WO2022060185A1 - 표적화된 탈아미노효소 및 이를 이용한 염기 교정 - Google Patents
표적화된 탈아미노효소 및 이를 이용한 염기 교정 Download PDFInfo
- Publication number
- WO2022060185A1 WO2022060185A1 PCT/KR2021/012872 KR2021012872W WO2022060185A1 WO 2022060185 A1 WO2022060185 A1 WO 2022060185A1 KR 2021012872 W KR2021012872 W KR 2021012872W WO 2022060185 A1 WO2022060185 A1 WO 2022060185A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- protein
- fusion protein
- dna
- nucleic acid
- tale
- Prior art date
Links
- 108010080611 Cytosine Deaminase Proteins 0.000 claims abstract description 154
- 102000000311 Cytosine Deaminase Human genes 0.000 claims abstract description 151
- 108020001507 fusion proteins Proteins 0.000 claims abstract description 143
- 102000037865 fusion proteins Human genes 0.000 claims abstract description 143
- 239000000203 mixture Substances 0.000 claims abstract description 88
- 238000000034 method Methods 0.000 claims abstract description 80
- 108010052875 Adenine deaminase Proteins 0.000 claims abstract description 47
- 231100000252 nontoxic Toxicity 0.000 claims abstract description 21
- 230000003000 nontoxic effect Effects 0.000 claims abstract description 21
- 238000012937 correction Methods 0.000 claims description 345
- 210000004027 cell Anatomy 0.000 claims description 201
- 108020004414 DNA Proteins 0.000 claims description 161
- 108090000623 proteins and genes Proteins 0.000 claims description 154
- 150000007523 nucleic acids Chemical class 0.000 claims description 138
- 102000039446 nucleic acids Human genes 0.000 claims description 134
- 108020004707 nucleic acids Proteins 0.000 claims description 134
- 230000002438 mitochondrial effect Effects 0.000 claims description 113
- 102000004169 proteins and genes Human genes 0.000 claims description 110
- 101710185494 Zinc finger protein Proteins 0.000 claims description 104
- 102100023597 Zinc finger protein 816 Human genes 0.000 claims description 104
- 235000018102 proteins Nutrition 0.000 claims description 104
- 239000012634 fragment Substances 0.000 claims description 103
- 102000052510 DNA-Binding Proteins Human genes 0.000 claims description 78
- 101710096438 DNA-binding protein Proteins 0.000 claims description 73
- 235000001014 amino acid Nutrition 0.000 claims description 70
- 210000001938 protoplast Anatomy 0.000 claims description 70
- 150000001413 amino acids Chemical class 0.000 claims description 67
- 230000008685 targeting Effects 0.000 claims description 64
- 230000027455 binding Effects 0.000 claims description 62
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical compound O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 claims description 52
- 101710163270 Nuclease Proteins 0.000 claims description 50
- 230000000694 effects Effects 0.000 claims description 50
- 229960000643 adenine Drugs 0.000 claims description 49
- 108091033409 CRISPR Proteins 0.000 claims description 46
- 210000003470 mitochondria Anatomy 0.000 claims description 44
- 210000003763 chloroplast Anatomy 0.000 claims description 42
- 229910052725 zinc Inorganic materials 0.000 claims description 42
- 239000011701 zinc Substances 0.000 claims description 42
- 210000003527 eukaryotic cell Anatomy 0.000 claims description 40
- 102000053602 DNA Human genes 0.000 claims description 39
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 claims description 38
- 108010077850 Nuclear Localization Signals Proteins 0.000 claims description 36
- 238000001890 transfection Methods 0.000 claims description 35
- 210000001236 prokaryotic cell Anatomy 0.000 claims description 34
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 33
- 229940035893 uracil Drugs 0.000 claims description 26
- 210000004102 animal cell Anatomy 0.000 claims description 24
- 241000588724 Escherichia coli Species 0.000 claims description 23
- 108010017070 Zinc Finger Nucleases Proteins 0.000 claims description 22
- 235000004279 alanine Nutrition 0.000 claims description 20
- 108010031100 chloroplast transit peptides Proteins 0.000 claims description 20
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 19
- 229940113491 Glycosylase inhibitor Drugs 0.000 claims description 18
- 238000004520 electroporation Methods 0.000 claims description 18
- 241000894006 Bacteria Species 0.000 claims description 17
- 230000001404 mediated effect Effects 0.000 claims description 17
- 125000000539 amino acid group Chemical group 0.000 claims description 16
- 230000004568 DNA-binding Effects 0.000 claims description 15
- 238000002347 injection Methods 0.000 claims description 15
- 239000007924 injection Substances 0.000 claims description 15
- 238000000520 microinjection Methods 0.000 claims description 15
- 210000004940 nucleus Anatomy 0.000 claims description 15
- 108010066154 Nuclear Export Signals Proteins 0.000 claims description 13
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 claims description 12
- 238000013518 transcription Methods 0.000 claims description 12
- 230000035897 transcription Effects 0.000 claims description 12
- 238000010459 TALEN Methods 0.000 claims description 10
- 230000004927 fusion Effects 0.000 claims description 10
- 230000001965 increasing effect Effects 0.000 claims description 9
- 239000012636 effector Substances 0.000 claims description 8
- 210000002706 plastid Anatomy 0.000 claims description 5
- 229920002477 rna polymer Polymers 0.000 claims description 5
- 230000003612 virological effect Effects 0.000 claims description 5
- 108010043645 Transcription Activator-Like Effector Nucleases Proteins 0.000 claims description 3
- 230000009466 transformation Effects 0.000 claims description 3
- 241000589158 Agrobacterium Species 0.000 claims description 2
- 241000589156 Agrobacterium rhizogenes Species 0.000 claims description 2
- 241000589155 Agrobacterium tumefaciens Species 0.000 claims description 2
- 108091060290 Chromatid Proteins 0.000 claims description 2
- 229910052799 carbon Inorganic materials 0.000 claims description 2
- 210000004756 chromatid Anatomy 0.000 claims description 2
- 238000010354 CRISPR gene editing Methods 0.000 claims 7
- OPTASPLRGRRNAP-UHFFFAOYSA-N cytosine Chemical compound NC=1C=CNC(=O)N=1 OPTASPLRGRRNAP-UHFFFAOYSA-N 0.000 abstract description 215
- 229940104302 cytosine Drugs 0.000 abstract description 109
- 239000002585 base Substances 0.000 description 330
- 108010073062 Transcription Activator-Like Effectors Proteins 0.000 description 203
- 230000035772 mutation Effects 0.000 description 120
- 239000013612 plasmid Substances 0.000 description 116
- 108020005196 Mitochondrial DNA Proteins 0.000 description 104
- 125000003729 nucleotide group Chemical group 0.000 description 102
- 239000002773 nucleotide Substances 0.000 description 99
- RWQNBRDOKXIBIV-UHFFFAOYSA-N thymine Chemical compound CC1=CNC(=O)NC1=O RWQNBRDOKXIBIV-UHFFFAOYSA-N 0.000 description 85
- 241000196324 Embryophyta Species 0.000 description 70
- 108020004999 messenger RNA Proteins 0.000 description 68
- 229940024606 amino acid Drugs 0.000 description 54
- 229940113082 thymine Drugs 0.000 description 54
- 229930024421 Adenine Natural products 0.000 description 46
- GFFGJBXGBJISGV-UHFFFAOYSA-N Adenine Chemical compound NC1=NC=NC2=C1N=CN2 GFFGJBXGBJISGV-UHFFFAOYSA-N 0.000 description 46
- 241001465754 Metazoa Species 0.000 description 41
- 125000006850 spacer group Chemical group 0.000 description 40
- 235000003228 Lactuca sativa Nutrition 0.000 description 37
- 241000208822 Lactuca Species 0.000 description 33
- 239000013598 vector Substances 0.000 description 32
- 101000633984 Homo sapiens Influenza virus NS1A-binding protein Proteins 0.000 description 30
- 101000604411 Homo sapiens NADH-ubiquinone oxidoreductase chain 1 Proteins 0.000 description 30
- 102100038625 NADH-ubiquinone oxidoreductase chain 1 Human genes 0.000 description 30
- 238000012163 sequencing technique Methods 0.000 description 28
- 210000003463 organelle Anatomy 0.000 description 27
- 238000006243 chemical reaction Methods 0.000 description 26
- 230000032258 transport Effects 0.000 description 26
- 206010020649 Hyperkeratosis Diseases 0.000 description 25
- 238000012350 deep sequencing Methods 0.000 description 25
- -1 promoters Proteins 0.000 description 25
- 241000699670 Mus sp. Species 0.000 description 24
- 238000006467 substitution reaction Methods 0.000 description 24
- 101000598279 Homo sapiens NADH-ubiquinone oxidoreductase chain 5 Proteins 0.000 description 23
- 102100036971 NADH-ubiquinone oxidoreductase chain 5 Human genes 0.000 description 23
- 108091093105 Nuclear DNA Proteins 0.000 description 23
- 241000699666 Mus <mouse, genus> Species 0.000 description 22
- 229940088598 enzyme Drugs 0.000 description 22
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 22
- 102000004190 Enzymes Human genes 0.000 description 21
- 108090000790 Enzymes Proteins 0.000 description 21
- 238000006481 deamination reaction Methods 0.000 description 21
- 239000000243 solution Substances 0.000 description 21
- 125000003275 alpha amino acid group Chemical group 0.000 description 20
- 210000005260 human cell Anatomy 0.000 description 20
- 230000009615 deamination Effects 0.000 description 19
- 239000002609 medium Substances 0.000 description 19
- 240000002791 Brassica napus Species 0.000 description 18
- 235000004977 Brassica sinapistrum Nutrition 0.000 description 18
- 210000002257 embryonic structure Anatomy 0.000 description 18
- 210000001519 tissue Anatomy 0.000 description 18
- 210000004899 c-terminal region Anatomy 0.000 description 17
- 101001103039 Homo sapiens Inactive tyrosine-protein kinase transmembrane receptor ROR1 Proteins 0.000 description 16
- 101001103036 Homo sapiens Nuclear receptor ROR-alpha Proteins 0.000 description 16
- 102100039615 Inactive tyrosine-protein kinase transmembrane receptor ROR1 Human genes 0.000 description 16
- 230000001580 bacterial effect Effects 0.000 description 16
- 238000010362 genome editing Methods 0.000 description 16
- 238000004458 analytical method Methods 0.000 description 15
- 239000002105 nanoparticle Substances 0.000 description 15
- 102220605874 Cytosolic arginine sensor for mTORC1 subunit 2_D10A_mutation Human genes 0.000 description 14
- 230000003197 catalytic effect Effects 0.000 description 14
- 230000009261 transgenic effect Effects 0.000 description 14
- 239000013613 expression plasmid Substances 0.000 description 13
- 239000013604 expression vector Substances 0.000 description 13
- 238000001727 in vivo Methods 0.000 description 13
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 12
- 108020004465 16S ribosomal RNA Proteins 0.000 description 12
- 101710153660 Nuclear receptor corepressor 2 Proteins 0.000 description 12
- 102220484160 Pogo transposable element with ZNF domain_H840A_mutation Human genes 0.000 description 12
- 238000010586 diagram Methods 0.000 description 12
- 238000002474 experimental method Methods 0.000 description 12
- 238000000338 in vitro Methods 0.000 description 12
- 208000012268 mitochondrial disease Diseases 0.000 description 12
- 102100030569 Nuclear receptor corepressor 2 Human genes 0.000 description 11
- 210000002459 blastocyst Anatomy 0.000 description 11
- 238000003776 cleavage reaction Methods 0.000 description 11
- 238000010367 cloning Methods 0.000 description 11
- 230000006870 function Effects 0.000 description 11
- 229920001223 polyethylene glycol Polymers 0.000 description 11
- 238000007480 sanger sequencing Methods 0.000 description 11
- 230000007017 scission Effects 0.000 description 11
- 229960005322 streptomycin Drugs 0.000 description 11
- 108091093088 Amplicon Proteins 0.000 description 10
- 101000606129 Homo sapiens Tyrosine-protein kinase receptor TYRO3 Proteins 0.000 description 10
- 102100039127 Tyrosine-protein kinase receptor TYRO3 Human genes 0.000 description 10
- 238000010276 construction Methods 0.000 description 10
- 230000009977 dual effect Effects 0.000 description 10
- 238000005516 engineering process Methods 0.000 description 10
- 239000013603 viral vector Substances 0.000 description 10
- 108700028369 Alleles Proteins 0.000 description 9
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 9
- 108020005004 Guide RNA Proteins 0.000 description 9
- 102100021519 Hemoglobin subunit beta Human genes 0.000 description 9
- 229920002873 Polyethylenimine Polymers 0.000 description 9
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 9
- UYTPUPDQBNUYGX-UHFFFAOYSA-N guanine Chemical compound O=C1NC(N)=NC2=C1N=CN2 UYTPUPDQBNUYGX-UHFFFAOYSA-N 0.000 description 9
- 230000009437 off-target effect Effects 0.000 description 9
- 210000000056 organ Anatomy 0.000 description 9
- 230000001105 regulatory effect Effects 0.000 description 9
- 231100000419 toxicity Toxicity 0.000 description 9
- 230000001988 toxicity Effects 0.000 description 9
- 241000371430 Burkholderia cenocepacia Species 0.000 description 8
- 108091079001 CRISPR RNA Proteins 0.000 description 8
- 102100023823 Homeobox protein EMX1 Human genes 0.000 description 8
- 101001048956 Homo sapiens Homeobox protein EMX1 Proteins 0.000 description 8
- 101000632748 Homo sapiens NADH-ubiquinone oxidoreductase chain 2 Proteins 0.000 description 8
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 8
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 description 8
- 235000003704 aspartic acid Nutrition 0.000 description 8
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 8
- 238000001415 gene therapy Methods 0.000 description 8
- 239000002502 liposome Substances 0.000 description 8
- 229920000642 polymer Polymers 0.000 description 8
- 230000008569 process Effects 0.000 description 8
- 230000002829 reductive effect Effects 0.000 description 8
- 238000010361 transduction Methods 0.000 description 8
- 230000026683 transduction Effects 0.000 description 8
- 238000011144 upstream manufacturing Methods 0.000 description 8
- 239000004475 Arginine Substances 0.000 description 7
- 241000701022 Cytomegalovirus Species 0.000 description 7
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 7
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 7
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 7
- 102100021601 Ephrin type-A receptor 8 Human genes 0.000 description 7
- 101000898676 Homo sapiens Ephrin type-A receptor 8 Proteins 0.000 description 7
- 208000026350 Inborn Genetic disease Diseases 0.000 description 7
- 102100028488 NADH-ubiquinone oxidoreductase chain 2 Human genes 0.000 description 7
- 108020004485 Nonsense Codon Proteins 0.000 description 7
- 108091028113 Trans-activating crRNA Proteins 0.000 description 7
- 241000700605 Viruses Species 0.000 description 7
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 7
- 235000009697 arginine Nutrition 0.000 description 7
- 230000003115 biocidal effect Effects 0.000 description 7
- 210000004369 blood Anatomy 0.000 description 7
- 239000008280 blood Substances 0.000 description 7
- 125000002091 cationic group Chemical group 0.000 description 7
- 238000012217 deletion Methods 0.000 description 7
- 230000037430 deletion Effects 0.000 description 7
- 239000003814 drug Substances 0.000 description 7
- 208000016361 genetic disease Diseases 0.000 description 7
- 238000012165 high-throughput sequencing Methods 0.000 description 7
- 230000037434 nonsense mutation Effects 0.000 description 7
- 229960000268 spectinomycin Drugs 0.000 description 7
- UNFWWIHTNXNPBV-WXKVUWSESA-N spectinomycin Chemical compound O([C@@H]1[C@@H](NC)[C@@H](O)[C@H]([C@@H]([C@H]1O1)O)NC)[C@]2(O)[C@H]1O[C@H](C)CC2=O UNFWWIHTNXNPBV-WXKVUWSESA-N 0.000 description 7
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 6
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 6
- 108020004705 Codon Proteins 0.000 description 6
- 108010008532 Deoxyribonuclease I Proteins 0.000 description 6
- 102000007260 Deoxyribonuclease I Human genes 0.000 description 6
- 108010067770 Endopeptidase K Proteins 0.000 description 6
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 6
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 6
- 241000282412 Homo Species 0.000 description 6
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 6
- 102100028386 NADH-ubiquinone oxidoreductase chain 6 Human genes 0.000 description 6
- 101150034114 ND5 gene Proteins 0.000 description 6
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 6
- 239000003242 anti bacterial agent Substances 0.000 description 6
- 229940088710 antibiotic agent Drugs 0.000 description 6
- 238000003491 array Methods 0.000 description 6
- 238000004113 cell culture Methods 0.000 description 6
- 210000000349 chromosome Anatomy 0.000 description 6
- 230000003013 cytotoxicity Effects 0.000 description 6
- 231100000135 cytotoxicity Toxicity 0.000 description 6
- 239000000539 dimer Substances 0.000 description 6
- 201000010099 disease Diseases 0.000 description 6
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 6
- 230000005782 double-strand break Effects 0.000 description 6
- 239000003623 enhancer Substances 0.000 description 6
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 6
- 238000001638 lipofection Methods 0.000 description 6
- 239000007788 liquid Substances 0.000 description 6
- 210000001161 mammalian embryo Anatomy 0.000 description 6
- 231100000350 mutagenesis Toxicity 0.000 description 6
- 102000040430 polynucleotide Human genes 0.000 description 6
- 108091033319 polynucleotide Proteins 0.000 description 6
- 239000002157 polynucleotide Substances 0.000 description 6
- 230000002441 reversible effect Effects 0.000 description 6
- 239000006228 supernatant Substances 0.000 description 6
- 231100000699 Bacterial toxin Toxicity 0.000 description 5
- 238000010356 CRISPR-Cas9 genome editing Methods 0.000 description 5
- 108700004991 Cas12a Proteins 0.000 description 5
- 108020004998 Chloroplast DNA Proteins 0.000 description 5
- 108700020911 DNA-Binding Proteins Proteins 0.000 description 5
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 5
- 101150025079 RPS14 gene Proteins 0.000 description 5
- 238000012300 Sequence Analysis Methods 0.000 description 5
- 241000193996 Streptococcus pyogenes Species 0.000 description 5
- 108020004566 Transfer RNA Proteins 0.000 description 5
- 108010072685 Uracil-DNA Glycosidase Proteins 0.000 description 5
- 102000006943 Uracil-DNA Glycosidase Human genes 0.000 description 5
- 239000000688 bacterial toxin Substances 0.000 description 5
- 239000000872 buffer Substances 0.000 description 5
- 230000000295 complement effect Effects 0.000 description 5
- 230000007423 decrease Effects 0.000 description 5
- 238000011161 development Methods 0.000 description 5
- 230000018109 developmental process Effects 0.000 description 5
- 235000013601 eggs Nutrition 0.000 description 5
- 230000001976 improved effect Effects 0.000 description 5
- 238000003780 insertion Methods 0.000 description 5
- 230000037431 insertion Effects 0.000 description 5
- 230000003993 interaction Effects 0.000 description 5
- 230000003834 intracellular effect Effects 0.000 description 5
- 150000002632 lipids Chemical class 0.000 description 5
- 210000004962 mammalian cell Anatomy 0.000 description 5
- 238000007481 next generation sequencing Methods 0.000 description 5
- 238000002360 preparation method Methods 0.000 description 5
- 230000001915 proofreading effect Effects 0.000 description 5
- 238000000746 purification Methods 0.000 description 5
- 230000008439 repair process Effects 0.000 description 5
- 239000000126 substance Substances 0.000 description 5
- 238000012360 testing method Methods 0.000 description 5
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 4
- 101150029019 ATP6 gene Proteins 0.000 description 4
- 241000191879 Barley yellow striate mosaic cytorhabdovirus Species 0.000 description 4
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 4
- 108700031407 Chloroplast Genes Proteins 0.000 description 4
- 102000004533 Endonucleases Human genes 0.000 description 4
- 108010042407 Endonucleases Proteins 0.000 description 4
- 241000710017 Foxtail mosaic virus Species 0.000 description 4
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 4
- 101000597928 Homo sapiens Numb-like protein Proteins 0.000 description 4
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 4
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 4
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 4
- 240000008415 Lactuca sativa Species 0.000 description 4
- 239000012097 Lipofectamine 2000 Substances 0.000 description 4
- 102100036986 Numb-like protein Human genes 0.000 description 4
- 101150002896 RNR2 gene Proteins 0.000 description 4
- 241000712465 Sonchus yellow net nucleorhabdovirus Species 0.000 description 4
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 4
- 239000004473 Threonine Substances 0.000 description 4
- 241000723573 Tobacco rattle virus Species 0.000 description 4
- 241000723613 Tomato mosaic virus Species 0.000 description 4
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 4
- 230000008901 benefit Effects 0.000 description 4
- 238000005119 centrifugation Methods 0.000 description 4
- 230000008859 change Effects 0.000 description 4
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 4
- 210000004748 cultured cell Anatomy 0.000 description 4
- 229940079593 drug Drugs 0.000 description 4
- 238000000605 extraction Methods 0.000 description 4
- 239000012091 fetal bovine serum Substances 0.000 description 4
- 230000037433 frameshift Effects 0.000 description 4
- 238000012268 genome sequencing Methods 0.000 description 4
- 235000013922 glutamic acid Nutrition 0.000 description 4
- 239000004220 glutamic acid Substances 0.000 description 4
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 4
- 235000004554 glutamine Nutrition 0.000 description 4
- 239000001963 growth medium Substances 0.000 description 4
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 4
- 235000014304 histidine Nutrition 0.000 description 4
- FDGQSTZJBFJUBT-UHFFFAOYSA-N hypoxanthine Chemical compound O=C1NC=NC2=C1NC=N2 FDGQSTZJBFJUBT-UHFFFAOYSA-N 0.000 description 4
- 238000011534 incubation Methods 0.000 description 4
- 238000002955 isolation Methods 0.000 description 4
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 4
- 239000006166 lysate Substances 0.000 description 4
- 238000004519 manufacturing process Methods 0.000 description 4
- 230000007246 mechanism Effects 0.000 description 4
- 101150075980 psbA gene Proteins 0.000 description 4
- 101150012020 psbB gene Proteins 0.000 description 4
- 238000003259 recombinant expression Methods 0.000 description 4
- 230000011218 segmentation Effects 0.000 description 4
- 235000008521 threonine Nutrition 0.000 description 4
- 238000012546 transfer Methods 0.000 description 4
- 230000001052 transient effect Effects 0.000 description 4
- 230000014616 translation Effects 0.000 description 4
- 239000004474 valine Substances 0.000 description 4
- 235000014393 valine Nutrition 0.000 description 4
- 239000011592 zinc chloride Substances 0.000 description 4
- 235000005074 zinc chloride Nutrition 0.000 description 4
- JIAARYAFYJHUJI-UHFFFAOYSA-L zinc dichloride Chemical compound [Cl-].[Cl-].[Zn+2] JIAARYAFYJHUJI-UHFFFAOYSA-L 0.000 description 4
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 3
- 108010051109 Cell-Penetrating Peptides Proteins 0.000 description 3
- 102000020313 Cell-Penetrating Peptides Human genes 0.000 description 3
- 102000012410 DNA Ligases Human genes 0.000 description 3
- 108010061982 DNA Ligases Proteins 0.000 description 3
- 238000007702 DNA assembly Methods 0.000 description 3
- 238000010442 DNA editing Methods 0.000 description 3
- 241000702421 Dependoparvovirus Species 0.000 description 3
- 108010024636 Glutathione Proteins 0.000 description 3
- 239000004471 Glycine Substances 0.000 description 3
- 208000032087 Hereditary Leber Optic Atrophy Diseases 0.000 description 3
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 3
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 3
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 3
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 3
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 3
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 3
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 3
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 3
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 3
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 3
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 3
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 3
- 201000000639 Leber hereditary optic neuropathy Diseases 0.000 description 3
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 3
- 239000004472 Lysine Substances 0.000 description 3
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 3
- 208000009564 MELAS Syndrome Diseases 0.000 description 3
- 241000204031 Mycoplasma Species 0.000 description 3
- 108091034117 Oligonucleotide Proteins 0.000 description 3
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 3
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 3
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 3
- 241000714474 Rous sarcoma virus Species 0.000 description 3
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 3
- 241000194017 Streptococcus Species 0.000 description 3
- 229930006000 Sucrose Natural products 0.000 description 3
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 3
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 3
- 101150063416 add gene Proteins 0.000 description 3
- 125000003277 amino group Chemical group 0.000 description 3
- 229920001400 block copolymer Polymers 0.000 description 3
- 229910002092 carbon dioxide Inorganic materials 0.000 description 3
- 229910002091 carbon monoxide Inorganic materials 0.000 description 3
- 239000006143 cell culture medium Substances 0.000 description 3
- 239000008004 cell lysis buffer Substances 0.000 description 3
- 230000002759 chromosomal effect Effects 0.000 description 3
- 239000002299 complementary DNA Substances 0.000 description 3
- 150000001875 compounds Chemical class 0.000 description 3
- 238000012258 culturing Methods 0.000 description 3
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 3
- 235000018417 cysteine Nutrition 0.000 description 3
- 230000001419 dependent effect Effects 0.000 description 3
- 230000004064 dysfunction Effects 0.000 description 3
- 231100000221 frame shift mutation induction Toxicity 0.000 description 3
- 210000004602 germ cell Anatomy 0.000 description 3
- 229960003180 glutathione Drugs 0.000 description 3
- 230000006872 improvement Effects 0.000 description 3
- 229960000310 isoleucine Drugs 0.000 description 3
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 3
- 235000018977 lysine Nutrition 0.000 description 3
- 229910001629 magnesium chloride Inorganic materials 0.000 description 3
- 239000012528 membrane Substances 0.000 description 3
- 229930182817 methionine Natural products 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 238000012986 modification Methods 0.000 description 3
- 238000002703 mutagenesis Methods 0.000 description 3
- 101150015830 nd1 gene Proteins 0.000 description 3
- 229930027945 nicotinamide-adenine dinucleotide Natural products 0.000 description 3
- BOPGDPNILDQYTO-NNYOXOHSSA-N nicotinamide-adenine dinucleotide Chemical compound C1=CCC(C(=O)N)=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](COP(O)(=O)OP(O)(=O)OC[C@@H]2[C@H]([C@@H](O)[C@@H](O2)N2C3=NC=NC(N)=C3N=C2)O)O1 BOPGDPNILDQYTO-NNYOXOHSSA-N 0.000 description 3
- 238000005457 optimization Methods 0.000 description 3
- 239000002245 particle Substances 0.000 description 3
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 3
- 238000001742 protein purification Methods 0.000 description 3
- 238000011160 research Methods 0.000 description 3
- 238000012216 screening Methods 0.000 description 3
- 235000004400 serine Nutrition 0.000 description 3
- 230000037432 silent mutation Effects 0.000 description 3
- 239000011780 sodium chloride Substances 0.000 description 3
- 238000000527 sonication Methods 0.000 description 3
- 239000005720 sucrose Substances 0.000 description 3
- 238000012353 t test Methods 0.000 description 3
- 231100000331 toxic Toxicity 0.000 description 3
- 230000002588 toxic effect Effects 0.000 description 3
- 239000003053 toxin Substances 0.000 description 3
