WO2022047189A1 - Lag-3 antagonist therapy for hepatocellular carcinoma - Google Patents

Lag-3 antagonist therapy for hepatocellular carcinoma Download PDF

Info

Publication number
WO2022047189A1
WO2022047189A1 PCT/US2021/048002 US2021048002W WO2022047189A1 WO 2022047189 A1 WO2022047189 A1 WO 2022047189A1 US 2021048002 W US2021048002 W US 2021048002W WO 2022047189 A1 WO2022047189 A1 WO 2022047189A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
seq
set forth
chain variable
lag
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2021/048002
Other languages
English (en)
French (fr)
Inventor
Shivani Srivastava
Rebecca A. MOSS
Andrea HORVATH
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Bristol Myers Squibb Co
Original Assignee
Bristol Myers Squibb Co
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Bristol Myers Squibb Co filed Critical Bristol Myers Squibb Co
Priority to AU2021331476A priority Critical patent/AU2021331476A1/en
Priority to MX2023002332A priority patent/MX2023002332A/es
Priority to EP21789895.6A priority patent/EP4204095A1/en
Priority to KR1020237009984A priority patent/KR20230058442A/ko
Priority to US18/043,562 priority patent/US20230265188A1/en
Priority to BR112023003427A priority patent/BR112023003427A2/pt
Priority to JP2023513856A priority patent/JP2023540255A/ja
Priority to CN202180071182.XA priority patent/CN116529261A/zh
Priority to CA3193421A priority patent/CA3193421A1/en
Priority to IL300813A priority patent/IL300813A/en
Publication of WO2022047189A1 publication Critical patent/WO2022047189A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0019Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • A61K2039/507Comprising a combination of two or more separate antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94Stability, e.g. half-life, pH, temperature or enzyme-resistance

Definitions

  • the present disclosure provides a method of treating human subjects afflicted with hepatocellular carcinoma (HCC) comprising a lymphocyte activation gene-3 (LAG-3) antagonist.
  • HCC hepatocellular carcinoma
  • LAG-3 lymphocyte activation gene-3
  • HCC is the fifth most common cancer worldwide and the second leading cause of cancer-related death, with both infectious and non-infectious etiologies. HCC incidence rates and death rates are increasing in many parts of the world, including North America, Latin America, and central Europe.
  • the present disclosure is directed to a method of treating a human subject afflicted with hepatocellular carcinoma (HCC), the method comprising administering to the subject a lymphocyte activation gene-3 (LAG-3) antagonist.
  • HCC hepatocellular carcinoma
  • LAG-3 lymphocyte activation gene-3
  • the method is a first line therapy.
  • the method is a second line therapy.
  • the method is a third line therapy.
  • the subject has progressed on or is intolerant of a prior therapy.
  • the prior therapy comprises a tyrosine kinase inhibitor, an anti-angiogenesis agent, a checkpoint inhibitor, a checkpoint stimulator, a chemotherapeutic agent, an immunotherapeutic agent, a platinum agent, an alkylating agent, a taxane, a nucleoside analog, an antimetabolite, a topisomerase inhibitor, an anthracycline, a vinca alkaloid, or any combination thereof.
  • the subject is naive to prior immuno-oncology therapy, the subject is naive to prior immuno-oncology therapy for HCC, or the HCC is naive to prior immuno- oncology therapy.
  • the HCC is unresectable, advanced, and/or metastatic.
  • the subject has microvascular invasion and/or extrahepatic spread of HCC.
  • the subject lacks microvascular invasion and/or extrahepatic spread of HCC.
  • the subject has a Child-Pugh score of 5 or 6 and/or has Child-Pugh A status, a Child-Pugh score of 7-9 and/or has Child-Pugh B status, or a Child-Pugh score of 10-15 and/or has Child-Pugh C status.
  • the subject has an Eastern Cooperative Oncology Group (ECOG) performance status of 0, 1, 2, 3, or 4.
  • ECOG Eastern Cooperative Oncology Group
  • the subject has a Barcelona Clinic Liver Cancer (BCLC) stage 0, A, B, C, or D status.
  • BCLC Barcelona Clinic Liver Cancer
  • the HCC is viral HCC.
  • the HCC is non-viral HCC.
  • one or more immune cells in tumor tissue from the subject express
  • LAG-3 LAG-3.
  • at least about 1%, at least about 3%, at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, or about 100% of the immune cells express LAG-3.
  • at least about 1% of the immune cells express LAG-3.
  • one or more tumor cells in tumor tissue from the subject express PD-L1.
  • at least about 1%, at least about 3%, at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, or about 100% of the tumor cells express PD-L1.
  • at least about 1% of the tumor cells express PD-L1.
  • the immune cells are tumor-infiltrating lymphocytes. In some aspects, the tumor-infiltrating lymphocytes are CD8 + cells.
  • the LAG-3 antagonist is an anti-LAG-3 antibody.
  • the anti-LAG-3 antibody is a full-length antibody. In some aspects, the anti-LAG-3 antibody is a monoclonal, human, humanized, chimeric, or multispecific antibody. In some aspects, the multispecific antibody is a dual-affinity re-targeting antibody (DART), a DVD-Ig, or bispecific antibody.
  • DART dual-affinity re-targeting antibody
  • DVD-Ig DVD-Ig
  • the anti-LAG-3 antibody is a F(ab')2 fragment, a Fab' fragment, a Fab fragment, a Fv fragment, a scFv fragment, a dsFv fragment, a dAb fragment, or a single chain binding polypeptide.
  • the anti-LAG-3 antibody is BMS-986016 (relatlimab), IMP731 (H5L7BW), MK-4280 (28G-10, favezelimab), REGN3767 (fianlimab), GSK2831781, humanized BAP050, IMP-701 (LAG-525, ieramilimab), aLAG3(0414), aLAG3(0416), Sym022, TSR-033, TSR-075, XmAb22841, MGD013, BI754111, FS118, P 13B02-30, AVA-017, 25F7, AGEN1746, or comprises an antigen binding portion thereof.
  • the anti -LAG-3 antibody comprises CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4.
  • the anti -LAG-3 antibody comprises: (a) a heavy chain variable region CDR1 comprising the sequence set forth in SEQ ID NO:5; (b) a heavy chain variable region CDR2 comprising the sequence set forth in SEQ ID NO:6; (c) a heavy chain variable region CDR3 comprising the sequence set forth in SEQ ID NO: 7; (d) a light chain variable region CDR1 comprising the sequence set forth in SEQ ID NO:8; (e) a light chain variable region CDR2 comprising the sequence set forth in SEQ ID NO:9; and (f) a light chain variable region CDR3 comprising the sequence set forth in SEQ ID NO: 10.
  • the anti-LAG-3 antibody comprises heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs:3 and 4, respectively.
  • the anti-LAG-3 antibody comprises heavy and light chains comprising the sequences set forth in SEQ ID NOs: 1 and 2, respectively.
  • the anti-LAG-3 antibody comprises heavy and light chains comprising the sequences set forth in SEQ ID NOs:21 and 2, respectively.
  • the LAG-3 antagonist is a soluble LAG-3 polypeptide.
  • the soluble LAG-3 polypeptide is a fusion polypeptide.
  • the soluble LAG-3 polypeptide comprises a ligand binding fragment of the LAG-3 extracellular domain.
  • the ligand binding fragment of the LAG-3 extracellular domain comprises an amino acid sequence with at least about 90%, at least about 95%, at least about 98%, at least about 99%, or about 100% sequence identity to SEQ ID NO:22.
  • the soluble LAG-3 polypeptide further comprises a half-life extending moiety.
  • the half-life extending moiety comprises an immunoglobulin constant region or a portion thereof, an immunoglobulin-binding polypeptide, an immunoglobulin G (IgG), albumin-binding polypeptide (ABP), a PASylation moiety, a HESylation moiety, XTEN, a PEGylation moiety, an Fc region, or any combination thereof.
  • the soluble LAG-3 polypeptide is IMP321 (eftilagimod alpha).
  • the LAG-3 antagonist is formulated for intravenous administration. [0036] In some aspects, the LAG-3 antagonist is administered at a flat dose.
  • the LAG-3 antagonist is administered at a dose of from at least about 0.25 mg to about 2000 mg, about 0.25 mg to about 1600 mg, about 0.25 mg to about 1200 mg, about 0.25 mg to about 800 mg, about 0.25 mg to about 400 mg, about 0.25 mg to about 100 mg, about 0.25 mg to about 50 mg, about 0.25 mg to about 40 mg, about 0.25 mg to about 30 mg, about 0.25 mg to about 20 mg, about 20 mg to about 2000 mg, about 20 mg to about 1600 mg, about 20 mg to about 1200 mg, about 20 mg to about 800 mg, about 20 mg to about 400 mg, about 20 mg to about 100 mg, about 100 mg to about 2000 mg, about 100 mg to about 1800 mg, about 100 mg to about 1600 mg, about 100 mg to about 1400 mg, about 100 mg to about 1200 mg, about 100 mg to about 1000 mg, about 100 mg to about 800 mg, about 100 mg to about 600 mg, about 100 mg to about 400 mg, about 400 mg to about 2000 mg, about 400 mg to about 1800 mg, about 400 mg, about 0.25 mg to
  • the LAG-3 antagonist is administered at a dose of about 0.25 mg, about 0.5 mg, about 0.75 mg, about 1 mg, about 1.25 mg, about 1.5 mg, about 1.75 mg, about 2 mg, about 2.25 mg, about 2.5 mg, about 2.75 mg, about 3 mg, about 3.25 mg, about 3.5 mg, about 3.75 mg, about 4 mg, about 4.25 mg, about 4.5 mg, about 4.75 mg, about 5 mg, about 5.25 mg, about 5.5 mg, about 5.75 mg, about 6 mg, about 6.25 mg, about 6.5 mg, about 6.75 mg, about 7 mg, about 7.25 mg, about 7.5 mg, about 7.75 mg, about 8 mg, about 8.25 mg, about 8.5 mg, about 8.75 mg, about 9 mg, about 9.25 mg, about 9.5 mg, about 9.75 mg, about 10 mg, about 20 mg, about 30 mg, about 40 mg, about 50 mg, about 60 mg, about 70 mg, about 80 mg, about 90 mg, about 100 mg, about 110 mg, about 120 mg, about 130 mg
  • the LAG-3 antagonist is administered at a weight-based dose.
