglobulin heavy chain constant region derived from a canine immunoglobulin molecule.
  • the antigen-binding molecule is a caninized antigen-binding molecule.
  • the antigen-binding molecule comprises an amino acid sequence that is compatible with feline, such that the amino acid sequence is unlikely to be seen as foreign by the immune system of a feline subject.
  • the felinized antigen-binding molecule comprises one or more immunoglobulin framework regions derived from one or more feline immunoglobulin molecules. In some embodiments, all of the framework regions of the felinized antigen- binding molecule will be derived from one or more feline immunoglobulin molecules.
  • the felinized antibody may optionally comprise an immunoglobulin heavy chain constant region derived from a feline immunoglobulin molecule.
  • the antigen-binding molecule is a felinized antigen-binding molecule.
  • the antigen-binding molecule comprises an amino acid sequence that is compatible with equine, such that the amino acid sequence is unlikely to be seen as foreign by the immune system of an equine subject.
  • the equinized antigen-binding molecule comprises one or more immunoglobulin framework regions derived from one or more equine immunoglobulin molecules. In some embodiments, all of the framework regions of the equinized antigenbinding molecule will be derived from one or more equine immunoglobulin molecules.
  • the equinized antibody may optionally comprise an immunoglobulin heavy chain constant region derived from an equine immunoglobulin molecule.
  • antigen-binding molecules that are compatible with species other than canine, feline and equine.
  • the antigen-binding molecules can be referred to as "speciesized”, referring to the target species to which the molecule will be administered.
  • Suitable methods of designing and producing recombinant antibodies or antigenbinding molecules that are compatible with the target species will be familiar to persons skilled in the art, illustrative examples of which are described in Cattaneo (2010; Curr. Op. Mol. Ther. 12(1): 94- 106), WO 2006/131951, WO 2012/153122, WO 2013/034900, WO 2012/153121 and WO 2012/153123, the contents of which are incorporated herein by reference in their entirety.
  • the antigen-binding molecule is caninized.
  • the caninized antigen-binding molecule comprises: (i) a heavy chain variable domain (VH) comprising:
  • VHFR1 heavy chain variable domain framework region 1
  • VHFR2 amino acid sequence having at least 80% sequence identity to a VHFR2 amino acid sequence selected from the group consisting of SEQ ID N0s: 19, 23, 27, 31 and 35,
  • VHFR3 amino acid sequence having at least 80% sequence identity to a VHFR3 amino acid sequence selected from the group consisting of SEQ ID NOs:20, 24, 27, 32 and 36, and
  • VLFR1 heavy chain variable domain framework region 1
  • VLFR2 amino acid sequence having at least 80% sequence identity to a VLFR2 amino acid sequence selected from the group consisting of SEQ ID NOs:39, 43, 47 and 51,
  • VLFR4 amino acid sequence having at least 80% sequence identity to a VHFR4 amino acid sequence selected from the group consisting of SEQ ID NOs:41, 45, 49 and 53.
  • the caninized antigen-binding molecule comprises:
  • VH heavy chain variable domain
  • VHFR1 heavy chain variable domain framework region 1
  • VHFR4 amino acid sequence having at least 80% sequence identity to a VHFR4 amino acid sequence of SEQ ID NO: 84 or SEQ ID NO:88;
  • VL light chain variable domain
  • VLFR1 heavy chain variable domain framework region 1
  • the caninized antigen-binding molecule comprises a heavy chain variable domain (VH) comprising an amino acid sequence having at least 80% sequence identity to a VH amino acid sequence of SEQ ID NO: 99 or SEQ ID NO: 100.
  • VH heavy chain variable domain
  • the caninized antigen-binding molecule comprises a light chain variable domain (VL) comprising an amino acid sequence having at least 80% sequence identity to a VL amino acid sequence of SEQ ID NO: 101.
  • VL light chain variable domain
  • the antigen-binding molecule is felinized.
  • the felinized antigen-binding molecule comprises: (i) a heavy chain variable domain (VH) comprising:
  • VHFR1 heavy chain variable domain framework region 1
  • VLFR1 light chain variable domain framework region 1
  • VLFR2 amino acid sequence having at least 80% sequence identity to a VLFR2 amino acid sequence of SEQ ID NO:59 (g) a VLFR3 amino acid sequence having at least 80% sequence identity to a VLFR3 amino acid sequence of SEQ ID NO:60, and
  • the phrase “specifically binds” or “specific binding” refers to a binding reaction between two molecules that is at least two times the background and more typically more than 10 to 100 times background molecular associations under physiological conditions.
  • detectable binding agents that are proteins
  • specific binding is determinative of the presence of the protein, in a heterogeneous population of proteins and other biologies.
  • the specified antigen-binding molecule binds to a particular antigenic determinant, thereby identifying its presence.
  • Specific binding to an antigenic determinant under such conditions requires an antigen-binding molecule that is selected for its specificity to that determinant.
  • This selection may be achieved by subtracting out antigen-binding molecules that cross-react with other molecules.
  • a variety of immunoassay formats may be used to select antigen-binding molecules (e.g, immunoglobulins)[ such that they are specifically immunoreactive with a particular antigen.
  • immunoglobulins e.g., immunoglobulins
  • solid-phase ELISA immunoassays are routinely used to select antibodies specifically immunoreactive with a protein (see, e.g., Harlow & Lane, Antibodies, A Laboratory Manual (1988) for a description of immunoassay formats and conditions that can be used to determine specific immunoreactivity).
  • Binding affinity refers to the strength of the sum total of non- covalent interactions between a single binding site of a molecule (e.g, an antigen- binding molecule) and its binding partner (e.g., an antigen). Unless indicated otherwise, as used herein, “binding affinity” refers to intrinsic binding affinity which reflects a 1 : 1 interaction between members of a binding pair e.g., an antigen-binding molecule.
  • the affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (Kd), which is the ratio of dissociation and association rate constants (k O ff and kon, respectively).
  • affinities may comprise different rate constants, as long as the ratio of the rate constants remains the same.
  • Affinity can be measured by common methods known in the art, including those described herein.
  • a particular method for measuring affinity is Surface Plasmon Resonance (SPR).
  • polypeptide polypeptide
  • peptide or protein
  • polypeptide polypeptide
  • peptide or protein
  • the amino acid residues are usually in the natural "L” isomeric form. However, residues in the "D” isomeric form can be substituted for any L-amino acid residue, as long as the desired functional property is retained by the polypeptide.
  • modified antibody includes synthetic forms of antibodies which are altered such that they are not naturally occurring, e.g., antibodies that comprise at least two heavy chain portions but not two complete heavy chains (such as domain deleted antibodies or minibodies); multispecific forms of antibodies (e.g., bispecific, trispecific, etc.) altered to bind to two or more different antigens or to different epitopes on a single antigen; heavy chain molecules joined to scFv molecules and the like. ScFv molecules are known in the art and are described, e.g., in U.S. Pat. No. 5,892,019.
  • modified antibody includes multivalent forms of antibodies (e.g., trivalent, tetraval ent, etc., antibodies that bind to three or more copies of the same antigen).
  • antigen-binding molecule is an antibody or an antigenbinding fragment thereof, as described elsewhere herein.
  • the antigenbinding fragment is selected from the group consisting of a Fab fragment, scFab, Fab’, a single chain variable fragment (scFv) and a one-armed antibody.
  • the antigen-binding molecule comprises a heavy chain and/or a light chain constant region of an immunoglobulin molecule. In an embodiment, the antigen-binding molecule comprises a heavy chain and/or a light chain constant region of a canine, feline or equine immunoglobulin molecule.
  • the antigen-binding molecule comprises a heavy chain constant region of a canine immunoglobulin molecule. In an embodiment, the antigenbinding molecule comprises a light chain constant region of a canine immunoglobulin molecule. In yet an embodiment, the antigen-binding molecule comprises a heavy chain and a light chain constant region of a canine immunoglobulin molecule.
  • the antigen-binding molecule comprises a heavy chain constant region of a canine immunoglobulin molecule selected from the group consisting of IgGA, IgGB, IgGC and IgGD. In an embodiment, the antigen-binding molecule comprises a light chain constant region of a canine immunoglobulin molecule selected from the group consisting of IgGA, IgGB, IgGC and IgGD. In an embodiment, the antigen-binding molecule comprises a heavy chain and a light chain constant region of a canine immunoglobulin molecule selected from the group consisting of IgGA, IgGB, IgGC and IgGD.