- 231100000765 toxin Toxicity 0.000 description 3
- 230000002103 transcriptional effect Effects 0.000 description 3
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 3
- 235000002374 tyrosine Nutrition 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- MWRBNPKJOOWZPW-NYVOMTAGSA-N 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine zwitterion Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OC[C@H](COP(O)(=O)OCCN)OC(=O)CCCCCCC\C=C/CCCCCCCC MWRBNPKJOOWZPW-NYVOMTAGSA-N 0.000 description 2
- LDGWQMRUWMSZIU-LQDDAWAPSA-M 2,3-bis[(z)-octadec-9-enoxy]propyl-trimethylazanium;chloride Chemical compound [Cl-].CCCCCCCC\C=C/CCCCCCCCOCC(C[N+](C)(C)C)OCCCCCCCC\C=C/CCCCCCCC LDGWQMRUWMSZIU-LQDDAWAPSA-M 0.000 description 2
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 2
- KQLXBKWUVBMXEM-UHFFFAOYSA-N 2-amino-3,7-dihydropurin-6-one;7h-purin-6-amine Chemical compound NC1=NC=NC2=C1NC=N2.O=C1NC(N)=NC2=C1NC=N2 KQLXBKWUVBMXEM-UHFFFAOYSA-N 0.000 description 2
- FFKUHGONCHRHPE-UHFFFAOYSA-N 5-methyl-1h-pyrimidine-2,4-dione;7h-purin-6-amine Chemical compound CC1=CNC(=O)NC1=O.NC1=NC=NC2=C1NC=N2 FFKUHGONCHRHPE-UHFFFAOYSA-N 0.000 description 2
- 239000013607 AAV vector Substances 0.000 description 2
- 102000012758 APOBEC-1 Deaminase Human genes 0.000 description 2
- 101150012656 APOBEC1 gene Proteins 0.000 description 2
- 108091006112 ATPases Proteins 0.000 description 2
- 241000251468 Actinopterygii Species 0.000 description 2
- 102000057290 Adenosine Triphosphatases Human genes 0.000 description 2
- 101710095342 Apolipoprotein B Proteins 0.000 description 2
- 102100040202 Apolipoprotein B-100 Human genes 0.000 description 2
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 2
- 101710149870 C-C chemokine receptor type 5 Proteins 0.000 description 2
- 102100035875 C-C chemokine receptor type 5 Human genes 0.000 description 2
- 102000014914 Carrier Proteins Human genes 0.000 description 2
- ACTIUHUUMQJHFO-UHFFFAOYSA-N Coenzym Q10 Natural products COC1=C(OC)C(=O)C(CC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)C)=C(C)C1=O ACTIUHUUMQJHFO-UHFFFAOYSA-N 0.000 description 2
- 102100021982 Coiled-coil domain-containing protein 28B Human genes 0.000 description 2
- 102100039259 Cytochrome c oxidase subunit 8A, mitochondrial Human genes 0.000 description 2
- 230000009946 DNA mutation Effects 0.000 description 2
- 101710177611 DNA polymerase II large subunit Proteins 0.000 description 2
- 101710184669 DNA polymerase II small subunit Proteins 0.000 description 2
- 230000033616 DNA repair Effects 0.000 description 2
- 230000004543 DNA replication Effects 0.000 description 2
- 241000620209 Escherichia coli DH5[alpha] Species 0.000 description 2
- 108700039887 Essential Genes Proteins 0.000 description 2
- 241000702463 Geminiviridae Species 0.000 description 2
- 102100022662 Guanylyl cyclase C Human genes 0.000 description 2
- 101710198293 Guanylyl cyclase C Proteins 0.000 description 2
- HVLSXIKZNLPZJJ-TXZCQADKSA-N HA peptide Chemical compound C([C@@H](C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](C)C(O)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=C(O)C=C1 HVLSXIKZNLPZJJ-TXZCQADKSA-N 0.000 description 2
- 239000007995 HEPES buffer Substances 0.000 description 2
- 108091060210 Heavy strand Proteins 0.000 description 2
- 241000238631 Hexapoda Species 0.000 description 2
- 101000896972 Homo sapiens Coiled-coil domain-containing protein 28B Proteins 0.000 description 2
- 101000745956 Homo sapiens Cytochrome c oxidase subunit 8A, mitochondrial Proteins 0.000 description 2
- 101000613629 Homo sapiens Lysine-specific demethylase 4B Proteins 0.000 description 2
- 101000575376 Homo sapiens Microfibrillar-associated protein 1 Proteins 0.000 description 2
- 101000867469 Homo sapiens Segment polarity protein dishevelled homolog DVL-3 Proteins 0.000 description 2
- 102000004157 Hydrolases Human genes 0.000 description 2
- 108090000604 Hydrolases Proteins 0.000 description 2
- UGQMRVRMYYASKQ-UHFFFAOYSA-N Hypoxanthine nucleoside Natural products OC1C(O)C(CO)OC1N1C(NC=NC2=O)=C2N=C1 UGQMRVRMYYASKQ-UHFFFAOYSA-N 0.000 description 2
- 108020004684 Internal Ribosome Entry Sites Proteins 0.000 description 2
- 241001397173 Kali <angiosperm> Species 0.000 description 2
- 208000006136 Leigh Disease Diseases 0.000 description 2
- 208000017507 Leigh syndrome Diseases 0.000 description 2
- 241000713666 Lentivirus Species 0.000 description 2
- 239000000232 Lipid Bilayer Substances 0.000 description 2
- 102100040860 Lysine-specific demethylase 4B Human genes 0.000 description 2
- 241000124008 Mammalia Species 0.000 description 2
- 102100025602 Microfibrillar-associated protein 1 Human genes 0.000 description 2
- 206010058799 Mitochondrial encephalomyopathy Diseases 0.000 description 2
- 101150056703 Mrps14 gene Proteins 0.000 description 2
- 108010086428 NADH Dehydrogenase Proteins 0.000 description 2
- 102000006746 NADH Dehydrogenase Human genes 0.000 description 2
- 244000061176 Nicotiana tabacum Species 0.000 description 2
- 235000002637 Nicotiana tabacum Nutrition 0.000 description 2
- 108700026244 Open Reading Frames Proteins 0.000 description 2
- 241000283973 Oryctolagus cuniculus Species 0.000 description 2
- 241000288906 Primates Species 0.000 description 2
- 241000283984 Rodentia Species 0.000 description 2
- 102100032754 Segment polarity protein dishevelled homolog DVL-3 Human genes 0.000 description 2
- 229920002684 Sepharose Polymers 0.000 description 2
- 108020004682 Single-Stranded DNA Proteins 0.000 description 2
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 2
- 101710172430 Uracil-DNA glycosylase inhibitor Proteins 0.000 description 2
- DRTQHJPVMGBUCF-XVFCMESISA-N Uridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-XVFCMESISA-N 0.000 description 2
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 2
- HIHOWBSBBDRPDW-PTHRTHQKSA-N [(3s,8s,9s,10r,13r,14s,17r)-10,13-dimethyl-17-[(2r)-6-methylheptan-2-yl]-2,3,4,7,8,9,11,12,14,15,16,17-dodecahydro-1h-cyclopenta[a]phenanthren-3-yl] n-[2-(dimethylamino)ethyl]carbamate Chemical compound C1C=C2C[C@@H](OC(=O)NCCN(C)C)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HIHOWBSBBDRPDW-PTHRTHQKSA-N 0.000 description 2
- 239000002253 acid Substances 0.000 description 2
- 150000007513 acids Chemical class 0.000 description 2
- 230000004913 activation Effects 0.000 description 2
- OIRDTQYFTABQOQ-KQYNXXCUSA-N adenosine Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O OIRDTQYFTABQOQ-KQYNXXCUSA-N 0.000 description 2
- 125000001931 aliphatic group Chemical group 0.000 description 2
- 230000003321 amplification Effects 0.000 description 2
- 229940121375 antifungal agent Drugs 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- 235000009582 asparagine Nutrition 0.000 description 2
- 229960001230 asparagine Drugs 0.000 description 2
- 125000000613 asparagine group Chemical group N[C@@H](CC(N)=O)C(=O)* 0.000 description 2
- CKLJMWTZIZZHCS-REOHCLBHSA-L aspartate group Chemical group N[C@@H](CC(=O)[O-])C(=O)[O-] CKLJMWTZIZZHCS-REOHCLBHSA-L 0.000 description 2
- 230000037429 base substitution Effects 0.000 description 2
- 108091008324 binding proteins Proteins 0.000 description 2
- 230000005540 biological transmission Effects 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 239000006227 byproduct Substances 0.000 description 2
- 150000001767 cationic compounds Chemical class 0.000 description 2
- 230000032823 cell division Effects 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- 235000012000 cholesterol Nutrition 0.000 description 2
- 235000017471 coenzyme Q10 Nutrition 0.000 description 2
- ACTIUHUUMQJHFO-UPTCCGCDSA-N coenzyme Q10 Chemical compound COC1=C(OC)C(=O)C(C\C=C(/C)CC\C=C(/C)CC\C=C(/C)CC\C=C(/C)CC\C=C(/C)CC\C=C(/C)CC\C=C(/C)CC\C=C(/C)CC\C=C(/C)CCC=C(C)C)=C(C)C1=O ACTIUHUUMQJHFO-UPTCCGCDSA-N 0.000 description 2
- 229920001577 copolymer Polymers 0.000 description 2
- 238000005520 cutting process Methods 0.000 description 2
- 230000002950 deficient Effects 0.000 description 2
- 230000018044 dehydration Effects 0.000 description 2
- 238000006297 dehydration reaction Methods 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 230000029087 digestion Effects 0.000 description 2
- PSLWZOIUBRXAQW-UHFFFAOYSA-M dimethyl(dioctadecyl)azanium;bromide Chemical compound [Br-].CCCCCCCCCCCCCCCCCC[N+](C)(C)CCCCCCCCCCCCCCCCCC PSLWZOIUBRXAQW-UHFFFAOYSA-M 0.000 description 2
- 239000012153 distilled water Substances 0.000 description 2
- 239000012458 free base Substances 0.000 description 2
- 239000012737 fresh medium Substances 0.000 description 2
- 238000000227 grinding Methods 0.000 description 2
- 230000002401 inhibitory effect Effects 0.000 description 2
- 229930027917 kanamycin Natural products 0.000 description 2
- 229960000318 kanamycin Drugs 0.000 description 2
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 2
- 229930182823 kanamycin A Natural products 0.000 description 2
- 210000003734 kidney Anatomy 0.000 description 2
- 239000004922 lacquer Substances 0.000 description 2
- 230000003902 lesion Effects 0.000 description 2
- 238000007169 ligase reaction Methods 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 229910052751 metal Inorganic materials 0.000 description 2
- 239000002184 metal Substances 0.000 description 2
- 239000002082 metal nanoparticle Substances 0.000 description 2
- 238000002156 mixing Methods 0.000 description 2
- 239000006870 ms-medium Substances 0.000 description 2
- 210000003205 muscle Anatomy 0.000 description 2
- 238000003199 nucleic acid amplification method Methods 0.000 description 2
- 230000010627 oxidative phosphorylation Effects 0.000 description 2
- 238000010979 pH adjustment Methods 0.000 description 2
- YBYRMVIVWMBXKQ-UHFFFAOYSA-N phenylmethanesulfonyl fluoride Chemical compound FS(=O)(=O)CC1=CC=CC=C1 YBYRMVIVWMBXKQ-UHFFFAOYSA-N 0.000 description 2
- 108010079892 phosphoglycerol kinase Proteins 0.000 description 2
- 230000029553 photosynthesis Effects 0.000 description 2
- 238000010672 photosynthesis Methods 0.000 description 2
- 230000008121 plant development Effects 0.000 description 2
- 239000013600 plasmid vector Substances 0.000 description 2
- 229920000729 poly(L-lysine) polymer Polymers 0.000 description 2
- 229920000962 poly(amidoamine) Polymers 0.000 description 2
- 229920000744 poly(arginines) Polymers 0.000 description 2
- 108010011110 polyarginine Proteins 0.000 description 2
- 229920000656 polylysine Polymers 0.000 description 2
- 102000054765 polymorphisms of proteins Human genes 0.000 description 2
- 239000002244 precipitate Substances 0.000 description 2
- 239000000047 product Substances 0.000 description 2
- 238000001814 protein method Methods 0.000 description 2
- 108020001775 protein parts Proteins 0.000 description 2
- 230000018883 protein targeting Effects 0.000 description 2
- 230000007398 protein translocation Effects 0.000 description 2
- 238000002708 random mutagenesis Methods 0.000 description 2
- 239000011535 reaction buffer Substances 0.000 description 2
- NPCOQXAVBJJZBQ-UHFFFAOYSA-N reduced coenzyme Q9 Natural products COC1=C(O)C(C)=C(CC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)C)C(O)=C1OC NPCOQXAVBJJZBQ-UHFFFAOYSA-N 0.000 description 2
- 239000011347 resin Substances 0.000 description 2
- 229920005989 resin Polymers 0.000 description 2
- 230000027756 respiratory electron transport chain Effects 0.000 description 2
- 230000029058 respiratory gaseous exchange Effects 0.000 description 2
- 108091008146 restriction endonucleases Proteins 0.000 description 2
- 101150107339 rpsN gene Proteins 0.000 description 2
- 101150028844 rpsZ gene Proteins 0.000 description 2
- 102220243686 rs1555618729 Human genes 0.000 description 2
- 238000007790 scraping Methods 0.000 description 2
- 238000002864 sequence alignment Methods 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- 230000035939 shock Effects 0.000 description 2
- 238000002741 site-directed mutagenesis Methods 0.000 description 2
- 210000003491 skin Anatomy 0.000 description 2
- 230000002269 spontaneous effect Effects 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 230000001225 therapeutic effect Effects 0.000 description 2
- 230000036962 time dependent Effects 0.000 description 2
- 210000003371 toe Anatomy 0.000 description 2
- 238000013519 translation Methods 0.000 description 2
- 229940035936 ubiquinone Drugs 0.000 description 2
- 239000013154 zeolitic imidazolate framework-8 Substances 0.000 description 2
- DSLBDPPHINVUID-REOHCLBHSA-N (2s)-2-aminobutanediamide Chemical compound NC(=O)[C@@H](N)CC(N)=O DSLBDPPHINVUID-REOHCLBHSA-N 0.000 description 1
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 1
- NRJAVPSFFCBXDT-HUESYALOSA-N 1,2-distearoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCCCCCCCCCCC NRJAVPSFFCBXDT-HUESYALOSA-N 0.000 description 1
- OHVLMTFVQDZYHP-UHFFFAOYSA-N 1-(2,4,6,7-tetrahydrotriazolo[4,5-c]pyridin-5-yl)-2-[4-[2-[[3-(trifluoromethoxy)phenyl]methylamino]pyrimidin-5-yl]piperazin-1-yl]ethanone Chemical compound N1N=NC=2CN(CCC=21)C(CN1CCN(CC1)C=1C=NC(=NC=1)NCC1=CC(=CC=C1)OC(F)(F)F)=O OHVLMTFVQDZYHP-UHFFFAOYSA-N 0.000 description 1
- KSXTUUUQYQYKCR-LQDDAWAPSA-M 2,3-bis[[(z)-octadec-9-enoyl]oxy]propyl-trimethylazanium;chloride Chemical compound [Cl-].CCCCCCCC\C=C/CCCCCCCC(=O)OCC(C[N+](C)(C)C)OC(=O)CCCCCCC\C=C/CCCCCCCC KSXTUUUQYQYKCR-LQDDAWAPSA-M 0.000 description 1
- NOIRDLRUNWIUMX-UHFFFAOYSA-N 2-amino-3,7-dihydropurin-6-one;6-amino-1h-pyrimidin-2-one Chemical compound NC=1C=CNC(=O)N=1.O=C1NC(N)=NC2=C1NC=N2 NOIRDLRUNWIUMX-UHFFFAOYSA-N 0.000 description 1
- 125000000022 2-aminoethyl group Chemical group [H]C([*])([H])C([H])([H])N([H])[H] 0.000 description 1
- QFVHZQCOUORWEI-UHFFFAOYSA-N 4-[(4-anilino-5-sulfonaphthalen-1-yl)diazenyl]-5-hydroxynaphthalene-2,7-disulfonic acid Chemical compound C=12C(O)=CC(S(O)(=O)=O)=CC2=CC(S(O)(=O)=O)=CC=1N=NC(C1=CC=CC(=C11)S(O)(=O)=O)=CC=C1NC1=CC=CC=C1 QFVHZQCOUORWEI-UHFFFAOYSA-N 0.000 description 1
- 101710169336 5'-deoxyadenosine deaminase Proteins 0.000 description 1
- QCVGEOXPDFCNHA-UHFFFAOYSA-N 5,5-dimethyl-2,4-dioxo-1,3-oxazolidine-3-carboxamide Chemical compound CC1(C)OC(=O)N(C(N)=O)C1=O QCVGEOXPDFCNHA-UHFFFAOYSA-N 0.000 description 1
- CRYRGPNRAULTHU-UHFFFAOYSA-N 6-amino-1h-pyrimidin-2-one;3,7-dihydropurin-6-one Chemical compound NC=1C=CNC(=O)N=1.O=C1NC=NC2=C1NC=N2 CRYRGPNRAULTHU-UHFFFAOYSA-N 0.000 description 1
- MRBCEWCMDNCIDB-UHFFFAOYSA-N 7h-purin-6-amine;1h-pyrimidine-2,4-dione Chemical compound O=C1C=CNC(=O)N1.NC1=NC=NC2=C1NC=N2 MRBCEWCMDNCIDB-UHFFFAOYSA-N 0.000 description 1
- 108010029988 AICDA (activation-induced cytidine deaminase) Proteins 0.000 description 1
- 102220554170 APC membrane recruitment protein 1_L30A_mutation Human genes 0.000 description 1
- 102220510635 APC membrane recruitment protein 1_Q16A_mutation Human genes 0.000 description 1
- 102100021921 ATP synthase subunit a Human genes 0.000 description 1
- 102000007469 Actins Human genes 0.000 description 1
- 108010085238 Actins Proteins 0.000 description 1
- 102000055025 Adenosine deaminases Human genes 0.000 description 1
- 229920000936 Agarose Polymers 0.000 description 1
- 241000219194 Arabidopsis Species 0.000 description 1
- 241000219195 Arabidopsis thaliana Species 0.000 description 1
- 241000589941 Azospirillum Species 0.000 description 1
- 102220479043 BEN domain-containing protein 3_K56A_mutation Human genes 0.000 description 1
- 241000606125 Bacteroides Species 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 241000258971 Brachiopoda Species 0.000 description 1
- 102220615344 C-C chemokine receptor type 5_S17A_mutation Human genes 0.000 description 1
- 102220615339 C-C chemokine receptor type 5_T16A_mutation Human genes 0.000 description 1
- 239000002126 C01EB10 - Adenosine Substances 0.000 description 1
- 101150018129 CSF2 gene Proteins 0.000 description 1
- 101150069031 CSN2 gene Proteins 0.000 description 1
- 102220469886 CTP synthase 1_K100A_mutation Human genes 0.000 description 1
- 101000909256 Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) DNA polymerase I Proteins 0.000 description 1
- 241000589876 Campylobacter Species 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 102100025064 Cellular tumor antigen p53 Human genes 0.000 description 1
- 102220583068 Cellular tumor antigen p53_E28A_mutation Human genes 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 241000195628 Chlorophyta Species 0.000 description 1
- 101800004419 Cleaved form Proteins 0.000 description 1
- 108091026890 Coding region Proteins 0.000 description 1
- 241000186216 Corynebacterium Species 0.000 description 1
- 241000195493 Cryptophyta Species 0.000 description 1
- 101150074775 Csf1 gene Proteins 0.000 description 1
- 102220520885 DCN1-like protein 1_F15A_mutation Human genes 0.000 description 1
- 108091028709 DNA adenine Proteins 0.000 description 1
- 238000007400 DNA extraction Methods 0.000 description 1
- 238000007399 DNA isolation Methods 0.000 description 1
- 238000012270 DNA recombination Methods 0.000 description 1
- XULFJDKZVHTRLG-JDVCJPALSA-N DOSPA trifluoroacetate Chemical compound [O-]C(=O)C(F)(F)F.CCCCCCCC\C=C/CCCCCCCCOCC(C[N+](C)(C)CCNC(=O)C(CCCNCCCN)NCCCN)OCCCCCCCC\C=C/CCCCCCCC XULFJDKZVHTRLG-JDVCJPALSA-N 0.000 description 1
- 241000252212 Danio rerio Species 0.000 description 1
- 108010082610 Deoxyribonuclease (Pyrimidine Dimer) Proteins 0.000 description 1
- 102000004099 Deoxyribonuclease (Pyrimidine Dimer) Human genes 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 102220562239 Disintegrin and metalloproteinase domain-containing protein 11_F16P_mutation Human genes 0.000 description 1
- 241000255581 Drosophila <fruit fly, genus> Species 0.000 description 1
- 102000002322 Egg Proteins Human genes 0.000 description 1
- 108010000912 Egg Proteins Proteins 0.000 description 1
- 108010089760 Electron Transport Complex I Proteins 0.000 description 1
- 102000008013 Electron Transport Complex I Human genes 0.000 description 1
- 241000186394 Eubacterium Species 0.000 description 1
- 241000206602 Eukaryota Species 0.000 description 1
- 108700024394 Exon Proteins 0.000 description 1
- XZWYTXMRWQJBGX-VXBMVYAYSA-N FLAG peptide Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@@H](N)CC(O)=O)CC1=CC=C(O)C=C1 XZWYTXMRWQJBGX-VXBMVYAYSA-N 0.000 description 1
- 241000178967 Filifactor Species 0.000 description 1
- 241000589565 Flavobacterium Species 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 229940126656 GS-4224 Drugs 0.000 description 1
- 108091006057 GST-tagged proteins Proteins 0.000 description 1
- 241000032681 Gluconacetobacter Species 0.000 description 1
- 244000068988 Glycine max Species 0.000 description 1
- 235000010469 Glycine max Nutrition 0.000 description 1
- 229940121672 Glycosylation inhibitor Drugs 0.000 description 1
- 102220502351 Golgin subfamily A member 1_L5A_mutation Human genes 0.000 description 1
- 102220562003 HLA class I histocompatibility antigen, A alpha chain_Y3A_mutation Human genes 0.000 description 1
- 108091005904 Hemoglobin subunit beta Proteins 0.000 description 1
- 101000753741 Homo sapiens ATP synthase subunit a Proteins 0.000 description 1
- 101100438883 Homo sapiens CCR5 gene Proteins 0.000 description 1
- 101000616502 Homo sapiens Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 Proteins 0.000 description 1
- 101000755690 Homo sapiens Single-stranded DNA cytosine deaminase Proteins 0.000 description 1
- 206010020460 Human T-cell lymphotropic virus type I infection Diseases 0.000 description 1
- 241000714260 Human T-lymphotropic virus 1 Species 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 238000012404 In vitro experiment Methods 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-N L-arginine Chemical compound OC(=O)[C@@H](N)CCCN=C(N)N ODKSFYDXXFIFQN-BYPYZUCNSA-N 0.000 description 1
- 229930064664 L-arginine Natural products 0.000 description 1
- 235000014852 L-arginine Nutrition 0.000 description 1
- 241000186660 Lactobacillus Species 0.000 description 1
- 241000589248 Legionella Species 0.000 description 1
- 208000007764 Legionnaires' Disease Diseases 0.000 description 1
- 241000270322 Lepidosauria Species 0.000 description 1
- 239000006142 Luria-Bertani Agar Substances 0.000 description 1
- 208000007466 Male Infertility Diseases 0.000 description 1
- 206010052641 Mitochondrial DNA mutation Diseases 0.000 description 1
- 108010026155 Mitochondrial Proton-Translocating ATPases Proteins 0.000 description 1
- 102000013379 Mitochondrial Proton-Translocating ATPases Human genes 0.000 description 1
- 102220482801 Mitochondrial coenzyme A diphosphatase NUDT8_E92A_mutation Human genes 0.000 description 1
- 101710204192 Mitochondrial nuclease Proteins 0.000 description 1
- 108010042046 Mitochondrial processing peptidase Proteins 0.000 description 1
- 241000237852 Mollusca Species 0.000 description 1
- 102000016943 Muramidase Human genes 0.000 description 1
- 108010014251 Muramidase Proteins 0.000 description 1
- 101100219625 Mus musculus Casd1 gene Proteins 0.000 description 1
- KWYHDKDOAIKMQN-UHFFFAOYSA-N N,N,N',N'-tetramethylethylenediamine Chemical compound CN(C)CCN(C)C KWYHDKDOAIKMQN-UHFFFAOYSA-N 0.000 description 1
- 108010062010 N-Acetylmuramoyl-L-alanine Amidase Proteins 0.000 description 1
- 101710106577 NADH-ubiquinone oxidoreductase chain 5 Proteins 0.000 description 1
- 102220514244 NADH-ubiquinone oxidoreductase chain 6_V31A_mutation Human genes 0.000 description 1
- 101150102231 ND2 gene Proteins 0.000 description 1
- 101150100316 ND4 gene Proteins 0.000 description 1
- 241000588653 Neisseria Species 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- 101100385413 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) csm-3 gene Proteins 0.000 description 1
- 241000135938 Nitratifractor Species 0.000 description 1
- 102220567113 Ornithine decarboxylase antizyme 1_M57A_mutation Human genes 0.000 description 1
- 240000007594 Oryza sativa Species 0.000 description 1
- 235000007164 Oryza sativa Nutrition 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- 102220627452 Paired immunoglobulin-like type 2 receptor alpha_L95A_mutation Human genes 0.000 description 1
- 241001386753 Parvibaculum Species 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 229930182555 Penicillin Natural products 0.000 description 1
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 241000009328 Perro Species 0.000 description 1
- 241000251745 Petromyzon marinus Species 0.000 description 1
- 240000009164 Petroselinum crispum Species 0.000 description 1
- 206010057249 Phagocytosis Diseases 0.000 description 1
- 102100021797 Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 Human genes 0.000 description 1
- 108010060806 Photosystem II Protein Complex Proteins 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 101000902592 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) DNA polymerase Proteins 0.000 description 1
- 238000002123 RNA extraction Methods 0.000 description 1
- 230000006819 RNA synthesis Effects 0.000 description 1
- 102100026085 RNA-binding region-containing protein 3 Human genes 0.000 description 1
- 102220597494 RNA-binding region-containing protein 3_H33A_mutation Human genes 0.000 description 1
- 239000012980 RPMI-1640 medium Substances 0.000 description 1
- 102220507306 Rab11 family-interacting protein 1_K13A_mutation Human genes 0.000 description 1
- 102220507283 Rab11 family-interacting protein 1_K28A_mutation Human genes 0.000 description 1
- 102220507208 Rab11 family-interacting protein 1_M21A_mutation Human genes 0.000 description 1
- 102220507210 Rab11 family-interacting protein 1_V19A_mutation Human genes 0.000 description 1
- 102220567299 Rab3 GTPase-activating protein non-catalytic subunit_Y17A_mutation Human genes 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 101100047461 Rattus norvegicus Trpm8 gene Proteins 0.000 description 1
- 108091028664 Ribonucleotide Proteins 0.000 description 1
- 241000605947 Roseburia Species 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 102220527169 Sarcolipin_Y18A_mutation Human genes 0.000 description 1
- 102100022433 Single-stranded DNA cytosine deaminase Human genes 0.000 description 1
- 101710143275 Single-stranded DNA cytosine deaminase Proteins 0.000 description 1
- 241000191940 Staphylococcus Species 0.000 description 1
- 241000191967 Staphylococcus aureus Species 0.000 description 1
- 238000000692 Student's t-test Methods 0.000 description 1
- 108091027544 Subgenomic mRNA Proteins 0.000 description 1
- 206010042573 Superovulation Diseases 0.000 description 1
- 102100032891 Superoxide dismutase [Mn], mitochondrial Human genes 0.000 description 1
- 241000282898 Sus scrofa Species 0.000 description 1
- 241000123710 Sutterella Species 0.000 description 1
- 101710137500 T7 RNA polymerase Proteins 0.000 description 1
- 241000255588 Tephritidae Species 0.000 description 1
- 241000053227 Themus Species 0.000 description 1
- 102220567856 Thioredoxin domain-containing protein 11_I10A_mutation Human genes 0.000 description 1
- 108010022394 Threonine synthase Proteins 0.000 description 1
- 102220470366 Thymosin beta-10_F30A_mutation Human genes 0.000 description 1
- 102220536910 Transcription factor JunD_F32A_mutation Human genes 0.000 description 1
- 102220561788 Transcriptional repressor NF-X1_F20A_mutation Human genes 0.000 description 1
- 241000589886 Treponema Species 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 235000021307 Triticum Nutrition 0.000 description 1
- 244000098338 Triticum aestivum Species 0.000 description 1
- 108090000848 Ubiquitin Proteins 0.000 description 1
- 102000044159 Ubiquitin Human genes 0.000 description 1
- 108091093126 WHP Posttrascriptional Response Element Proteins 0.000 description 1
- 240000008042 Zea mays Species 0.000 description 1
- 235000005824 Zea mays ssp. parviglumis Nutrition 0.000 description 1
- 235000002017 Zea mays subsp mays Nutrition 0.000 description 1
- 102220634796 Zinc finger protein 268_V88A_mutation Human genes 0.000 description 1
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 1
- HMNZFMSWFCAGGW-XPWSMXQVSA-N [3-[hydroxy(2-hydroxyethoxy)phosphoryl]oxy-2-[(e)-octadec-9-enoyl]oxypropyl] (e)-octadec-9-enoate Chemical compound CCCCCCCC\C=C\CCCCCCCC(=O)OCC(COP(O)(=O)OCCO)OC(=O)CCCCCCC\C=C\CCCCCCCC HMNZFMSWFCAGGW-XPWSMXQVSA-N 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 229960005305 adenosine Drugs 0.000 description 1
- 239000011543 agarose gel Substances 0.000 description 1
- 238000000246 agarose gel electrophoresis Methods 0.000 description 1
- 230000002776 aggregation Effects 0.000 description 1
- 238000004220 aggregation Methods 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 230000006907 apoptotic process Effects 0.000 description 1
- 125000000637 arginyl group Chemical group N[C@@H](CCCNC(N)=N)C(=O)* 0.000 description 1
- 229940009098 aspartate Drugs 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- 230000002238 attenuated effect Effects 0.000 description 1
- 210000003050 axon Anatomy 0.000 description 1
- 239000013602 bacteriophage vector Substances 0.000 description 1
- 239000011324 bead Substances 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- DRTQHJPVMGBUCF-PSQAKQOGSA-N beta-L-uridine Natural products O[C@H]1[C@@H](O)[C@H](CO)O[C@@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-PSQAKQOGSA-N 0.000 description 1
- 230000000975 bioactive effect Effects 0.000 description 1
- 210000000988 bone and bone Anatomy 0.000 description 1
- 239000012888 bovine serum Substances 0.000 description 1
- 244000309466 calf Species 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 239000001569 carbon dioxide Substances 0.000 description 1
- 101150038500 cas9 gene Proteins 0.000 description 1
- 101150055766 cat gene Proteins 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 229920006317 cationic polymer Polymers 0.000 description 1
- 230000022131 cell cycle Effects 0.000 description 1
- 230000010261 cell growth Effects 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 230000004098 cellular respiration Effects 0.000 description 1
- 230000007541 cellular toxicity Effects 0.000 description 1
- 230000004700 cellular uptake Effects 0.000 description 1
- 210000000991 chicken egg Anatomy 0.000 description 1
- 230000008711 chromosomal rearrangement Effects 0.000 description 1
- 238000004590 computer program Methods 0.000 description 1