  • the LAG-3 antagonist is administered at a dose from about 0.003 mg/kg to about 25 mg/kg, about 0.003 mg/kg to about 20 mg/kg, about 0.003 mg/kg to about 15 mg/kg, about 0.003 mg/kg to about 10 mg/kg, about 0.003 mg/kg to about 5 mg/kg, about 0.003 mg/kg to about 1 mg/kg, about 0.003 mg/kg to about 0.9 mg/kg, about 0.003 mg/kg to about 0.8 mg/kg, about 0.003 mg/kg to about 0.7 mg/kg, about 0.003 mg/kg to about 0.6 mg/kg, about 0.003 mg/kg to about 0.5 mg/kg, about 0.003 mg/kg to about 0.4 mg/kg, about 0.003 mg/kg to about 0.3 mg/kg, about 0.003 mg/kg to about 0.2 mg/kg, about 0.003 mg/kg to about 0.1 mg/kg, about 0.1 mg/kg to about 25 mg/kg, about 0.1
  • the LAG-3 antagonist is administered at a dose of about 0.003 mg/kg, about 0.004 mg/kg, about 0.005 mg/kg, about 0.006 mg/kg, about 0.007 mg/kg, about 0.008 mg/kg, about 0.009 mg/kg, about 0.01 mg/kg, about 0.02 mg/kg, about 0.03 mg/kg, about 0.04 mg/kg, about 0.05 mg/kg, about 0.06 mg/kg, about 0.07 mg/kg, about 0.08 mg/kg, about 0.09 mg/kg, about 0.1 mg/kg, about 0.2 mg/kg, about 0.3 mg/kg, about 0.4 mg/kg, about 0.5 mg/kg, about 0.6 mg/kg, about 0.7 mg/kg, about 0.8 mg/kg, about 0.9 mg/kg, about 1.0 mg/kg, about 2.0 mg/kg, about 3.0 mg/kg, about 4.0 mg/kg, about 5.0 mg/kg, about 6.0 mg/kg, about 7.0 mg/kg, about 8.0 mg/
  • the dose is administered once about every one week, once about every two weeks, once about every three weeks, once about every four weeks, once about every five weeks, once about every six weeks, once about every seven weeks, once about every eight weeks, once about every nine weeks, once about every ten weeks, once about every eleven weeks, or once about every twelve weeks.
  • the method further comprises administering to the subject an additional therapeutic agent.
  • the additional therapeutic agent comprises an anti-cancer agent.
  • the anti-cancer agent comprises a tyrosine kinase inhibitor, an anti-angiogenesis agent, a checkpoint inhibitor, a checkpoint stimulator, a chemotherapeutic agent, an immunotherapeutic agent, a platinum agent, an alkylating agent, a taxane, a nucleoside analog, an antimetabolite, a topisomerase inhibitor, an anthracycline, a vinca alkaloid, or any combination thereof.
  • the tyrosine kinase inhibitor comprises sorafenib, lenvatinib, regorafenib, cabozantinib, sunitinib, brivanib, linifanib, erlotinib, pemigatinib, everolimus, gefitinib, imatinib, lapatinib, nilotinib, pazopanib, temsirolimus, or any combination thereof.
  • the anti-angiogenesis agent comprises an inhibitor of a vascular endothelial growth factor (VEGF), VEGF receptor (VEGFR), platelet-derived growth factor (PDGF), PDGF receptor (PDGFR), angiopoietin (Ang), tyrosine kinase with Ig-like and EGF-like domains (Tie) receptor, hepatocyte growth factor (HGF), tyrosine-protein kinase Met (c-MET), C-type lectin family 14 member A (CLEC14A), multimerin 2 (MMRN2), shock protein 70-1A (HSP70-1A), a epidermal growth factor (EGF), EGF receptor (EGFR), or any combination thereof.
  • VEGF vascular endothelial growth factor
  • VGF VEGF receptor
  • PDGF platelet-derived growth factor
  • PDGFR PDGF receptor
  • Ang angiopoietin
  • Ang tyrosine kinase with Ig-
  • the anti-angiogenesis agent comprises bevacizumab, ramucirumab, aflibercept, tanibirumab, olaratumab, nesvacumab, AMG780, MEDI3617, vanucizumab, rilotumumab, ficlatuzumab, TAK-701, onartuzumab, emibetuzumab, or any combination thereof.
  • the checkpoint inhibitor comprises a programmed death-1 (PD-1) pathway inhibitor, a cytotoxic T-lymphocyte-associated protein 4 (CTLA-4) inhibitor, a T cell immunoglobulin and ITIM domain (TIGIT) inhibitor, a T cell immunoglobulin and mucin-domain containing-3 (TIM-3) inhibitor, a TIM-1 inhibitor, a TIM-4 inhibitor, a B7- H3 inhibitor, a B7-H4 inhibitor, a B and T cell lymphocyte attenuator (BTLA) inhibitor, a V-domain Ig suppressor of T cell activation (VISTA) inhibitor, an indoleamine 2,3- dioxygenase (IDO) inhibitor, a nicotinamide adenine dinucleotide phosphate oxidase isoform 2 (N0X2) inhibitor, a killer-cell immunoglobulin-like receptor (KIR) inhibitor, an adenosine A2a receptor (A2aR) inhibitor,
  • PD-1 programmed death
  • the checkpoint inhibitor comprises a PD-1 pathway inhibitor.
  • the PD-1 pathway inhibitor is an anti -PD-1 antibody and/or an anti -PD -LI antibody.
  • the PD-1 pathway inhibitor is an anti-PD-1 antibody.
  • the anti-PD-1 antibody is a full-length antibody.
  • the anti-PD-1 antibody is a monoclonal, human, humanized, chimeric, or multispecific antibody.
  • the multispecific antibody is a DART, a DVD-Ig, or bispecific antibody.
  • the anti-PD-1 antibody is a F(ab')2 fragment, a Fab' fragment, a Fab fragment, a Fv fragment, a scFv fragment, a dsFv fragment, a dAb fragment, or a single chain binding polypeptide.
  • the anti-PD-1 antibody is nivolumab, pembrolizumab, PDR001, MEDI-0680, TSR-042, cemiplimab, JS001, PF-06801591, BGB-A317, BI 754091, INCSHR1210, GLS-010, AM-001, STI-1110, AGEN2034, MGA012, BCD-100, IBI308, SSI-361, or comprises an antigen binding portion thereof.
  • the anti-PD-1 antibody comprises CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14.
  • the anti-PD-1 antibody comprises: (a) a heavy chain variable region CDR1 comprising the sequence set forth in SEQ ID NO: 15; (b) a heavy chain variable region CDR2 comprising the sequence set forth in SEQ ID NO: 16; (c) a heavy chain variable region CDR3 comprising the sequence set forth in SEQ ID NO: 17; (d) a light chain variable region CDR1 comprising the sequence set forth in SEQ ID NO: 18; (e) a light chain variable region CDR2 comprising the sequence set forth in SEQ ID NO: 19; and (f) a light chain variable region CDR3 comprising the sequence set forth in SEQ ID NO:20.
  • the anti-PD-1 antibody comprises heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs: 13 and 14, respectively.
  • the anti-PD-1 antibody comprises heavy and light chains comprising the sequences as set forth in SEQ ID NOs: 11 and 12, respectively.
  • the PD-1 pathway inhibitor is a soluble PD-L2 polypeptide.
  • the soluble PD-L2 polypeptide is a fusion polypeptide.
  • the soluble PD-L2 polypeptide comprises a ligand binding fragment of the PD-L2 extracellular domain.
  • the soluble PD-L2 polypeptide further comprises a half-life extending moiety.
  • the half-life extending moiety comprises an immunoglobulin constant region or a portion thereof, an immunoglobulin-binding polypeptide, an immunoglobulin G (IgG), albumin-binding polypeptide (ABP), a PASylation moiety, a HESylation moiety, XTEN, a PEGylation moiety, an Fc region, or any combination thereof.
  • the soluble PD-L2 polypeptide is AMP-224.
  • the PD-1 pathway inhibitor is an anti-PD-Ll antibody.
  • the anti-PD-Ll antibody is a full-length antibody.
  • the anti-PD-Ll antibody is a monoclonal, human, humanized, chimeric, or multispecific antibody.
  • the multispecific antibody is a DART, a DVD-Ig, or bispecific antibody.
  • the anti-PD-Ll antibody is a F(ab')2 fragment, a Fab' fragment, a Fab fragment, a Fv fragment, a scFv fragment, a dsFv fragment, a dAb fragment, or a single chain binding polypeptide.