  • the antigen-binding molecule comprises a heavy chain constant region of a canine IgGA molecule. In an embodiment, the antigen-binding molecule comprises a light chain constant region of a canine IgGA molecule. In an embodiment, the antigen-binding molecule comprises a heavy chain and a light chain constant region of a canine IgGA molecule.
  • the antigen-binding molecule comprises a heavy chain constant region of a canine IgGB molecule. In an embodiment, the antigen-binding molecule comprises a light chain constant region of a canine IgGB molecule. In an embodiment, the antigen-binding molecule comprises a heavy chain and a light chain constant region of a canine IgGB molecule.
  • the antigen-binding molecule comprises a heavy chain constant region of a canine IgGC molecule. In an embodiment, the antigen-binding molecule comprises a light chain constant region of a canine IgGC molecule. In an embodiment, the antigen-binding molecule comprises a heavy chain and a light chain constant region of a canine IgGC molecule.
  • the antigen-binding molecule comprises a heavy chain constant region of a canine IgGD molecule. In an embodiment, the antigen-binding molecule comprises a light chain constant region of a canine IgGD molecule. In an embodiment, the antigen-binding molecule comprises a heavy chain and a light chain constant region of a canine IgGD molecule.
  • the canine immunoglobulin molecule is a canine IgGA comprising, consisting or consisting essentially of the amino acid sequence of SEQ ID NO:2, or an amino acid sequence having at least 80% sequence identity thereto.
  • the canine IgGA comprises, consists or consists essentially of the amino acid sequence of SEQ ID NO:2.
  • the antigen-binding molecule comprises an immunoglobulin heavy chain comprising, consisting or consisting essentially of the amino acid sequence of SEQ ID NO: 16 or an amino acid sequence having at least 80% sequence identity thereto.
  • the antigen-binding molecule comprises an immunoglobulin light chain comprising, consisting or consisting essentially of the amino acid sequence of SEQ ID NO: 17 or an amino acid sequence having at least 80% sequence identity thereto.
  • the antigen-binding molecule comprises an immunoglobulin heavy chain comprising, consisting or consisting essentially of the amino acid sequence of SEQ ID NO: 16.
  • the antigen-binding molecule comprises an immunoglobulin light chain comprising, consisting or consisting essentially of the amino acid sequence of SEQ ID NO: 17.
  • VH is encoded by the nucleic acid sequence of SEQ ID NO: 14. In an embodiment, the VH is encoded by the nucleic acid sequence of SEQ ID NO:15.
  • the chimeric antibody, or the IL-31 -binding fragment thereof comprises a heavy chain constant region of a feline immunoglobulin molecule selected from the group consisting of IgGla, IgGlb and IgG2.
  • the chimeric antibody, or the IL-31 -binding fragment thereof comprises a light chain constant region of a feline immunoglobulin molecule selected from the group consisting of IgGla, IgGlb and IgG2.
  • the chimeric antibody, or the IL-31-binding fragment thereof comprises a heavy chain and a light chain constant region of a feline immunoglobulin molecule selected from the group consisting of IgGla, IgGlb and IgG2.
  • the chimeric antibody, or the IL-31 -binding fragment thereof comprises a heavy chain constant region of a feline IgGla molecule. In an embodiment, the chimeric antibody, or the IL-31 -binding fragment thereof, comprises a light chain constant region of a feline IgGla molecule. In an embodiment, the chimeric antibody, or the IL-31 -binding fragment thereof, comprises a heavy chain and a light chain constant region of a feline IgGla molecule.
  • the chimeric antibody, or the IL-31 -binding fragment thereof comprises a heavy chain constant region of a feline IgGlb molecule. In an embodiment, the chimeric antibody, or the IL-31 -binding fragment thereof, comprises a light chain constant region of a feline IgGlb molecule. In an embodiment, the chimeric antibody, or the IL-31 -binding fragment thereof, comprises a heavy chain and a light chain constant region of a feline IgGlb molecule.
  • the chimeric antibody, or the IL-31 -binding fragment thereof comprises a heavy chain constant region of a feline IgG2 molecule. In an embodiment, the chimeric antibody, or the IL-31 -binding fragment thereof, comprises a light chain constant region of a feline IgG2 molecule. In an embodiment, the chimeric antibody, or the IL-31 -binding fragment thereof, comprises a heavy chain and a light chain constant region of a feline IgG2 molecule.
  • a chimeric molecule comprising an IL-31-binding molecule, as herein described, and a heterologous moiety.
  • the heterologous moiety may be a detectable moiety, a half-life extending moiety, or a therapeutic moiety.
  • a “chimeric” molecule is one which comprises one or more unrelated types of components or contains two or more chemically distinct regions which can be conjugated to each other, fused, linked, translated, attached via a linker, chemically synthesized, expressed from a nucleic acid sequence, etc.
  • a peptide and a nucleic acid sequence for example, a peptide and a nucleic acid sequence, a peptide and a detectable label, unrelated peptide sequences, and the like.
  • the chimeric molecule comprises amino acid sequences of different origin, the chimeric molecule includes (1) polypeptide sequences that are not found together in nature (i.e., at least one of the amino acid sequences is heterologous with respect to at least one of its other amino acid sequences), or (2) amino acid sequences that are not naturally adjoined.
  • a “chimeric” antibody” as used herein refers to an antibody in which a portion of the heavy and/or light chain is derived from a particular source or species, while the remainder of the heavy and/or light chain is derived from a different source or species.
  • the antigen-binding molecule described herein is an antibody or an IL-31 -binding fragment thereof.
  • the antibody is a chimeric antibody.
  • Illustrative examples of chimeric antibodies include antibody molecules in which the VH and VL sequences are derived from mouse and the heavy and light chain constant regions are derived from a species other than mouse (e.g., heavy and light chain constant regions derived from canine, feline, equine immunoglobulin molecules).
  • the chimeric antibody, or the IL-31 -binding fragment thereof comprises a heavy chain constant region of a canine immunoglobulin molecule. In an embodiment, the chimeric antibody, or the IL-31 -binding fragment thereof, comprises a light chain constant region of a canine immunoglobulin molecule. In yet an embodiment, the chimeric antibody, or the IL-31 -binding fragment thereof, comprises a heavy chain and a light chain constant region of a canine immunoglobulin molecule.
  • the chimeric antibody, or the IL-31 -binding fragment thereof comprises a heavy chain constant region of a canine immunoglobulin molecule selected from the group consisting of IgGA, IgGB, IgGC and IgGD.
  • the chimeric antibody, or the IL-31 -binding fragment thereof comprises a light chain constant region of a canine immunoglobulin molecule selected from the group consisting of IgGA, IgGB, IgGC and IgGD.
  • the chimeric antibody, or the IL-31 -binding fragment thereof comprises a heavy chain and a light chain constant region of a canine immunoglobulin molecule selected from the group consisting of IgGA, IgGB, IgGC and IgGD.
  • the chimeric antibody, or the IL-31 -binding fragment thereof comprises a heavy chain constant region of a canine IgGA molecule. In an embodiment, the chimeric antibody, or the IL-31 -binding fragment thereof, comprises a light chain constant region of a canine IgGA molecule. In an embodiment, the chimeric antibody, or the IL-31 -binding fragment thereof, comprises a heavy chain and a light chain constant region of a canine IgGA molecule.
  • the chimeric antibody, or the IL-31 -binding fragment thereof comprises a heavy chain constant region of a canine IgGB molecule. In an embodiment, the chimeric antibody, or the IL-31 -binding fragment thereof, comprises a light chain constant region of a canine IgGB molecule. In an embodiment, the chimeric antibody, or the IL-31 -binding fragment thereof, comprises a heavy chain and a light chain constant region of a canine IgGB molecule.
  • the chimeric antibody, or the IL-31 -binding fragment thereof comprises a heavy chain constant region of a canine IgGC molecule. In an embodiment, the chimeric antibody, or the IL-31 -binding fragment thereof, comprises a light chain constant region of a canine IgGC molecule. In an embodiment, the chimeric antibody, or the IL-31 -binding fragment thereof, comprises a heavy chain and a light chain constant region of a canine IgGC molecule.
  • the chimeric antibody, or the IL-31 -binding fragment thereof comprises a heavy chain constant region of a canine IgGD molecule. In an embodiment, the chimeric antibody, or the IL-31 -binding fragment thereof, comprises a light chain constant region of a canine IgGD molecule. In an embodiment, the chimeric antibody, or the IL-31 -binding fragment thereof, comprises a heavy chain and a light chain constant region of a canine IgGD molecule.
  • the canine immunoglobulin molecule is a canine immunoglobulin gamma heavy chain A.