- 238000012790 confirmation Methods 0.000 description 1
- 101150055601 cops2 gene Proteins 0.000 description 1
- 235000005822 corn Nutrition 0.000 description 1
- 239000013601 cosmid vector Substances 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 210000000805 cytoplasm Anatomy 0.000 description 1
- 231100000433 cytotoxic Toxicity 0.000 description 1
- 230000001472 cytotoxic effect Effects 0.000 description 1
- 238000007405 data analysis Methods 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 210000001787 dendrite Anatomy 0.000 description 1
- 239000005547 deoxyribonucleotide Substances 0.000 description 1
- 125000002637 deoxyribonucleotide group Chemical group 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- 102000004419 dihydrofolate reductase Human genes 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- VHJLVAABSRFDPM-QWWZWVQMSA-N dithiothreitol Chemical compound SC[C@@H](O)[C@H](O)CS VHJLVAABSRFDPM-QWWZWVQMSA-N 0.000 description 1
- MOTZDAYCYVMXPC-UHFFFAOYSA-N dodecyl hydrogen sulfate Chemical compound CCCCCCCCCCCCOS(O)(=O)=O MOTZDAYCYVMXPC-UHFFFAOYSA-N 0.000 description 1
- 229940043264 dodecyl sulfate Drugs 0.000 description 1
- 231100000673 dose–response relationship Toxicity 0.000 description 1
- 235000014103 egg white Nutrition 0.000 description 1
- 238000010828 elution Methods 0.000 description 1
- 239000012149 elution buffer Substances 0.000 description 1
- 210000002308 embryonic cell Anatomy 0.000 description 1
- 230000012202 endocytosis Effects 0.000 description 1
- 210000001163 endosome Anatomy 0.000 description 1
- 230000009088 enzymatic function Effects 0.000 description 1
- 238000006911 enzymatic reaction Methods 0.000 description 1
- 241001233957 eudicotyledons Species 0.000 description 1
- 210000003608 fece Anatomy 0.000 description 1
- HJUFTIJOISQSKQ-UHFFFAOYSA-N fenoxycarb Chemical compound C1=CC(OCCNC(=O)OCC)=CC=C1OC1=CC=CC=C1 HJUFTIJOISQSKQ-UHFFFAOYSA-N 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 238000003198 gene knock in Methods 0.000 description 1
- 238000003209 gene knockout Methods 0.000 description 1
- 238000010457 gene scissor Methods 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 238000003205 genotyping method Methods 0.000 description 1
- 125000000291 glutamic acid group Chemical group N[C@@H](CCC(O)=O)C(=O)* 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 239000010931 gold Substances 0.000 description 1
- 229910052737 gold Inorganic materials 0.000 description 1
- 239000000833 heterodimer Substances 0.000 description 1
- 125000000487 histidyl group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C([H])=N1 0.000 description 1
- 238000002744 homologous recombination Methods 0.000 description 1
- 230000006801 homologous recombination Effects 0.000 description 1
- 230000002631 hypothermal effect Effects 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 230000002779 inactivation Effects 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 230000015788 innate immune response Effects 0.000 description 1
- 229940039696 lactobacillus Drugs 0.000 description 1
- 208000032839 leukemia Diseases 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 230000004777 loss-of-function mutation Effects 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 239000012139 lysis buffer Substances 0.000 description 1
- 229960000274 lysozyme Drugs 0.000 description 1
- 239000004325 lysozyme Substances 0.000 description 1
- 235000010335 lysozyme Nutrition 0.000 description 1
- 230000035800 maturation Effects 0.000 description 1
- 235000012054 meals Nutrition 0.000 description 1
- 238000002844 melting Methods 0.000 description 1
- 150000002734 metacrylic acid derivatives Chemical class 0.000 description 1
- 239000000693 micelle Substances 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 230000006705 mitochondrial oxidative phosphorylation Effects 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 238000010172 mouse model Methods 0.000 description 1
- 101150077280 mt-atp6 gene Proteins 0.000 description 1
- 230000036438 mutation frequency Effects 0.000 description 1
- 239000002071 nanotube Substances 0.000 description 1
- 229940042880 natural phospholipid Drugs 0.000 description 1
- 238000007857 nested PCR Methods 0.000 description 1
- 210000002569 neuron Anatomy 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 238000006386 neutralization reaction Methods 0.000 description 1
- 231100001083 no cytotoxicity Toxicity 0.000 description 1
- 230000001937 non-anti-biotic effect Effects 0.000 description 1
- 230000009871 nonspecific binding Effects 0.000 description 1
- 230000025308 nuclear transport Effects 0.000 description 1
- 238000005580 one pot reaction Methods 0.000 description 1
- 210000003101 oviduct Anatomy 0.000 description 1
- 210000000496 pancreas Anatomy 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 229940049954 penicillin Drugs 0.000 description 1
- 235000011197 perejil Nutrition 0.000 description 1
- 230000008782 phagocytosis Effects 0.000 description 1
- 239000002953 phosphate buffered saline Substances 0.000 description 1
- WTJKGGKOPKCXLL-RRHRGVEJSA-N phosphatidylcholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCC=CCCCCCCCC WTJKGGKOPKCXLL-RRHRGVEJSA-N 0.000 description 1
- 150000003904 phospholipids Chemical class 0.000 description 1
- 230000000243 photosynthetic effect Effects 0.000 description 1
- 244000000003 plant pathogen Species 0.000 description 1
- 229920000083 poly(allylamine) Polymers 0.000 description 1
- 108010056869 poly(ethylene glycol)-poly(N'-(N-(2-aminoethyl)-2-aminoethyl)aspartamide) block copolymer Proteins 0.000 description 1
- 229920002401 polyacrylamide Polymers 0.000 description 1
- 238000002264 polyacrylamide gel electrophoresis Methods 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 235000019833 protease Nutrition 0.000 description 1
- 238000002331 protein detection Methods 0.000 description 1
- 108020001580 protein domains Proteins 0.000 description 1
- 230000004853 protein function Effects 0.000 description 1
- 238000001243 protein synthesis Methods 0.000 description 1
- 102000005962 receptors Human genes 0.000 description 1
- 108020003175 receptors Proteins 0.000 description 1
- 230000003362 replicative effect Effects 0.000 description 1
- 230000035806 respiratory chain Effects 0.000 description 1
- 230000001177 retroviral effect Effects 0.000 description 1
- 239000002336 ribonucleotide Substances 0.000 description 1
- 125000002652 ribonucleotide group Chemical group 0.000 description 1
- 108090000850 ribosomal protein S14 Proteins 0.000 description 1
- 210000004708 ribosome subunit Anatomy 0.000 description 1
- 235000009566 rice Nutrition 0.000 description 1
- 238000005096 rolling process Methods 0.000 description 1
- 102220213553 rs1026192345 Human genes 0.000 description 1
- 102220011712 rs146176004 Human genes 0.000 description 1
- 102220309539 rs1553218779 Human genes 0.000 description 1
- 102220287867 rs1555618738 Human genes 0.000 description 1
- 102200097289 rs199472830 Human genes 0.000 description 1
- 102200048773 rs2224391 Human genes 0.000 description 1
- 102200150982 rs28939717 Human genes 0.000 description 1
- 102200102378 rs387906638 Human genes 0.000 description 1
- 102200011361 rs727502767 Human genes 0.000 description 1
- 102220279444 rs988441570 Human genes 0.000 description 1
- 210000003296 saliva Anatomy 0.000 description 1
- 239000012679 serum free medium Substances 0.000 description 1
- 230000005783 single-strand break Effects 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 210000001082 somatic cell Anatomy 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 230000006641 stabilisation Effects 0.000 description 1
- 238000011105 stabilization Methods 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 230000001954 sterilising effect Effects 0.000 description 1
- 238000004659 sterilization and disinfection Methods 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 108010045815 superoxide dismutase 2 Proteins 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 208000011580 syndromic disease Diseases 0.000 description 1
- 101710199622 tRNA-specific adenosine deaminase Proteins 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 125000000341 threoninyl group Chemical group [H]OC([H])(C([H])([H])[H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 231100000167 toxic agent Toxicity 0.000 description 1
- 239000003440 toxic substance Substances 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 230000001131 transforming effect Effects 0.000 description 1
- 230000007704 transition Effects 0.000 description 1
- 230000005945 translocation Effects 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- GPRLSGONYQIRFK-MNYXATJNSA-N triton Chemical compound [3H+] GPRLSGONYQIRFK-MNYXATJNSA-N 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- DRTQHJPVMGBUCF-UHFFFAOYSA-N uracil arabinoside Natural products OC1C(O)C(CO)OC1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-UHFFFAOYSA-N 0.000 description 1
- 229940045145 uridine Drugs 0.000 description 1
- 210000002700 urine Anatomy 0.000 description 1
- 239000011534 wash buffer Substances 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
- C12N15/102—Mutagenizing nucleic acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
- C12N9/22—Ribonucleases RNAses, DNAses
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/87—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
- C12N15/90—Stable introduction of foreign DNA into chromosome
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/78—Hydrolases (3) acting on carbon to nitrogen bonds other than peptide bonds (3.5)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/005—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/07—Fusion polypeptide containing a localisation/targetting motif containing a mitochondrial localisation signal
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/08—Fusion polypeptide containing a localisation/targetting motif containing a chloroplast localisation signal
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/09—Fusion polypeptide containing a localisation/targetting motif containing a nuclear localisation signal
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/095—Fusion polypeptide containing a localisation/targetting motif containing a nuclear export signal
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/80—Fusion polypeptide containing a DNA binding domain, e.g. Lacl or Tet-repressor
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/80—Fusion polypeptide containing a DNA binding domain, e.g. Lacl or Tet-repressor
- C07K2319/81—Fusion polypeptide containing a DNA binding domain, e.g. Lacl or Tet-repressor containing a Zn-finger domain for DNA binding
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/20—Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPRs]
Definitions
- the present invention relates to an isolated form of cytosine or adenine deaminase or a variant thereof, a non-toxic full-length cytosine deaminase or a variant thereof, a fusion protein comprising the same, a composition for base correction, and a method for base correction using the same. .
- Fusion proteins in which DNA binding proteins and deaminases are linked do not produce DNA double-strand breaks (DSBs), but target nucleotide substitutions or base editing in the genome, correct point mutations that cause genetic disorders, or prokaryotic cells , enabling single nucleotide conversion in a targeted manner to introduce desired single nucleotide mutations into humans and other eukaryotic cells.
- DLBs DNA double-strand breaks
- nucleases such as CRISPR-Cas9, which induce small insertions or deletions (indels) at the target site, it converts a single base within a window of several nucleotides at the target site.
- point mutations that cause genetic diseases can be corrected or single nucleotide polymorphisms (SNPs) can be generated in cultured cells, animals and plants.
- dCas9 catalytically-deficient Cas9
- nCas9 D10A Cas9 nickase
- BEs pyogenes and a rat cytosine deaminase Base Editors (BEs), including rAPOBEC1; 2) Target-AID comprising dCas9 or nCas9 and PmCDA1 or human AID, which is an activation-induced cytidine deaminase (AID) ortholog of sea lamprey; 3) CRISPR-X comprising sgRNAs and dCas9 linked to MS2 RNA hairpins to recruit overactivated AID variants fused to MS2-binding protein, and the like can be exemplified.
- BEs rAPOBEC1
- Target-AID comprising dCas9 or nCas9 and PmCDA1 or human AID, which is an activation-induced cytidine deaminase (AID) ortholog of sea lamprey
- CRISPR-X comprising sgRNAs and dCas9 linked to MS2 RNA hairpin
- ZFN zinc-finger nuclease
- TALEN transcription activator-like effector nuclease
- CRISPR clustered regularly interspaced short palindromic repeat
- Cas9 CRISPR-associated protein 9 mutant and base deaminase that lack nucleolysis efficiency
- Programs such as protein base correction technology
- Genome editing tools have been developed for genetic research of plants and improvement of crop traits through nucleotide sequence changes. However, these tools are not suitable for correcting the DNA sequence of plant organelles, including mitochondria and chloroplasts, primarily because of the difficulty in delivering guide RNAs to organelles or expressing both compounds simultaneously in organelles. Plant organelles encode several essential genes required for photosynthesis and respiration.
- a method or tool for correcting the gene of these organelles is very necessary for the study of the function of these genes or the improvement of crop productivity and traits.
- targeted mutations in the mitochondrial atp6 gene can lead to male infertility, a trait useful for reproduction, and specific point mutations in the 16S rRNA gene in the chloroplast genome can lead to antibiotic resistance.
- Bacterial toxin DddA tox is an enzymatic function of a bacterial toxin derived from Burkholderia cenocepacia , and can deaminate cytosine in double-stranded DNA.
- DddA tox is toxic to cells, so to avoid toxicity in the host cell, DddA tox is divided into two inactivated splits, each of which is capable of binding to DNA. It can be used as a functional DdCBE pair by linking to a DNA binding protein designed to be used.
- this enzymatic reaction of deamination is activated only when two inactivated halves exist close to the target DNA by the DNA-binding protein. Therefore, cytosine to thymine base correction occurs in the middle of the two DNA binding protein binding sites.
- Two inactive forms bound to a TALE (transcription activator-like effector) array as a DNA binding protein have a function when bound to a target DNA by TALE in the vicinity. Base conversion from cytosine to thymine is induced in the region between 14 and 18 bases between the two TALE binding sites.
- the split form DddA tox divided into two is subject to many limitations in the experiment.
- the full-length DddA tox cannot be cloned using general E. coli because of its toxicity, and is cloned using E. coli that also expresses an immunity gene that interferes with toxicity.
- mitochondrial DNA plays a very important role in cellular respiration, which is accomplished through the mitochondrial oxidative phosphorylation (OXPHOS) mechanism. Because the OXPHOS mechanism is essential for survival, mutations in mitochondrial DNA can cause severe dysfunction in many organs or muscles, such as high-energy-demanding tissues.
- OXPHOS mitochondrial oxidative phosphorylation
- normal mitochondrial DNA and mitochondrial DNA with single base mutations coexist, which causes a numerical heterogeneity of mitochondrial DNA (heteroplasmy).
- the balance of mutation and normal mitochondrial DNA determines the development of clinically symptomatic mitochondrial disease.
- programmable nucleases were used in a way that cuts mutant mitochondrial DNA and does not remove normal mitochondrial DNA. However, these nucleases cannot introduce or reverse specific mutations into mitochondria, probably because double-strand breaks of DNA in mitochondria are not efficiently repaired through heterologous end splicing or homologous recombination as in the nucleus.
- Mitochondrial base correction can help create models for various diseases that have not been tried before, or create therapeutic agents to treat them. In this respect, the need for the development of highly efficient mitochondrial base editing enzymes is increasing.
- the desired CBE cytosine base editor
- ABE adenine base editor
- An object of the present invention is to provide a fusion protein comprising a DNA binding protein, an isolated form of a cytosine or adenine deaminase or a variant thereof, a non-toxic full-length cytosine deaminase or a variant thereof.
- the present invention provides (i) a DNA binding protein; And (ii) a fusion protein comprising a first fragment and a second fragment derived from cytosine deaminase or a variant thereof, wherein the first fragment and the second fragment are each bound to the DNA-binding protein It provides a fusion protein in a form that can be
- the present invention relates to (i) a DNA binding protein; And (ii) provides a fusion protein comprising a cytosine deaminase or a non-toxic full-length cytosine deaminase derived from a variant thereof.
- the present invention relates to (i) a DNA binding protein; (ii) cytosine deaminase or a variant thereof; And (iii) a fusion protein comprising an adenine deaminase, wherein the cytosine deaminase or a variant thereof is (a) a non-toxic full-length cytosine deaminase or (b) a first fragment derived from a cytosine deaminase or a variant thereof It provides a fusion protein comprising a sieve and a second fragment, wherein the first fragment and the second fragment are each bound to the DNA-binding protein.
- the present invention provides a nucleic acid encoding the fusion protein.
- the present invention provides a composition for base correction comprising the fusion protein or nucleic acid.
- the present invention provides a composition for correcting a eukaryotic base comprising the fusion protein or nucleic acid.
- the present invention also provides the fusion protein or nucleic acid; And NLS (nuclear localization signal) provides a composition for base correction of plant cells comprising a peptide or a nucleic acid encoding the same.
- the present invention also provides the fusion protein or nucleic acid; And chloroplast transit peptide (chloroplast transit peptide) or provides a composition for plant cell base correction comprising a nucleic acid encoding the same.
- the present invention also provides the fusion protein or nucleic acid; and Mitochondrial Targeting Signal (MTS) or a nucleic acid encoding the same. It provides a composition for editing plant cell bases.
- MTS Mitochondrial Targeting Signal
- the present invention also provides an extranuclear transport signal protein or a composition for correcting plant cell bases, further comprising a nucleic acid encoding the same.
- the present invention also provides a plant cell base correction method comprising the step of treating plant cells with the composition.
- the present invention also provides the fusion protein or nucleic acid; and NLS (nuclear localization signal) peptide or a nucleic acid encoding the same to plant cells.
- the present invention also provides the fusion protein or nucleic acid; and chloroplast transit peptide (chloroplast transit peptide) or a nucleic acid encoding the same in plant cells.
- the present invention also provides the fusion protein or nucleic acid; and Mitochondrial Targeting Signal (MTS) or a nucleic acid encoding the same in plant cells.
- MTS Mitochondrial Targeting Signal
- the present invention also provides the fusion protein or nucleic acid; and NLS (nuclear localization signal) peptide or a nucleic acid encoding the same.
- the present invention also provides the fusion protein or nucleic acid; and mitochondrial targeting signal (MTS) or a nucleic acid encoding the same.
- MTS mitochondrial targeting signal
- the present invention also provides a composition for correcting the base of animal cells, optionally further comprising an extranuclear transport signal protein or a nucleic acid encoding the same.
- the present invention also provides an animal cell base correction method comprising the step of treating the animal cells with the composition.
- the present invention also provides the fusion protein or nucleic acid; and NLS (nuclear localization signal) peptide or a nucleic acid encoding the same, to the animal cells.
- the present invention also provides the fusion protein or nucleic acid; and mitochondrial targeting signal (MTS) or a nucleic acid encoding the same, to the animal cells.
- MTS mitochondrial targeting signal
- the present invention also provides a composition for A-to-G base correction in prokaryotic or eukaryotic cells comprising the fusion protein or a nucleic acid encoding the fusion protein, wherein the DNA binding protein is a zinc finger protein, a TALE protein Or CRISPR-associated nuclease, the cytosine deaminase of the fusion protein or a variant thereof is derived from bacteria, and provides a composition characterized in that it is specific for double-stranded DNA.
- the present invention also provides a composition for A-to-G base correction in prokaryotic or eukaryotic cells comprising the fusion protein or a nucleic acid encoding the fusion protein, wherein the DNA binding protein is a zinc finger protein, a TALE protein or CRISPR-associated nuclease, wherein the cytosine deaminase or variant thereof of the fusion protein is of bacterial origin and is specific for double-stranded DNA, and a DNA binding protein is bound to the N-terminus of the cytosine deaminase or variant thereof, and , It provides a composition in which a DNA-binding protein is bound to the C-terminus of the adenine deaminase of the fusion protein.
- the present invention also provides a composition for C-to-T base correction in prokaryotic or eukaryotic cells comprising the fusion protein or a nucleic acid encoding it and UGI (uracil glycosylase inhibitor), wherein the DNA binding protein is a zinc pinker protein ( zinc finger protein), TALE protein, or CRISPR-associated nuclease, the cytosine deaminase or variant thereof of the fusion protein is a full-length non-toxic cytosine deaminase, and the cytosine deaminase or variant thereof of the fusion protein is derived from bacteria and provides a composition characterized in that it is double-stranded DNA-specific.
- UGI uracil glycosylase inhibitor
- the present invention also provides a composition for C-to-T base correction in prokaryotic or eukaryotic cells comprising the fusion protein or a nucleic acid encoding it and UGI (uracil glycosylase inhibitor), wherein the DNA binding protein is a zinc pinker protein ( zinc finger protein), TALE protein, or CRISPR-associated nuclease, and the cytosine deaminase or variant thereof of the fusion protein is a split cytosine deaminase comprising a first fragment and a second fragment, and the The cytosine deaminase or variant thereof is of bacterial origin and provides a composition characterized in that it is double-stranded DNA-specific.
- UGI uracil glycosylase inhibitor
- the present invention also provides an A-to-G base correction method in a prokaryotic or eukaryotic cell comprising the step of treating the fusion protein or a nucleic acid encoding the same in the prokaryotic or eukaryotic cell, wherein the DNA-binding protein is a zinc pinker It is a zinc finger protein, a TALE protein, or a CRISPR-associated nuclease, and the cytosine deaminase of the fusion protein or a variant thereof is derived from bacteria, and provides a method characterized in that it is specific for double-stranded DNA.
- the present invention also provides an A-to-G base correction method in a prokaryotic or eukaryotic cell comprising the step of treating the fusion protein or a nucleic acid encoding the same in the prokaryotic or eukaryotic cell, wherein the DNA-binding protein is a zinc pinker a protein (zinc finger protein), a TALE protein, or a CRISPR-associated nuclease,
- the DNA-binding protein is a zinc pinker a protein (zinc finger protein), a TALE protein, or a CRISPR-associated nuclease
- the cytosine deaminase or variant thereof of the fusion protein is of bacterial origin and is specific to double-stranded DNA
- It provides a method in which a DNA-binding protein is bound to the N-terminus of the cytosine deaminase or a variant thereof, and the DNA-binding protein is bound to the C-terminus of the adenine deaminase of the fusion protein.
- the present invention also provides a C-to-T base correction method in a prokaryotic or eukaryotic cell comprising the step of treating the fusion protein or a nucleic acid encoding the same and UGI (uracil glycosylase inhibitor) to the prokaryotic or eukaryotic cell, wherein the
- the DNA binding protein is a zinc finger protein, a TALE protein, or a CRISPR-associated nuclease, and the cytosine deaminase or a variant thereof of the fusion protein is derived from bacteria and is double-stranded DNA-specific. to provide.
- the Split-DddAtox half is fused to the C terminus of Zinc Finger Protein (C type).
- C type Zinc Finger Protein
- the pTarget plasmid contains a spacer ranging in size from 1 to 24 bp (indicated in red) and a region of a ZFP DNA binding site (indicated in green).
- the ZFD structure contains AA linkers of varying lengths (shown in yellow and orange) and different DddAtox cleavage sites and orientations (shown in blue).
- c-d ZFD activity was measured at the target site of the pTarget library to investigate the influence of the variables described in (b).
- ZFD pairs with linkers of the same (c) or different (d) lengths in the left and right ZFDs were tested.
- Figure 2 shows the results of confirming the ZFD efficiency having various linkers in the pTarget plasmid.
- a Frequency of corrections from C/G to non-C/G in various pTarget spacers with lengths of 1-24 bps depicted in the heat map.
- Various ZFD constructs were tested, including different types of linkers between ZFP and cleaved DddAtox and the cleaved region of DddAtox.
- b Overall activity of each ZFD pair. In the nomenclature used for the x-axis, the left ZFD is shown at the bottom and the right ZFD is shown at the top.
- a Structure of the nuclear DNA target ZFD.
- Split-DddAtox halves are fused to the C terminus (C type) or N terminus (N type) of ZFP.
- a ZFD pair is designed in CC or NC configuration, and consists of a C-type left ZFD and C-right ZFD or N-type left ZFD and C-right ZFD, respectively.
- cf Efficiency of ZFD-induced nucleotide correction at each nucleotide position within the spacer of NUMBL (c), INPP5D-2 (d), TRAC-CC (e) and TRAC-NC (f) target sites in HEK 293T cells.
- g Frequency of ZFD-induced base correction in K562 cells after delivery of ZFD protein or ZFD-encoding plasmid by electroporation or direct delivery. ZFD proteins with one or four NLSs were tested and left and right ZFDs were used equimolar. The electroporation method was performed using an Amaxa 4D-Nucleofector.
- K562 cells were incubated with cell media containing left and right ZFD proteins. Cells were treated once (1x) or twice (2x) in the same manner.
- FIG. 5 is a schematic diagram showing the configuration of a ZFD targeting nuclear DNA. a-d, four possible ZFD configurations.
- the NC and CN configurations are structurally identical, but the types of left and right ZFD configurations are different.
- Red arrows indicate possible sites for ZFD-induced deamination.
- c ZFD activity overview for PCR amplicons containing TRAC sites.
- the TRAC-NC ZFD pair first deaminates cytosine to generate uracil (shown in red). The USER enzyme then cleaves uracil to create a cleft (indicated by a red triangle).
- d Untreated PCR amplicons analyzed by agarose gel electrophoresis (left) and PCR amplicons treated with ZFD pairs (right).
- FIG. 8 is a schematic diagram of various configurations of the mitochondrial DNA target ZFD. a-d, four possible mitoZFD configurations.
- the NLS of the existing ZFD has been replaced by MTS and NES.