  • the anti-PD-Ll antibody is BMS-936559, atezolizumab, durvalumab, avelumab, STI-1014, CX-072, KN035, LY3300054, BGB-A333, ICO 36, FAZ053, CK-301, or comprises an antigen binding portion thereof.
  • the PD-1 pathway inhibitor is BMS-986189.
  • the checkpoint inhibitor comprises a CTLA-4 inhibitor.
  • the CTLA-4 inhibitor is an anti-CTLA-4 antibody.
  • the anti-CTLA-4 antibody is a full-length antibody.
  • the anti-CTLA-4 antibody is a monoclonal, human, humanized, chimeric, or multispecific antibody.
  • the multispecific antibody is a DART, a DVD-Ig, or bispecific antibody.
  • the anti-CTLA-4 antibody is a F(ab')2 fragment, a Fab' fragment, a Fab fragment, a Fv fragment, a scFv fragment, a dsFv fragment, a dAb fragment, or a single chain binding polypeptide.
  • the anti-CTLA-4 antibody is ipilimumab, tremelimumab, MK- 1308, AGEN-1884, or comprises an antigen binding portion thereof.
  • the checkpoint inhibitor is formulated for intravenous administration.
  • the LAG-3 antagonist and the checkpoint inhibitor are formulated separately. In some aspects, each checkpoint inhibitor is formulated separately when the checkpoint inhibitor comprises more than one checkpoint inhibitor. In some aspects, the checkpoint inhibitor is administered before the LAG-3 antagonist. In some aspects, the LAG-3 antagonist is administered before the checkpoint inhibitor. [0074] In some aspects, the LAG-3 antagonist and the checkpoint inhibitor are formulated together. In some aspects, two or more checkpoint inhibitors are formulated together when the checkpoint inhibitor comprises more than one checkpoint inhibitor.
  • the LAG-3 antagonist and the checkpoint inhibitor are administered concurrently.
  • the checkpoint inhibitor is administered at a flat dose.
  • the checkpoint inhibitor is administered at a dose of from at least about 0.25 mg to about 2000 mg, about 0.25 mg to about 1600 mg, about 0.25 mg to about 1200 mg, about 0.25 mg to about 800 mg, about 0.25 mg to about 400 mg, about 0.25 mg to about 100 mg, about 0.25 mg to about 50 mg, about 0.25 mg to about 40 mg, about 0.25 mg to about 30 mg, about 0.25 mg to about 20 mg, about 20 mg to about 2000 mg, about 20 mg to about 1600 mg, about 20 mg to about 1200 mg, about 20 mg to about 800 mg, about 20 mg to about 400 mg, about 20 mg to about 100 mg, about 100 mg to about 2000 mg, about 100 mg to about 1800 mg, about 100 mg to about 1600 mg, about 100 mg to about 1400 mg, about 100 mg to about 1200 mg, about 100 mg to about 1000 mg, about 100 mg to about 800 mg, about 100 mg to about 600 mg, about 100 mg to about 400 mg, about 400 mg to about 2000 mg, about 400 mg to about 1800 mg, about 400 mg, about 0.25 mg to about
  • the checkpoint inhibitor is administered at a dose of about 0.25 mg, about 0.5 mg, about 0.75 mg, about 1 mg, about 1.25 mg, about 1.5 mg, about 1.75 mg, about 2 mg, about 2.25 mg, about 2.5 mg, about 2.75 mg, about 3 mg, about 3.25 mg, about 3.5 mg, about 3.75 mg, about 4 mg, about 4.25 mg, about 4.5 mg, about 4.75 mg, about 5 mg, about 5.25 mg, about 5.5 mg, about 5.75 mg, about 6 mg, about 6.25 mg, about 6.5 mg, about 6.75 mg, about 7 mg, about 7.25 mg, about 7.5 mg, about 7.75 mg, about 8 mg, about 8.25 mg, about 8.5 mg, about 8.75 mg, about 9 mg, about 9.25 mg, about 9.5 mg, about 9.75 mg, about 10 mg, about 20 mg, about 30 mg, about 40 mg, about 50 mg, about 60 mg, about 70 mg, about 80 mg, about 90 mg, about 100 mg, about 110 mg, about 120 mg, about 130 mg,
  • the checkpoint inhibitor is administered as a weight-based dose.
  • the checkpoint inhibitor is administered at a dose from about 0.003 mg/kg to about 25 mg/kg, about 0.003 mg/kg to about 20 mg/kg, about 0.003 mg/kg to about 15 mg/kg, about 0.003 mg/kg to about 10 mg/kg, about 0.003 mg/kg to about 5 mg/kg, about 0.003 mg/kg to about 1 mg/kg, about 0.003 mg/kg to about 0.9 mg/kg, about 0.003 mg/kg to about 0.8 mg/kg, about 0.003 mg/kg to about 0.7 mg/kg, about 0.003 mg/kg to about 0.6 mg/kg, about 0.003 mg/kg to about 0.5 mg/kg, about 0.003 mg/kg to about 0.4 mg/kg, about 0.003 mg/kg to about 0.3 mg/kg, about 0.003 mg/kg to about 0.2 mg/kg, about 0.003 mg/kg to about 0.1 mg/kg, about 0.1 mg/kg to about 25 mg/kg, about 0.1 mg
  • the checkpoint inhibitor is administered at a dose of about 0.003 mg/kg, about 0.004 mg/kg, about 0.005 mg/kg, about 0.006 mg/kg, about 0.007 mg/kg, about 0.008 mg/kg, about 0.009 mg/kg, about 0.01 mg/kg, about 0.02 mg/kg, about 0.03 mg/kg, about 0.04 mg/kg, about 0.05 mg/kg, about 0.06 mg/kg, about 0.07 mg/kg, about 0.08 mg/kg, about 0.09 mg/kg, about 0.1 mg/kg, about 0.2 mg/kg, about 0.3 mg/kg, about 0.4 mg/kg, about 0.5 mg/kg, about 0.6 mg/kg, about 0.7 mg/kg, about 0.8 mg/kg, about 0.9 mg/kg, about 1.0 mg/kg, about 2.0 mg/kg, about 3.0 mg/kg, about 4.0 mg/kg, about 5.0 mg/kg, about 6.0 mg/kg, about 7.0 mg/kg, about 8.0 mg/kg
  • the dose is administered once about every one week, once about every two weeks, once about every three weeks, once about every four weeks, once about every five weeks, once about every six weeks, once about every seven weeks, once about every eight weeks, once about every nine weeks, once about every ten weeks, once about every eleven weeks, or once about every twelve weeks.
  • the present disclosure is directed to a method of treating a human subject afflicted with HCC, the method comprising administering to the subject: (a) an anti-LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4, and (b) an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14, wherein the method is a first line therapy.
  • the present disclosure is directed to a method of treating a human subject afflicted with unresectable HCC, the method comprising administering to the subject: (a) an anti- LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4, and (b) an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14, wherein the method is a first line therapy.
  • the present disclosure is directed to a method of treating a human subject afflicted with metastatic HCC, the method comprising administering to the subject: (a) an anti-LAG- 3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4, and (b) an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14, wherein the method is a first line therapy.
  • the present disclosure is directed to a method of treating a human subject afflicted with HCC, the method comprising administering to the subject: (a) a dose of about 480 mg of an anti -LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4, and (b) a dose of about 480 mg of an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14, wherein the method is a first line therapy.
  • the present disclosure is directed to a method of treating a human subject afflicted with unresectable HCC, the method comprising administering to the subject: (a) a dose of about 480 mg of an anti -LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4, and (b) a dose of about 480 mg of an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14, wherein the method is a first line therapy.
  • the present disclosure is directed to a method of treating a human subject afflicted with metastatic HCC, the method comprising administering to the subject: (a) a dose of about 480 mg of an anti -LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4, and (b) a dose of about 480 mg of an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14, wherein the method is a first line therapy.
  • the present disclosure is directed to a method of treating a human subject afflicted with HCC, the method comprising administering to the subject: (a) a dose of about 960 mg of an anti -LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4, and (b) a dose of about 480 mg of an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14, wherein the method is a first line therapy.
  • the present disclosure is directed to a method of treating a human subject afflicted with unresectable HCC, the method comprising administering to the subject: (a) a dose of about 960 mg of an anti -LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4, and (b) a dose of about 480 mg of an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14, wherein the method is a first line therapy.
  • the present disclosure is directed to a method of treating a human subject afflicted with metastatic HCC, the method comprising administering to the subject: (a) a dose of about 960 mg of an anti -LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4, and (b) a dose of about 480 mg of an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14, wherein the method is a first line therapy.
  • the present disclosure is directed to a method of treating a human subject afflicted with HCC, the method comprising administering to the subject: (a) an anti-LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4, and (b) an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14, wherein the subject has progressed on or is intolerant of a prior therapy.
  • the present disclosure is directed to a method of treating a human subject afflicted with unresectable HCC, the method comprising administering to the subject: (a) an anti- LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4, and (b) an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14, wherein the subject has progressed on or is intolerant of a prior therapy.
  • the present disclosure is directed to a method of treating a human subject afflicted with metastatic HCC, the method comprising administering to the subject: (a) an anti-LAG- 3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4, and (b) an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14, wherein the subject has progressed on or is intolerant of a prior therapy.
  • the present disclosure is directed to a method of treating a human subject afflicted with HCC, the method comprising administering to the subject: (a) a dose of about 480 mg of an anti -LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4, and (b) a dose of about 480 mg of an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14, wherein the subject has progressed on or is intolerant of a prior therapy.