  • the canine immunoglobulin gamma heavy chain A comprises, consists or consists essentially of the amino acid sequence of SEQ ID NO:2, or an amino acid sequence having at least 80% sequence identity thereto.
  • the canine immunoglobulin gamma heavy chain A comprises, consists or consists essentially of the amino acid sequence of SEQ ID NO:2.
  • the chimeric antibody comprises, consists or consists essentially of a heavy chain comprising the amino acid sequence of SEQ ID NO: 16 or an amino acid sequence having at least 80% sequence identity thereto.
  • the chimeric antibody comprises, consists or consists essentially of a light chain comprising the amino acid sequence of SEQ ID NO: 17 or an amino acid sequence having at least 80% sequence identity thereto.
  • the chimeric antibody comprises, consists or consists essentially of a heavy chain comprising the amino acid sequence of SEQ ID NO: 16.
  • the chimeric antibody comprises, consists or consists essentially of a light chain comprising the amino acid sequence of SEQ ID NO: 17.
  • VH is encoded by the nucleic acid sequence of SEQ ID NO: 14. In an embodiment, the VH is encoded by the nucleic acid sequence of SEQ ID NO:15.
  • the chimeric antibody, or the IL-31 -binding fragment thereof comprises a heavy chain constant region of a feline immunoglobulin molecule. In an embodiment, the chimeric antibody, or the IL-31 -binding fragment thereof, comprises a light chain constant region of a feline immunoglobulin molecule. In yet an embodiment, the chimeric antibody, or the IL-31 -binding fragment thereof, comprises a heavy chain and a light chain constant region of a feline immunoglobulin molecule.
  • the chimeric antibody, or the IL-31 -binding fragment thereof comprises a heavy chain constant region of a feline immunoglobulin molecule selected from the group consisting of IgGla, IgGlb and IgG2.
  • the chimeric antibody, or the IL-31 -binding fragment thereof comprises a light chain constant region of a feline immunoglobulin molecule selected from the group consisting of IgGla, IgGlb and IgG2.
  • the chimeric antibody, or the IL-31-binding fragment thereof comprises a heavy chain and a light chain constant region of a feline immunoglobulin molecule selected from the group consisting of IgGla, IgGlb and IgG2.
  • the chimeric antibody, or the IL-31 -binding fragment thereof comprises a heavy chain constant region of a feline IgGla molecule. In an embodiment, the chimeric antibody, or the IL-31 -binding fragment thereof, comprises a light chain constant region of a feline IgGla molecule. In an embodiment, the chimeric antibody, or the IL-31 -binding fragment thereof, comprises a heavy chain and a light chain constant region of a feline IgGla molecule.
  • the chimeric antibody, or the IL-31 -binding fragment thereof comprises a heavy chain constant region of a feline IgGlb molecule. In an embodiment, the chimeric antibody, or the IL-31 -binding fragment thereof, comprises a light chain constant region of a feline IgGlb molecule. In an embodiment, the chimeric antibody, or the IL-31 -binding fragment thereof, comprises a heavy chain and a light chain constant region of a feline IgGlb molecule.
  • the chimeric antibody, or the IL-31 -binding fragment thereof comprises a heavy chain constant region of a feline IgG2 molecule. In an embodiment, the chimeric antibody, or the IL-31 -binding fragment thereof, comprises a light chain constant region of a feline IgG2 molecule. In an embodiment, the chimeric antibody, or the IL-31 -binding fragment thereof, comprises a heavy chain and a light chain constant region of a feline IgG2 molecule.
  • the present disclosure also extends to the use of heavy chain and light chain constant region sequences modified to improve, for example, stability and serum half- life.
  • Suitable heavy chain and light chain constant region sequences including modified sequences of non-human species (e.g., canine, feline and equine) will be familiar to persons skilled in the art, illustrative examples of which are described in WO 2019/035010, the entire contents of which is incorporated herein by reference.
  • non-human species e.g., canine, feline and equine
  • an isolated nucleic acid molecule comprising a nucleic acid sequence encoding the antigen-binding molecule described herein.
  • an isolated nucleic acid molecule comprising (i) a nucleic acid sequence encoding an immunoglobulin heavy chain variable region having at least 80% sequence identity to SEQ ID NO: 12 and/or (ii) a nucleic acid sequence encoding an immunoglobulin light chain variable region having at least 80% sequence identity to SEQ ID NO: 13.
  • the nucleic acid sequence encoding an immunoglobulin heavy chain variable region comprises the nucleic acid sequence of SEQ ID NO: 14.
  • the nucleic acid sequence encoding an immunoglobulin light chain variable region comprises the nucleic acid sequence of SEQ ID NO: 15.
  • polynucleotide or “nucleic acid” are used interchangeably herein to refer to a polymer of nucleotides, which can be mRNA, RNA, cRNA, cDNA or DNA.
  • the term typically refers to polymeric form of nucleotides of at least 10 bases in length, either ribonucleotides or deoxynucleotides or a modified form of either type of nucleotide.
  • the term includes single and double stranded forms of DNA.
  • an expression vector that comprises a nucleic acid encoding the IL-31-binding molecules, as described herein.
  • vector is meant a nucleic acid molecule, preferably a DNA molecule derived, for example, from a plasmid, bacteriophage, or virus, into which a nucleic acid sequence may be inserted or cloned.
  • a vector preferably contains one or more unique restriction sites and may be capable of autonomous replication in a defined host cell including a target cell or tissue or a progenitor cell or tissue thereof, or be integrable with the genome of the defined host such that the cloned sequence is reproducible.
  • the vector may be an autonomously replicating vector, i.e., a vector that exists as an extrachromosomal entity, the replication of which is independent of chromosomal replication, e.g., a linear or closed circular plasmid, an extrachromosomal element, a minichromosome, or an artificial chromosome.
  • the vector may contain any means for assuring self-replication.
  • the vector may be one which, when introduced into the host cell, is integrated into the genome and replicated together with the chromosome(s) into which it has been integrated.
  • a vector system may comprise a single vector or plasmid, two or more vectors or plasmids, which together contain the total DNA to be introduced into the genome of the host cell, or a transposon.
  • the choice of the vector will typically depend on the compatibility of the vector with the host cell into which the vector is to be introduced.
  • the vector may also include a selection marker such as an antibiotic resistance gene that can be used for selection of suitable transformants. Examples of such resistance genes are well known to those of skill in the art.
  • the vector is an adeno-associated virus (AAV) vector that enables the IL-31-binding molecule, as described herein, to be safely administered to subjects and to provide a persistent expression of the IL-31 -binding molecule in the subject.
  • AAV adeno-associated virus
  • Adeno-associated virus is a member of the Parvoviridae family and comprises a linear, single-stranded DNA genome of less than about 5,000 nucleotides.
  • AAV requires co-infection with a helper virus (i.e., an adenovirus or a herpes virus), or expression of helper genes, for efficient replication.
  • helper virus i.e., an adenovirus or a herpes virus
  • helper genes for efficient replication.
  • AAV vectors used for administration of therapeutic nucleic acids typically have approximately 96% of the parental genome deleted, such that only the terminal repeats (ITRs), which contain recognition signals for DNA replication and packaging, remain. This eliminates immunologic or toxic side effects due to expression of viral genes.
  • delivering specific AAV proteins to producing cells enables integration of the AAV vector comprising AAV ITRs into a specific region of the cellular genome, if desired (see, e.g., U.S. Pat. Nos. 6,342,390 and 6,821,511).
  • Host cells comprising an integrated AAV genome show no change in cell growth or morphology (see, for example, U.S. Pat. No. 4,797,368).
  • the AAV ITRs flank the unique coding nucleotide sequences for the non- structural replication (Rep) proteins and the structural capsid (Cap) proteins (also known as virion proteins (VPs)).
  • the terminal 145 nucleotides are self-complementary and are organized so that an energetically stable intramolecular duplex forming a T-shaped hairpin may be formed. These hairpin structures function as an origin for viral DNA replication by serving as primers for the cellular DNA polymerase complex.
  • the Rep genes encode the Rep proteins Rep78, Rep68, Rep52, and Rep40. Rep78 and Rep68 are transcribed from the p5 promoter, and Rep 52 and Rep40 are transcribed from the pl9 promoter.
  • the Rep78 and Rep68 proteins are multifunctional DNA binding proteins that perform helicase and nickase functions during productive replication to allow for the resolution of AAV termini (see, e.g., Im et al., Cell, 61: 447-57 (1990)). These proteins also regulate transcription from endogenous AAV promoters and promoters within helper viruses (see, e.g., Pereira et al., J. Virol., 71 : 1079-1088 (1997)). The other Rep proteins modify the function of Rep78 and Rep68.