- the NC and CN configurations are structurally identical, but the types of left and right ZFD configurations are different.
- h Comparison of DNA changes and amino acid changes in the ND1 gene introduced by mitoZFD and TALE-DdCBE. The frequency (%) of sequencing reads for each mutant allele was determined by targeted deep sequencing. The spacer regions for the ZFD pair and TALE-DdCBE pair are indicated by blue dashed lines.
- Single cell-derived clones were obtained for allele analysis. The frequency of C/G-to-non-C/G corrections in each single cell-derived clone was determined by targeted deep sequencing.
- a Single cell-derived clone of HEK 293T cell population treated with ND1 target mitoZFD.
- b Single cell-derived clone of HEK 293T cell population treated with ND2 target mitoZFD.
- c Single cell-derived clone of an untreated HEK 293T cell population. ZFP binding sites are shown in green. Higher calibration frequencies of clones that underwent mitoZFD-induced calibration are shown in red.
- FIG. 11 shows the results of confirming the nucleotide correction efficiency of a single cell-derived clone population isolated from MT-ZFD-treated HEK293T cells.
- 12A and 12B show the results of confirming the nucleotide correction efficiency of a single cell-derived clone population isolated from MT-ZFD-treated HEK293T cells. Allelic analysis of single cell-derived clones showing high frequency of base corrections. The table shows the amino acids changed as a result of base correction in ND2. Red letters in the reference sequence at the top indicate spacers. Red letters in alleles indicate changes in the amino acid sequence.
- a DNA sequences of the binding regions of mitoZFD and TALE-DdCBE pairs. Sites recognized by TALE-DdCBE are highlighted in green and blue for mitoZFD. The upper sequence represents the mtDNA heavy strand and the lower sequence represents the mtDNA light strand.
- c Heat map of nucleotide correction activity at each nucleotide position. Red boxes indicate spacer regions for each configuration. Blue arrows indicate the location of mtDNA.
- FIG. 15 shows the results of confirming the calibration efficiency according to the ZFD concentration, mRNA vs Plasmid.
- a The top figure shows ZFD binding at the ND1 site. ZFD binding sites are shown in green. The target cytosine between the spacers is shown in red.
- On-target activity determined from total mtDNA sequencing data in FIG. 14 . Activity decreases as the amount of plasmid or mRNA encoding the transfected mitoZFD decreases.
- b Number of C/G sites corrected with a frequency of > 1% for each plasmid or mRNA amount.
- a The top figure shows ZFD binding at the ND2 site. ZFD binding sites are shown in green. The target cytosine between the spacers is shown in red.
- On-target activity determined from total mtDNA sequencing data in FIG. 16 . Activity decreases as the amount of plasmid or mRNA encoding the transfected mitoZFD decreases.
- b Number of C/G sites that are base corrected with a frequency of > 1% for each plasmid or mRNA amount.
- Figure 18 shows the results of confirming the efficiency of the entire mitochondrial sequencing / QQ mutant production and calibration.
- QQ mitoZFD variants contain R(-5)Q mutations in each zinc finger of ZFD to eliminate non-specific DNA contacts. (If there is no R at position -5 of the zinc finger framework, a nearby K or R is converted to Q.)
- c-d proofreading efficiency and specificity depended on the delivered dose of ZFD-encoding mRNA.
- c Average C/G-to-T/A correction frequency for all C/Gs of the mitochondrial genome.
- d Number of corrected C/Gs with base correction frequencies greater than 1%.
- FIG. 20 Chloroplast and mitochondrial base correction of plants.
- a, b, c, d chloroplast base correction frequency and pattern induced by cp-DdCBE in 16s rDNA (a, b) and psbA (c, d).
- Split DdCBE G1333 and G1397 pairs were transfected into lettuce and rape protoplasts.
- e Mitochondrial base correction efficiency and pattern induced by mt-DdCBE in fATP6 gene.
- Split DdCBE G1333 and G1397 pairs were transfected into lettuce and rape protoplasts.
- a, c, e the TALE binding region is shown in blue, the cytosine of the spacer is shown in orange. Error bars in all graphs show mean ⁇ standard deviation. 3 independent biological replicates.
- b, d, f converted nucleotides are shown in red. Corrected allele % (mean ⁇ standard deviation) was obtained
- FIG. 21 Plant organ DNA correction via DdCBE.
- a Schematic diagram of plant organ mutagenesis.
- b Efficiency for C G to T A conversion in cp-DdCBE transfected calli cultured in the absence of spectinomycin, including representative Sanger sequencing chromatograms. Converted nucleotides are marked in red to the left. Arrows show substituted nucleotides in the chromatogram.
- c Summary of DdCBE-driven plant organ mutagenesis. Variant callus appears to have a much higher frequency of corrections than that in simulated callus.
- d Frequency of C to T transformation induced after transfection of lettuce protoplasts with mRNA encoding cp-DdCBE against 16srDNA.
- FIG. 22 Chloroplast and mitochondrial base correction strategy. Since chloroplast transit peptide (CTP) or mitochondrial targeting signal (MTS) is included in each of the cp-DdCBE and mt-DdCBE preproteins (preproteins), they are translated in plant cells and then transported to chloroplasts and mitochondria. Proproteins pass through the outer and inner membranes of organelles, and CTP and MTS are cleaved by interstitial processing peptidase and mitochondrial processing peptidase, respectively, followed by cp-DdCBE and mt-DdCBE (mature protein) form the final conformation.
- CTP chloroplast transit peptide
- MTS mitochondrial targeting signal
- FIG. 23 Time course for correction via DdCBE plasmid in lettuce protoplasts. Transfected protoplasts were collected at each time point and analyzed for proofreading efficiency by targeted deep sequencing. Frequency (mean ⁇ standard deviation) was obtained from 3 independent experiments.
- Figure 26 Efficiency of base editing targeting the chloroplast genome in callus.
- Converted nucleotides in the spacer region are marked in red.
- Figure 28 DNA-free base correction. Frequency and pattern of chloroplast base correction at target sites in 16srDNA after DdCBE mRNA transfection into lettuce protoplasts. After culturing the protoplasts for 7 days, target deep sequencing was performed. The transformed nucleotides of the spacer region of interest are marked in red.
- 29 shows the results of gel electrophoresis showing the absence of DdCBE mRNA or DNA sequences in protoplasts and callus (M is a marker).
- Figure 30 16 srDNA mutation selection. Red arrows show streptomycin-resistant green callus.
- FIG 32 Off-target activity analysis at the 5 sites with the highest homology to the on-target site.
- Five potential off-target sites of the 16s rRNA gene-specific DdCBE of the lettuce chloroplast genome were selected, including up to nine mismatches in the TALE binding site.
- TALE binding sequences and mismatched nucleotides are indicated in blue and red, respectively.
- Off-target mutation frequencies were measured in protoplasts and drug-resistant calli or suits transfected with DdCBE plasmids or DdCBE mRNA using target dip sequences. Frequency (mean ⁇ standard deviation) was obtained from 3 independent experiments.
- FIG. 33 Schematic diagram of DdCBE assembly and mitochondrial DNA correction.
- the TALE binding site is shown in gray, and the base correction range is shown in black.
- Each repeat variable directory module is shown in orange, blue, green and yellow, in order: adenine “NI”, thymine “NG”, guanine “NN”, and “HD” for cytosine recognition.
- Figure 34 Mouse mitochondrial ND5 point mutation resulting from base correction due to DdCBE.
- translation codons are underlined and editable regions are marked in red.
- Combinations for DdCBE transfection are marked left or right, -G1333 or -G1397, and -N or -C.
- Sequence analysis data were obtained from blastocysts developed from zygotes microinjected with left-G1397-N and right-G1397-C DdCBE mRNA.
- Targeted deep sequencing was performed by extracting genomic DNA from tissues obtained from the tail region obtained immediately after birth and from the toes 7 days and 14 days after birth. Corrected bases are marked in red. The frequency of correction of the mutant mitochondrial genome was indicated.
- dark gray bars and light gray bars represent the correction frequencies of m.C12539T(C10) and m.G12542A(C13) mutations, respectively.
- FIG. 35 Transmission of mutant mitochondrial DNA into germ cells.
- b Base correction efficiency in various tissues of F1 pups (101) obtained using targeted deep sequencing of genomic DNA. Dark and light gray bars indicate the frequency of m.C12539T (C10) and m.G12542A (C13) mutations, respectively. Error bars are standard error of the mean (s.e.m.) for n 3 biologically independent samples.
- FIG. 36 Mouse mitochondrial ND5 G12918A mutation produced by DdCBE.
- a DdCBE target to make the m.G12918A point mutation causing a D393N change in the ND5 protein.
- Target codons are underlined and possible correction sites are shown in red.
- b Efficiency of cytosine-thymine base correction using DdCBE in NIH3T3 cells. Combinations of transfected DdCBE pairs are indicated. Error bars are s.e.m. n for 3 biologically independent samples (n.s. not significant, *p ⁇ 0.05, **p ⁇ 0.01, using Student’s two-tailed t test).
- F0 ND5 point mutations
- F0 pups carrying an ND5 point mutation that developed after microinjection of DdCBE mRNA Mutant sequence alignment identified in newborn pups. Corrected bases are indicated in red, and the correction frequency of the mutant mitochondrial gene is indicated on the right.
- FIG. 37 Mouse mitochondrial ND5 nonsense mutations generated via cytosine deaminase-mediated base correction.
- the m.C12336T(C9) mutation produces a Q199stop mutation in the ND5 protein, whereas the m. G12341A (C14) causes a silent Q200Q mutation.
- Transcription triplets are underlined and possible correction positions are indicated in red.
- FIG 38 Schematic diagram of Golden Gate cloning generating DdCBE structures. All reactions occur simultaneously in one tube. Arrows do not indicate a continuous reaction process.
- the empty expression vector and the modular vector were digested using the BsaI enzyme to remove the linearized backbone and TALE module insert, including compatible aggregation ends.
- T4 DNA ligase joined the backbone and six modular inserts to create the final DdCBE structure. Eight DdCBE replicating backbone plasmids were used. For SOD2MTS, these are Left-G1333-N, Left-G1333-C, Left-G1397-N, Left-G1397-C. For COX8A MTS, these are Right-G1333-N, Right-G1333-C, Right-G1397-N, and Right-G1397-C.
- FIG 39 ND5 mutant mice (F0). (a) ND5 silent mutant mice, (b) ND5 G12918A mutant mice, (c) ND5 nonsense mutant mice generated after microinjection of DdCBEmRNA.
- Fig. 40 (a) Schematic diagram and NES sequence of a vector containing DdCBE-NES. (b) Mouse m.G12918 ND5 gene and ND5-like sequence of chromosome 4 in the nucleus. Chromosome 5 sequence in mitochondrial TrnA and nucleus. Chromosome 6 sequence in mitochondrial Rnr2 and nucleus. (c) Calibration efficiency in the ND5 gene of DdCBE and DdCBE-NES using the NIH3T3 cell line. (d) Calibration efficiency in the TrnA gene of DdCBE and DdCBE-NES using the NIH3T3 cell line.
- Figure 41 Improved proofreading efficiency in mouse embryos and subjects using DdCBE-NES and mitoTALEN.
- FIG. 42 (a) Schematic diagram of DdCBE protein improvement.
- FIG 43 (a) Graph of the base correction efficiency of the G1397 binding surface mutant. The calibration range and target cytosine are indicated above. Mutant and wild-type/TALE-free DddAtox proteins were co-transfected as indicated next. In the case of Left-DdCBE, the TALE-free DddAtox protein is G1397-N, and in the case of Right-DdCBE, the TALE-free DddAtox protein is G1397-C. (b) A heat map indicating the cytosine-thymine (guanine-adenine) base correction efficiency of DdCBE and the mutant.
- FIG. 44 (a) G1333 binding surface mutant base correction efficiency graph. The calibration range and target cytosine are indicated above. Mutant and wild-type/TALE-free DddAtox proteins were co-transfected as indicated next. In the case of Left-DdCBE, the TALE-free DddAtox protein is G1333-N, and in the case of Right-DdCBE, the TALE-free DddAtox protein is G1333-C. (b) A heat map indicating the cytosine-thymine (guanine-adenine) base correction efficiency of DdCBE and the mutant.
- Figure 45 shows the comparison result of the amino acid sequence of the wild type and novel full-length DddA.
- FIG. 47 shows the results of confirming the activity of replacing thymine with cytosine of the TC motif in human cell genomic context ROR1 site (a), HEK3 site (b), and TYRO3 site (c).
- Figure 50 is DddA-dCas9 (D10A, H840A)-UGI using human cell genomic context TYRO3 (a), ROR1 (b), HEK3 (c), EMX1 site 2 (d), TRAC site 1 (e), HBB ( f) shows the results of measuring the activity of DddA.
- FIG. 51 Base editing efficiency of full-length DddAtox in HEK293T cells.
- (a) Schematic of screening full-length DddAtox in a structure-based manner. Red alanine indicates that positively charged amino acid residues have been replaced by alanine.
- (b) E. coli transformants of the DddA mutant substituted with alanine were shown, and E1347A was used as an active site mutant as a control.
- (d) Allele frequencies of the TYRO3 region indicate C to T substitutions in red. Proto-spacer is shown in blue and proto-spacer adjacent motif (PAM) is shown in orange.
- PAM proto-spacer adjacent motif
- Non-toxic DddA GSVG (a) Schematic of the screening of non-toxic full-length DddAtox variants based on error-prone PCR. (b) and allele (c) correction frequencies fused to the N- and C-terminus of Cas9, nCas9 (D10A), nCas9 (H840A) and dCas9 (D10A, H840A).
- the protospacer is shown in blue and the protospacer adjacent motif (PAM) is shown in orange.
- Figure 53 Correction frequency at the N-terminus of nCas9 (D10A) in DddAtox variants in which positively charged amino acid residues are substituted with alanine at the TYRO3 site (a), ROR1 site 1 (b), and HEK3 site (c).
- Proto-spacer is shown in blue and proto-spacer adjacent motif (PAM) is shown in orange.
- FIG 54 ROR1 site 1 (a), ROR1 site 2 (b), ROR1 site 3 (c), FANCF site (d), HBB site (e), HEK3 site (f), TRAC5 site 1 (g) and EMX1 Sites (h, I, j) are respectively.
- Proto-spacer is shown in blue and proto-spacer adjacent motif (PAM) is shown in orange. Substitutions from C to T are shown in red.
- the target window of DddA is negative, counting proto spacer 5' upstream.
- FIG. 55 TYRO3 site (a), ROR1 site 1 (b), ROR1 site 2 (c), ROR1 site 3 (d), FANCF site (e), HBB site (f), HEK3 of AAAAA and E1347A in HeLa cells.
- the protospacer is shown in blue and the protospacer adjacent motif (PAM) is shown in orange.
- DddA's target window is counted as proto-spacer 5' upstream and expressed as a negative number.
- Target cytosine is shown in red.
- Figure 56 Time-dependent base correction and indel rates of AAAAA and E1347A at TYRO3 site (a) and ROR1 site 1 (b).
- FIG. 57 EMX1 site 2 (a), FANCF site (b), TRAC5 site 1 (c), TRAC5 site 2 (d), ROR1 site 1 (e), ROR1 site 2 (f), ROR1 site 3 (g) and correction, indel and allele frequencies of GSVG fused to the N-terminus of nCas9(D10A), nCas9(H840A) and dCas9 at the HBB site (h).
- the protospacer is shown in blue and the protospacer adjacent motif (PAM) is shown in orange. Substitutions from C to T are shown in red.
- the target window of GSVG is negative, counting proto spacer 5' upstream.
- FIG. 58 GSVG fused to the C-terminus of nCas9(D10A), nCas9(H840A) and dCas9 at EMX1 site 2(a), EMX1 site 4(b), ROR1 site 2(c), and HBB site (d). of corrections, indels and allele frequencies.
- the protospacer is shown in blue and the protospacer adjacent motif (PAM) is shown in orange. Substitutions from G to A are shown in red.
- the target window of GSVG is indicated counting 3' downstream from the first position of the proto spacer.
- FIG. 60 Mitochondrial base correction of mDdCBE in HEK293T cells. Calibration efficiency of ND4(a) and ND6(b). Target cytosine and TALE binding sites are shown in red and gray, respectively. Calibration efficiencies at ND4(c, d) and ND6(e, f) when only half of DddAtox was fused to the TALE array and the other half had no TALEs. The left TALE arrangement and the right TALE arrangement are denoted by L and R, respectively. ND6 TALE array mismatches with the reference genome are underlined in purple.
- WT-ZFD is a C to T deaminse with only split DddAtox without adenine deaminase.
- the left TALE-split DddAtox is attached with adenine deaminase, and the right is the base correction efficiency when using a pair of DdCBE in units of one nucleotide.
- the green box is the area where the TALE is attached.
- dual tale module using two TALE modules components include a full length DddAtox and TALE array on one side, and adenine deaminase and TALE array on the other side.
- Figure 66 shows the results of confirming the nucleotide correction efficiency of the dual module targeting the ND1 site (components include TALE array, adenine deaminase (AD) and full length DddAtox (GSVG, AAAA, E1347A are variant
- Figure 67 shows the nucleotide correction efficiency when only TadA (AD) adenine deamination enzyme is attached to the TALE binding protein targeting the ND1 site.
- Figure 68 It shows the adenine and cytosine base correction efficiency for dual module, single module and split-DddA-AD in TALE targeting the ND1 site. If there are UGIs on both sides (from the bottom), only cytosine base correction occurs. When AD is attached to one side, both cytosine and adenine base correction occur, and when there is no UGI, it can be seen that only adenine base correction occurs selectively. Likewise, it can be seen that only adenine base correction occurs selectively in the dual module and single module.
- correction can be used interchangeably with “editing” and refers to a method of altering a nucleic acid sequence by selective deletion of a specific genomic target.
- specific genomic targets include, but are not limited to, chromosomal regions, genes, promoters, open reading frames, or any nucleic acid sequence.
- single base refers to one and only one nucleotide in a nucleic acid sequence. When used in the context of single base correction, this means that a base at a specific position in a nucleic acid sequence is replaced with a different base. Such substitutions may occur by many mechanisms, including, without limitation, substitutions or modifications.
- target or “target site” refers to a previously identified nucleoline sequence of any composition and/or length. Such target sites include, but are not limited to, chromosomal regions, genes, promoters, open reading frames, or any nucleic acid sequence.
- on-target refers to a subsequence of a specific genomic target that may be completely complementary to a programmable DNA binding region and/or a single guide RNA sequence.
- off-target refers to a subsequence of a specific genomic target that may be partially complementary to a programmable DNA binding region and/or a single guide RNA sequence.
- the fusion protein according to the present invention is a fusion protein comprising a cytosine deaminase or a variant thereof, wherein the cytosine deaminase or a variant thereof is a first fragment and a second fragment derived from a cytosine deaminase or a variant thereof. and a sieve, wherein the first fragment and the second fragment are each bound to the DNA-binding protein.
- the cytosine deaminase is an amino group leaving enzyme, and can convert cytosine (C) to uridine (U).
- the cytosine deaminase may be the cytosine deaminase.
- APOBEC1 apolipoprotein B editing complex 1
- AID activation-induced deaminase
- DNA deaminases work only on single-stranded DNA and are linked to a DNA binding protein. Therefore, it may not be suitable for base correction.
- the cytosine deaminase may be derived from a deaminase (DddA) that acts on double-stranded DNA or an orthologue thereof. More specifically, the cytosine deaminase may be a double-stranded DNA-specific bacterial cytosine deaminase.
- the cytosine deaminase is in a divided form, and the cytosine deaminase includes the separated first and second fragments, and each of the first and second fragments has no deaminase activity. will be.
- the cytosine deaminase includes a first fragment and a second fragment, and each of the first fragment and the second fragment has no deaminase activity.
- the first fragment or the second fragment of the cytosine deaminase is selected from the group consisting of G33, G44, A54, N68, G82, N98, G108 at the N-terminus of the sequence of SEQ ID NO: 1 It may contain up to one or more sequences.
- the first fragment or the second fragment of the cytosine deaminase is a sequence from at least one selected from the group consisting of G34, P45, G55, N69, T83, A99, A109 to the C-terminus of the sequence of SEQ ID NO: 1 may include
- the cytosine deaminase includes the first fragment of SEQ ID NO: 23 (G1333-N) and the second fragment of SEQ ID NO: 24 (G1333-C), or the first fragment of SEQ ID NO: 25 (G1397) -N) and a second fragment of SEQ ID NO: 26 (G1397-C), or a first fragment of SEQ ID NO: 23 (G1333-N) and a second fragment of SEQ ID NO: 26 (G1397-C)
- the first fragment of SEQ ID NO: 25 (G1397-N) and the second fragment of SEQ ID NO: 24 (G1333-C) may be included.
- G1333N, G1333C, G1397N and G1397C can be combined and used as a cleaved form of deaminase. Specifically, Left-G1333-N + Right-G133-C, Left-G1397-N + Right-G1397-C, Left-G1397-N + Right-G1333-C, or Left-G1333-N + Right-G1397- It can be used in the form of C.
- the inventors of the present application tried to suppress undesired base correction by the DdCBE mutation through a DdCBE mutation in which an amino acid residue is substituted.
- This off-target nucleotide correction effect is a phenomenon caused by spontaneous binding of the DddA tox deaminase fragment independent of the interaction between TALE and DNA.
- the amino acid residue introducing the mutation is a contact site located on the surface where the dimer of DddAtox binds to each other.
- HF-DdCBE was produced by substituting alanine for amino acid residues located on the surface of the DddA tox fragments.
- HF-DdCBE prevented proper function when two pairs of deamination enzymes linked to TALE did not bind to DNA. .
- whole mitochondrial genome analysis it was confirmed that HF-DdCBE is highly efficient and precise, unlike conventional DdCBE, which causes numerous unwanted and off-target C-to-T conversions in human mitochondrial DNA.
- split dimers In the case of DddAtox, theoretically, all split dimers must be applied (recruited) to the target site of DNA to cause base correction. Even when using , target base correction occurs. To solve this problem, the split dimer replaces residues on the surface of the protein that bind to each other to prevent binding of the DdCBE pair at an unwanted position.
- the present invention relates to a novel variant that reduces non-selective base correction by substituting amino acid residues of the cytosine deamination enzyme DddAtox.
- the cytosine deaminase includes a first fragment of SEQ ID NO: 23 (G1333-N) and a second fragment of SEQ ID NO: 24 (G1333-C), or a first fragment of SEQ ID NO: 25 (G1397-N) and a second fragment of SEQ ID NO: 26 (G1397-C).
- the variant of the cytosine deaminase is One or more amino acids selected may be substituted with other amino acids.
- the variant according to the present invention is one or more selected from the group consisting of positions 87, 88, 91, 92, 95, 100, 101, 102 and 103 of the first fragment of SEQ ID NO: 25, or the first fragment of SEQ ID NO: 26
- One or more amino acids selected from the group consisting of positions 13, 14, 15, and 16 in the bipartite are substituted with other amino acids.
- the 'other amino acids' include alanine, isoleucine, leucine, methionine, phenylalanine, proline, tryptophan, valine, aspartic acid, cysteine, glutamine, glycine, serine, threonine, tyrosine, aspartic acid, glutamic acid, arginine, histidine, lysine, the amino acids Among all known variants of these, it refers to an amino acid selected from amino acids other than the amino acid originally possessed by the wild-type protein at the mutation position. In one example, the 'other amino acid' may be alanine.
- Y3A, L5A, I10A, S11A, V13A, G14A, T15A, F16A, Y17A, Y18A, V19A, K28A, F30A, S31A each Y1292A, L1294A, I1299A, S1300A, V1312A, G1313A, T1314A, F1315A, Y1316A, Y1317A, V1318A, K1327A, F1329A, S1330A).
- E1361A, G1362A, L1363A, V1364A, F1365A, H1366A, K1389A, M1390A, T1391A, V1393A may include one or more amino acid substitutions selected from the group consisting of.
- C87A, V88A, T91A, E92A, L95A, K100A, M101A, T102A, V103A C1376A, V1377A, T1380A, E1381A, L1384A, K1389A, M1390A, T1391A, V1392A, respectively)
- one or more amino acid substitutions selected from the group consisting of K13A, V14A, F15A, and T16A may be included.
- the cytosine deaminase variant according to the present invention may include one or more sequences selected from the group consisting of the amino acid sequences described in the table above.
- the cytosine deaminase variant according to the present invention shows the possibility of reducing the effect of causing unwanted corrections to several bases in a non-specific target site.
- the inventors of the present application developed a novel programmable cytosine deaminase using full-length DddA made by modifying an amino acid having a positive charge of wild-type cytosine deaminase DddA tox , which is used in an isolated form by causing intracellular toxicity. has been developed.
- the present invention relates to (i) a DNA binding protein; and (ii) a fusion protein comprising a cytosine deaminase or a variant thereof, wherein the cytosine deaminase or a variant thereof is a non-toxic full-length cytosine deaminase.
- an amino acid having a positive charge (KRKKK) is specifically clustered. Because DNA is negatively charged, it binds to amino acids that have a positive charge in proteins. By substituting this positively charged amino acid with an amino acid without an electrode, the DddA tox weakens the DNA-binding force, thereby lowering or eliminating intracellular toxicity. That is, a combination that does not have toxicity by substituting an amino acid having a positive charge with an amino acid without a polarity can be cloned using E. coli, thereby securing full-length DddA.
- Wild-type DddA tox uses an isolated form divided into two due to intracellular toxicity, which imposes many limitations on the experiment.
- an orthogonal Cas9 variant that recognizes another PAM is used.
- the target window showing the highest activity is 40 bp between the binding of the two Cas9 variants, where undesired cytosines are also deamidated.
- full-length DddA is not separated, it is not constrained by PAM.
- the TC motif within 10 bp of the target position is most active, the accuracy is also high.
- DddA In the full-length DddA, it is possible to substitute thymine for cytosine at a desired position using Cas9 as well as TALE module and zinc finger protein.
- Existing DddAtox had to be delivered in pairs because it was separated, but full-length DddA can use only one module of the TALE module and zinc finger protein, so the target position can be selected without any restrictions.
- DNA such as mitochondria, plant chloroplasts, or plastids as well as genomic sites, cytosine of specific DNA can be converted into thymine.
- AAV a viral vector used for gene therapy.
- CBE cytosine base editor
- thymine substitutes thymine for cytosine in the R-loop formed by Cas9 binding to the target site. to deamination. Therefore, it is possible to convert cytosine to thymine in the case of a position where there is a restriction on correction with conventional CBE.
- one or more, two or more, three or more, four or more, or five or more amino acids of the wild-type deaminase of SEQ ID NO: 1 may be substituted with other amino acids.
- the 'other amino acids' include alanine, isoleucine, leucine, methionine, phenylalanine, proline, tryptophan, valine, aspartic acid, cysteine, glutamine, glycine, serine, threonine, tyrosine, aspartic acid, glutamic acid, arginine, histidine, lysine, the amino acids Among all known variants of these, it refers to an amino acid selected from amino acids other than the amino acid originally possessed by the wild-type protein at the mutation position. In one example, the 'other amino acid' may be alanine.
- the non-toxic full-length DddA may include a sequence selected from the group consisting of the following SEQ ID NO: 12 to SEQ ID NO: 18 depending on the type.
- AAAAA SEQ ID No: 13
- AAAAK SEQ ID No: 14
- AAKAA SEQ ID No: 15
- AAKAK (SEQ ID No: 16)
- the full-length deaminase variant may include one or more substitutions selected from the group consisting of the amino acid sequence of SEQ ID NO: 1:
- a at position 109 is substituted with V;
- the full-length deaminase variant comprises: S at position 37 in the amino acid sequence of SEQ ID NO: 1 is substituted with G; G at position 59 is substituted with S; A at position 109 is substituted with V; and the sequence of SEQ ID NO: 19, wherein S at position 129 is replaced with G.
- the full-length DddA GSVG can be cloned using general E. coli. It was confirmed in the human cell genomic context that the full-length DddA GSVG deaminates the cytosine of the TC motif in the target site to thymine.