  • the present disclosure is directed to a method of treating a human subject afflicted with unresectable HCC, the method comprising administering to the subject: (a) a dose of about 480 mg of an anti -LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4, and (b) a dose of about 480 mg of an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14, wherein the subject has progressed on or is intolerant of a prior therapy.
  • the present disclosure is directed to a method of treating a human subject afflicted with metastatic HCC, the method comprising administering to the subject: (a) a dose of about 480 mg of an anti -LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4, and (b) a dose of about 480 mg of an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14, wherein the subject has progressed on or is intolerant of a prior therapy.
  • the present disclosure is directed to a method of treating a human subject afflicted with HCC, the method comprising administering to the subject: (a) a dose of about 960 mg of an anti -LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4, and (b) a dose of about 480 mg of an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14, wherein the subject has progressed on or is intolerant of a prior therapy.
  • the present disclosure is directed to a method of treating a human subject afflicted with unresectable HCC, the method comprising administering to the subject: (a) a dose of about 960 mg of an anti -LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4, and (b) a dose of about 480 mg of an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14, wherein the subject has progressed on or is intolerant of a prior therapy.
  • the present disclosure is directed to a method of treating a human subject afflicted with metastatic HCC, the method comprising administering to the subject: (a) a dose of about 960 mg of an anti -LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4, and (b) a dose of about 480 mg of an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14, wherein the subject has progressed on or is intolerant of a prior therapy.
  • the subject has microvascular invasion of HCC.
  • the subject lacks microvascular invasion of HCC.
  • the prior therapy comprises sorafenib, lenvatinib, regorafenib, and/or cabozantinib.
  • the subject is naive to prior immuno-oncology therapy, the subject is naive to prior immuno-oncology therapy for HCC, or the HCC is naive to prior immuno- oncology therapy.
  • the subject has a Child-Pugh score of 5 or 6 and/or has Child-Pugh A status, a Child-Pugh score of 7-9 and/or has Child-Pugh B status, or a Child-Pugh score of 10-15 and/or has Child-Pugh D status.
  • the subject has an Eastern Cooperative Oncology Group (ECOG) performance status of 0, 1, 2, 3, or 4.
  • EOG Eastern Cooperative Oncology Group
  • the subject has a Barcelona Clinic Liver Cancer (BCLC) stage 0, A, B, C, or D status.
  • BCLC Barcelona Clinic Liver Cancer
  • the HCC is viral HCC.
  • the HCC is non-viral HCC.
  • one or more immune cells in tumor tissue from the subject express
  • LAG-3 LAG-3.
  • at least about 1%, at least about 3%, at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, or about 100% of the immune cells express LAG-3.
  • at least about 1% of the immune cells express LAG-3.
  • one or more tumor cells in tumor tissue from the subject express PD-L1.
  • at least about 1%, at least about 3%, at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, or about 100% of the tumor cells express PD-L1.
  • at least about 1% of the tumor cells express PD-L1.
  • the immune cells are tumor-infiltrating lymphocytes.
  • the tumor-infiltrating lymphocytes are CD8 + cells.
  • the anti-LAG-3 antibody comprises a heavy chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID NO:5, SEQ ID NO: 6, and SEQ ID NO: 7, respectively, and a light chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID NO:8, SEQ ID NO:9, and SEQ ID NO: 10, respectively
  • the anti-PD-1 antibody comprises a heavy chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID NO: 15, SEQ ID NO: 16, and SEQ ID NO: 17, respectively, and a light chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID NO: 18, SEQ ID NO: 19, and SEQ ID NO:20, respectively.
  • the anti-LAG-3 antibody comprises heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs:3 and 4, respectively, and the anti-PD-1 antibody comprises heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs: 13 and 14, respectively.
  • the anti-LAG-3 antibody and/or the anti-PD-1 antibody is a full- length antibody.
  • the anti-LAG-3 antibody and/or anti-PD-1 antibody is a monoclonal, human, humanized, chimeric, or multispecific antibody.
  • the multispecific antibody is a DART, a DVD-Ig, or bispecific antibody.
  • the anti-LAG-3 antibody and/or anti-PD-1 antibody is a F(ab')2 fragment, a Fab' fragment, a Fab fragment, a Fv fragment, a scFv fragment, a dsFv fragment, a dAb fragment, or a single chain binding polypeptide.
  • the anti-LAG-3 antibody comprises heavy and light chains comprising the sequences set forth in SEQ ID NOs: 1 and 2, respectively, and the anti-PD- 1 antibody comprises heavy and light chains comprising the sequences as set forth in SEQ ID NOs: 11 and 12, respectively.
  • the anti-LAG-3 antibody comprises heavy and light chains comprising the sequences set forth in SEQ ID NOs:21 and 2, respectively, and the anti-PD- 1 antibody comprises heavy and light chains comprising the sequences as set forth in SEQ ID NOs: 11 and 12, respectively.
  • the method further comprises administering to the subject an additional therapeutic agent.
  • the additional therapeutic agent comprises an anti-cancer agent.
  • the anti-cancer agent comprises a tyrosine kinase inhibitor, an anti-angiogenesis agent, a checkpoint inhibitor, a checkpoint stimulator, a chemotherapeutic agent, an immunotherapeutic agent, a platinum agent, an alkylating agent, a taxane, a nucleoside analog, an antimetabolite, a topisomerase inhibitor, an anthracycline, a vinca alkaloid, or any combination thereof.
  • the tyrosine kinase inhibitor is sorafenib, lenvatinib, regorafenib, cabozantinib, sunitinib, brivanib, linifanib, erlotinib, pemigatinib, everolimus, gefitinib, imatinib, lapatinib, nilotinib, pazopanib, temsirolimus, or any combination thereof.
  • the anti-angiogenesis agent comprises an inhibitor of a vascular endothelial growth factor (VEGF), VEGF receptor (VEGFR), platelet-derived growth factor (PDGF), PDGF receptor (PDGFR), angiopoietin (Ang), tyrosine kinase with Ig-like and EGF-like domains (Tie) receptor, hepatocyte growth factor (HGF), tyrosine-protein kinase Met (c-MET), C-type lectin family 14 member A (CLEC14A), multimerin 2 (MMRN2), shock protein 70-1A (HSP70-1A), a epidermal growth factor (EGF), EGF receptor (EGFR), or any combination thereof.
  • VEGF vascular endothelial growth factor
  • VGF VEGF receptor
  • PDGF platelet-derived growth factor
  • PDGFR PDGF receptor
  • Ang angiopoietin
  • Ang tyrosine kinase with Ig-
  • the anti-angiogenesis agent comprises bevacizumab, ramucirumab, aflibercept, tanibirumab, olaratumab, nesvacumab, AMG780, MEDI3617, vanucizumab, rilotumumab, ficlatuzumab, TAK-701, onartuzumab, emibetuzumab, or any combination thereof.
  • the checkpoint inhibitor comprises a programmed death-1 (PD-1) pathway inhibitor, a cytotoxic T-lymphocyte-associated protein 4 (CTLA-4) inhibitor, a T cell immunoglobulin and ITIM domain (TIGIT) inhibitor, a T cell immunoglobulin and mucin-domain containing-3 (TIM-3) inhibitor, a TIM-1 inhibitor, a TIM-4 inhibitor, a B7- H3 inhibitor, a B7-H4 inhibitor, a B and T cell lymphocyte attenuator (BTLA) inhibitor, a V-domain Ig suppressor of T cell activation (VISTA) inhibitor, an indoleamine 2,3- dioxygenase (IDO) inhibitor, a nicotinamide adenine dinucleotide phosphate oxidase isoform 2 (N0X2) inhibitor, a killer-cell immunoglobulin-like receptor (KIR) inhibitor, an adenosine A2a receptor (A2aR) inhibitor,
  • PD-1 programmed death
  • the PD-1 pathway inhibitor is an anti-PD-Ll antibody.
  • the anti-PD-Ll antibody is a full-length antibody.
  • the anti-PD-Ll antibody is a monoclonal, human, humanized, chimeric, or multispecific antibody.
  • the multispecific antibody is a DART, a DVD-Ig, or bispecific antibody.
  • the anti-PD-Ll antibody is a F(ab')2 fragment, a Fab' fragment, a Fab fragment, a Fv fragment, a scFv fragment, a dsFv fragment, a dAb fragment, or a single chain binding polypeptide.
  • the anti-PD-Ll antibody is BMS-936559, atezolizumab, durvalumab, avelumab, STI-1014, CX-072, KN035, LY3300054, BGB-A333, ICO 36, FAZ053, CK-301, or comprises an antigen binding portion thereof.
  • the PD-1 pathway inhibitor is BMS-986189.
  • the checkpoint inhibitor comprises a CTLA-4 inhibitor.
  • the CTLA-4 inhibitor is an anti-CTLA-4 antibody.
  • the anti-CTLA-4 antibody is a full-length antibody.
  • the anti-CTLA-4 antibody is a monoclonal, human, humanized, chimeric, or multispecific antibody.
  • the multispecific antibody is a DART, a DVD-Ig, or bispecific antibody.
  • the anti-CTLA-4 antibody is a F(ab')2 fragment, a Fab' fragment, a Fab fragment, a Fv fragment, a scFv fragment, a dsFv fragment, a dAb fragment, or a single chain binding polypeptide.
  • the anti-CTLA-4 antibody is ipilimumab, tremelimumab, MK- 1308, AGEN-1884, or comprises an antigen binding portion thereof.