  • the cap genes encode the capsid proteins VP1, VP2, and VP3. The cap genes are transcribed from the p40 promoter.
  • an expression construct comprising a nucleic acid sequence encoding the IL-31-binding molecule, as described herein, operably linked to one or more regulatory sequences.
  • constructs refers to a recombinant genetic molecule including one or more isolated nucleic acid sequences from different sources.
  • constructs are chimeric molecules in which two or more nucleic acid sequences of different origin are assembled into a single nucleic acid molecule and include any construct that contains (1) nucleic acid sequences, including regulatory and coding sequences that are not found together in nature (i.e., at least one of the nucleotide sequences is heterologous with respect to at least one of its other nucleotide sequences), or (2) sequences encoding parts of functional RNA molecules or proteins not naturally adjoined, or (3) parts of promoters that are not naturally adjoined.
  • constructs include any recombinant nucleic acid molecule such as a plasmid, cosmid, virus, autonomously replicating polynucleotide molecule, phage, or linear or circular single stranded or double stranded DNA or RNA nucleic acid molecule, derived from any source, capable of genomic integration or autonomous replication, comprising a nucleic acid molecule where one or more nucleic acid molecules have been operably linked.
  • Constructs of the present invention will generally include the necessary elements to direct expression of a nucleic acid sequence of interest that is also contained in the construct, such as, for example, a target nucleic acid sequence or a modulator nucleic acid sequence.
  • Such elements may include control elements or regulatory sequences such as a promoter that is operably linked to (so as to direct transcription of) the nucleic acid sequence of interest, and often includes a polyadenylation sequence as well.
  • the construct may be contained within a vector.
  • the vector may include, for example, one or more selectable markers, one or more origins of replication, such as prokaryotic and eukaryotic origins, at least one multiple cloning site, and/or elements to facilitate stable integration of the construct into the genome of a host cell.
  • Two or more constructs can be contained within a single nucleic acid molecule, such as a single vector, or can be contained within two or more separate nucleic acid molecules, such as two or more separate vectors.
  • An “expression construct” generally includes at least a control sequence operably linked to a nucleotide sequence of interest. In this manner, for example, promoters in operable connection with the nucleotide sequences to be expressed are provided in expression constructs for expression in an organism or part thereof including a host cell.
  • conventional compositions and methods for preparing and using constructs and host cells are well known to one skilled in the art, see for example, Molecular Cloning: A Laboratory Manual, 3rd edition Volumes 1, 2, and 3. J. F. Sambrook, D. W. Russell, and N. Irwin, Cold Spring Harbor Laboratory Press, 2000.
  • control element By “control element”, “control sequence”, “regulatory sequence” and the like, as used herein, is meant a nucleic acid sequence (e.g., DNA) necessary for expression of an operably linked coding sequence in a particular host cell.
  • the control sequences that are suitable for prokaryotic cells for example, include a promoter, and optionally a cis-acting sequence such as an operator sequence and a ribosome binding site.
  • Control sequences that are suitable for eukaryotic cells include transcriptional control sequences such as promoters, polyadenylation signals, transcriptional enhancers, translational control sequences such as translational enhancers and internal ribosome binding sites (IRES), nucleic acid sequences that modulate mRNA stability, as well as targeting sequences that target a product encoded by a transcribed polynucleotide to an intracellular compartment within a cell or to the extracellular environment.
  • transcriptional control sequences such as promoters, polyadenylation signals, transcriptional enhancers, translational control sequences such as translational enhancers and internal ribosome binding sites (IRES), nucleic acid sequences that modulate mRNA stability, as well as targeting sequences that target a product encoded by a transcribed polynucleotide to an intracellular compartment within a cell or to the extracellular environment.
  • Also disclosed herein is a host cell comprising the construct as defined herein.
  • host refers to cells into which exogenous nucleic acid has been introduced, including the progeny of such cells.
  • Host cells include “transformants” and “transformed cells”, which include the primary transformed cell and progeny derived therefrom without regard to the number of passages. Progeny may not be completely identical in nucleic acid content to a parent cell, but may contain mutations. Mutant progeny that have the same function or biological activity as screened or selected for in the originally transformed cell are included herein.
  • a host cell is any type of cellular system that can be used to generate the antigen binding molecules of the present invention.
  • Host cells include cultured cells, e.g., mammalian cultured cells, such as CHO cells, BHK cells, NS0 cells, SP2/0 cells, YO myeloma cells, P3X63 mouse myeloma cells, PER cells, PER.C6 cells or hybridoma cells, yeast cells, insect cells, and plant cells, to name only a few, but also cells comprised within a transgenic animal, transgenic plant or cultured plant or animal tissue.
  • the host cell is a CHO or HEK293 cell line.
  • Methods for producing a modified IL-31 -binding molecule are also provided, such methods comprising culturing the host cell disclosed herein and recovering the IL-31 -binding molecule from the host cell or culture medium.
  • composition comprising the IL-31- binding molecule or a vector, as described herein, and a pharmaceutically acceptable carrier.
  • the present inventors have found that the IL-31 binding molecules disclosed herein bind to an epitope of IL-31 that is not bound by any known IL-31 antigen-binding molecules; specifically, to an epitope of IL-31 comprising amino acid residues L29, Y32, Q33 and P40 of SEQ ID NO:1. Identification of this epitope of IL-31 advantageously allows the identified epitope, or a mimotope thereof, to be employed as an immunogenic composition for inducing an immune response when the immunogenic composition is administered to a subj ect.
  • an immunogenic composition capable of raising an immune response to IL-31, wherein the composition comprises (i) an immunogen comprising a B cell epitope of IL-31 and (ii) a pharmaceutically acceptable carrier, wherein the B cell epitope comprises an amino acid sequence corresponding to amino acid positions 29-40 of SEQ ID NO:1, or an amino acid sequence that has at least 80% sequence identity thereto, and wherein the immunogen does not comprise the amino acid sequence of a native IL-31 molecule.
  • the immunogen consists of an amino acid sequence corresponding to amino acid positions 29-40 of SEQ ID NO:1, or an amino acid sequence that has at least 80% sequence identity thereto.
  • the immunogen consists of an amino acid sequence corresponding to amino acid positions 29-40 of SEQ ID NO: 1.
  • reference to "at least 80% sequence identity” includes 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity the reference sequence, for example, after optimal alignment or best fit analysis.
  • pharmaceutically acceptable carrier a pharmaceutical vehicle comprised of a material that is not biologically or otherwise undesirable, i.e., the material may be administered to a subject along with the selected active agent without causing any or a substantial adverse reaction.
  • Carriers may include excipients and other additives such as diluents, detergents, colouring agents, wetting or emulsifying agents, pH buffering agents, preservatives, and the like.
  • Representative pharmaceutically acceptable carriers include any and all solvents, dispersion media, coatings, surfactants, antioxidants, preservatives (e.g, antibacterial agents, antifungal agents), isotonic agents, absorption delaying agents, salts, preservatives, drugs, drug stabilizers, gels, binders, excipients, disintegration agents, lubricants, sweetening agents, flavoring agents, dyes, such like materials and combinations thereof, as would be known to one of ordinary skill in the art (see, for example, Remington's Pharmaceutical Sciences, 18th Ed. Mack Printing Company, 1990, pp. 1289-1329, incorporated herein by reference). Except, insofar as any conventional carrier is incompatible with the active ingredient(s), its use in the pharmaceutical compositions is contemplated.
  • the pharmaceutical compositions may be in a variety of forms. These include, for example, liquid, semi-solid and solid dosage forms, such as liquid solutions (e.g, injectable and infusible solutions), dispersions or suspensions, liposomes and suppositories.
  • liquid solutions e.g, injectable and infusible solutions
  • dispersions or suspensions e.g., liposomes and suppositories.
  • the preferred form depends on the intended mode of administration and therapeutic application.