- the full-length DddA GSVG can be cloned into the N-terminal and C-terminal of Cas9, respectively. DddA GSVG linked to the N-terminal of Cas9 at the same target site can replace cytosine with thymine.
- DddA GSVG linked to the C-terminal of Cas9 the cytosine of the TC motif in the complementary sequence of the guanine to be substituted was substituted with thymine, and the substitution of the guanine to be substituted with adenine was confirmed at the human cell genome level.
- the full-length deaminase variant may include a sequence selected from the group consisting of SEQ ID NOs: 20 to 22.
- the DNA binding protein may be, for example, a zinc finger protein, a transcription activator-like effector (TALE) protein, a CRISPR-associated nuclease, or a combination of two or more thereof.
- TALE transcription activator-like effector
- the zinc finger motif of the zinc finger protein has a DNA binding domain, and the c-terminal portion of the finger specifically recognizes a DNA sequence.
- DNA binding proteins containing 3 to 6 zinc finger motifs recognize DNA sequences.
- each of the first fragment of the cytosine deaminase and the second fragment of the cytosine deaminase may bind to the N-terminus or the C-terminus of the zinc finger protein.
- ZF-Left zinc finger protein
- ZF-Right zinc finger protein
- ZF-Left zinc finger protein
- ZF-Right zinc finger protein
- the C-terminus of the zinc finger protein (ZF-Left) is bound to the N-terminus of the first fragment of cytosine deaminase, and the zinc finger protein (ZF-Right) N is linked to the C-terminus of the second fragment of cytosine deaminase.
- -Terminal bonding (CN configuration); or
- the N-terminus of the zinc finger protein (ZF-Left) is bound to the C-terminus of the first fragment of cytosine deaminase, and the zinc finger protein (ZF-Right) N is linked to the C-terminus of the second fragment of cytosine deaminase.
- -End can be combined (NN configuration).
- the ZF-Left may include the following sequence of SEQ ID NO: 2:
- the ZF-Right may include the following sequence of SEQ ID NO: 3:
- ZF may have a different sequence depending on the DNA target.
- ZF can be customized according to the DNA target sequence. Since ZF recognizes 3 bp of DNA, it is possible to construct a ZF combination that recognizes 9 to 18 bp DNA by concatenating 3 to 6 ZFs. For example, it can be produced using a library including modules such as GNN, TNN, CNN, or ANN.
- the zinc finger protein may be linked to a deaminase through a linker.
- the linker may be a peptide linker comprising 2 to 40 amino acid residues.
- the linker may be, for example, a linker having a length of 2aa, 5aa, 10aa, 16aa, 24aa or 32aa, but is not limited thereto.
- the linker may comprise:
- the split deaminase and the zinc finger protein may be linked through a linker, and the zinc finger protein binds to the N-terminus of the half deaminase including the first split body, and the second split The zinc finger protein binds to the N-terminus of the half deaminase containing the sieve.
- base conversion from C to T may occur at the spacer between the left and right ZFPs. It was confirmed that when both the left and right ZFP were linked to each of the half deaminase containing the first fragment and the half deaminase containing the second fragment through the 24 a.a linker, high proofreading efficiency was shown.
- the TAL effector (TALE) consists of a repeated 33 to 34 amino acid sequence, and about 9 repeated variant domains (RVD) are repeated. It can recognize one nucleotide per domain and can bind to a specific DNA sequence according to the 12th-13th amino acid sequence (HD->Cytosine, NI->Adenine, NG->Thymine, NN->Guanine).
- a de-effector (TALE) recognizes a single DNA strand within a target site. The distance between target sites may be 12-14 nucleotides.
- the TALE domain refers to a protein domain that binds to nucleotides in a sequence-specific manner by a combination of one or more TALE-Repeats. At least one TALE-Repeat, specifically 1 to 30 TALE-Repeat, but is not limited thereto. TALE-Repeat is a site that recognizes a specific nucleotide sequence in the TALE domain.
- the TALE domain includes an N-terminal containment region of TALE and a C-terminal containment region of TALE as a backbone structure.
- the first TALE comprising the N-terminus of the TALE may be encoded by SEQ ID NO: 4 or 5.
- the second TALE including the C-terminus of the TALE may be encoded by SEQ ID NO: 6 or 7.
- a single TALE array or a first TALE array and a second TALE array may be bound, respectively, depending on the binding position of the TALE domain with respect to the cleavage site.
- a first TALE may be bound to the first fragment of the cytosine deaminase (left TALE), and a second TALE (right TALE) may be bound to the second fragment of the cytosine deaminase.
- Each has the structure of N'-TALE-first fragment-C' and N'-TALE-second fragment-C'.
- a single module TALE may be coupled to the N-terminus of the cytosine deaminase.
- a single TALE module and cytosine deaminase in the N-C direction are included.
- a dual module TALE may be included, and in this case, the first TALE may be coupled to the N-terminus of the full-length cytosine deaminase, and the second TALE may be included separately.
- the first TALE module and cytosine deaminase are included in the N-C direction, and have the structures of N'-TALE-cytosine deaminase-C' and N'-TALE-C'.
- the TALE array can be customized according to the target DNA sequence.
- the TALE array consists of modules consisting of 33 to 35 amino acid residues arranged repeatedly. These are derived from the plant pathogen Xanthmonas, and each module recognizes each A, C, G, and T base and binds to DNA. The base specificity of each module is determined by the 12th and 13th amino acid residues, which are called repeat variable di-residue (RVD). For example, a module with RVD of NN recognizes G, NI recognizes A, HD recognizes C, and NG recognizes T.
- the TALE array can be designed to recognize 15-20bp of the target DNA sequence, consisting of a minimum of 14 and a maximum of 18 or more modules.
- RNAs are encoded in the CRISPR array, one is crRNA (CRISPR RNA) and the other is tracrRNA (trans activating CRPSPR RNA).
- crRNA is transcribed in the protospace region and forms a tertiary structure by binding with tracrRNA. Both types of RNA help recognize and cut foreign DNA.
- the Cas protein is Cas1, Cas1B, Cas2, Cas3, Cas4, Cas5, Cas6, Cas7, Cas8, Cas9, Cas10, Cas12a, Cas12b, Cas12c, Cas12d, Cas12e, Cas12g, Cas12h, Cas12i, Cas12j, Cas13a, Cas13b, Cas13c, Cas13d, Cas14, Csy1, Csy2, Csy3, Cse1, Cse2, Csc1, Csc2, Csa5, Csn2, CsMT2, Csm3, Csm4, Csm5, Csm6, Cmr1, Cmr3, Cmr4, Cmr5, Csb3, Csx17, Csb1, Csx17, Csb2 It may be an endonuclease of Csx14, Csx10, Csx16, CsaX, Csx3, Csx1, Csx15, Csf
- the Cas protein is Corynebacter, Sutterella, Legionella, Treponema, Filifactor, Eubacterium, Streptococcus (Streptococcus: Streptococcus pyogenes) , Lactobacillus, Mycoplasma, Bacteroides, Flaviivola, Flavobacterium, Azospirillum, Gluconacetobacter , Neisseria, Roseburia, Parvibaculum, Staphylococcus: Staphylococcus aureus, Nitratifractor, Corynebacterium and Campylobacter ) is derived from a microorganism genus containing an ortholog of a Cas protein selected from the group consisting of, and may be simply isolated or recombined therefrom.
- It may include a mutated form of the Cas protein. It may mean that it has been mutated to lose the endonuclease activity that cuts DNA double strands, for example, mutated target-specific nucleases and endonucleases mutated to lose endonuclease activity and have nickase activity. It may be one or more of the forms mutated to lose both the first activity and the nickase activity.
- the base conversion by the cytosine deaminase (eg, cytosine to uradin) is performed simultaneously or sequentially regardless of the sequence, the strand or the opposite strand (such as , a nick may be introduced in the opposite strand of the strand on which the base conversion has occurred (eg, on the opposite strand of the strand where the PAM is located, between the 3rd and 4th nucleotides in the 5' end direction of the PAM sequence) nick was introduced in ).
- Such a mutation eg, amino acid substitution, etc.
- may occur in the catalytically active domain eg, RuvC catalytic domain in the case of Cas9.
- mutations include catalytic aspartate residues (such as aspartate at position 10 (D10)), glutamic acid at position 762 (E762), and histidine at position 840 (H840). ), asparagine at position 854 (N854), asparagine at position 863 (N863), aspartic acid at position 986 (D986), and the like. .
- any other amino acid to be substituted may be alanine (alanine), but is not limited thereto.
- one or more, such as all three, of an aspartic acid at position 1135 (D1135), an arginine at position 1335 (R1335), and a threonine at position 1337 (T1337) of the Streptococcus pyogenes-derived Cas9 protein are different It may be mutated to recognize an NGA (N is any base selected from A, T, G, and C) different from the PAM sequence (NGG) of wild-type Cas9 by being substituted with an amino acid.
- NGA is any base selected from A, T, G, and C
- the 'other amino acids' include alanine, isoleucine, leucine, methionine, phenylalanine, proline, tryptophan, valine, aspartic acid, cysteine, glutamine, glycine, serine, threonine, tyrosine, aspartic acid, glutamic acid, arginine, histidine, lysine, the amino acids Among all known variants of these, it refers to an amino acid selected from amino acids other than the amino acid originally possessed by the wild-type protein at the mutation position.
- the 'other amino acid' may be alanine, valine, glutamine, or arginine.
- a guide RNA may be further included.
- the guide RNA may be, for example, at least one selected from the group consisting of CRISPR RNA (crRNA), trans-activating crRNA (tracrRNA), and single guide RNA (sgRNA), and specifically, crRNA and tracrRNA are It may be a double-stranded crRNA:tracrRNA complex bound to each other, or a single-stranded guide RNA (sgRNA) in which crRNA or a portion thereof and tracrRNA or a portion thereof are linked by an oligonucleotide linker.
- crRNA CRISPR RNA
- tracrRNA trans-activating crRNA
- sgRNA single guide RNA
- the present invention relates to (i) a DNA binding protein; (ii) cytosine deaminase or a variant thereof; And (iii) a fusion protein comprising an adenine deaminase, wherein the cytosine deaminase or a variant thereof is (a) a non-toxic full-length cytosine deaminase or (b) a first fragment derived from a cytosine deaminase or a variant thereof It relates to a fusion protein comprising a sieve and a second fragment, wherein the first fragment and the second fragment are each bound to the DNA-binding protein.
- the inventors of the present application connect DddAtox cytosine deaminase and adenine deaminase that can cause A to G conversion to TALE or ZFP protein capable of binding to DNA to produce a base editor capable of correcting base A (base editor) did
- DdCBE deaminase using DddAtox
- TALE repeat as a DNA binding module.
- DdABE can cause A to G and thus can produce different mutation patterns.
- DdABE recognizes double-stranded DNA by itself and causes deamination, there is no additional component such as RNA.
- RNA In the case of mitochondria and chloroplast, the mechanism of RNA delivery was not known, so the Crispr system could not be applied.
- DdABE without these components can not only target the genomic DNA in the cell, but also target the DNA of organelles such as mitochondria and chloroplast to cause A to G conversion of specific DNA.
- DdCBE is the only gene editing technology that targets mitochondria or organelles. Therefore, the only mutation that can be introduced across all existing technologies was C to T, but DdABE can cause A to G, so the spectrum that can introduce mutations becomes much more diverse. This enables the creation or treatment of mitochondrial disease models that have been impossible to date.
- DdABE In the case of the existing DdCBE, two TALE modules (attached to the left and right, respectively) are required, so it cannot be mounted on AAV, a viral vector with low gene capacity in gene therapy.
- DdABE can be used as a 'single module' that can use only one TALE module, it can be mounted on AAV viruses and has strengths in gene therapy.
- DdABE can be used by using a split DddAtox as needed, or it can be used by using a full-length DddAtox variant, so it has high compatibility.
- the adenine deaminase may be selected from the group consisting of, for example, apolipoprotein B editing complex 1 (APOBEC1), activation-induced deaminase (AID), and tRNA-specific adenosine deaminase (tadA), specifically tadA (tRNA). -specific adenosine deaminase).
- APOBEC1 apolipoprotein B editing complex 1
- AID activation-induced deaminase
- tadA tRNA-specific adenosine deaminase
- tRNA-specific adenosine deaminase specifically tadA
- the adenine deaminase may be, for example, deoxy-adenine deaminase as a variant of E. coli TadA.
- the cytosine deaminase is included in a split form, the DNA binding protein is a zinc finger protein, and the N-terminus of the zinc finger protein (ZF-Left) is bound to the C-terminus of the first fragment of the cytosine deaminase.
- the adenine deaminase is the C-terminus of the zinc finger protein (ZF-Left).
- cytosine deaminase may bind to the N-terminus or C-terminus of the first fragment of cytosine deaminase, the N-terminus of zinc finger protein (ZF-Right), and the N-terminus or C-terminus of the second fragment of cytosine deaminase.
- the C-terminus of the zinc finger protein (ZF-Left) is bound to the N-terminus of the first fragment of the cytosine deaminase, and the zinc finger protein ( ZF-Right) C-terminal binding (CC configuration);
- the C-terminus of the zinc finger protein (ZF-Left) is bound to the N-terminus of the first fragment of cytosine deaminase, and the zinc finger protein (ZF-Right) N is linked to the C-terminus of the second fragment of cytosine deaminase.
- the N-terminus of the zinc finger protein (ZF-Left) is bound to the C-terminus of the first fragment of the cytosine deaminase, and the zinc finger protein (ZF-Right) is linked to the C-terminus of the second fragment of the cytosine deaminase.
- N-terminal bonding Even in N-terminal bonding (NN configuration), the C terminus of the zinc finger protein (ZF-Left), the N terminus or C terminus of the first fragment of cytosine deaminase, the N terminus of the zinc finger protein (ZF-Right), It can bind to the N-terminus or C-terminus of the second fragment of the cytosine deaminase.
- the first TALE is bound to the first fragment of the cytosine deaminase, and the second fragment is attached to the second fragment of the cytosine deaminase.
- Two TALEs may be bound, and each has the structure of N'-TALE-first fragment DDDA-C' and N'-TALE-second fragment DDDA-C'.
- the adenine deaminase may bind to the N-terminus or C-terminus of the first fragment of cytosine deaminase or the N-terminus or C-terminus of the second fragment of cytosine deaminase.
- the DNA binding protein is TALE
- it may include a single TALE module, and includes a single TALE module and a cytosine deaminase in the NC direction, wherein the adenine deaminase can bind to the C-terminal direction of a single TALE module, the N-terminus or the C-terminus of cytosine deaminase.
- the DNA binding protein is TALE
- it may include a dual TALE module, and a first TALE module and a cytosine deaminase in the NC direction are included, adenine deaminase and A second fragment including the second TALE may be further included, and in the structure of N'-TALE-cytosine deaminase-C' and N'-TALE-adenine deaminase-C', the adenine deaminase is N of TALE. It may bind to the terminus or C terminus.
- UGI uracil DNA glycosylase inhibitor
- UGI can increase base editing efficiency by inhibiting the activity of Uracil DNA glycosylase (UDG), an enzyme that repairs mutant DNA that catalyzes the removal of U from DNA.
- UGG Uracil DNA glycosylase
- the present invention provides a composition for A-to-G base correction in prokaryotic or eukaryotic cells comprising the fusion protein or a nucleic acid encoding the same, wherein the DNA binding protein is a zinc finger protein, a TALE protein, or CRISPR It is a related nuclease, and the cytosine deaminase of the fusion protein or a variant thereof is of bacterial origin, and relates to a composition characterized in that it is specific for double-stranded DNA.
- the present invention provides a composition for A-to-G base correction in prokaryotic or eukaryotic cells comprising the fusion protein or a nucleic acid encoding the same, wherein the DNA binding protein is a zinc finger protein, a TALE protein, or CRISPR is a related nuclease,
- the cytosine deaminase or variant thereof of the fusion protein is derived from bacteria and is specific for double-stranded DNA, and a DNA binding protein is bound to the N-terminus of the cytosine deaminase or variant thereof, and adenine deamination of the fusion protein It relates to a composition in which a DNA binding protein is bound to the C terminus of an enzyme.
- the present invention provides a composition for C-to-T base correction in prokaryotic or eukaryotic cells comprising the fusion protein or a nucleic acid encoding the fusion protein and UGI (uracil glycosylase inhibitor), wherein the DNA binding protein is a zinc finger protein (zinc finger protein).
- UGI uracil glycosylase inhibitor
- the DNA binding protein is a zinc finger protein (zinc finger protein).
- protein TALE protein or CRISPR-associated nuclease
- the cytosine deaminase or variant thereof of the fusion protein is derived from bacteria, and relates to a composition characterized in that it is specific for double-stranded DNA.
- the present invention relates to prokaryotic and eukaryotic cells comprising 1) a DNA binding protein 2) a full-length double-stranded DNA-specific bacterial cytosine deaminase or a variant thereof and 3) an E. coli TadA-derived deoxyadenine deaminase.
- a composition (without UGI) for A-to-G base correction of ego; The composition is DddAtox from the full-length double-stranded DNA-specific bacterial cytosine deaminase Burkholderia cenocepacia .
- the present invention relates to 1) a left DNA binding protein operably linked to a full-length double-stranded DNA specific bacterial cytosine deaminase or a variant thereof 2) a right DNA binding protein operably linked to a deoxyadenine deaminase from E.
- compositions for A-to-G base correction in prokaryotic and eukaryotic cells comprising: a zinc finger protein (ZFP) or a transcriptional activator-like effector (TALE) array or catalytically deficient CRISPR-Cas9 (nCas9 or dCas9) or Cas12a;
- ZFP zinc finger protein
- TALE transcriptional activator-like effector
- the composition is DddAtox from the full-length double-stranded DNA-specific bacterial cytosine deaminase Burkholderia cenocepacia .
- the present invention also provides 1) DNA binding protein 2) full-length double-stranded DNA-specific bacterial cytosine deaminase or a variant thereof, 3) E. coli TadA-derived deoxyadenine deaminase, and 4) UGI (uracil glycosylase inhibitor)
- a composition for A-to-G and C-to-T base correction in prokaryotic and eukaryotic cells comprising: a zinc finger protein (ZFP) or a transcriptional activator-like effector (TALE) array or a catalytic deletion CRISPR-Cas9 (nCas9 or dCas9) or Cas12a;
- the composition is DddAtox from the full-length double-stranded DNA-specific bacterial cytosine deaminase Burkholderia cenocepacia .
- the present invention further relates to prokaryotic and eukaryotic cells comprising 1) a DNA binding protein 2) a split double-stranded DNA specific bacterial cytosine deaminase or variant thereof and 3) a deoxyadenine deaminase from E. coli TadA.
- a composition (without UGI) for A-to-G base correction of ego; The composition is DddAtox from the cleaved double-stranded DNA specific bacterial cytosine deaminase Burkholderia cenocepacia .
- the present invention further provides 1) DNA binding protein 2) split double-stranded DNA-specific bacterial cytosine deaminase or variants thereof 3) E. coli TadA-derived deoxyadenine deaminase and 4) UGI (uracil glycosylase inhibitor)
- a composition for A-to-G and C-to-T base correction in prokaryotic and eukaryotic cells comprising: a zinc finger protein (ZFP) or a transcriptional activator-like effector (TALE) array or a catalytic deletion CRISPR-Cas9 (nCas9 or dCas9) or Cas12a;
- the composition is DddAtox from the cleaved double-stranded DNA specific bacterial cytosine deaminase Burkholderia cenocepacia .
- the present invention is an A-to-G base correction method in a prokaryotic or eukaryotic cell comprising the step of treating the fusion protein or a nucleic acid encoding the same in the prokaryotic or eukaryotic cell, wherein the DNA binding protein is a zinc pinker protein ( zinc finger protein), TALE protein, or CRISPR-associated nuclease, and the cytosine deaminase or variant thereof of the fusion protein is derived from bacteria and is characterized in that it is specific for double-stranded DNA.
- the DNA binding protein is a zinc pinker protein ( zinc finger protein), TALE protein, or CRISPR-associated nuclease
- the cytosine deaminase or variant thereof of the fusion protein is derived from bacteria and is characterized in that it is specific for double-stranded DNA.
- the present invention is an A-to-G base correction method in a prokaryotic or eukaryotic cell comprising the step of treating the fusion protein or a nucleic acid encoding the same in the prokaryotic or eukaryotic cell, wherein the DNA binding protein is a zinc pinker protein ( zinc finger protein), TALE protein, or CRISPR-associated nuclease, and the cytosine deaminase or variant thereof of the fusion protein is derived from bacteria, is double-stranded DNA-specific, and is located at the N-terminus of the cytosine deaminase or variant thereof.
- the present invention provides a C-to-T base correction method in a prokaryotic or eukaryotic cell comprising the step of treating the fusion protein or a nucleic acid encoding the same and UGI (uracil glycosylase inhibitor) to the prokaryotic or eukaryotic cell, wherein the DNA
- the binding protein is a zinc finger protein, a TALE protein, or a CRISPR-associated nuclease, and the cytosine deaminase or a variant thereof of the fusion protein is derived from bacteria and is double-stranded DNA-specific.
- ND1-Right-TALE-1333C-AD (FIG. 63: SEQ ID No: 424)
- ND1-Right-TALE-1397C-AD (FIGS. 62-63: SEQ ID No: 426)
- ND1-Left-TALE-1333C (FIG. 63: SEQ ID No: 428)
- ND1-Right-TALE-1333N (FIG. 63: SEQ ID No: 430)
- ND1-Right-TALE-1333C (FIG. 63: SEQ ID No: 431)
- ND1-Right-TALE-1397N (FIGS. 62-63: SEQ ID No: 432)
- ND4-LEFT-TALE-1333N-AD (FIG. 63: SEQ ID No: 433)
- ND4-LEFT-TALE-1333C-AD (FIG. 63: SEQ ID No: 434)
- ND4-LEFT-TALE-1397C-AD (FIG. 63: SEQ ID No: 435)
- TRAC-ZFP-LEFT (SEQ ID No: 450)
- AD Adenine deaminase (AD: ABE 8e) (SEQ ID No: 458)
- SOD2 MTS-3xHA MALSRAVCGTSRQLAPVLGYLGSRQKHSLPDYPYDVPDYAGYPYDVPDYAGYPYDVPDYA (SEQ ID No: 476)
- the fusion protein according to the present invention can be prepared by, for example, microinjection, electroporation, DEAE-dextran treatment, lipofection, nanoparticle-mediated transfection, protein transduction domain mediated introduction, and It can be delivered to the cell by various methods in the art, such as, but not limited to, PEG-mediated transfection.
- the present invention relates to a nucleic acid encoding the fusion protein.
- polynucleotide In reference to the above nucleic acids, "polynucleotide”, “nucleotide”, “nucleotide sequence”, and “oligonucleotide” are used interchangeably. polymeric forms of nucleotides of any length, deoxyribonucleotides or ribonucleotides, or analogs thereof.
- a polynucleotide may have any three-dimensional structure and may perform any function, known or unknown.
- a polynucleotide may comprise one or more modified nucleotides, such as methylated nucleotides and nucleotide analogs. Modifications to the nucleotide structure may be possible either before or after assembly of the polymer.
- the polynucleotide may be an RNA sequence, a DNA sequence, or a combination thereof (RNA-DNA combination sequence).
- known expression vectors such as plasmid vectors, cosmid vectors, and bacteriophage vectors can be used, and the vector can be easily prepared by those skilled in the art according to any known method using DNA recombination technology.
- the vector may be a plasmid vector or a viral vector, and the viral vector may be specifically an adenovirus, an adeno-associated virus, a lentivirus, or a retrovirus vector,
- the present invention is not limited thereto.
- the recombinant expression vector may contain the nucleic acid in a form suitable for expression of the nucleic acid in the host cell, which is selected on the basis of the host cell such that the recombinant expression vector is used for expression, ie, operably-linked to the nucleic acid sequence to be expressed. It is meant to include one or more regulatory elements that may be
- operably linked means that the nucleotide sequence of interest permits expression of the nucleotide sequence (eg, in an in vitro transcription/translation system or in a host cell when the vector is introduced into the host cell). ) means connected to the control element.
- the recombinant expression vector may contain a form suitable for messenger RNA synthesis, including a T7 promoter, which contains one or more regulatory elements that enable mRNA synthesis in vitro, that is, messenger RNA can be synthesized by T7 polymerase.
- Regulatory elements may include promoters, enhancers, internal ribosome entry sites (IRES), and other expression regulatory elements (eg, transcription termination signals such as polyadenylation signals and poly-U sequences). Regulatory elements include elements that direct the induction or constitutive expression of a nucleotide sequence in many types of host cells and elements that direct expression of the nucleotide sequence only in specific host cells (eg, tissue-specific regulatory sequences).
- tissue-specific promoter directs expression primarily in a desired tissue of interest, such as muscle, neuron, bone, skin, blood, a specific organ (eg, liver, pancreas), or a specific cell type (eg, lymphocytes). can do.
- Regulatory elements may also direct expression in a transient-dependent manner, such as a cell-cycle dependent or developmental stage-dependent manner, which may or may not be tissue or cell-type specific.
- the vector comprises one or more pol III promoters, one or more pol II promoters, one or more pol I promoters, or a combination thereof.
- pol III promoters include, but are not limited to, the U6 and H1 promoters.
- pol II promoters include, but are not limited to, a retroviral Rous sarcoma virus (RSV) LTR promoter (optionally with an RSV enhancer), a cytomegalovirus (CMV) promoter (optionally with a CMV enhancer) (e.g., Boshart et al.
- RSV Rous sarcoma virus
- CMV cytomegalovirus
- SV40 promoter dihydrofolate reductase promoter
- ⁇ -actin promoter phosphoglycerol kinase (PGK) promoter
- PGK phosphoglycerol kinase
- Regulatory elements include enhancers such as WPRE; CMV enhancer; R-U5' segment in LTR of HTLV-I; SV40 enhancer; and an intron sequence between exons 2 and 3 of rabbit ⁇ -globin, and the like. It will be appreciated by those skilled in the art that the design of an expression vector may depend on factors such as the selection of the host cell to be transformed, the level of expression desired, and the like.
- a vector can be introduced into a host cell to produce a transcript, protein or peptide comprising a fusion protein or peptide encoded by a nucleic acid as described herein (e.g., clustered regularly spaced short palindromic repeats ( CRISPR) transcripts, proteins, enzymes, mutants thereof, fusion proteins thereof, etc.).
- CRISPR clustered regularly spaced short palindromic repeats
- Beneficial vectors include lentiviruses and adeno-associated viruses, and types of such vectors can also be selected to target specific types of cells.
- Each of the vectors is a local injection method (eg, direct injection of a lesion or target site), electroporation, lipofection, viral vectors, nanoparticles, as well as PTD (Protein translocation domain) fusion protein method, etc. It can be delivered in vivo or into a cell.
- the nucleic acid is injected in the form of ribonucleic acid, for example, messenger ribonucleic acid mRNA, so that the gene base correction of the cell, for example, the gene base correction is possible without limitation in animal cells or plant cells.
- ribonucleic acid for example, messenger ribonucleic acid mRNA
- the nucleic acid according to the present invention may be in the form of mRNA, and when delivered in the form of mRNA, compared to delivery in the form of a vector using DNA, the transcription process into mRNA is unnecessary, so the initiation of gene editing may be quick. Transient protein expression is likely.
- the inventors of the present application have found that when a cytosine base editor is injected into plant cells in the form of ribonucleic acid, for example, messenger ribonucleic acid, for plant organelle gene editing into plant cells, the off-target effect is reduced compared to delivery as a plasmid Confirmed.
- ribonucleic acid for example, messenger ribonucleic acid
- a cytosine base corrector in plant organelle gene editing it was demonstrated for the first time that there is an advantage in off-target effects compared to plasmids.
- the mRNA may be delivered directly or delivered through a carrier.
- the mRNA of the nuclease and/or the cleavage factor may be chemically modified or directly delivered in the form of synthetic self-replicative RNA.