  • the anti -LAG-3 antibody and the anti -PD-1 antibody are formulated for intravenous administration.
  • the checkpoint inhibitor is formulated for intravenous administration.
  • the anti -LAG-3 antibody and the anti-PD-1 antibody are formulated separately.
  • the anti-PD-1 antibody is administered before the anti-LAG-3 antibody.
  • the anti-LAG-3 antibody is administered before the anti-PD-1 antibody.
  • the anti-LAG-3 antibody and the anti-PD-1 antibody are formulated together.
  • the LAG-3 antibody and the anti-PD-1 antibody are administered concurrently.
  • the LAG-3 antibody and/or the anti-PD-1 antibody is administered once about every one week, once about every two weeks, once about every three weeks, once about every four weeks, once about every five weeks, once about every six weeks, once about every seven weeks, once about every eight weeks, once about every nine weeks, once about every ten weeks, once about every eleven weeks, or once about every twelve weeks.
  • the LAG-3 antibody and the anti-PD-1 antibody are administered every four weeks.
  • the present disclosure provides a method of treating a human subject afflicted with hepatocellular carcinoma (HCC), the method comprising administering to the subject a LAG-3 antagonist (e.g., an anti-LAG-3 antibody).
  • LAG-3 antagonist e.g., an anti-LAG-3 antibody
  • Some aspects of the present disclosure are directed to a method of treating a human subject afflicted with HCC, wherein the method is a first, second, or third line therapy, and/or wherein the subject has progressed on or is intolerant to a prior therapy.
  • Some aspects of the present disclosure are directed to a method of treating a human subject afflicted with unresectable, advanced, and/or metastatic HCC.
  • Some aspects of the present disclosure are directed to a method of treating a human subject afflicted with HCC, the method comprising administering to the subject a LAG-3 antagonist and an additional therapeutic agent (e.g., a PD-1 pathway inhibitor).
  • a or “an” entity refers to one or more of that entity; for example, “a nucleotide sequence,” is understood to represent one or more nucleotide sequences.
  • the terms “a” (or “an”), “one or more,” and “at least one” can be used interchangeably herein.
  • the terms "about” or “comprising essentially of refer to a value or composition that is within an acceptable error range for the particular value or composition as determined by one of ordinary skill in the art, which will depend in part on how the value or composition is measured or determined, /. ⁇ ?., the limitations of the measurement system.
  • “about” or “comprising essentially of can mean within 1 or more than 1 standard deviation per the practice in the art.
  • “about” or “comprising essentially of can mean a range of up to 10% or 20% (z.e., ⁇ 10% or ⁇ 20%).
  • about 3 mg can include any number between 2.7 mg and 3.3 mg (for 10%) or between 2.4 mg and 3.6 mg (for 20%).
  • any concentration range, percentage range, ratio range or integer range is to be understood to include the value of any integer within the recited range and, when appropriate, fractions thereof (such as one-tenth and one-hundredth of an integer), unless otherwise indicated.
  • an "antagonist” shall include, without limitation, any molecule capable of blocking, reducing, or otherwise limiting an interaction or activity of a target molecule (e.g., LAG- 3).
  • the antagonist is an antibody.
  • the antagonist comprises a small molecule.
  • the terms "antagonist” and “inhibitor” are used interchangeably herein.
  • an "antibody” shall include, without limitation, a glycoprotein immunoglobulin which binds specifically to an antigen and comprises at least two heavy (H) chains and two light (L) chains interconnected by disulfide bonds.
  • Each H chain comprises a heavy chain variable region (abbreviated herein as Vzz) and a heavy chain constant region (abbreviated herein as CH).
  • the heavy chain constant region comprises three constant domains, CHI, CHI and CH3.
  • Each light chain comprises a light chain variable region (abbreviated herein as Vz) and a light chain constant region (abbreviated herein as CL).
  • the light chain constant region comprises one constant domain, CL.
  • the Vzz and Vz regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDRs), interspersed with regions that are more conserved, termed framework regions (FR).
  • CDRs complementarity determining regions
  • FR framework regions
  • Each Vzz and Vz comprises three CDRs and four FRs, arranged from amino-terminus to carboxy -terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
  • the variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
  • the constant regions of the antibodies can mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system.
  • a heavy chain can have the C-terminal lysine or not.
  • the amino acids in the variable regions are numbered using the Kabat numbering system and those in the constant regions
  • An immunoglobulin can derive from any of the commonly known isotypes, including but not limited to IgA, secretory IgA, IgG and IgM.
  • IgG subclasses are also well known to those in the art and include but are not limited to human IgGl, IgG2, IgG3 and IgG4.
  • immunotype refers to the antibody class or subclass (e.g., IgM or IgGl) that is encoded by the heavy chain constant region genes.
  • antibody includes, by way of example, both naturally occurring and non-naturally occurring antibodies; monoclonal and polyclonal antibodies; chimeric and humanized antibodies; human or nonhuman antibodies; wholly synthetic antibodies; single chain antibodies; monospecific antibodies; bispecific antibodies; and multi-specific antibodies.
  • a nonhuman antibody can be humanized by recombinant methods to reduce its immunogenicity in humans.
  • the term "antibody” also includes an antigen-binding fragment or an antigen-binding portion of any of the aforementioned immunoglobulins, and includes a monovalent and a divalent fragment or portion, that retains the ability to bind specifically to the antigen bound by the whole immunoglobulin.
  • an “antigen-binding portion” or “antigen-binding fragment” include: (1) a Fab fragment (fragment from papain cleavage) or a similar monovalent fragment consisting of the Vz, Vzz, Lc and CHI domains; (2) a F(ab’)2 fragment (fragment from pepsin cleavage) or a similar bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (3) a Fd fragment consisting of the VH and CHI domains; (4) a Fv fragment consisting of the Vz and Vzz domains of a single arm; (5) a single domain antibody (dAb) fragment (Ward et al., (1989) Nature 341 :544-46), which consists of a Vzz domain; (6) a bi -single domain antibody which consists of two MH domains linked by a hinge (dual-affinity re-targeting antibodies (DARTs)); or (7) a dual variable domain immuno
  • the two domains of the Fv fragment, Vz and VH are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the Vz and Vzz regions pair to form monovalent molecules (known as single chain Fv (scFv); see, e.g., Bird et al. (1988) Science 242:423-426; and Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883).
  • scFv single chain Fv
  • an "isolated antibody” refers to an antibody that is substantially free of other antibodies having different antigenic specificities (e.g., an isolated antibody that binds specifically to LAG-3 is substantially free of antibodies that do not bind specifically to LAG-3).
  • An isolated antibody that binds specifically to LAG-3 can, however, have crossreactivity to other antigens, such as LAG-3 molecules from different species.
  • an isolated antibody can be substantially free of other cellular material and/or chemicals.
  • mAb monoclonal antibody
  • a mAb is an example of an isolated antibody.
  • MAbs can be produced by hybridoma, recombinant, transgenic or other techniques known to those skilled in the art.
  • a “human” antibody refers to an antibody having variable regions in which both the framework and CDR regions are derived from human germline immunoglobulin sequences. Furthermore, if the antibody contains a constant region, the constant region is also derived from human germline immunoglobulin sequences.
  • the human antibodies of the invention can include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo).
  • the term "human antibody,” as used herein is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
  • a “humanized antibody” refers to an antibody in which some, most or all of the amino acids outside the CDR domains of a non-human antibody are replaced with corresponding amino acids derived from human immunoglobulins. In one aspect of a humanized form of an antibody, some, most or all of the amino acids outside the CDR domains have been replaced with amino acids from human immunoglobulins, whereas some, most or all amino acids within one or more CDR regions are unchanged. Small additions, deletions, insertions, substitutions or modifications of amino acids are permissible as long as they do not abrogate the ability of the antibody to bind to a particular antigen.
  • a "humanized” antibody retains an antigenic specificity similar to that of the original antibody.
  • a "chimeric antibody” refers to an antibody in which the variable regions are derived from one species and the constant regions are derived from another species, such as an antibody in which the variable regions are derived from a mouse antibody and the constant regions are derived from a human antibody.
  • an "anti-antigen” antibody refers to an antibody that binds specifically to the antigen.
  • an anti-LAG-3 antibody binds specifically to LAG-3.
  • LAG-3 refers to Lymphocyte Activation Gene-3.
  • the term “LAG-3” includes variants, isoforms, homologs, orthologs and paralogs.
  • antibodies specific for a human LAG-3 protein can, in certain cases, cross-react with a LAG-3 protein from a species other than human.
  • the antibodies specific for a human LAG-3 protein can be completely specific for the human LAG-3 protein and not exhibit species or other types of cross-reactivity, or can cross-react with LAG-3 from certain other species, but not all other species (e.g., cross-react with monkey LAG-3 but not mouse LAG-3).
  • human LAG-3 refers to human sequence LAG-3, such as the complete amino acid sequence of human LAG-3 having GenBank Accession No. NP 002277.
  • mouse LAG-3 refers to mouse sequence LAG-3, such as the complete amino acid sequence of mouse LAG-3 having GenBank Accession No. NP_032505.
  • LAG-3 is also known in the art as, for example, CD223.
  • the human LAG-3 sequence can differ from human LAG-3 of GenBank Accession No. NP_002277 by having, e.g., conserved mutations or mutations in non-conserved regions, and the LAG-3 has substantially the same biological function as the human LAG-3 of GenBank Accession No. NP 002277.