  • Suitable pharmaceutical compositions may be administered intravenously, subcutaneously or intramuscularly.
  • the compositions are in the form of injectable or infusible solutions.
  • a preferred mode of administration is parenteral (e.g, intravenous, subcutaneous, intraperitoneal, intramuscular).
  • the pharmaceutical composition is administered by intravenous infusion or injection.
  • the pharmaceutical composition is administered by intramuscular or subcutaneous injection.
  • parenteral administration and “administered parenterally” as used herein means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrastemal injection and infusion.
  • Preparations for parenteral administration include sterile aqueous or nonaqueous solutions, suspensions, and emulsions.
  • non-aqueous solvents are propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate.
  • Aqueous carriers include water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media.
  • pharmaceutically acceptable carriers include, but are not limited to, 0.01- 0.1M and preferably 0.05M phosphate buffer or 0.8% saline.
  • Intravenous vehicles include sodium phosphate solutions, Ringer's dextrose, dextrose and sodium chloride, lactated Ringer's, or fixed oils.
  • Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers, such as those based on Ringer's dextrose, and the like.
  • Preservatives and other additives can also be present such as for example, antimicrobials, antioxidants, chelating agents, and inert gases and the like.
  • compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions.
  • the composition must be sterile and should be fluid to the extent that easy syringability exists. It should be stable under the conditions of manufacture and storage and will preferably be preserved against the contaminating action of microorganisms, such as bacteria and fungi.
  • the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (e.g, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof.
  • an agent of the present disclosure may be conjugated to a vehicle for cellular delivery.
  • the agent may be encapsulated in a suitable vehicle to either aid in the delivery of the agent to target cells, to increase the stability of the agent, or to minimize potential toxicity of the agent.
  • a variety of vehicles are suitable for delivering an agent of the present disclosure.
  • suitable structured fluid delivery systems may include nanoparticles, liposomes, microemulsions, micelles, dendrimers and other phospholipid-containing systems.
  • Dosage regimens are adjusted to provide the optimum desired response (e.g, a therapeutic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation.
  • An antigen-binding molecule of the present disclosure can be administered on multiple occasions. Intervals between single dosages can be daily, weekly, monthly or yearly. Intervals can also be irregular as indicated by measuring blood levels of modified polypeptide or antigen in the patient. Alternatively, the antigen-binding molecule can be administered as a sustained release formulation, in which case less frequent administration is required. Dosage and frequency vary depending on the half-life of the polypeptide in the patient.
  • Dosage unit form refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutically acceptable carrier.
  • the specification for the dosage unit forms of the invention are dictated by and directly dependent on (a) the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and (b) the limitations inherent in the art of compounding such an active compound for the treatment of sensitivity in individuals.
  • the antigen-binding molecule is administered by injection (e.g., subcutaneously or intravenously) at a dose of about 0.01 to 40 mg/kg, e.g., 0.01 to 0.1 mg/kg, e.g., about 0.1 to 1 mg/kg, about 1 to 5 mg/kg, about 5 to 25 mg/kg, about 10 to 40 mg/kg, or about 0.4 mg/kg.
  • the dosing schedule can vary from e.g., once a week to once every 2, 3, or 4 weeks.
  • the antigen-binding molecule is administered at a dose from about 10 to 20 mg/kg every other week.
  • An exemplary, non-limiting range for an effective amount of an antigenbinding molecule of the present disclosure is 0.01-5 mg/kg, more suitably 0.03-2 mg/kg.
  • dosage values may vary with the type and severity of the condition to be alleviated. It is to be further understood that for any particular subject, specific dosage regimens should be adjusted over time according to the individual need and the professional judgment of the person administering or supervising the administration of the compositions, and that dosage ranges set forth herein are exemplary only and are not intended to limit the scope or practice of the claimed composition.
  • the pharmaceutical compositions of the invention may include an effective amount of agent (i.e., the IL-31 -binding molecule) disclosed herein.
  • the effective amount may be a “therapeutically effective amount” or a “prophylactically effective amount”.
  • a “therapeutically effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic result.
  • a therapeutically effective amount of the agent may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the agent to elicit a desired response in the individual.
  • a therapeutically effective amount is also one in which any toxic or detrimental effects of the agent is outweighed by the therapeutically beneficial effects.
  • this property of a composition can be evaluated by examining the ability of the compound to inhibit, for example in in vitro by assays known to the skilled practitioner.
  • a “prophy lactically effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired prophylactic result. Typically, since a prophylactic dose is used in subjects prior to or at an earlier stage of disease, the prophylactically effective amount will be less than the therapeutically effective amount.
  • Also disclosed herein is a method of treating or preventing a condition associated with increased expression and/or increased activity of IL-31, the method comprising administering the antigen-binding molecule, the vector or the pharmaceutical composition, as described herein, to a subject in need thereof.
  • treating may refer to (1) delaying the appearance of one or more symptoms of the condition; (2) inhibiting the development of the condition or one or more symptoms of the condition; (3) relieving the condition, i.e., causing regression of the condition or at least one or more symptoms of the condition; and/or (4) causing a decrease in the severity of the condition or of one or more symptoms of the condition.
  • treating are used interchangeably herein to mean relieving, reducing, alleviating, ameliorating or otherwise inhibiting the condition, including one or more symptoms of the condition.
  • prevent are used interchangeably herein to mean preventing or delaying the onset of the condition, or the risk of developing the condition.
  • treating also include relieving, reducing, alleviating, ameliorating or otherwise inhibiting the effects of the condition for at least a period of time. It is also to be understood that terms “treating”, “treatment” and the like do not imply that the condition, or a symptom thereof, is permanently relieved, reduced, alleviated, ameliorated or otherwise inhibited and therefore also encompasses the temporary relief, reduction, alleviation, amelioration or otherwise inhibition of the condition, or of a symptom thereof.
  • the terms “subject”, “patient”, “host” or “individual” used interchangeably herein, refer to any animal in need of treatment.
  • the subject will typically encompass non-human subjects, including, but not limited to, mammals, birds and fish, and suitably encompasses domestic, farm, zoo and wild animals, such as, for example, cows, pigs, horses, goats, sheep or other hoofed animals, dogs, cats, chickens, ducks, non-human primates, guinea pigs, rabbits, ferrets, rats, hamsters and mice.
  • the subject is selected from the group consisting of a canine, a feline and an equine.
  • the subject is a canine.
  • the subject is a feline.
  • the subject is an equine.
  • Conditions associated with an abnormal (e.g., increased) level and/or abnormal (e.g., increased) activity of IL-31 will be familiar to persons skilled in the art, illustrative example of which include chronic pruritic skin disorders, such as atopic eczema, and non-dermatological conditions, such as allergic asthma and rhinitis, inflammatory bowel diseases, malignancies (e.g., cancer), and osteoporosis.
  • chronic pruritic skin disorders such as atopic eczema
  • non-dermatological conditions such as allergic asthma and rhinitis, inflammatory bowel diseases, malignancies (e.g., cancer), and osteoporosis.
  • the condition associated with increased expression and/or increased activity of IL-31 is selected from the group consisting of pruritis and dermatitis.
  • the condition is atopic dermatitis.
  • the condition is pruritis.
  • IL-31 -binding molecules, or vector, as described herein in the manufacture of a medicament for treating, inhibiting or ameliorating a condition associated with an abnormal (e.g., increased) level and/or abnormal (e.g., increased) activity of IL-31 in a subject in need thereof, as described herein.
  • Also disclosed herein is a method of treating or preventing a condition caused by, associated with, or resulting from, an increased expression of IL-31 or increased sensitivity to IL-31 in a subject in need thereof, the method comprising the step of administering the IL-31 -binding molecule, or vector, as described herein, to a canine subject in need thereof.