- Methods capable of delivering mRNA molecules to cells in vitro or in vivo are contemplated, including a method for delivering mRNA into a cell or a method for delivering mRNA into a cell of an organism such as a human or animal in vivo.
- lipids eg, liposomes, micelles, etc.
- nanoparticles or nanotubes include cationic compounds (eg, polyethyleneimine or PEI), or include cationic compounds (eg, for example, polyethylenimine or PEI), to deliver mRNA molecules into cells.
- PEI polyethyleneimine
- cationic compounds eg, for example, polyethylenimine or PEI
- a bolistics method such as a gene gun or a biolistic particle delivery system may be used to deliver mRNA into cells.
- the carrier may include, for example, a cell penetrating peptide (CPP), nanoparticles, or a polymer, but is not limited thereto.
- CPP cell penetrating peptide
- nanoparticles or a polymer, but is not limited thereto.
- the CPP is a short peptide that facilitates cellular uptake of a variety of molecular cargoes (from nanosized particles to small chemical molecules and large fragments of DNA).
- the composition according to the present invention may be delivered via polymer nanoparticles, metal nanoparticles, metal/inorganic nanoparticles or lipid nanoparticles.
- the polymer nanoparticles may be, for example, DNA nanoclew synthesized by rolling circle amplification, or thread-like DNA nanoparticles.
- DNA nanoclew may be coated with PEI to improve the endosomal escape ability, loading the mRNA into the DNA nanoparticle like a thread. This complex binds to the cell membrane, is internalized, and then moves to the nucleus through endosomal escape, so that it can be delivered.
- the gold particles may be linked and a complex may be formed with a cationic endosomal disruptive polymer and delivered to the cell.
- the cationic endosomes escape polymer is, for example, polyethylene imine, poly(arginine), poly(lysine), poly(histidine), poly-[2- ⁇ (2-aminoethyl)amino ⁇ -ethyl -aspartamide] (pAsp(DET)), poly(ethylene glycol) (PEG) and poly(arginine) block co-polymer, PEG and poly(lysine) block co-polymer, or PEG and poly ⁇ N-[N It may be a block co-polymer of -(2-aminoethyl)-2-aminoethyl]aspartamide ⁇ (PEG-pAsp(DET)).
- mRNA can be encapsulated through ZIF-8 (zeolitic imidazolate framework-8).
- the mRNA is negatively charged and can combine with cationic substances to form nanoparticles, which are receptor-mediated into the cell. It can penetrate through endocytosis or phagocytosis.
- polyallylamine as a cationic polymer; polyethyleneimine (PEI); poly(L-lysine) (PLL); poly(L-arginine) (PLA); polyvinylamine homo- or copolymers; poly(vinylbenzyl-tri-C1-C4-alkylammonium salt); polymers of aliphatic or araliphatic dihalides and aliphatic N,N,N',N'-tetra-C1-C4-alkyl-alkylenediamines; poly(vinylpyridine) or poly(vinylpyridinium salt); poly(N,N-diallyl-N,N-di-C1-C4-alkyl-ammonium halide); homo- or copolymers of quaternized di-C 1 -C 4 -alkyl-aminoethyl acrylates or methacrylates; POLYQUADTM; polyaminoamides and the like may be included.
- Cationic lipids may include cationic liposome preparations.
- the lipid bilayer of the liposome protects the encapsulated nucleic acid from degradation and can prevent specific neutralization by antibodies capable of binding to the nucleic acid.
- endosomal maturation the endosomal membrane and the liposome are fused, allowing efficient endosomal escape of cationic lipid-nucleases.
- Representative cationic liposomes include N-[1-(2,3-dioleoloxy)-propyl]-N,N,N-trimethylammonium chloride (DOTMA), N-[1-(2,3-dioleoloxy) -Propyl]-N,N,N-trimethylammonium methylsulfate (DOTAP), 3 ⁇ -[N-(N',N'-dimethylaminoethane)carbamoyl]cholesterol (DC-Chol), 2,3- Dioleyloxy-N-[2(sperminecarboxamido)ethyl]-N,N-dimethyl-1-propanaminium trifluoroacetate (DOSPA), 1,2-dimyristyloxypropyl-3 -dimethyl-hydroxyethyl ammonium bromide; or dimethyldioctadecylammonium bromide (DDAB).
- DOTMA N-[1-(2,3
- Liposomes are spherical vesicular structures composed of a single or multiple lamellar lipid bilayers surrounding an inner aqueous compartment and a relatively impermeable outer lipophilic phospholipid bilayer.
- the liposome formulation may mainly contain natural phospholipids and lipids such as 1,2-distearolyl-sn-glycero-3-phosphatidyl choline (DSPC), sphingomyelin, phosphatidylcholine or monosialoganglioside and the like.
- DSPC 1,2-distearolyl-sn-glycero-3-phosphatidyl choline
- sphingomyelin phosphatidylcholine or monosialoganglioside and the like.
- cholesterol or 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine may be added to the lipid membrane. Addition of cholesterol decreases the rapid release of encapsulated bioactive compounds into plasma or 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine (DOPE) increases stability.
- the present invention relates to a composition for base correction comprising the fusion protein or the nucleic acid.
- the present invention relates to a base correction method comprising the step of treating cells with the composition.
- the cytosine deaminase of the fusion protein hydrolyzes the amino group of cytosine to transform it into uracil. Since uracil can base pair with adenine, cytosine-guanine base pairing through intracellular DNA replication can be corrected to uracil-adenine base pairing and finally thymine-adenine base pairing.
- the adenine deaminase of the fusion protein hydrolyzes the amino group of adenine to transform it into the form of hypoxanthine. Since hypoxanthine can base pair with cytosine, similarly, during intracellular DNA replication, adenine-thymine base pairing can be corrected to guanine-cytosine base pairing via hypoxanthine-cytosine base pairing.
- the cells are eukaryotic cells (eg, fungi such as yeast, eukaryotic and / or eukaryotic plant-derived cells (eg, embryonic cells, stem cells, somatic cells, germ cells, etc.)), eukaryotic animals (eg, humans, monkeys It may be a primate dog, pig, cow, sheep, goat, mouse, rat, etc.), or a eukaryotic plant (eg, algae such as green algae, corn, soybean, wheat, rice, etc.), but is not limited thereto.
- eukaryotic cells eg, fungi such as yeast, eukaryotic and / or eukaryotic plant-derived cells (eg, embryonic cells, stem cells, somatic cells, germ cells, etc.)
- eukaryotic animals eg, humans, monkeys It may be a primate dog, pig, cow, sheep, goat, mouse, rat, etc.
- a eukaryotic plant eg, algae such as green
- the present invention relates to a composition for nucleotide correction of plant cell DNA or a nucleotide correction method.
- the fusion protein or a nucleic acid encoding the same and NLS (nuclear localization signal) peptide, chloroplast transit peptide, mitochondrial targeting signal (MTS), extranuclear transport signal protein or a nucleic acid encoding the same, It relates to a composition for editing plant cell bases will be.
- the present invention also provides the fusion protein or nucleic acid; And NLS (nuclear localization signal) provides a composition for base correction of plant cells comprising a peptide or a nucleic acid encoding the same.
- the present invention also provides the fusion protein or nucleic acid; And chloroplast transit peptide (chloroplast transit peptide) or provides a composition for plant cell base correction comprising a nucleic acid encoding the same.
- the present invention also provides the fusion protein or nucleic acid; and Mitochondrial Targeting Signal (MTS) or a nucleic acid encoding the same. It provides a composition for editing plant cell bases.
- MTS Mitochondrial Targeting Signal
- the present invention also provides an extranuclear transport signal protein or a composition for correcting plant cell bases, further comprising a nucleic acid encoding the same.
- composition or base correction method for the correction of plant cell nuclear DNA, mitochondrial DNA, or chloroplast DNA relates to a composition or base correction method for the correction of plant cell nuclear DNA, mitochondrial DNA, or chloroplast DNA.
- the fusion protein can be delivered to plant cells through:
- the polynucleotide sequence encoding the fusion protein according to the present invention may be an RNA sequence, a DNA sequence, or a combination thereof (RNA-DNA combination sequence).
- the polynucleotide encoding the fusion protein can be delivered to plant cells through:
- Transformation using Agrobacterium for example, Agrobacterium tumefaciens , Agrobacterium rhizogen , etc.
- Viral vectors Geminivirus, tobacco rattle virus (TRV), tomato mosaic virus (ToMV), foxtail mosaic virus (FoMV), barley yellow striate mosaic virus (BYSMV), Sonchus yellow net rhabdovirus (SYNV), etc.;
- the virus is, for example, a viral vector: Geminivirus, tobacco rattle virus (TRV), tomato mosaic virus (ToMV), foxtail mosaic virus (FoMV), barley yellow striate mosaic virus (BYSMV), Sonchus yellow net rhabdovirus (SYNV), etc.
- TRV tobacco rattle virus
- ToMV tomato mosaic virus
- FoMV foxtail mosaic virus
- BYSMV barley yellow striate mosaic virus
- SYNV Sonchus yellow net rhabdovirus
- Each of the vectors is a local injection method (eg, direct injection of a lesion or target site), electroporation, lipofection, viral vectors, nanoparticles, as well as PTD (Protein translocation domain) fusion protein method, etc. can be delivered intracellularly.
- a local injection method eg, direct injection of a lesion or target site
- electroporation e.g., electroporation, lipofection, viral vectors, nanoparticles, as well as PTD (Protein translocation domain) fusion protein method, etc.
- PTD Protein translocation domain
- the plant organ may be a mitochondrion, a chloroplast or a plastid (white body, chromatid).
- the protein transported to the plant organ may be, for example, a chloroplast transit peptide or a mitochondrial targeting signal (MTS).
- MTS mitochondrial targeting signal
- Chloroplast Transit Peptide CTP
- Mitochondrial Targeting Signal MTS
- CTP Chloroplast Transit Peptide
- MTS Mitochondrial Targeting Signal
- CTP chloroplast transit peptide
- MTS mitochondrial targeting signal
- nucleic acid encoding the same is treated or delivered to plant cells to plant mitochondria, chloroplasts , can be used to correct bases in colored or white body DNA.
- the extranuclear transport signal protein may be derived from, for example, Mirute virus of mice (MVM), but is not limited thereto.
- the extranuclear transport signal protein may include, for example, the amino acid sequence of SEQ ID NO: 31, but is not limited thereto.
- VDEMTKKFGTLTIHDTEK (SEQ ID NO: 31)
- the present invention also provides a TAL (Transcription Activator-Like) effector (TALE) domain that cuts a wild-type DNA sequence but does not cut a corrected sequence, and a FokI nuclease or a nucleic acid or ZFN (zinc) encoding the same finger nuclease) or a nucleic acid encoding it, that is, mitoTALEN (Mitochondrial TALE Nuclease), a mitochondrial nuclease, or a nucleic acid encoding the same or ZFN (zinc finger nuclease) or a nucleic acid encoding the same. Even when used at the same time, higher efficiency of mitochondrial base correction can be expected.
- TALE Transcription Activator-Like effector
- the present invention relates to a composition for nucleotide correction of animal cell DNA or a nucleotide correction method.
- the fusion protein or a nucleic acid encoding the same and a nuclear localization signal (NLS) peptide, a mitochondrial targeting signal (MTS), an extranuclear transport signal protein, or a nucleic acid encoding the same, to a composition for editing animal cell bases.
- NLS nuclear localization signal
- MTS mitochondrial targeting signal
- extranuclear transport signal protein or a nucleic acid encoding the same
- the present invention also provides the fusion protein or nucleic acid; and NLS (nuclear localization signal) peptide or a nucleic acid encoding the same.
- the present invention also provides the fusion protein or nucleic acid; and mitochondrial targeting signal (MTS) or a nucleic acid encoding the same.
- MTS mitochondrial targeting signal
- the present invention also provides a composition for correcting the base of animal cells, optionally further comprising an extranuclear transport signal protein or a nucleic acid encoding the same.
- the animal cells are non-human animal cells, and include an extranuclear transport signal protein or a nucleic acid encoding the same; and/or by treating a mitochondrial targeting signal (MTS) or a nucleic acid encoding the same to correct the base of mitochondrial DNA in non-human animal cells.
- MTS mitochondrial targeting signal
- a mitochondrial targeting signal binds and is delivered to the mitochondria.
- MTS mitochondrial targeting signal
- the remainder except for the N-terminal MTS protein is transferred into the mitochondria in the form of a preprotein.
- the transfer protein part is separated, and a specific part can be base-corrected by targeting the mitochondria.
- TALE-DdCBE TALE DddA-derived cytosine base editor containing mitochondrial transduction signal, TAL effector and cytosine deaminase (DddA tox ) or a nuclear export signal (NES) to a nucleic acid encoding the same
- Extranuclear transport signals may reduce nuclear DNA base correction to mitochondrial-nuclear-like sequences.
- the present invention it is possible to achieve more efficient animal mitochondrial DNA base correction, including the extranuclear transport signal protein or a nucleic acid encoding the same.
- the extranuclear transport signal protein may be derived from, for example, Mirute virus of mice (MVM), but is not limited thereto.
- the extranuclear transport signal protein may include, for example, the amino acid sequence of VDEMTKKFGTLTIHDTEK (SEQ ID NO: 31), but is not limited thereto.
- the corrected nucleotide sequence is a TAL (Transcription Activator-Like) effector (TALE) domain that cannot be cut and FokI nuclease (FokI Nuclease) or a nucleic acid encoding the same or ZFN (zinc finger nuclease) or a nucleic acid encoding the same to eukaryotic cells.
- TALE Transcription Activator-Like effector
- extranuclear transport signal protein or nucleic acid encoding the same and/or mitochondrial targeting signal (MTS) or a nucleic acid encoding the same may be included.
- nucleotide-correcting protein when an extranuclear transport sequence is attached to a nucleotide-correcting protein during animal mitochondrial gene editing, the nucleotide is corrected with higher efficiency, and in animal embryos, non-specific nucleotide correction of a similar sequence in the nucleus is also suppressed.
- the present invention also further includes mitochondrial nucleic acid hydrolase mitoTALEN (Mitochondrial TALE Nuclease) or a nucleic acid encoding the same, so that even when using a mitochondrial sequence cleavage protein at the same time, higher efficiency of mitochondrial base correction can be expected.
- Mitochondrial DNA can be cut using mitochondrial DNA nuclease mitoTALEN (Mitochondrial TALE Nuclease), and wild-type mitochondrial genomes can be cut to obtain base-corrected genomes from animals with high efficiency.
- the present invention also further includes mitochondrial nucleic acid hydrolase mitoTALEN (Mitochondrial TALE Nuclease) or a nucleic acid encoding the same, so that even when using a mitochondrial sequence cleavage protein at the same time, higher efficiency of mitochondrial base correction can be expected.
- mitoTALEN Mitochondrial TALE Nuclease
- it may include a fusion protein (mitoTALEN) or a nucleic acid encoding the TAL effector domain to which a mitochondrial transduction signal is bound and FokI nuclease (FokI Nuclease) or ZFN or a nucleic acid encoding the same.
- Mitochondrial DNA can be cut using mitochondrial DNA nuclease mitoTALEN (Mitochondrial TALE Nuclease), and wild-type mitochondrial genomes can be cut to obtain base-corrected genomes from animals with high efficiency.
- mitoTALEN Mitochondrial TALE Nuclease
- UGI uracil DNA glycosylase inhibitor
- UGI can increase base editing efficiency by inhibiting the activity of Uracil DNA glycosylase (UDG), an enzyme that repairs mutant DNA that catalyzes the removal of U from DNA.
- UGG Uracil DNA glycosylase
- DddA-derived cytosine base correctors consisting of a fragmented bacterial toxin DddAtox, a transcription activator-like effector (TALE) designed to bind to DNA, and a uracil glycosylation inhibitor (UGI) Thymine base modifications were made possible in mitochondrial DNA.
- DdCBEs DddA-derived cytosine base correctors
- TALE transcription activator-like effector
- UMI uracil glycosylation inhibitor
- DNA-binding protein, deaminase or a variant thereof or a nucleic acid encoding the same is linked to the (1) extranuclear transport signal protein or nucleic acid encoding the same, 3) mitoTALEN (Mitochondrial TALE Nuclease) or a nucleic acid encoding it can be linked.
- mitoTALEN Mitochondrial TALE Nuclease
- a single or a plurality of delivery means may be used in combination in the same or different configurations.
- Each delivery system may be a viral delivery means at the same time, one viral delivery means and the other non-viral delivery means, or simultaneously a non-viral delivery means.
- the extranuclear transport signal protein, DdCBE, and mitoTALEN of (1) to (3) above may be mixed and delivered.
- One or more of the above (1) to (3) can be delivered to the extranuclear transport signal protein, DdCBE, and mitoTALEN, and some can be delivered by placing the DNA sequence encoding (1) to (3) on a vector.
- the DNA sequences encoding the above (1) to (3) can be delivered simultaneously through one vector by positioning them on the same vector, or can be delivered by being positioned on another separate vector.
- Animals according to the present invention may include human or non-human animals.
- the non-human transgenic animal may be an insect, an annulus, a mollusk, a brachiopod, a linear animal, a coliform, a sponge, an axon, or a vertebrate, and the vertebrate may be a fish, an amphibian, a reptile, a bird or a mammal,
- the insect may be a fruit fly (Drosophila)
- the linear animal may be C. elegans
- the fish may be a zebrafish
- the mammal may be a primate, carnivorous, carnivorous, or rodent. It may be a neck, an oxiform, a progenitor, or a progenitor
- the rodent may be a rat or a mouse.
- a base-corrected animal can be prepared by introducing the composition according to the present invention into an embryo of a human or non-human animal, transplanting the embryo in a surrogate mother, and impregnating the embryo.
- the composition according to the present invention can be introduced into a fertilized egg of an animal and cultured.
- the obtained fertilized egg can be transplanted into a surrogate mother for delivery.
- the non-human transgenic animal may further comprise the step of confirming whether or not transgenic after delivery.
- the non-human transgenic animals can be crossed to produce offspring transgenic animals.
- the "offspring” refers to all transgenic animals that are viable by crossing with the non-human transgenic animal, and more specifically, by crossing the transgenic animal as a parent and transgenic animals or by crossing the transgenic animal with a normal animal. It refers to the F1 generation produced, the F2 generation produced by crossing an F1 generation animal with a normal animal, and generations thereafter, but is not limited thereto.
- the cross may be characterized in that the cross with the transgenic animal or the normal animal.
- the present invention may include cells, tissues and by-products isolated from the transgenic animal or progeny transgenic animal.
- the by-product means any material derived from the transgenic rabbit, but is preferably selected from the group consisting of blood, serum, urine, feces, saliva, organs and skin, but is not limited thereto.
- the ZFD platform includes a DNA binding protein, interbacterial toxin deaminase DDDAtox (DDDAtox), and a uracil glycosylase inhibitor (UGI).
- DDDAtox interbacterial toxin deaminase DDDAtox
- UGI uracil glycosylase inhibitor
- Indels small unwanted insertions and deletions
- ZFD does not cut DNA to make single or double-stranded breaks, so unwanted insertions and deletions (indels) by error-prone non-homologous end joinig at the target site This does not happen.
- the recombinant ZFD proteins purified from E. coli spontaneously pass through human cells to convert the target base to another base (base conversion). This proves the proof-of-princile of gene-free gene therapy.
- ZFNs zinc finger nucleases
- TALE transcription activator-like effector nucleases
- DdCBEs transcription activator-like effector nucleases
- base editors CRISPR -Cas9
- Cas9-linked deaminases with abolished cleavage activity include, but are not limited to.
- ZFNs zinc finger nucleases
- TALE transcription activator-like effector nucleases
- DdCBEs transcription activator-like effector nucleases
- Cas9-linked deaminases with abolished cleavage activity aka base editors
- base editors Cas9-linked deaminases with abolished cleavage activity
- nucleases Function as DNA binding sites
- deaminases split DddA tox in DdCBE and CBE in CBE
- APOBEC1 functions as a catalytic unit.
- Crispr-cas9 has both a nuclease function and an RNA-guided DNA binding protein function.
- Custom-designed, programmable nucleases such as ZFNs, TALENs and Cas9 cut DNA and cause double-strand breaks. It causes gene knock-out and knock-in in a targeted manner while repairing it.
- programmable nuclease-induced double-strand breaks can lead to large deletions of unwanted genes at the target site, p53 activation, and chromosomal rearrangement during simultaneous DSB repair at the target and non-target sites.
- programmable base correctors including cytosine and adenine base correctors (CBE and ABE)
- CBE and ABE cytosine and adenine base correctors
- CBE and ABE cytosine and adenine base correctors
- ZFD zinc finger deaminase
- zinc finger array (2 x 0.3 ⁇ 0.6 k base pair) is smaller in size than the TALE array (2 x 1.7 ⁇ 2k base pair) or S.pyogenes Cas9 (4.1 k base pair), in vivo
- ZFD-encoded genes can be easily loaded into viral vectors with virally restricted cargo space, such as AAV.
- AAV virally restricted cargo space
- zinc finger arrays are engineering-friendly because they do not have bulky domains at the C-terminus or N-terminus.
- the split DddAtox half can be fused to either the C-terminal part or the N-terminal part of the zinc finger protein.
- zinc finger proteins have intrinsic cell-penetrating ability. This allows nucleic acid-free gene editing in human cells. These properties make zinc finger proteins an ideal platform for base correction in the nucleus or other organelles as a DNA binding module.
- the p3s-ZFD plasmid for mammalian expression was prepared by cleaving the p3s-ABE7.10 plasmid (addgene, #113128) with HindIII and XhoI (NEB) enzymes and then modifying it.
- the enzymatically cleaved p3s plasmid and the synthesized insert DNA were assembled using a HiFi DNA Assembly Kit (NEB). All insert DNAs encoding MTS-, ZFP (Toolgen, Sangamo and Barbas modules)-, split DddA- or UGI were synthesized by IDT.
- the pTarget plasmid was designed to determine the optimal length of the spacer sequence for ZFD activity.
- Each pTarget plasmid containing a multi-length spacer and two ZFP binding sites was constructed by inserting the ZFP binding sequence and the spacer sequence into the pRGS-CCR5-NHEJ reporter plasmid digested with two enzymes (EcoRI and BamHI, NEB).
- the pET-ZFD plasmid for protein production in E. coli was generated by cutting the pET-Hisx6-rAPOBEC1-XTEN-nCas9-UGI-NLS plasmid (addgene, #89508) with NcoI and XhoI (NEB) and then modifying it.
- the ZFD sequence was amplified from the p3s-ZFD plasmid using PCR, and Hisx6 tag and GST tag sequences were synthesized as oligonucleotides (Macrogen). All plasmids for protein purification were constructed by inserting the sequences encoding the ZFD and tag into the enzymatically digested pET plasmid using the HiFi DNA Assembly Kit (NEB). The chemically acceptable DH5 ⁇ E. coli cells were transformed with a plasmid, and the plasmid was purified with AccuPrep Plasmid Mini Extraction Kit (Bioneer) according to the manufacturer's protocol. After confirming the entire sequence by Sanger sequencing, the desired plasmid was selected.
- NEB HiFi DNA Assembly Kit
- HEK 293T cells (ATCC CRL-11268) were cultured in Dulbecco's Modified Eagle Medium (Welgene) supplemented with 10% fetal bovine serum (Welgene) and 1% antibiotic-antifungal solution (Welgene).
- HEK 293T cells (7.5 ⁇ 104) were seeded in a 48-well plate. After 18-24 hours, when the cells have grown to 70-80%, transfect the left and right ZFD-encoding plasmids (500 ng each) with Lipofectamine 2000 (1.5 ⁇ L, Invitrogen), or pTarget plasmid (10 ng).
- HEK 293T cells were transfected with serially diluted plasmids or mRNAs encoding ND1 or ND2 target mitoZFD pairs. The amount of structure (ng) is delivered per 7.5 ⁇ 104. mtDNA was extracted from the cells 96 hours after transfection.
- K562 cells were cultured in RPMI 1640 medium supplemented with 10% fetal bovine serum (Welgene) and 1% antibiotic-antifungal solution (Welgene).
- An Amaxa 4D-NucleofectorTM X Unit system with program FF-120 (Lonza) was used for ZFD delivery into K562 cells by electroporation.
- the maximum volume of substrate solution added to each sample was 2 ⁇ L.
- K562 cells (1x105) were transfected with 220 pmol (for maximal dose) or 110 pmol (half of maximal dose) of left and right ZFD respectively for protein and 500ng of plasmid encoding left and right ZFD for plasmid. .
- a mixture of left and right ZFD proteins (final concentration 50 ⁇ M) or a mixture of left and right ZFD encoding plasmids (500 ng each) was diluted with serum-free medium pH 7.4 containing 100 mM L-arginine and 90 ⁇ M ZnCl2 and the final volume was It was made into 20 ⁇ L.
- K562 cells (1 ⁇ 105) were centrifuged at 100 g for 5 minutes, and the supernatant was removed. Cells were then lysed in diluted ZFD solution and incubated at 37 °C for 1 h. After incubation, the cells were centrifuged at 100 g for 5 minutes, and then a fresh culture medium was added. Cells were maintained at 30 °C (transient hypothermic conditions) or 37 °C for 18 h and then grown for two more days at 37 °C. Some cells were treated twice according to the above procedure. Cells were analyzed 96 hours after treatment.
- the culture was placed on ice for about 1 h, after which 0.5 mM isopropyl ⁇ -D-1-thiogalactopyranoside (IPTG; GoldBio) was added to induce ZFD protein expression and the culture was incubated at 18 °C. incubated for 14 hours.
- IPTG isopropyl ⁇ -D-1-thiogalactopyranoside
- lysis bath 50 mM Tris-HCl (Sigma-Aldrich), 500 mM NaCl (Sigma-Aldrich), 1 mM MgCl2 (Sigma-Aldrich), 10 mM 1,4-dithiothreitol (DTT; GoldBio)) , 1% Triton X-10 Sigma-Aldrich), 10% glycerol, 1 mM phenylmethylsulfonyl fluoride (Sigma-Aldrich), 1 mg/ml lysozyme from chicken egg white (Sigma-Aldrich), 100 ⁇ M ZnCl 2 (Sigma) -Aldrich), 100 mM Sigma-Aldrich), pH 8.0).
- the cells were lysed, followed by sonication (3 min total, 5 s on, 10 s off) to further lyse the cells. After doing these, the solution was centrifuged (13,000 rpm) to extract only the supernatant. The supernatant was incubated for 1 hour by adding Glutathione Sepharose 4B (GE healthcare).
- GE healthcare Glutathione Sepharose 4B
- wash buffer 50 mM Tris-HCl (Sigma-Aldrich), 500 mM NaCl (Sigma-Aldrich), 10 mM DTT (GoldBio), 1 mM MgCl2 (Sigma-Aldrich), 100 ⁇ M) ZnCl2 (Sigma-Aldrich), 10% glycerol, 100 mM arginine (Sigma-Aldrich), pH 8.0
- wash buffer 50 mM Tris-HCl (Sigma-Aldrich), 500 mM NaCl (Sigma-Aldrich), 10 mM DTT (GoldBio), 1 mM MgCl2 (Sigma-Aldrich), 100 ⁇ M) ZnCl2 (Sigma-Aldrich), 10% glycerol, 100 mM arginine (Sigma-Aldrich), pH 8.0
- Proteins attached to resin are elution buffer (50mM Tris-HCl (Sigma-Aldrich), 500mM NaCl (Sigma-Aldrich), 1mM MgCl2 (Sigma-Aldrich), 40 mM glutathione (Sigma-Aldrich), 10% glycerol) , 1mM DTT (GoldBio), 100 ⁇ M ZnCl2 (Sigma-Aldrich), 100 mM arginine (Sigma-Aldrich), pH 8.0) was separated from the resin. Finally, the extracted protein was concentrated to a concentration of ⁇ 15 ng/ ⁇ L (200-240 pmol/ ⁇ L, depending on protein size).