  • a biological function of human LAG-3 is having an epitope in the extracellular domain of LAG-3 that is specifically bound by an antibody of the instant disclosure or a biological function of human LAG-3 is binding to MHC Class II molecules.
  • a particular human LAG-3 sequence will generally be at least about 90% identical in amino acid sequence to human LAG-3 of GenBank Accession No. NP 002277 and contains amino acid residues that identify the amino acid sequence as being human when compared to LAG-3 amino acid sequences of other species (e.g., murine).
  • a human LAG-3 can be at least about 95%, or even at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical in amino acid sequence to LAG-3 of GenBank Accession No. NP 002277.
  • a human LAG-3 sequence will display no more than 10 amino acid differences from the LAG-3 sequence of GenBank Accession No. NP 002277.
  • the human LAG-3 can display no more than 5, or even no more than 4, 3, 2, or 1 amino acid difference from the LAG-3 sequence of GenBank Accession No. NP_002277.
  • PD-1 Programmed Death-1
  • PD-1 refers to an immunoinhibitory receptor belonging to the CD28 family. PD-1 is expressed predominantly on previously activated T cells in vivo, and binds to two ligands, PD-L1 and PD-L2.
  • the term "PD-1 " as used herein includes human PD-1 (hPD-1), variants, isoforms, and species homologs of hPD-1, and analogs having at least one common epitope with hPD-1. The complete hPD-1 sequence can be found under GenBank Accession No. U64863.
  • PD-1 and PD-1 receptor are used interchangeably herein.
  • CTLA-4 Cytotoxic T-Lymphocyte Antigen-4
  • CTLA-4 is expressed exclusively on T cells in vivo, and binds to two ligands, CD80 and CD86 (also called B7-1 and B7-2, respectively).
  • CTLA-4" as used herein includes human CTLA-4 (hCTLA-4), variants, isoforms, and species homologs of hCTLA-4, and analogs having at least one common epitope with hCTLA-4.
  • the complete hCTLA-4 sequence can be found under GenBank Accession No. AAB59385.
  • P-L1 Programmed Death Ligand- 1
  • PD-L1 is one of two cell surface glycoprotein ligands for PD-1 (the other being PD-L2) that downregulate T cell activation and cytokine secretion upon binding to PD-1.
  • the term "PD-L1” as used herein includes human PD-L1 (hPD-Ll), variants, isoforms, and species homologs of hPD-Ll, and analogs having at least one common epitope with hPD-Ll. The complete hPD-Ll sequence can be found under GenBank Accession No. Q9NZQ7.
  • P-L2 Programmed Death Ligand-2
  • PD-L2 human PD-L2 (hPD-L2), variants, isoforms, and species homologs of hPD-L2, and analogs having at least one common epitope with hPD-L2.
  • the complete hPD-L2 sequence can be found under GenBank Accession No. Q9BQ51.
  • a "patient” as used herein includes any patient who is afflicted with a HCC (e.g., metastatic or unresectable HCC).
  • HCC e.g., metastatic or unresectable HCC.
  • subject and patient are used interchangeably herein.
  • administering refers to the physical introduction of a therapeutic agent to a subject (e.g., a composition or formulation comprising the therapeutic agent), using any of the various methods and delivery systems known to those skilled in the art.
  • routes of administration include intravenous, intramuscular, subcutaneous, intraperitoneal, spinal or other parenteral routes of administration, for example by injection or infusion.
  • parenteral administration means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intralymphatic, intralesional, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrasternal injection and infusion, as well as in vivo electroporation.
  • the formulation is administered via a non-parenteral route, in some aspects, orally.
  • non-parenteral routes include a topical, epidermal or mucosal route of administration, for example, intranasally, vaginally, rectally, sublingually or topically.
  • Administering can also be performed, for example, once, a plurality of times, and/or over one or more extended periods.
  • a "Child-Pugh” score or status is a measure of the severity of liver disease in a subject that employs five clinical measures of liver disease (i.e., (1) total bilirubin, (2) serum albumin, (3) ascites, (4) hepatic encephalopathy, and (5) either prothrombin time or international normalized ratio).
  • Each measure of liver disease is scored from 1 to 3 points, with 3 points indicating the most severe disease, and total scores ranging from 5 to 15 points.
  • a subject with a Child-Pugh score of 5-6 has a Child-Pugh A (or Class A) status, indicating normal or apparently normal liver function.
  • ECOG PS Eastern Cooperative Oncology Group Performance Status
  • Example definitions for ECOG PS include: "0" for a patient who is fully active and able to carry on all pre-disease performance without restriction; "1” for a patient who is restricted in physically strenuous activity but ambulatory and able to carry out work of a light or sedentary nature; "2” for a patient who is ambulatory and capable of all self-care, up and about more than 50% of waking hours, but unable to carry out any work activities; "3” for a patient who is capable of only limited self-care and is confined to a bed or chair more than 50% of waking hours; and "4" for a patient who is completely disabled, cannot carry on any self-care, and is totally confined to bed or chair.
  • a "Barcelona Clinic Liver Cancer (BCLC)" staging system assesses the number of and size of tumors in a patient's liver, the patient's performance status (e.g., ECOG PS), and the patient's liver function (e.g., Child-Pugh score).
  • BCLC Barcelona Clinic Liver Cancer
  • Stage 0 indicates a very early stage corresponding to ECOG PS 0 and Child-Pugh A
  • Stages A and B indicate early and intermediate stages, respectively, that correspond to ECOG PS 0 and either Child-Pugh A or B depending on liver function
  • Stage C indicates an advanced stage corresponding to PS 1 or 2 and either Child-Pugh A or B depending on liver function
  • Stage D indicates severe liver damage corresponding to PS 3 or 4 and Child-Pugh C.
  • Treatment or “therapy” of a subject refers to any type of intervention or process performed on, or the administration of an active agent to, the subject with the objective of reversing, alleviating, ameliorating, inhibiting, slowing down progression, development, severity or recurrence of a symptom, complication or condition, or biochemical indicia associated with a disease.
  • Response Evaluation Criteria In Solid Tumors (RECIST) is a measure for treatment efficacy and are established rules that define when tumors respond, stabilize, or progress during treatment.
  • RECIST 1.1 is the current guideline to solid tumor measurement and definitions for objective assessment of change in tumor size for use in adult and pediatric cancer clinical trials.
  • effective treatment refers to treatment producing a beneficial effect, e.g., amelioration of at least one symptom of a disease or disorder.
  • a beneficial effect can take the form of an improvement over baseline, i.e., an improvement over a measurement or observation made prior to initiation of therapy according to the method.
  • a beneficial effect can also take the form of arresting, slowing, retarding, or stabilizing of a deleterious progression of a marker of solid tumor.
  • Effective treatment can refer to alleviation of at least one symptom of a solid tumor.
  • Such effective treatment can, e.g., reduce patient pain, reduce the size and/or number of lesions, can reduce or prevent metastasis of a tumor, and/or can slow tumor growth.
  • an effective amount refers to an amount of an agent that provides the desired biological, therapeutic, and/or prophylactic result. That result can be reduction, amelioration, palliation, lessening, delaying, and/or alleviation of one or more of the signs, symptoms, or causes of a disease, or any other desired alteration of a biological system.
  • an effective amount comprises an amount sufficient to cause a tumor to shrink and/or to decrease the growth rate of the tumor (such as to suppress tumor growth) or to delay other unwanted cell proliferation.
  • an effective amount is an amount sufficient to prevent or delay tumor recurrence.
  • An effective amount can be administered in one or more administrations.
  • the effective amount of the drug or composition can: (i) reduce the number of cancer cells; (ii) reduce tumor size; (iii) inhibit, retard, slow to some extent and can stop cancer cell infiltration into peripheral organs; (iv) inhibit (i.e., slow to some extent and can stop tumor metastasis; (v) inhibit tumor growth; (vi) prevent or delay occurrence and/or recurrence of tumor; and/or (vii) relieve to some extent one or more of the symptoms associated with the cancer.
  • an "effective amount” is the amount of anti -LAG-3 antibody alone or the amount of anti-LAG- 3 antibody and the amount an additional therapeutic agent (e.g., anti-PD-1 antibody), in combination, clinically proven to affect a significant decrease in cancer or slowing of progression of cancer, such as an advanced solid tumor.
  • an additional therapeutic agent e.g., anti-PD-1 antibody
  • the terms “fixed dose”, “flat dose” and “flat-fixed dose” are used interchangeably and refer to a dose that is administered to a patient without regard for the weight or body surface area (BSA) of the patient.
  • the fixed or flat dose is therefore not provided as a mg/kg dose, but rather as an absolute amount of the agent (e.g., an amount in pg or mg).
  • fixed dose combination means that two or more different inhibitors as described herein (e.g., an anti- LAG-3 antibody and an anti-PD-1 antibody) in a single composition are present in the composition in particular (fixed) ratios with each other.
  • the fixed dose is based on the weight (e.g., mg) of the inhibitors.
  • the fixed dose is based on the concentration (e.g., mg/ml) of the inhibitors.