  • IL-31-binding molecule or the vector, or the pharmaceutical composition, as described herein, for use in the treatment of a condition caused by, associated with, or resulting from, an increased expression of IL-31 or increased sensitivity to IL-31 in a subject.
  • the present disclosure also extends to the use of the IL-31-binding molecule, or the vector, as described herein, in the manufacture of a medicament for the treatment of a condition caused by, associated with, or resulting from, an increased expression of IL- 31 or increased sensitivity to IL-31 in a subject.
  • the present disclosure also extends to a method for the treatment or prevention of a tumour induced to proliferate by IL-31 and conditions associated therewith, the method comprising administering the IL-31 -binding molecule, or the vector, or the pharmaceutical composition, as described herein, to a subject in need thereof.
  • IL-31-binding molecule or the vector, or the pharmaceutical composition, as described herein, for use in the treatment or prevention of a tumour induced to proliferate by IL-31 and conditions associated therewith, in a subject in need thereof.
  • the present disclosure also extends to the use of the IL-31-binding molecule, or the vector, as described herein, in the manufacture of a medicament for the treatment or prevention of a tumour induced to proliferate by IL-31 and conditions associated therewith, in a subject in need thereof.
  • the present disclosure also extends to a kit comprising the IL-31-binding molecule, or the vector, or the pharmaceutical composition, as described herein.
  • IL-31-binding molecule or the vector, as described herein, for detecting IL-31 in a sample.
  • “about” is meant a quantity, level, value, number, frequency, percentage, dimension, size, amount, weight or length that varies by as much 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1 % to a reference quantity, level, value, number, frequency, percentage, dimension, size, amount, weight or length.
  • Interleukin 31 (IL-31) [0182] Recombinant canine IL-31 (ProSpec-Tany, Israel) produced in Sf9 Baculovirus cells comprising 142 amino acids (amino acid residues 24-159 of Accession no. NP 001159386; SEQ ID NO: 1) fused to a 6 amino acid His-Tag at C-terminus was used as an immunogen to generate antibodies in Balb/c mice.
  • Antibody titres from immunized mice were determined using an enzyme linked immunosorbent assay (ELISA).
  • Canine IL-31 (100 ng/well) was immobilized to polystyrene microplates and used as a capture antigen and blocked with PBS/0.05% Tween 20/1% BSA. Coated wells were incubated for 1 hour at room temperature with monoclonal antibody (mAb) diluted in PBS/0.05% Tween 20/1% BSA (100 pl/well).
  • mAb concentrations ranging from 1000 ng/ml to 1.37 ng/ml were used to establish a standard curve.
  • the spleens of 3 mice that were immunized with canine IL-31 protein (SEQ ID NO:1) were isolated and individually used for hybridoma generation using standard technologies (see, for example, Albitar (2007; Methods in Molecular Biology; Monoclonal Antibodies Volume 378
  • hybridomas were plated out into multi-well plates. 6000 wells were screened for binding to canine IL-31 using a microarray ELISA format.
  • VH heavy chain variable region
  • VL light chain variable region
  • chRA4 the heavy chain variable sequence of the murine monoclonal antibody RA4 was fused to the constant region of the canine immunoglobulin gamma heavy chain A of SEQ ID NO:2 (corresponding to amino acid positions 138-468 of GenBank: AAL35301), and the light chain variable sequence was fused to the constant region corresponding to the IGKC*01 allele from IMGT (accession number IMGT000067) as shown below:
  • Table 1A CDR sequences of the Heavy Chain (HC) and Light Chain (LC) variable regions of monoclonal antibody RD4.D2 (IMGT defined)
  • Table IB CDR sequences of the Heavy Chain (HC) and Light Chain (LC) variable regions of monoclonal antibody RD4.D2 (identified using Kabat numbering)
  • LEIKRADAAPTVS SEQ ID NO: 13
  • VH heavy chain
  • VL light chain
  • VL Light-chain variable region
  • the framework regions of the heavy and light chain variable sequences of the murine monoclonal antibody RA4 were substituted for canine heavy and light chain framework regions.
  • Canine antibody sequences were searched for comparison to the murine heavy and light chain variable domains using BLAST search algorithms, and candidate canine variable domains selected from the top 200 BLAST results.
  • the top candidates were selected based on a combination of framework homology, maintaining key framework residues and canonical loop structure.
  • amino acid sequences of the caninized RA4 heavy and light chain variable regions are set out below:
  • VLC6 EIVLTQSPASLSLSQGEKVTITCRASESVEYYGTSLMQWYQQKPGQAPKLLIY AASGVESGVPSRFSGSGSGTDFSFTISSLEPEDVAVYFCQQSRKVPYTFGGGTK
  • the framework regions of the heavy and light chain variable sequences of the murine monoclonal antibody RA4 will be substituted for feline heavy and light chain framework region sequences.
  • Feline antibody sequences will be searched for comparison to the murine heavy and light chain variable domains using BLAST search algorithms, and candidate feline variable domains will be selected from the top 200 BLAST results.
  • the top candidates will be selected based on a combination of framework homology, maintaining key framework residues and canonical loop structure.
  • Table 3 Illustrative examples of amino acid sequences of heavy chain (VH) and the light chain (VL) framework regions (FR1-4) of a felinized IL-31 -binding molecule:
  • Example 2 Determination of Binding of Monoclonal Antibody RA4 to Canine IL- 31, Feline IL-31 and Canine IL-31 mutants
  • Canine IL-31 Mutant 1 (the alanine substitutions are identified by bold and underlined text)
  • RA4 mAb to neutralise IL-31 -mediated pSTAT3-signalling in a canine monocyte cell line was assessed as follows: canine DH-82 cells were pre-treated for 24 hours with canine gamma interferon at 10 ng/mL and then serum starved for 2 hours. Cell supernatants were incubated with canine IL-31 (160ng/mL) for 60 minutes. The RA4/IL-31 mix was then added to cells for 5 min and STAT phosphorylation was evaluated using apSTAT3 ELISA (STAT-3 (Phospho) [pY705] Multispecies ELISA Kit, Invitrogen).
  • STAT-3 Phospho
  • RA4 bound to canine IL-31, feline IL-31 (SEQ ID NO: 64) and to both canine IL-31 mutant proteins, Mutant 1 (SEQ ID NO:62) and Mutant 2 (SEQ ID NO:63).
  • M14 bound to canine IL-31 and to canine IL-31 Mutant 1, but did not show significant binding to canine IL-31 Mutant 2.
  • Ml 4 shows minimal binding to feline IL-31.
  • 34D03 also bound to canine IL-31 and to a lesser extent, feline IL-31 , but did not show significant binding to either Mutant 1 or Mutant 2.
  • RA4 did not bind to human IL-31 in these studies.
  • the murine RA4 mAh does not bind to critical residues involved in the binding of anti-canine IL-31 mAbs M14 and 34D03.
  • Canine IL-31 (SEQ ID NO : 1 )
  • SHMAPTHQLPPSDVRKIILE (SEQ ID NO: 69)
  • IL-31 proteins and peptides were assessed by ELISA.
  • IL- 31 proteins or peptides were immobilized to polystyrene microplates as capture antigen. Wells were blocked with PBS/0.05% Tween 20/1% BSA. Coated wells were incubated for 1 h at room temperature with anti -IL-31 mAbs diluted in PBS/0.05% Tween 20/1% BSA (100 pl/well).
  • the RA4 mAh binds to the chimeric canine/human IL- 31 proteins that contain the first 49 amino acids of canine IL-31 (SEQ ID NO:1) which incorporates the helix A of IL-31.
  • SEQ ID NO:1 which incorporates the helix A of IL-31.
  • Replacement of the canine sequence for helices B, C and D with the human sequence did not abrogate binding, demonstrating that the epitope of RA4 mAh resides in the N-terminal region of canine IL-31.
  • M14 bound only to Peptide 1, comprising amino acid residues 1-20 of canine IL-31.
  • An alanine-scanning peptide library of the region encompassing amino acid residues 18-42 of SEQ ID NO:1 was generated (IILELQPLSRGLLEDYQKKETGVPES; SEQ ID NO:79), consisting of 25 peptides, each with a single alanine mutation at a different residue. Binding of the RA4 mAh to each of the peptides was determined by ELISA, as detailed above.
  • the chimeric RA4 mAh was able to bind all proteins with a single amino acid alanine substitution when comparable to binding to the wild-type canine IL-31 protein (Figure 7A).
  • Figure 7A When all 4 residues (L29, Y32, Q33, and P40) were substituted for alanine in combination, no binding to canine IL-31 was detected.
  • Ml 4 mAb bound equally well to all mutant proteins and wild-type canine IL-31 protein.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • General Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Medicinal Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Immunology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Animal Behavior & Ethology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • Dermatology (AREA)
  • Microbiology (AREA)
  • Virology (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Organic Low-Molecular-Weight Compounds And Preparation Thereof (AREA)
PCT/US2021/060369 2020-11-23 2021-11-22 Antigen-binding molecules and uses thereof Ceased WO2022109403A1 (en)