- elution buffer 50mM Tris-HCl (Sigma-Aldrich), 500mM NaCl (Sigma-Aldrich), 1mM MgCl2 (Sigma-Aldrich), 40 mM glutathione (Sigma-Aldrich), 10% glyce
- Amplicons containing TRAC sites were prepared using PCR. 8 ⁇ g of amplicons were incubated with 2 ⁇ g of each ZFD protein (Left-G1397N and Right-G1397C) in NEB3.1 buffer containing 100 ⁇ M ZnCl2 for 1-2 h at 37 °C. After the reaction, 4 ⁇ L of Proteinase K solution (Qiagen) was added and incubated at 55 °C for 30 minutes to remove ZFD, and the amplicon was purified using a PCR purification kit (MGmed). 1 ⁇ g of purified amplicons were incubated with two USER enzymes (NEB) for 1 h at 37 °C. The amplicons were then incubated with 4 ⁇ L of proteinase K solution (Qiagen) and purified again using a PCR purification kit (MGmed). Purified PCR was electrophoresed on an agarose gel and imaged.
- the target site was subjected to overlapping primary PCR, secondary PCR amplification, and tertiary PCR using TruSeq HT Dual index-containing primers using PrimeSTAR® GXL DNA polymerase (TAKARA).
- TAKARA PrimeSTAR® GXL DNA polymerase
- a DNA template comprising a T7 RNA polymerase promoter upstream of the ZFD sequence was prepared with forward and reverse primers (forward: 5'-CATCAATGGGCGTGGATAG-3' SEQ ID No: 116, reverse: 5'-CATCAATGGGCGTGGATAG-3' SEQ ID No: 117 , reverse: 5'-GACACCTACTCAGACAATGC-3' SEQ ID No: 118).
- mRNA was synthesized in vitro using the mMESSAGE mMACHINETM T7 ULTRA Transcription Kit (Thermo Fisher). In vitro transcribed mRNA was purified using the MEGAclearTM Transcription Clean-Up Kit (Thermo Fisher) according to the manufacturer's protocol.
- NGS library generation Illumina DNA Prep kit containing NexteraTM DNA CD Indexes (Illumina) was used to generate NGS libraries from the extracted mtDNA.
- NGS Libraries were pooled and loaded into a MiniSeq sequencer (Illumina). The average sequencing depth was greater than 50.
- BWA was used to align the Fastq file to the GRCh38.p13 (release v102) reference genome and correct the read pairing information and flags to generate the BAM file with SAMtools (v.1.9).
- the REDItoolDenovo.py script from REDItools (v.1.2.1) was used to identify positions with a base correction rate greater than 1% among all cytosines and guanines in the mitochondrial genome. Positions with a base correction rate of 50% or more in the cell line were considered as single nucleotide mutations and excluded from all samples. For off-target analysis, the target site of each ZFD was excluded.
- the remaining positions with a correction frequency ⁇ 1% were considered off-target and the number of corrected C/G nucleotides was calculated.
- To calculate the T/A base correction frequency at the mean C/G of the offtarget of the mitochondrial genome it was averaged over all C/Gs.
- the specificity ratio was calculated by dividing the on-target average value by the off-target average value.
- a mitochondrial genome-wide graph was generated by plotting base correction rates at on- and off-target positions.
- DddAtox can be cleaved at two positions (G1333 and G1397) and each half can be fused to either left or right ZFP.
- Hek293T cells were measured by deep sequencing on the 4th day of transfection.
- PKKKRKV (SEQ ID No: 478)
- ZFDs with short linkers (2 and 5 amino acid (AA) linkers) have low or no efficiency.
- the C to T base correction efficiency in spacers of 4 base pairs or more was in the range of 1% to 24% ( FIGS. 1c and 2a,c ).
- the one with 24AA linker showed the highest editing efficiency.
- the 24AA linker was fixed on the ZFD on the left side of the ZFD pair, and the base correction efficiency was observed by combining the right side with ZFDs having various linker lengths, and the same was done in reverse (Figs. 1d and 3). . It was found that both of them had the 24AA linker with the most efficiency.
- ZFD with 24AA linker in human cells can catalyze C to T base correction even at chromosomal target sites in vivo.
- 22 pairs of ZFDs targeting 11 sites (two ZFD pairs in one place) in a total of 8 genes were produced (FIG. 4).
- 14 pairs of ZFDs were used from publicly available zinc finger resources.
- Another eight pairs of ZFDs were made by modifying previously-characterized ZFNs (specific to CCR5 and TRAC). The reason is that ZFN cuts the target DNA at a spacer length of 5 to 7 bp, whereas ZFD operates a spacer of at least 7 or more.
- FokI nuclease part can be fused to the N-terminal or C-terminal part to ZFP to make ZFNs with four different configurations, also two pairs of ZFDs with different configurations (Trac- NC) and split DddAtox halves were tested whether they could be fused to the N-terminal part of ZFP as well as the existing ZFP C-terminus (NC configuration is shown in Figs. 4a and 5).
- Type C SV40 NLS-Zinc finger protein-24aa linker-DddA tox half-4aa linker-UGI
- PKKKRKV (SEQ ID No: 478)
- the C-to-T base correction efficiency of ZFD is 1.0% to 60%.
- indels rarely occurred (Fig. 4b and Fig. 6), about ⁇ 0.4%.
- the ZFD targeting CCR5 with a 5bp spacer had very poor efficiency.
- the other 20 ZFD pairs showed an average editing efficiency of 12.0 ⁇ 3.4%, which is comparable to the cas9-derived Base Editor2, which shows an average of 8.3 ⁇ 2.2%.
- the base correction from C to T occurred not only in the TC context but also in A C or GC C ( FIGS. 4c to 4f ).
- a C at C 6 of NUMBL
- the nucleotide correction efficiency of the ZFD protein was tested in vitro using a PCR amplicon having a TRAC site, and it was confirmed that the efficiency was very high. Efficiency was confirmed by cleaving the gene using uracil-specific cleavage reagent (USER), a mixture of Uracil DNA glycosylase and DNA glycosylase-lyase Endonuclease VIII (FIG. 7).
- the TRAC-NC ZFD protein was delivered to human leukemia K562 cells, which are difficult to transfect cells, in two ways, by electroporation or direct delivery without electroporation. The ZFD protein was very efficient. Base correction from C to T showed 26.5% (electroporation) and 17% (direct delivery) ( FIG. 4G ). Taken together, these results show that either a plasmid encoding ZFD or a purified recombinant ZFD protein can be used to base-correct the nuclear DNA of human cells.
- mitoZFDs were constructed by linking a mitochondrial targeting signal (MTS) and a nuclear export signal (NES) to the N-terminal portion of nine ZFDs designed to target mitochondrial genes ( FIG. 8 ).
- the ZFP portion of ZFD is taken from the publicly available zinc finger resource.
- the ZFD was manufactured to have a spacer length of 7 to 15 bp, and the DNA binding site was made to be 12 bp on both the left and right sides.
- VDEMTKKF Minute virus if mice; MVM NES
- Zinc fingers are connected by TGEKP linkers. (ZF1-linker-ZF2-linker-ZF3-linker-ZF4).
- the ND2-target mitoZFD has a QQ variant.
- This variant is one in which R or K amino acids are substituted with Q. marked in red letters.
- the mitochondrial DNA base correction efficiency by mitoZFD in HEK293T cells is 2.6%-30% (average 14 ⁇ 3%) ( FIG. 9a ).
- Most cytosines having a T C context in the spacer part were base-corrected with various efficiencies (FIGS. 9b-g).
- cytosine having A CC (C 8 and C 9 ) context in the ND2 region also showed efficiencies of about 7.4% and 19.9%, respectively (FIG. 9b). This shows that ZFD-mediated C to T base correction is not limited to the TC motif.
- Base correction is a relatively new technique that can correct target bases without DNA repair templates without causing DNA double-strand breaks.
- Base correction can cause C to T or A to G base correction in cells, animals and plants to study the functional effects of single base mutations (SNPs), and for therapeutic applications to correct disease-causing point mutations.
- SNPs single base mutations
- Two types of base correction techniques have been developed. It is CRISPR-based adenine and cytosine base correction scissors and DddA-based base correction technology.
- CRISPR-based base-correction scissors constitute a catalytically-impaired Cas9 or Cas12a as a DNA binding unit, and deaminase has a single-strand DNA specific from rat or E. coli.
- DdCBE it consists of a TALE DNA binding array and a double-strand DNA specific DddAtox.
- ZFD is smaller in size. This is because the size of the zinc finger protein contained in ZFD is small, whereas the size of the TALE array contained in DdCBE is large. Consequently, a gene encoding a ZFD pair can be easily loaded into an AAV vector with a small mount space, whereas a gene encoding a DdCBE pair cannot. Additionally, it is easy to engineer due to its simple ZFP properties. Since the half DddAtox can be fused to either the N-terminal or C-terminal portion of ZFP, it can be made to operate either upstream or downstream of the ZFP binding site. Moreover, ZFD recombinant proteins can spontaneously penetrate human cells without electroporation or lipofection.
- ZFD pairs or mixed ZFD/DdCBE pairs can create unique mutation patterns. This was a pattern that could not be achieved using only DdCBE. These properties make ZFD a powerful new platform for the modeling and treatment of mitochondrial diseases.
- Plant organelles including mitochondria and chloroplasts, each have their own genomes, encoding many essential genes for respiration and photosynthesis. Plant organelle gene editing, an unmet condition for plant genetics and biotechnology, has been limited by the lack of appropriate tools to target the DNA of these organelles.
- Golden Gate consisting of 16 expression plasmids (8 for mitochondrial delivery of the resulting protein, and another 8 for delivery to the chloroplast) and 424 TALE subarray plasmids to assemble a DddA-derived cytosine base correction plasmid (DdCBE)
- DdCBE DddA-derived cytosine base correction plasmid
- DdCBE messenger RNA was transferred to the lettuce protoplast, and base correction was demonstrated in the chloroplast without DNA.
- lettuce kali and seedlings with a correction efficiency of up to 99% that were resistant to streptomycin or spectinomycin were made.
- DdCBEs are composed of an isolated non-toxic domain derived from the bacterial cytosine deaminase toxic substance DddAtox and a TALE array and UGI designed for a specific position. It functions to cause a substitutional cytosine deamination reaction.
- the results of DdCBEs were used to demonstrate the fast and convenient binding of mitochondrial and chloroplast-expressing DdCBE plasmids and to demonstrate high and efficient organelle base editing in plants.
- the DdCBE Golden Gate destination vector was constructed using the Gibson assembly method. Sequences encoding TAL N-terminal domain, HA tag, FLAG tag, TAL C-terminal domain, split DddAtox, and UGI were codon-optimized for dicot (Arabidopsis thaliana) expression, and synthesized through Integrated DNA Technology. Sequences encoding CTP from AtinfA and AtRbcS and MTS from the ATPase delta subunit and ATPase gamma subunit were amplified from Arabidopsis cDNA. For plant expression, the mammalian CMV promoter was replaced with the PcUbi promoter and the pea3A terminator in the backbone plasmid and used. To construct the vector for in-flight DdCBE mRNA transcription, a T7 promoter cassette was introduced between the PcUbi promoter and the DdCBE encoding region in the DdCBE Golden Gate destination vector.
- the TALE array gene was constructed using a single golden gate assembly.
- the DdCBE expression plasmid was constructed by Golden Gate assembly of BsaI digestion and T4 ligation using 424 TALE array plasmids and a destination vector.
- Single golden gate cloning was performed as follows. 20 repetitions of 37°C and 50°C for 5 minutes each, followed by a final 50°C 15-minute reaction followed by 80°C for 5 minutes. All plant protoplast transfection vectors were purified using Plasmid Plus Midifrap Kit (Qiagen). The DNA and amino acid sequences of the vector are as follows.
- a specific amino acid sequence for the construction of DdCBE and a specific amino acid sequence for TALE repeat are as follows.
- DdCBE DNA template was prepared by PCR using fusion DNA polymerase (Thermo Fisher). DdCBE mRNA was synthesized and purified using an in-flight mRNA synthesis kit (Engnomics).
- Protoplast extraction and transduction are performed according to previous studies. Cotyledons of 7-day-old lettuce and 14-day-old rapeseed are treated for 3 hours in dark conditions shaking (40 rpm) in an enzyme solution. The protoplast-enzyme mixture is obtained from a sucrose solution by washing with the same amount of W5 solution, and then centrifuging the intact protoplasts at 80 g for 7 minutes. Protoplasts are transduced using polyethylene glycol after treatment at 4° C. for 1 hour in W5 solution.
- Lettuce protoplasts and rape protoplasts are resuspended in MMG solution and then transduced with plasmid or mRNA using PEG and incubated at room temperature for 20 minutes.
- the PEG-protoplast mixture is rinsed 3 times using the same amount of W5 solution, and then incubated for 10 minutes while slowly inverting each time.
- the protoplasts are then centrifuged at 100 g for 5 minutes to form pellets.
- Lettuce protoplasts were resuspended with lettuce protoplast culture medium (LPCM) after introduction of the plasmid encoding DdCBE.
- Protoplasts including the medium are mixed 1:1 with the medium and the medium containing low-melting agarose 2.4%, and then immediately put on a 6-well plate. After the mixture is solidified, 1 ml of liquid medium is placed on the embedded protoplast, and then cultured at 25° C. in the dark for 1 week. After the initial culture, the liquid medium on top is changed weekly with a fresh medium, and the embedded protoplasts are cultured for 16 hours under light conditions for 8 hours under dark conditions for 1 week, and then cultured for 2 weeks at 16 hours under light conditions and 8 hours under dark conditions.
- LPCM lettuce protoplast culture medium
- Small calli derived from protoplasts are cultured in redifferentiation medium for 4 weeks at 25°C for 16 hours under light conditions for 8 hours under dark conditions.
- protoplasts were cultured for 1 week in dark conditions at 25°C in a liquid medium without embedding.
- small callus embedded for a month were cultured for 4 weeks in a redifferentiation medium containing 50 mg/L streptomycin or 50 mg/L spectinomycin at 25° C. for 16 hours under light conditions for 8 hours under dark conditions. .
- antibiotic-resistant green calli or non-antibiotics were transferred to fresh redifferentiation medium containing 200 mg/L streptomycin or 50 mg/L spectinomycin.
- Rapeseed protoplasts introduced with the DdCBE encoding plasmid were resuspended in rapeseed culture medium.
- the protoplast-medium mixture is transferred to a 6-well dish and incubated for 2 weeks at 25°C in the dark. Two weeks later, the protoplasts were cultured for 16 hours under light light conditions and 8 hours dark conditions for 3 weeks. The medium was replaced with very fresh medium.
- RNA of cells cultured in a liquid medium or transformed callus was extracted using a DNA plant mini kit or an RNG plant mini kit. Cultured cells or callus were harvested by centrifugation at 10,000 rpm for 1 minute. cDNA from total RNA was reverse transcribed using RNA to cDNA EcoDry Premix (Takara).
- the target region was amplified using a fusion enzyme and appropriate primers (Supplementary Table 1). Three rounds of PCR (first, nested PCR, second, PCR, third, indexing PCR) were performed to create a DNA sequence analysis library. After collecting the same amount of DNA, it was sequenced using MiniSeq (Illumina) equipment. Paired sequencing files were analyzed by Cas-analyzer and computer program source code.
- DdCBE cp-DdCBE
- mt-DdCBE DdCBE
- the expression plasmid encodes a chloroplast transfer peptide or mitochondrial targeting sequence as a bound protein, the N- or C-terminal domain of TALE, split DddAtox (G1333N, G1333C, G1397N, and G1397C) and UGI, which have been optimized for expression in dicotyledonous plants. It is regulated by the parsley ubiquitin (PcUbi) promoter and the pea3A terminator.
- PcUbi parsley ubiquitin
- the custom-designed TALE DNA binding sequence and DdCBE plasmid can be created in a single subcloning step by mixing an expression vector and six TALE subarray plasmids into an E-tube.
- a total of 424 (6X64 3 sequence recognition + 2X16 2 sequence recognition + 2 X 4 1 sequence recognition) modular TALE subarray plasmids contain a conserved T at the 5' end of the cp to recognize 16-20 nucleotides in length -DdCBE and mt-DdCBE can be made. Consequently, functionally, the DdCBE heterodimer recognizes a 32 to 40 bp DNA sequence.
- rape protoplasts In rape protoplasts, the other combination (Left-G1333-N+Right-G1333-C) showed the highest efficiency at the four cytosine positions (C3, C4, C11, C12) and showed efficiencies up to 3.5% (C3).
- C3 and C4 are 5'-TCC sequences, but in lettuce, they have a 5'-ACC sequence because of a relatively single nucleotide polymorphism. causative, but not in the lettuce gene.
- the cp-DdCBE combination targeting the psbB gene of rapeseed protoplasts replaced two cytosines with TCC sequences with an efficiency of 0.36% to 4.1% ( FIG. 25 ).
- a plasmid encoding mt-DdCBE targeting the atp6 gene of lettuce and rapeseed and the rps14 gene of rapeseed was prepared (using the Golden Gate cloning system), and the plasmid was introduced into the protoplasts of lettuce and rapeseed. After 7 days of introduction, the nucleotide correction efficiency was measured through deep sequencing ( FIGS. 20e , f , 26 ).
- the off-target of TALE deaminase targeting the 16S rRNA site was analyzed in protoplasts, callus, and chute.
- Five potential off-target positions selected based on the sequence similarity in the target site (50 base pairs on both sides) (Fig. 31) or chloroplast genes in callus and suits derived from single cells and having antibiotic resistance (Fig. 32) It was measured that the off-target was not visible.
- the off-target in which TC was changed to TT was induced with a low efficiency of 1.2% to 4.1% in three of the five potential off-targets.
- DddA-derived cytosine base correctors including the cleaved bacterial toxin DddAtox, a transcription activator-like effector (TALE) designed to bind to DNA, and a uracil glycosylase inhibitor (UGI), are targeted to modify cytosine-thymine bases.
- TALE transcription activator-like effector
- UMI uracil glycosylase inhibitor
- MT-ND5 encoding a subunit of NADH dehydrogenase that catalyzes NADH dehydration and electron transfer to ubiquinone, which is a mutation associated with human mitochondrial disease, such as m.G12918A. and mutations that make an early stop codon such as m.C12336T.
- a mitochondrial disease model could be produced in mice, and the possibility of treating mitochondrial disease was presented.
- Plasmid assembly The TALEN (transcription activator-like effector nucleases) system was borrowed to construct the expression plasmid containing the DddA half and the final TALE-DddAtox construct.
- the nuclear transport signal and monomers in the FokI dimer were substituted with a mitochondrial transduction signal (MTS), a DddA deaminase half and a uracil glycosylase inhibitor (UGI). Sequences encoding MTS, DddA, and UGI were synthesized in IDT.
- MTS mitochondrial transduction signal
- UGI uracil glycosylase inhibitor
- the purified gene fragment was assembled using the HiFi DNA assembly kit (NEB), chemically transformed into E coli DH5a (Enzynomics), and confirmed by Sanger sequencing.
- NEB HiFi DNA assembly kit
- E coli DH5a Enzynomics
- Sanger sequencing eight different expression plasmids were obtained, in which the BsaI restriction site for Golden-gate cloning was between the sequences encoding the N- and C-terminal domains.
- the expression plasmid was loaded with a modular vector (each encoding a TALE sequence), BsaI-HFv2 (10 U), T4 DNA ligase (200 U) and reaction buffer in one tube.
- restriction enzyme and ligase reactions were repeated 20 times at 37°C for 5 minutes and 50°C for 5 minutes in a thermocycler, followed by treatment at 50°C for 15 minutes and 80°C for 5 minutes.
- the conjugated plasmid was introduced into E coli DH5 ⁇ through chemical transformation, and the final construct was confirmed by Sanger sequencing. Plasmids were mid-prep for cell line introduction.
- NIH3T3 CRL-1658, American Type Culture Collection (ATCC)
- ATCC American Type Culture Collection
- DMEM Gibco
- v/v 10% bovine serum
- lipofection cells were started to grow 18-24 hours before transfection at a density of 1.5 ⁇ 10 4 cells on 12-well cell culture plates (SPL, Seoul, Korea).
- SPL 12-well cell culture plates
- Lipofectamine 3000 Invitrogen
- 500 ng of each DdCBE fragment was used to introduce a total of 1,000 ng of plasmid DNA. Cells were harvested 4 days after transfection.
- mRNA production The mRNA template was PCR amplified using Q5 DNA polymerase (NEB), and the following primers were used (F: 5'-CATCAA TGGGCGTGGATAG-3'SEQ ID No. 268, R: 5'-GACACCTACTCAGACAATGC-3 SEQ ID No. 269).
- DdCBE mRNA was synthesized using an in vitro RNA transcription kit (mMESSAGE mMACHINE T7 Ultra kit, Ambion) and then purified using the MEGAclear kit (Ambion).
- mice All experiments involving mice were carried out with the approval of the Animal Care and Use Committee of the Institute for Basic Science. Superovulated C57BL/6J females were bred with C57BL/6J males, and ICR strain females were used as surrogates. Mice were housed in a specific pathogen-free facility under conditions of 12 h day-night cycle and constant temperature and humidity conditions (20–26 °C, 40–60%).
- Microinjection into mouse zygotes Superovulation, embryo collection, and microinjection, the processes just before microinjection, were carried out as described in the previous paper.
- a mixture containing left DdCBE mRNA (300 ng/ ⁇ l) and right DdCBE mRNA (300 ng/ ⁇ l) was diluted in DEPC-treated injection buffer (0.25 mM EDTA, 10 mM Tris, pH 7.4), The zygote was injected into the cytoplasm using a Nikon ECLIPSE Ti micromanipulator and a FemtoJet 4i microinjector (Eppendorf).
- Genotyping Embryos and tissues at the blastocyst stage were placed in a digestion buffer (25 mM NaOH, 0.2 mM EDTA, pH 10) and incubated at 95 °C for 20 minutes. The pH was adjusted to 7.4 as much as possible. DNeasy Blood & Tissue Kits (Qiagen) were used to isolate genomic DNA from pups, and analyzed by Sanger sequencing and targeted deep sequencing.
- the precipitate was dissolved in 20 ⁇ l of a solution (25 mM NaOH, 0.2 mM EDTA, pH 10) and then boiled at 95 ⁇ C for 20 minutes. To lower the pH, 2 ⁇ l of 1 M HEPES (free acids, without pH adjustment) was added to the mitochondrial lysate. 1 ⁇ l of the thus prepared solution was used as a PCR template strand for high-throughput sequencing analysis.
- DdCBE plasmid assembly To facilitate assembly of the custom-designed TALE sequence in DdCBE, an expression plasmid encoding the split DddAtox halves was constructed, resulting in a total of 424 (6 ⁇ 64 3 sequence recognition + 2 ⁇ 16 2 sequence recognition + 2) The Golden-Gate cloning system using ⁇ 4 1 sequence recognition) was used ( FIG. 33A ). As shown in Table 4, a ready-to-use DdCBE plasmid was prepared by mixing 6 TALE plasmids and an expression plasmid in the same tube, and had 15.5-18.5 repeat variable diresidue sequences (FIG. 38).
- DdCBE recognizes 17-20 DNA sequences, including the conserved thymine sequence at the 5' end.
- a fully functional DdCBE pair recognizes a total of 32 to 40 DNA sequences.
- the ND5 gene encoding the Mus musculus mitochondrial NADH-ubiquinone oxidoreductase chain 5 protein was selected.
- the ND5 protein is a key subunit of NADH dehydrogenase (ubiquinone), which catalyzes the transfer of electrons from NADH to the respiratory chain.
- Mutations in the ND5 gene in humans are known to be associated with mitochondrial encephalomyopathy, lactic acidosis, and stroke-like episodes (MELAS), and are also known to be associated with some symptoms of Leigh syndrome or Leber's hereditary optic neuropathy (LHON).
- MELAS mitochondrial encephalomyopathy
- MELAS lactic acidosis
- LHON hereditary optic neuropathy
- DdCBE plasmids were assembled, which were designed to induce two silent mutations, m.C12539T and m.G12542A.
- This plasmid was transfected into the NIH3T3 mouse cell line, and the frequency of base correction was measured 3 days later.
- the target range of cytosine bases was corrected with thymine with an efficiency of up to 19% ( FIG. 34A ).
- DddAtox exclusively deaminates only cytosines in the “TC” sequence, but only two cytosines in the TC context were corrected in the experimental results. Indels or other types of point mutations were not significantly generated within the calibration target range.
- TALE-DddAtox deaminase efficiently generated base translocations from C * G to T * A, with an efficiency of 2.2 to 25% in m.C12539 and 0.63 to 5.8% in m.G12542. Thereafter, DdCBE-injected embryos were transplanted into surrogate mothers to obtain progeny having m.C12539T and m.G12542T ( FIG. 39 ). 3 of 4 pups (F0) had C*G to T*A corrections, ranging from 1 to 27% (Fig. 34c). The two pups showed similar mutation levels in the toes and tail, and the efficiency was maintained 14 days after birth.
- mice were transplanted into surrogate mothers, and progeny having m.C12336T and m.G12341A mutations were obtained ( FIG. 39c ).
- Nine F0 mice (23%) out of a total of 27 showed C * G to T * A correction, and the efficiency ranged from 0.22 to 57% (Fig. 37d,e), through which the nonsense mutation of ND5 showed embryo culling. It can be seen that it does not cause
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Microbiology (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Plant Pathology (AREA)
- Biophysics (AREA)
- Physics & Mathematics (AREA)
- Medicinal Chemistry (AREA)
- Mycology (AREA)
- Crystallography & Structural Chemistry (AREA)
- Cell Biology (AREA)
- Enzymes And Modification Thereof (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Document Processing Apparatus (AREA)
Abstract
Description
Claims (54)
- (i) DNA 결합 단백질; 및(ii) 시토신 탈아미노효소 (deaminase) 또는 이의 변이체 유래인 제1분할체 및 제2분할체를 포함하는 융합단백질로,상기 제1분할체 및 제2분할체는 각각 상기 DNA 결합 단백질에 결합되는 형태인 융합단백질.
- (i) DNA 결합 단백질; 및(ii) 시토신 탈아미노효소 또는 이의 변이체 유래 비독성 전장 시토신 탈아미노효소를 포함하는 융합단백질.
- 제1항에 있어서, 상기 제1분할체와 제2분할체 각각은 시토신 탈아미노효소 활성이 없는 것을 특징으로 하는, 융합단백질.
- 제1항에 있어서, 상기 제1분할체는 서열번호 1의 서열 중 N 말단에서 G33, G44, A54, N68, G82, N98, G108로 구성된 군에서 선택되는 하나 이상까지의 서열을 포함하는 융합단백질.
- 제1항 또는 제2항에 있어서 상기 시토신 탈아미노효소는 이중 가닥 DNA에 작용하는 탈아미노효소 (DddA) 또는 이의 오솔로그 (orthologue)에서 유래한 것을 특징으로 하는 융합단백질.
- 제1항에 있어서, 상기 제2분할체는 서열번호 1의 서열 중 G34, P45, G55, N69, T83, A99, A109로 구성된 군에서 선택되는 하나 이상에서 C-말단까지의 서열을 포함하는 융합단백질.
- 제1항에 있어서, 상기 시토신 탈아미노효소의 변이체는 서열번호 1의 서열 중 N 말단에서 G44까지의 서열을 포함하는 제1분할체 중 3, 5, 10, 11, 13, 14, 15, 16, 17, 18, 19, 28, 30 및 31번 위치로 구성된 군에서 선택되는 하나 이상의 아미노산이 다른 아미노산으로 치환된 융합단백질.
- 제1항에 있어서, 상기 시토신 탈아미노효소의 변이체는 서열번호 1의 서열 중 P45에서 C-말단까지의 서열을 포함하는 제2분할체 중 13, 16, 17, 20, 21, 28, 29, 30, 31, 32, 33, 56, 57, 58 및 60번 위치로 구성된 군에서 선택되는 하나 이상의 아미노산이 다른 아미노산으로 치환된 융합단백질.