  • the ratio is at least about 1 : 1, about 1:2, about 1 :3, about 1 :4, about 1 :5, about 1 :6, about 1 :7, about 1 :8, about 1 :9, about 1 : 10, about 1 : 15, about 1 :20, about 1 :30, about 1 :40, about 1 :50, about 1:60, about 1 :70, about 1 :80, about 1 :90, about 1 : 100, about 1 : 120, about 1 : 140, about 1 :160, about 1 : 180, about 1 :200, about 200: 1, about 180: 1, about 160: 1, about 140: 1, about 120: 1, about 100: 1, about 90: 1, about 80: 1, about 70: 1, about 60: 1, about 50: 1, about 40: 1, about 30: 1, about 20: 1, about 15: 1, about 10: 1, about 9: 1, about 8: 1, about 7: 1, about 6: 1, about 5: 1, about 4: 1, about 3: 1, or about 2: 1 mg first inhibitor to mg second inhibitor.
  • the 2: 1 ratio of a first inhibitor and a second inhibitor can mean that a vial can contain about 480 mg of the first inhibitor and 960 mg of the second inhibitor, about 12 mg/ml of the first inhibitor and 6 mg/ml of the second inhibitor, or about 100 mg/ml of the first inhibitor and 50 mg/ml of the second inhibitor.
  • weight based dose means that a dose that is administered to a patient is calculated based on the weight of the patient.
  • Dosing interval means the amount of time that elapses between multiple doses of a formulation disclosed herein being administered to a subject. Dosing interval can thus be indicated as ranges.
  • Dosing frequency refers to the frequency of administering doses of a formulation disclosed herein in a given time. Dosing frequency can be indicated as the number of doses per a given time, e.g., once a week or once in two weeks, etc.
  • the terms "about once a week,” “once about every week,” “once about every two weeks,” or any other similar dosing interval terms as used herein means approximate number, and "about once a week” or “once about every week” can include every seven days ⁇ two days, i.e., every five days to every nine days.
  • the dosing frequency of "once a week” thus can be every five days, every six days, every seven days, every eight days, or every nine days.
  • “Once about every three weeks” can include every 21 days ⁇ 3 days, i.e., every 25 days to every 31 days.
  • a dosing interval of once about every six weeks or once about every twelve weeks means that the first dose can be administered any day in the first week, and then the next dose can be administered any day in the sixth or twelfth week, respectively.
  • a dosing interval of once about every six weeks or once about every twelve weeks means that the first dose is administered on a particular day of the first week (e.g., Monday) and then the next dose is administered on the same day of the sixth or twelfth weeks (i.e., Monday), respectively.
  • An "adverse event” as used herein is any unfavorable and generally unintended or undesirable sign (including an abnormal laboratory finding), symptom, or disease associated with the use of a medical treatment.
  • an adverse event can be associated with activation of the immune system or expansion of immune system cells (e.g., T cells) in response to a treatment.
  • a medical treatment can have one or more associated AEs and each AE can have the same or different level of severity.
  • tumor refers to any mass of tissue that results from excessive cell growth or proliferation, either benign (non-cancerous) or malignant (cancerous), including pre-cancerous lesions.
  • the term "biological sample” as used herein refers to biological material isolated from a subject.
  • the biological sample can contain any biological material suitable for analysis, for example, by sequencing nucleic acids in the tumor (or circulating tumor cells) and identifying a genomic alteration in the sequenced nucleic acids.
  • the biological sample can be any suitable biological tissue or fluid such as, for example, tumor tissue, blood, blood plasma, and serum.
  • the biological sample can be a test tissue sample (e.g., a tissue sample comprising tumor cells and tumor-infiltrating inflammatory cells).
  • the sample is a tumor tissue biopsy, e.g., a formalin-fixed, paraffin-embedded (FFPE) tumor tissue or a fresh-frozen tumor tissue or the like.
  • the biological sample is a liquid biopsy that, in some aspects, comprises one or more of blood, serum, plasma, circulating tumor cells, exoRNA, ctDNA, and cfDNA.
  • an “anti-cancer agent” promotes cancer regression in a subject.
  • a therapeutically effective amount of the agent promotes cancer regression to the point of eliminating the cancer.
  • Promote cancer regression means that administering an effective amount of the anti-cancer agent, alone or in combination with another agent, results in a reduction in tumor growth or size, necrosis of the tumor, a decrease in severity of at least one disease symptom, an increase in frequency and duration of disease symptom-free periods, or a prevention of impairment or disability due to the disease affliction.
  • the terms “effective” and “effectiveness” with regard to a treatment includes both pharmacological effectiveness and physiological safety. Pharmacological effectiveness refers to the ability of the agent to promote cancer regression in the patient.
  • Physiological safety refers to the level of toxicity, or other adverse physiological effects at the cellular, organ and/or organism level (adverse effects) resulting from administration of the agent.
  • a therapeutically effective amount of an anti-cancer agent can inhibit cell growth or tumor growth by at least about 20%, at least about 40%, at least about 60%, or at least about 80% relative to untreated subjects.
  • tumor regression can be observed and continue for a period of at least about 20 days, more preferably at least about 40 days, or at least about 60 days. Notwithstanding these measurements of therapeutic effectiveness, evaluation of immunotherapeutic drugs must also make allowance for immune-related response patterns.
  • an "immuno-oncology" therapy or an “I-O” or “IO” therapy refers to a therapy that comprises utilizing an immune response to target and treat a tumor in a subject.
  • an 1-0 therapy is a type of anti-cancer therapy.
  • an 1-0 therapy comprises administering an antibody to a subject.
  • an 1-0 therapy comprises administering to a subject an immune cell, e.g., a T cell, e.g., a modified T cell, e.g., a T cell modified to express a chimeric antigen receptor or a particular T cell receptor.
  • the 1-0 therapy comprises administering a therapeutic vaccine to a subject.
  • the 1-0 therapy comprises administering a cytokine or a chemokine to a subject. In some aspects, the 1-0 therapy comprises administering an interleukin to a subject. In some aspects, the 1-0 therapy comprises administering an interferon to a subject. In some aspects, the 1-0 therapy comprises administering a colony stimulating factor to a subject.
  • an "immune response” refers to the action of a cell of the immune system (for example, T lymphocytes, B lymphocytes, natural killer (NK) cells, macrophages, eosinophils, mast cells, dendritic cells and neutrophils) and soluble macromolecules produced by any of these cells or the liver (including antibodies, cytokines, and complement) that results in selective targeting, binding to, damage to, destruction of, and/or elimination from a vertebrate's body of invading pathogens, cells or tissues infected with pathogens, cancerous or other abnormal cells, or, in cases of autoimmunity or pathological inflammation, normal human cells or tissues.
  • a cell of the immune system for example, T lymphocytes, B lymphocytes, natural killer (NK) cells, macrophages, eosinophils, mast cells, dendritic cells and neutrophils
  • soluble macromolecules produced by any of these cells or the liver including antibodies, cytokines, and complement
  • a "tumor-infiltrating inflammatory cell” or “tumor-associated inflammatory cell” is any type of cell that typically participates in an inflammatory response in a subject and which infiltrates tumor tissue. Such cells include tumor-infiltrating lymphocytes (TILs), macrophages, monocytes, eosinophils, histiocytes and dendritic cells.
  • TILs tumor-infiltrating lymphocytes
  • macrophages macrophages
  • monocytes eosinophils
  • histiocytes histiocytes and dendritic cells.
  • LAG-3 positive or "LAG-3 expression positive,” relating to LAG-3 expression, refers to tumor tissue (e.g., a test tissue sample) that is scored as expressing LAG-3 based on the proportion (z.e., percentage) of immune cells (e.g., tumor-infiltrating lymphocytes such as CD8+ T cells) expressing LAG-3 (e.g., greater than or equal to 1% expression).
  • immune cells e.g., tumor-infiltrating lymphocytes such as CD8+ T cells
  • LAG-3 negative refers to tumor tissue (e.g., a test tissue sample) that is not scored as expressing LAG-3 (e.g., less than 1% LAG-3 expression).
  • PD-L1 positive or "PD-L1 expression positive,” relating to cell surface PD-L1 expression, refers to tumor tissue (e.g., a test tissue sample) that is scored as expressing PD-L1 based on the proportion (z.e., percentage) of tumor cells expressing PD- L1 (e.g., greater than or equal to 1% expression).
  • PD-L1 negative or "PD-L1 expression negative” refers to tumor tissue (e.g., a test tissue sample) that is not scored as expressing PD-L1 (e.g., less than 1% expression).
  • HCC hepatocellular carcinoma
  • methods of treating a human subject afflicted with hepatocellular carcinoma comprising administering to the subject a LAG-3 antagonist (e.g., an anti-LAG-3 antibody).
  • LAG-3 antagonist e.g., an anti-LAG-3 antibody.
  • the method is a first line (IL) therapy.
  • the method is a second line (2L) therapy.
  • the method is a third line (3L) therapy.
  • the subject has progressed on or is intolerant to a prior therapy (e.g., a standard of care therapy, including a standard of care IL or 2L therapy).
  • a prior therapy e.g., a standard of care therapy, including a standard of care IL or 2L therapy.
  • the prior therapy and/or standard of care therapy comprises a tyrosine kinase inhibitor, an anti-angiogenesis agent, a checkpoint inhibitor, a checkpoint stimulator, a chemotherapeutic agent, an immunotherapeutic agent (e.g., an agent used in immunooncology therapy), a platinum agent, an alkylating agent, a taxane, a nucleoside analog, an antimetabolite, a topisomerase inhibitor, an anthracycline, a vinca alkaloid, or any combination thereof.
  • a prior therapy e.g., a standard of care therapy, including a standard of care IL or 2L therapy.