Priority Applications (7)

Application Number Priority Date Filing Date Title
US18/037,938 US20230416356A1 (en) 2020-11-23 2021-11-22 Antigen-binding molecules and uses thereof
EP21895765.2A EP4247848A4 (en) 2020-11-23 2021-11-22 ANTIGEN-BINDING MOLECULES AND THEIR USES
AU2021383841A AU2021383841A1 (en) 2020-11-23 2021-11-22 Antigen-binding molecules and uses thereof
KR1020237020496A KR20230118864A (ko) 2020-11-23 2021-11-22 항원 결합 분자 및 이의 용도
CA3199586A CA3199586A1 (en) 2020-11-23 2021-11-22 Antigen-binding molecules and uses thereof
JP2023530833A JP2023550628A (ja) 2020-11-23 2021-11-22 抗原結合分子およびその使用
CN202180091195.3A CN116981691A (zh) 2020-11-23 2021-11-22 抗原结合分子及其用途

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US202063117383P 2020-11-23 2020-11-23
US63/117,383 2020-11-23

Publications (1)

Publication Number Publication Date
WO2022109403A1 true WO2022109403A1 (en) 2022-05-27

Family

ID=81709767

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2021/060369 Ceased WO2022109403A1 (en) 2020-11-23 2021-11-22 Antigen-binding molecules and uses thereof