- 제1항에 있어서, 상기 시토신 탈아미노효소의 변이체는 서열번호 1의 서열 중 N 말단에서 G108까지의 서열을 포함하는 제1분할체 중 87, 88, 91, 92, 95, 100, 101, 102 및 103번 위치로 구성된 군에서 선택되는 하나 이상의 아미노산이 다른 아미노산으로 치환된 융합단백질.
- 제1항에 있어서, 상기 시토신 탈아미노효소의 변이체는 서열번호 1의 서열 중 A109에서 C-말단까지의 서열을 포함하는 제2분할체 중 13, 14, 15 및 16번 위치로 구성된 군에서 선택되는 하나 이상의 아미노산이 다른 아미노산으로 치환된 융합단백질.
- 제2항에 있어서, 상기 비독성 전장 시토신 탈아미노효소는 서열번호 1의 야생형 시토신 탈아미노효소 중 37, 59, 109, 129로 구성되는 군에서 선택되는 하나 이상 위치의 아미노산이 다른 아미노산으로 치환된 융합단백질.
- 제7항 내지 제11항 중 어느 한 항에 있어서, 상기 다른 아미노산은 알라닌인 융합단백질.
- 제2항에 있어서, 상기 비독성 전장 시토신 탈아미노효소는 서열번호 12 내지 22로 구성된 군에서 선택되는 하나 이상인 융합단백질.
- 제1항 또는 제2항에 있어서, 상기 DNA 결합 단백질은 징크 핑커 단백질 (zinc finger protein), TALE 단백질 또는 CRISPR 연관 뉴클레아제인 융합단백질.
- 제1항 또는 제2항에 있어서, 상기 DNA 결합 단백질은 2 내지 40개 아미노산 잔기를 포함하는 펩타이드 링커를 통해 시토신 탈아미노효소 또는 이의 변이체와 연결되는 것을 특징으로 하는 융합단백질.
- 제15항에 있어서, 상기 링커는 다음을 포함하는 융합단백질:2a.a 링커: GS5a.a 링커: TGEKQ (서열번호 8)10a.a 링커: SGAQGSTLDF (서열번호 9)16a.a 링커: SGSETPGTSESATPES (서열번호 10);24 a.a 링커: SGTPHEVGVYTLSGTPHEVGVYTL (서열번호 115); 또는32a.a 링커: GSGGSSGGSSGSETPGTSESATPESSGGSSGGS (서열번호 11).
- 제1항에 있어서, 상기 제1분할체 및 제2분할체 각각은 징크 핑거 단백질의 N-말단 또는 C-말단에 결합된 융합단백질.
- 제1항 또는 제2항에 있어서, 상기 시토신 탈아미노효소에 단일 TALE 어레이 (array) 또는 제 1 TALE 어레이 및 제 2 TALE 어레이가 각각 결합하는 융합단백질.
- 제1항 또는 제2항에 있어서, (iii) 아데닌 탈아미노효소를 추가로 포함하는 융합단백질.
- 제19항에 있어서, 상기 아데닌 탈아미노효소는 대장균 TadA의 변이체로서 디옥시-아데닌 탈아미노효소 (deoxy-adenine deaminase)인, 융합단백질.
- 제19항에 있어서, 상기 아데닌 탈아미노효소는 DNA 결합 단백질 또는 시토신 탈아미노효소 또는 이의 변이체의 N 또는 C 말단에 결합된 융합단백질.
- 제1항 내지 제21항 중 어느 한 항의 융합단백질을 코딩하는 핵산.
- 제22항에 있어서, 리보핵산 또는 DNA인 핵산.
- 제1항 내지 제21항 중 어느 한 항의 융합단백질 또는 제22항의 핵산을 포함하는 염기 교정용 조성물.
- 제24항에 있어서, UGI (uracil glycosylase inhibitor)를 추가로 포함하는 조성물.
- 제1항 내지 제21항 중 어느 한 항의 융합단백질 또는 제22항의 핵산을 포함하는 진핵세포 염기 교정용 조성물.
- 제1항 내지 제21항 중 어느 한 항의 융합단백질 또는 제22항의 핵산; 및NLS (nuclear localization signal) 펩타이드 또는 이를 코딩하는 핵산을 포함하는 식물세포 염기 교정용 조성물.
- 제1항 내지 제21항 중 어느 한 항의 융합단백질 또는 제22항의 핵산; 및엽록체 전달 펩타이드(chloroplast transit peptide) 또는 이를 코딩하는 핵산을 포함하는 식물세포 염기 교정용 조성물.
- 제1항 내지 제21항 중 어느 한 항의 융합단백질 또는 제22항의 핵산; 및미토콘드리아 전달 단백질 (Mitochondrial Targeting Signal, MTS) 또는 이를 코딩하는 핵산을 포함하는 식물세포 염기 교정용 조성물.
- 제29항에 있어서, 핵외 수송 신호 (Nuclear Export Signal, NES) 또는 이를 코딩하는 핵산을 추가로 포함하는, 조성물.
- 제27항 내지 제30항 중 어느 한 항에 있어서, 상기 융합단백질은 다음을 통해 식물세포에 전달되는 것을 특징으로 하는 조성물:Gene gun을 이용한 주입 (Bombardment);PEG-매개 원형질체 형질감염 (Protoplast transfection, PEG-mediated);전기천공에 의한 원형질체 형질감염 (Protoplast transfection, electroporation); 또는미세주사에 의한 원형질체 주사 (Protoplast injection, microinjection).
- 제31항에 있어서, 상기 핵산은 다음을 통해 식물세포에 전달되는 것을 특징으로 하는 조성물:Agrobacterium 예를 들어 Agrobacterium tumefaciens, Agrobacterium rhizogene 등을 이용한 형질전환;바이러스 형질감염;Gene gun을 이용한 주입 (Bombardment);PEG-매개 원형질체 형질감염 (Protoplast transfection, PEG-mediated);전기천공에 의한 원형질체 형질감염 (Protoplast transfection, electroporation); 또는미세주사에 의한 원형질체 주사 (Protoplast injection, microinjection).
- 제27항 내지 제30항 중 어느 한 항에 있어서, 상기 식물의 미토콘드리아, 엽록체 또는 색소체 (plastid: 백색체, 유색체)의 염기 교정용 조성물.
- 제27항 내지 제30항 중 어느 한 항에 있어서, 야생형 DNA 염기서열을 자르지만 교정된 염기서열은 자르지 못하는 TAL (Transcription Activator-Like) 이펙터 (TALE); 및 FokI 핵산 가수분해효소(FokI Nuclease) 또는 이를 코딩하는 핵산 또는 ZFN(zinc finger nuclease) 또는 이를 코딩하는 핵산을 추가로 포함하는 조성물.
- 제27항 내지 제30항 중 어느 한 항의 조성물을 처리하는 단계를 포함하는 진핵세포의 핵, 미토콘드리아, 또는 색소체 DNA의 염기를 교정하는 방법.
- 제35항에 있어서, 야생형 DNA 염기서열을 자르지만 교정된 염기서열은 자르지 못하는 TALEN 또는 ZFN 또는 이를 코딩하는 핵산을 추가로 포함해 염기교정의 효율을 높이는 방법.
- 제27항 내지 제30항 중 어느 한 항의 조성물을 식물세포에 처리하는 단계를 포함하는 식물세포 염기 교정방법.
- 제1항 내지 제21항 중 어느 한 항의 융합단백질 또는 제22항의 핵산; 및NLS (nuclear localization signal) 펩타이드 또는 이를 코딩하는 핵산을 식물세포에 처리하는 단계를 포함하는 식물세포 염기 교정방법.
- 제1항 내지 제21항 중 어느 한 항의 융합단백질 또는 제22항의 핵산; 및엽록체 전달 펩타이드(chloroplast transit peptide) 또는 이를 코딩하는 핵산을 식물세포에 처리하는 단계를 포함하는 식물세포 염기 교정방법.
- 제1항 내지 제21항 중 어느 한 항의 융합단백질 또는 제22항의 핵산; 및미토콘드리아 전달 단백질 (Mitochondrial Targeting Signal, MTS) 또는 이를 코딩하는 핵산을 식물세포에 처리하는 단계를 포함하는 식물세포 염기 교정방법.
- 제1항 내지 제21항 중 어느 한 항의 융합단백질 또는 제22항의 핵산; 및NLS (nuclear localization signal) 펩타이드 또는 이를 코딩하는 핵산을 포함하는 동물세포 염기 교정용 조성물
- 제1항 내지 제21항 중 어느 한 항의 융합단백질 또는 제22항의 핵산; 및미토콘드리아 전달 단백질 (Mitochondrial Targeting Signal, MTS) 또는 이를 코딩하는 핵산을 포함하는, 동물세포 염기 교정용 조성물.
- 제42항에 있어서, 핵외 수송 신호 (Nuclelar Export Signal) 또는 이를 코딩하는 핵산을 추가로 포함하는 조성물.
- 제42항에 있어서, 야생형 DNA 염기서열을 자르지만 교정된 염기서열은 자르지 못하는 TAL (Transcription Activator-Like) 이펙터 (TALE); 및 FokI 핵산 가수분해효소(FokI Nuclease) 또는 이를 코딩하는 핵산 또는 ZFN 또는 이를 코딩하는 핵산을 추가로 포함하는 조성물.
- 제41항 또는 제42항의 조성물을 동물세포에 처리하는 단계를 포함하는 동물세포의 염기 교정방법.
- 제1항 내지 제21항 중 어느 한 항의 융합단백질 또는 제22항의 핵산; 및NLS (nuclear localization signal) 펩타이드 또는 이를 코딩하는 핵산을 동물세포에 처리하는 단계를 포함하는 동물세포의 염기 교정방법.
- 제1항 내지 제21항 중 어느 한 항의 융합단백질 또는 제22항의 핵산; 및 미토콘드리아 전달 단백질 (Mitochondrial Targeting Signal, MTS) 또는 이를 코딩하는 핵산을 동물세포에 처리하는 단계를 포함하는 동물세포의 염기 교정방법.
- 제46항 또는 제47항에 있어서, 야생형 DNA 염기서열을 자르지만 교정된 염기서열은 자르지 못하는 TALEN 또는 ZFN 또는 이를 코딩하는 핵산을 추가로 포함해 염기교정의 효율을 높이는 방법.
- 제19항의 융합단백질 또는 이를 코딩하는 핵산을 포함하는 원핵세포 또는 진핵세포에서의 A-to-G 염기 교정용 조성물로, 상기 DNA 결합 단백질은 징크 핑커 단백질 (zinc finger protein), TALE 단백질 또는 CRISPR 연관 뉴클레아제이고, 상기 융합단백질의 시토신 탈아미노효소 또는 이의 변이체는 박테리아 유래이고, 이중 가닥 DNA 특이적인 것을 특징으로 하는 조성물.
- 제19항의 융합단백질 또는 이를 코딩하는 핵산을 포함하는 원핵세포 또는 진핵세포에서의 A-to-G 염기 교정용 조성물로, 상기 DNA 결합 단백질은 징크 핑커 단백질 (zinc finger protein), TALE 단백질 또는 CRISPR 연관 뉴클레아제이고,상기 융합단백질의 시토신 탈아미노효소 또는 이의 변이체는 박테리아 유래이고, 이중 가닥 DNA 특이적인 것이며,상기 시토신 탈아미노효소 또는 이의 변이체의 N 말단에 DNA 결합 단백질이 결합되어 있고, 상기 융합단백질의 아데닌 탈아미노효소의 C 말단에 DNA 결합 단백질이 결합되어 있는, 조성물.
- 제19항의 융합단백질 또는 이를 코딩하는 핵산 및 UGI (uracil glycosylase inhibitor)를 포함하는 원핵세포 또는 진핵세포에서의 C-to-T 염기 교정용 조성물로, 상기 DNA 결합 단백질은 징크 핑커 단백질 (zinc finger protein), TALE 단백질 또는 CRISPR 연관 뉴클레아제이고, 상기 융합단백질의 시토신 탈아미노효소 또는 이의 변이체는 박테리아 유래이고, 이중 가닥 DNA 특이적인 것을 특징으로 하는 조성물.
- 제19항의 융합단백질 또는 이를 코딩하는 핵산을 원핵세포 또는 진핵세포에 처리하는 단계를 포함하는 원핵세포 또는 진핵세포에서의 A-to-G 염기 교정 방법으로, 상기 DNA 결합 단백질은 징크 핑커 단백질 (zinc finger protein), TALE 단백질 또는 CRISPR 연관 뉴클레아제이고, 상기 융합단백질의 시토신 탈아미노효소 또는 이의 변이체는 박테리아 유래이고, 이중 가닥 DNA 특이적인 것을 특징으로 하는 방법.
- 제19항의 융합단백질 또는 이를 코딩하는 핵산을 원핵세포 또는 진핵세포에 처리하는 단계를 포함하는 원핵세포 또는 진핵세포에서의 A-to-G 염기 교정 방법으로, 상기 DNA 결합 단백질은 징크 핑커 단백질 (zinc finger protein), TALE 단백질 또는 CRISPR 연관 뉴클레아제이고,상기 융합단백질의 시토신 탈아미노효소 또는 이의 변이체는 박테리아 유래이고, 이중 가닥 DNA 특이적인 것이며,상기 시토신 탈아미노효소 또는 이의 변이체의 N 말단에 DNA 결합 단백질이 결합되어 있고, 상기 융합단백질의 아데닌 탈아미노효소의 C 말단에 DNA 결합 단백질이 결합되어 있는, 방법.
- 제19항의 융합단백질 또는 이를 코딩하는 핵산 및 UGI (uracil glycosylase inhibitor)를 원핵세포 또는 진핵세포에 처리하는 단계를 포함하는 원핵세포 또는 진핵세포에서의 C-to-T 염기 교정 방법으로, 상기 DNA 결합 단백질은 징크 핑커 단백질 (zinc finger protein), TALE 단백질 또는 CRISPR 연관 뉴클레아제이고, 상기 융합단백질의 시토신 탈아미노효소 또는 이의 변이체는 박테리아 유래이고, 이중 가닥 DNA 특이적인 것을 특징으로 하는 방법.
Priority Applications (7)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
BR112023005073A BR112023005073A2 (pt) | 2020-09-18 | 2021-09-17 | Desaminase direcionada e edição de base usando a mesma |
CN202180076508.8A CN117043342A (zh) | 2020-09-18 | 2021-09-17 | 靶向脱氨酶及使用其进行的碱基编辑 |
KR1020237009419A KR20230068402A (ko) | 2020-09-18 | 2021-09-17 | 표적화된 탈아미노효소 및 이를 이용한 염기 교정 |
EP21869807.4A EP4215608A1 (en) | 2020-09-18 | 2021-09-17 | Targeted deaminase and base editing using same |
JP2023517882A JP2023541990A (ja) | 2020-09-18 | 2021-09-17 | 標的化された脱アミノ酵素およびそれを用いた塩基編集 |
CA3193022A CA3193022A1 (en) | 2020-09-18 | 2021-09-17 | Targeted deaminase and base editing using same |
AU2021345339A AU2021345339A1 (en) | 2020-09-18 | 2021-09-17 | Targeted deaminase and base editing using same |
Applications Claiming Priority (20)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR20200120399 | 2020-09-18 | ||
KR10-2020-0120399 | 2020-09-18 | ||
KR20200159920 | 2020-11-25 | ||
KR10-2020-0159920 | 2020-11-25 | ||
KR10-2021-0013263 | 2021-01-29 | ||
KR20210013263 | 2021-01-29 | ||
KR10-2021-0016788 | 2021-02-05 | ||
KR20210016788 | 2021-02-05 | ||
KR10-2021-0049348 | 2021-04-15 | ||
KR20210049348 | 2021-04-15 | ||
KR20210050497 | 2021-04-19 | ||
KR10-2021-0050497 | 2021-04-19 | ||
KR10-2021-0085473 | 2021-06-30 | ||
KR20210085473 | 2021-06-30 | ||
KR20210085474 | 2021-06-30 | ||
KR10-2021-0085474 | 2021-06-30 | ||
KR20210092056 | 2021-07-14 | ||
KR10-2021-0092056 | 2021-07-14 | ||
KR10-2021-0114750 | 2021-08-30 | ||
KR20210114750 | 2021-08-30 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2022060185A1 true WO2022060185A1 (ko) | 2022-03-24 |
Family
ID=80776287
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/KR2021/012872 WO2022060185A1 (ko) | 2020-09-18 | 2021-09-17 | 표적화된 탈아미노효소 및 이를 이용한 염기 교정 |
Country Status (7)
Country | Link |
---|---|
EP (1) | EP4215608A1 (ko) |
JP (1) | JP2023541990A (ko) |
KR (1) | KR20230068402A (ko) |
AU (1) | AU2021345339A1 (ko) |
BR (1) | BR112023005073A2 (ko) |
CA (1) | CA3193022A1 (ko) |
WO (1) | WO2022060185A1 (ko) |
Cited By (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN110607320A (zh) * | 2018-11-23 | 2019-12-24 | 电子科技大学 | 一种植物基因组定向碱基编辑骨架载体及其应用 |
CN114686456A (zh) * | 2022-05-10 | 2022-07-01 | 中山大学 | 基于双分子脱氨酶互补的碱基编辑系统及其应用 |
WO2023182858A1 (ko) * | 2022-03-25 | 2023-09-28 | 기초과학연구원 | 식물세포 소기관 dna의 아데닌을 구아닌으로 염기 교정하는 방법 |
WO2024063538A1 (ko) * | 2022-09-21 | 2024-03-28 | 기초과학연구원 | 식물세포 소기관 dna의 염기 교정 |
Families Citing this family (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP4146804A1 (en) | 2020-05-08 | 2023-03-15 | The Broad Institute Inc. | Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence |
WO2023230613A1 (en) * | 2022-05-27 | 2023-11-30 | The Broad Institute, Inc. | Improved mitochondrial base editors and methods for editing mitochondrial dna |
Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR20180029937A (ko) * | 2016-09-13 | 2018-03-21 | 주식회사 툴젠 | 시토신 디아미나제에 의한 dna에서의 염기 교정 확인 방법 |
KR20190025565A (ko) * | 2016-06-02 | 2019-03-11 | 시그마-알드리치 컴퍼니., 엘엘씨 | 프로그램가능한 dna 결합 단백질을 사용한, 표적화된 게놈 변형의 개선 |
KR20190034628A (ko) * | 2016-08-03 | 2019-04-02 | 프레지던트 앤드 펠로우즈 오브 하바드 칼리지 | 아데노신 핵염기 편집제 및 그의 용도 |
KR20190044157A (ko) * | 2017-10-20 | 2019-04-30 | 경상대학교산학협력단 | 아데닌 또는 아데노신 탈아미노효소를 유효성분으로 포함하는 단일 염기 편집용 조성물 및 이의 용도 |
-
2021
- 2021-09-17 AU AU2021345339A patent/AU2021345339A1/en active Pending
- 2021-09-17 EP EP21869807.4A patent/EP4215608A1/en active Pending
- 2021-09-17 KR KR1020237009419A patent/KR20230068402A/ko unknown
- 2021-09-17 WO PCT/KR2021/012872 patent/WO2022060185A1/ko active Application Filing
- 2021-09-17 CA CA3193022A patent/CA3193022A1/en active Pending
- 2021-09-17 BR BR112023005073A patent/BR112023005073A2/pt unknown
- 2021-09-17 JP JP2023517882A patent/JP2023541990A/ja active Pending
Patent Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR20190025565A (ko) * | 2016-06-02 | 2019-03-11 | 시그마-알드리치 컴퍼니., 엘엘씨 | 프로그램가능한 dna 결합 단백질을 사용한, 표적화된 게놈 변형의 개선 |
KR20190034628A (ko) * | 2016-08-03 | 2019-04-02 | 프레지던트 앤드 펠로우즈 오브 하바드 칼리지 | 아데노신 핵염기 편집제 및 그의 용도 |
KR20180029937A (ko) * | 2016-09-13 | 2018-03-21 | 주식회사 툴젠 | 시토신 디아미나제에 의한 dna에서의 염기 교정 확인 방법 |
KR20190044157A (ko) * | 2017-10-20 | 2019-04-30 | 경상대학교산학협력단 | 아데닌 또는 아데노신 탈아미노효소를 유효성분으로 포함하는 단일 염기 편집용 조성물 및 이의 용도 |
Non-Patent Citations (2)
Title |
---|
BOSHART ET AL., CELL, vol. 41, 1985, pages 521 - 530 |
MOK BEVERLY Y.; DE MORAES MARCOS H.; ZENG JUN; BOSCH DUSTIN E.; KOTRYS ANNA V.; RAGURAM ADITYA; HSU FOSHENG; RADEY MATTHEW C.; PET: "A bacterial cytidine deaminase toxin enables CRISPR-free mitochondrial base editing", NATURE, NATURE PUBLISHING GROUP UK, LONDON, vol. 583, no. 7817, 8 July 2020 (2020-07-08), London, pages 631 - 637, XP037200062, ISSN: 0028-0836, DOI: 10.1038/s41586-020-2477-4 * |
Cited By (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN110607320A (zh) * | 2018-11-23 | 2019-12-24 | 电子科技大学 | 一种植物基因组定向碱基编辑骨架载体及其应用 |
WO2023182858A1 (ko) * | 2022-03-25 | 2023-09-28 | 기초과학연구원 | 식물세포 소기관 dna의 아데닌을 구아닌으로 염기 교정하는 방법 |
CN114686456A (zh) * | 2022-05-10 | 2022-07-01 | 中山大学 | 基于双分子脱氨酶互补的碱基编辑系统及其应用 |
CN114686456B (zh) * | 2022-05-10 | 2023-02-17 | 中山大学 | 基于双分子脱氨酶互补的碱基编辑系统及其应用 |
WO2024063538A1 (ko) * | 2022-09-21 | 2024-03-28 | 기초과학연구원 | 식물세포 소기관 dna의 염기 교정 |
Also Published As
Publication number | Publication date |
---|---|
AU2021345339A9 (en) | 2024-05-02 |
KR20230068402A (ko) | 2023-05-17 |
AU2021345339A1 (en) | 2023-06-01 |
BR112023005073A2 (pt) | 2023-10-31 |
JP2023541990A (ja) | 2023-10-04 |
EP4215608A1 (en) | 2023-07-26 |
CA3193022A1 (en) | 2022-03-24 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
WO2022060185A1 (ko) | 표적화된 탈아미노효소 및 이를 이용한 염기 교정 | |
AU2013335451C1 (en) | Composition for cleaving a target DNA comprising a guide RNA specific for the target DNA and Cas protein-encoding nucleic acid or Cas protein, and use thereof | |
US10590415B2 (en) | Engineered nucleic acid-targeting nucleic acids | |
US11560555B2 (en) | Engineered proteins | |
WO2019009682A2 (ko) | 표적 특이적 crispr 변이체 | |
WO2018231018A2 (ko) | 간에서 목적하는 단백질 발현하기 위한 플랫폼 | |
WO2016021973A1 (ko) | 캄필로박터 제주니 crispr/cas 시스템 유래 rgen을 이용한 유전체 교정 | |
US20220002756A1 (en) | Rna-guided nucleases and active fragments and variants thereof and methods of use | |
WO2017217768A1 (ko) | 온타겟 및 오프타겟의 다중 타겟 시스템을 이용하는, 표적 특이적 유전자 가위 스크리닝 방법 및 이의 용도 | |
WO2019103442A2 (ko) | CRISPR/Cpf1 시스템을 이용한 유전체 편집용 조성물 및 이의 용도 | |
US11981940B2 (en) | DNA modifying enzymes and active fragments and variants thereof and methods of use | |
CN101310015A (zh) | 在两个功能性亚结构域中具有突变的laglidadg归巢核酸内切酶变体及其用途 | |
WO2018088694A2 (ko) | 인위적으로 조작된 sc 기능 조절 시스템 | |
WO2019066549A2 (ko) | 망막 기능장애 질환 치료를 위한 유전자 조작 | |
Kashojiya et al. | Modification of tomato breeding traits and plant hormone signaling by target-AID, the genome-editing system inducing efficient nucleotide substitution | |
WO2018117377A1 (ko) | Fad2 유전자 조작된 올레인산 강화 식물체 및 이의 제조 방법 | |
Zhang et al. | Boosting genome editing efficiency in human cells and plants with novel LbCas12a variants | |
WO2022075816A1 (ko) | Crispr/cas12f1(cas14a1) 시스템 효율화를 위한 엔지니어링 된 가이드 rna 및 이의 용도 | |
WO2022204093A1 (en) | Dna modifyng enzymes and active fragments and variants thereof and methods of use | |
WO2020235974A2 (ko) | 단일염기 치환 단백질 및 이를 포함하는 조성물 | |
WO2018230976A1 (ko) | 반복 확장 돌연변이에 대한 게놈 편집 시스템 | |
WO2020022803A1 (ko) | 항응고 인자들의 유전자 에디팅 | |
WO2023059115A1 (ko) | 유전자 편집을 위한 target 시스템 및 이의 용도 | |
WO2020197242A1 (ko) | 혈우병b 질환 모델 랫드 | |
WO2020036445A1 (ko) | 인위적 뉴클레아제를 생산하는 형질전환 동물 및 형질전환 배아 |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 21869807 Country of ref document: EP Kind code of ref document: A1 |
|
ENP | Entry into the national phase |
Ref document number: 2023517882 Country of ref document: JP Kind code of ref document: A Ref document number: 3193022 Country of ref document: CA |
|
REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112023005073 Country of ref document: BR |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2023106040 Country of ref document: RU |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
ENP | Entry into the national phase |
Ref document number: 2021869807 Country of ref document: EP Effective date: 20230418 |
|
WWE | Wipo information: entry into national phase |
Ref document number: 202180076508.8 Country of ref document: CN |
|
REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: 112023005073 Country of ref document: BR Free format text: 1) ESCLARECER, EM ATE 60 (SESSENTA) DIAS, APRESENTANDO DOCUMENTACAO COMPROBATORIA, A EXCLUSAO DO INVENTOR SUNG IK CHO QUE CONSTA NA PUBLICACAO INTERNACIONAL WO/2022/060185 DE 24/03/2022 DO QUADRO DE INVENTORES CONSTANTE NO FORMULARIO DA PETICAO INICIAL NO 870230023145 DE 17/03/2023. 2) COM BASE NA PORTARIA 48 DE 20/06/2022, SOLICITA-SE QUE SEJA APRESENTADO, EM ATE 60 (SESSENTA) DIAS, NOVO CONTEUDO DE LISTAGEM DE SEQUENCIA POIS O CONTEUDO APRESENTADO NA PETICAO NO 870230040838 DE 16/05/2023 NAO ESTA NO FORMATO ST.25. QUE E O FORMATO DA LISTAGEM QUE FOI APRESENTADO NO DEPOSITO INTERNACIONAL. |
|
ENP | Entry into the national phase |
Ref document number: 2021345339 Country of ref document: AU Date of ref document: 20210917 Kind code of ref document: A |
|
REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: 112023005073 Country of ref document: BR Free format text: COM BASE NA PORTARIA/INPI/NO 48/2022, APRESENTE NOVO CONTEUDO DE LISTAGEM, POIS O CONTEUDO APRESENTADO NA PETICAO NO 870230064868 DE 24/07/2023 NAO ESTA NO FORMATO ST.25. A EXIGENCIA DEVE SER RESPONDIDA EM ATE 60 (SESSENTA) DIAS DE SUA PUBLICACAO E DEVE SER REALIZADA POR MEIO DA PETICAO GRU CODIGO DE SERVICO 207. DEVERA SER INCLUIDO NA RESPOSTA O CAMPO 140 / 141 UMA VEZ QUE O DEPOSITANTE JA POSSUI O NUMERO DO PEDIDO NO BRASIL. |
|
ENP | Entry into the national phase |
Ref document number: 112023005073 Country of ref document: BR Kind code of ref document: A2 Effective date: 20230317 |