Country Status (8)

Country Link
US (1) US20230416356A1 (https=)
EP (1) EP4247848A4 (https=)
JP (1) JP2023550628A (https=)
KR (1) KR20230118864A (https=)
CN (1) CN116981691A (https=)
AU (1) AU2021383841A1 (https=)
CA (1) CA3199586A1 (https=)
WO (1) WO2022109403A1 (https=)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20250277039A1 (en) * 2022-11-15 2025-09-04 Purdue Research Foundation Canine pd-l1 antibody, antigen binding fragments thereof, and methods of use thereof

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB202405576D0 (en) * 2024-04-19 2024-06-05 272Bio Ltd VHH antibodies
CN121362250A (zh) * 2024-07-19 2026-01-20 普米斯生物技术(珠海)有限公司 抗il-31抗体、其药物组合物及用途

Citations (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2009138494A2 (en) * 2008-05-15 2009-11-19 Ablynx N.V. Amino acid sequences directed against toll-like receptors and polypeptides comprising the same for the treatment of diseases related to toll-like receptors
WO2014165771A2 (en) * 2013-04-05 2014-10-09 Genentech, Inc. Anti-il-4 antibodies and bispecific antibodies and uses thereof
WO2016062720A1 (en) * 2014-10-22 2016-04-28 Saiba Gmbh Modified virus-like particles of cmv
WO2016094837A2 (en) * 2014-12-11 2016-06-16 Igenica Biotherapeutics, Inc. Anti-c10orf54 antibodies and uses thereof
WO2018109170A2 (en) * 2016-12-16 2018-06-21 Singapore Health Services Pte Ltd Il-11ra antibodies
US20180244766A1 (en) * 2017-02-24 2018-08-30 Kindred Biosciences, Inc. Anti-il31 antibodies for veterinary use
WO2019008377A1 (en) * 2017-07-05 2019-01-10 Ucl Business Plc ANTIBODY ROR1
WO2019118512A2 (en) * 2017-12-11 2019-06-20 Ubi Ip Holdings Peptide immunogens of il-31 and formulations thereof for the treatment and/or prevention of atopic dermatitis
US20190284272A1 (en) * 2018-03-16 2019-09-19 Zoetis Services Llc Interleukin-31 monoclonal antibodies for veterinary use
US20190300610A1 (en) * 2018-03-29 2019-10-03 Hummingbird Bioscience Pte. Ltd. Vista antigen-binding molecules
US20190389944A1 (en) * 2011-07-21 2019-12-26 Zoetis Services Llc Methods for treating il-31-mediated conditions in companion animals

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
ME03057B (me) * 2007-12-07 2019-01-20 Zymogenetics Inc Molekuli humanizovanih antitela specifični za il-31
US11433139B2 (en) * 2018-03-16 2022-09-06 Zoetis Services Llc Peptide vaccines against interleukin-31
WO2019183449A1 (en) * 2018-03-23 2019-09-26 North Carolina State University Methods and compositions for allergic disorders

Patent Citations (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2009138494A2 (en) * 2008-05-15 2009-11-19 Ablynx N.V. Amino acid sequences directed against toll-like receptors and polypeptides comprising the same for the treatment of diseases related to toll-like receptors
US20190389944A1 (en) * 2011-07-21 2019-12-26 Zoetis Services Llc Methods for treating il-31-mediated conditions in companion animals
WO2014165771A2 (en) * 2013-04-05 2014-10-09 Genentech, Inc. Anti-il-4 antibodies and bispecific antibodies and uses thereof
WO2016062720A1 (en) * 2014-10-22 2016-04-28 Saiba Gmbh Modified virus-like particles of cmv
WO2016094837A2 (en) * 2014-12-11 2016-06-16 Igenica Biotherapeutics, Inc. Anti-c10orf54 antibodies and uses thereof
WO2018109170A2 (en) * 2016-12-16 2018-06-21 Singapore Health Services Pte Ltd Il-11ra antibodies
US20180244766A1 (en) * 2017-02-24 2018-08-30 Kindred Biosciences, Inc. Anti-il31 antibodies for veterinary use
WO2019008377A1 (en) * 2017-07-05 2019-01-10 Ucl Business Plc ANTIBODY ROR1
WO2019118512A2 (en) * 2017-12-11 2019-06-20 Ubi Ip Holdings Peptide immunogens of il-31 and formulations thereof for the treatment and/or prevention of atopic dermatitis
US20190284272A1 (en) * 2018-03-16 2019-09-19 Zoetis Services Llc Interleukin-31 monoclonal antibodies for veterinary use
US20190300610A1 (en) * 2018-03-29 2019-10-03 Hummingbird Bioscience Pte. Ltd. Vista antigen-binding molecules

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See also references of EP4247848A4 *

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20250277039A1 (en) * 2022-11-15 2025-09-04 Purdue Research Foundation Canine pd-l1 antibody, antigen binding fragments thereof, and methods of use thereof

Also Published As

Publication number Publication date
US20230416356A1 (en) 2023-12-28
KR20230118864A (ko) 2023-08-14
AU2021383841A1 (en) 2023-06-22
CA3199586A1 (en) 2022-05-27
JP2023550628A (ja) 2023-12-04
AU2021383841A9 (en) 2024-06-13
EP4247848A4 (en) 2025-10-01
CN116981691A (zh) 2023-10-31
EP4247848A1 (en) 2023-09-27

Similar Documents

Publication Publication Date Title
JP3978338B2 (ja) ヒトIL−1βに対する抗体
US20250354169A1 (en) Adeno-associated virus (aav) delivery of anti-fam19a5 antibodies
JP5941049B2 (ja) ヒトtweakに対する抗体およびその使用
JP5596777B2 (ja) ヒトtweakに対する抗体とその使用
US20230416356A1 (en) Antigen-binding molecules and uses thereof
US20230110287A1 (en) Antigen-binding molecules and uses thereof
CN117003872A (zh) 含有突变轻链可变区骨架的单链抗体片段
CN116410319A (zh) 抗par2抗体及其用途
US20250011412A1 (en) Antigen-binding molecules and uses thereof
WO2023118241A1 (en) Anti-canine interleukine-31-receptor a (il-31ra) antibodies and the uses thereof
CN118638234B (zh) 抗bdca2抗体及其制备方法和应用
JP6529602B2 (ja) 抗cd20/抗baff二重特異性抗体
WO2024061158A1 (en) Slit2 related compositions and methods
US20260035484A1 (en) Isolated antigen binding protein and use thereof
TW202434634A (zh) 抗IL-18Rβ抗體、其抗原結合片段及其醫藥應用
HK40110110A (zh) 具有经修饰的ch2-ch3序列的犬抗体
HK40110084A (zh) 具有延长的半衰期的抗体和igg融合蛋白

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21895765

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3199586

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2023530833

Country of ref document: JP

ENP Entry into the national phase

Ref document number: 20237020496

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2021383841

Country of ref document: AU

Date of ref document: 20211122

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2021895765

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021895765

Country of ref document: EP

Effective date: 20230623

WWE Wipo information: entry into national phase

Ref document number: 202180091195.3

Country of ref document: CN