  • the prior therapy comprises sorafenib (e.g., sorafenib tosylate, also known as NEXAVAR®, which is indicated for the treatment of patients with unresectable HCC), lenvatinib (e.g., lenvatinib mesylate, also known as LENVIMA®, which is indicated for IL treatment of patients with unresectable HCC), regorafenib (e.g., STIVARGA®, which is indicated for the treatment of patients with HCC who have been previously treated with sorafenib) and/or cabozantinib (e.g., cabozantinib S-malate, also known as CABOMETYX®, which is indicated for the treatment of patients with HCC who have been previously treated with sorafenib).
  • sorafenib e.g., sorafenib tosylate, also known as NEXAVAR®, which is indicated for the
  • the prior therapy comprises the combination of an anti-PD-Ll antibody (e.g., atezolizumab, also known as TECENTRIQ®) and an anti-VEGF antibody (e.g, bevacizumab, also known as AVASTIN®).
  • an anti-PD-Ll antibody e.g., atezolizumab, also known as TECENTRIQ®
  • an anti-VEGF antibody e.g, bevacizumab, also known as AVASTIN®.
  • the combination of atezolizumab and bevacizumab is indicated for the treatment of patients with unresectable or metastatic HCC who have not received prior systemic therapy.
  • the prior therapy comprises an anti-VEGFR-2 antibody (e.g, ramucirumab, also known as CYRAMZA®, which is indicated as a single agent, for the treatment of patients with HCC who have an alpha fetoprotein of >400 ng/mL and have been treated with sorafenib).
  • the prior therapy is an anti-PD-1 antibody (e.g., nivolumab, also known as OPDIVO®, or pembrolizumab, also known as KEYTRUDA®, each indicated as a single agent for the treatment of patients with HCC who have been previously treated with sorafenib).
  • the prior therapy is the combination of an anti-PD-1 antibody (e.g., nivolumab/OPDIVO®) in combination with an anti-CTLA-4 antibody (e.g., ipilimumab, also known as YERVOY®).
  • an anti-CTLA-4 antibody e.g., ipilimumab, also known as YERVOY®.
  • the combination of nivolumab and ipilimumab is indicated for the treatment of patients who have been previously treated with sorafenib.
  • the subject is naive to prior immuno-oncology (I-O) therapy.
  • the subject has never received 1-0 therapy, has received 1-0 therapy for a cancer other than HCC, or has received 1-0 therapy for a previous HCC but not a current HCC.
  • the subject is naive to prior 1-0 therapy, the subject is naive to prior 1-0 therapy for HCC, or the HCC is naive to prior 1-0 therapy.
  • the prior 1-0 therapy is an antibody.
  • the antibody binds to a checkpoint inhibitor.
  • the prior 1-0 therapy is an anti-PD-1 antibody and/or the combination of an anti-PD-1 antibody and an anti-CTLA-4 antibody.
  • a method of the disclosure increases duration of progression-free survival (PFS), objective response rate (ORR), overall survival (OS), or any combination thereof as compared to a standard of care therapy and/or a prior therapy such as disclosed herein.
  • PFS progression-free survival
  • ORR objective response rate
  • OS overall survival
  • a method of the disclosure reduces the size of a tumor, inhibits growth of a tumor, eliminates a tumor from the subject, prevents relapse of HCC, induces remission of HCC, provides a complete response or partial response, or any combination thereof.
  • HCC in the methods of the disclosure is unresectable, advanced, and/or metastatic.
  • Advanced stage disease can include microvascular invasion (MVI) of HCC and/or extrahepatic spread (EHS) of HCC (Forner A, et al., Lancet (2Q ⁇ 8y, 391(10127): 1301-1314).
  • Microvascular invasion ofHCC refers to hepatic vein tumor thrombus, or inferior vena cava tumor thrombus, or portal vein (Vp) tumor thrombus Vp3/Vp4 (presence of a tumor thrombus in the main trunk of the portal vein or a portal vein branch contralateral to the primarily involved lobe or first- order branches of the portal vein).
  • Extrahepatic spread refers to metastatic disease in lymph nodes or distant sites outside the liver.
  • the subject has microvascular invasion of HCC and/or extrahepatic spread of HCC.
  • the subject lacks microvascular invasion of HCC and/or extrahepatic spread of HCC.
  • the methods of the disclosure comprise administering to the subject a LAG-3 antagonist based on the subject's performance status, liver function, and/or cancer stage.
  • Performance status, liver function, and/or cancer stage can be indicated by any one or more systems in the art.
  • the system is Child-Pugh score or status, Eastern Cooperative Oncology Group Performance Status (ECOG PS), and/or Barcelona Clinic Liver Cancer (BCLC) stage.
  • the subject has a Child-Pugh score of 5-6, 7-9, or 10-15.
  • the subject has a Child-Pugh status of A, B, or C.
  • the subject has a Child-Pugh score of 5-6 and/or has Child-Pugh A status.
  • the subject has a Child-Pugh score of 7-9 and/or has Child-Pugh B status. In some aspects, the subject has a Child-Pugh score of 10-15 and/or has Child-Pugh C status. In some aspects, the subject has an ECOG PS of 0, 1, 2, 3, or 4. In some aspects, the subject has a BCLC status of 0, A, B, C, or D. In some aspects, the subject has an ECOG PS of 0, a Child-Pugh score of 5-6, a Child-Pugh A (or Class A) status, and/or a BCLC stage of 0.
  • the subject has an ECOG PS of 0, a Child-Pugh score of 5 or 6, a Child- Pugh A (or Class A) status, and/or a BCLC stage of A. In some aspects, the subject has an ECOG PS of 0, a Child-Pugh score of 7-9, a Child-Pugh B (or Class B) status, and/or a BCLC stage of B. In some aspects, the subject has an ECOG PS of 1 or 2, a Child-Pugh score of 5-6 or 7-9, a Child-Pugh A or B (Class A or Class B) status, and/or a BCLC stage of C. In some aspects, the subject has an ECOG PS of 3 or 4, a Child-Pugh score of 10-15, a Child-Pugh C (or Class C) status, and/or a BCLC stage of D.
  • HCC is often related to cirrhosis resulting from chronic inflammation due to infection (e.g., viral hepatitis), alcoholic liver disease, or non-alcoholic fatty liver disease.
  • infection e.g., viral hepatitis
  • HCC is often associated with hepatitis B virus (HBV) infection and aflatoxin Bl exposure, while in the US, Europe, and Japan, hepatitis C virus (HCV) infection is the main risk factor along with excessive alcohol consumption (Fomer A, supra).
  • HBV hepatitis B virus
  • HCV hepatitis C virus
  • Co-infection of human immunodeficiency virus (HIV) with HBV and/or HCV has also been linked with rapid progression of liver disease and increased risk of HCC (/ ⁇ /).
  • HCC non-alcoholic fatty liver disease
  • the HCC has an etiology associated with chronic liver disease, chronic liver inflammation, an infection, a toxin, aflatoxin Bl, alcoholic liver disease, tobacco use, metabolic syndrome, diabetes, obesity, and/or non- alcoholic fatty liver disease.
  • the HCC is viral HCC (i.e., the cause of HCC is a viral infection).
  • the HCC is non-viral HCC (i.e., the cause of HCC is any cause other than viral infection).
  • the subject has an HBV infection.
  • the subject has an HCV infection. In some aspects, the subject has an HBV infection and an HCV infection. In some aspects, the subject has an HIV infection and a HBV and/or HCV infection. In some aspects, the subject has alcoholic liver disease. In some aspects, the subject has metabolic syndrome, diabetes, and/or non-alcoholic fatty liver disease.
  • one or more immune cells in tumor tissue from the subject express LAG-3 (i.e., tumor tissue from the patient is LAG-3 positive) and/or one or more tumor cells in tumor tissue from the subject express PD-L1 (i.e., tumor tissue from the patient is PD-L1 positive). In some aspects, one or more immune cells in tumor tissue from the subject express LAG-3.
  • At least about 1%, at least about 2%, at least about 3%, at least about 4%, at least about 5%, at least about 7%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, or about 100% of the immune cells express LAG-3.
  • at least about 1% of the immune cells express LAG-3.
  • greater than about 1% of the immune cells express LAG-3.
  • at least about 5% of the immune cells express LAG-3.
  • the immune cells are tumor-infiltrating lymphocytes.
  • the tumor-infiltrating lymphocytes are CD8 + cells.
  • one or more tumor cells in tumor tissue from the subject express PD-L1.
  • at least about 1%, at least about 2%, at least about 3%, at least about 4%, at least about 5%, at least about 7%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, or about 100% of the tumor cells express PD-L1.
  • at least about 1% of the tumor cells express PD-L1.
  • greater than about 1% of the tumor cells express PD-L1.
  • at least about 5% of the tumor cells express PD-L1.
  • any of the values of "at least about X%" is ">X%").
  • one or more immune cells in tumor tissue from the patient does not express LAG-3 (i.e., tumor tissue from the patient is LAG-3 negative).
  • the tumor tissue is LAG-3 negative when less than about 1% of the immune cells express LAG-3.
  • one or more tumor cells in tumor tissue from the patient does not express PD-L1 (i.e., tumor tissue from the patient is PD-L1 negative).
  • the tumor tissue is PD-L1 negative when less than about 1% of the tumor cells express PD-L1.
  • LAG-3 and/or PD-L1 expression in the subject's tumor tissue is determined from a test tissue sample.
  • a test tissue sample includes, but is not limited to, any clinically relevant tissue sample, such as a tumor biopsy, a core biopsy, an incisional biopsy, an excisional biopsy, a surgical specimen, a fine needle aspirate, or a sample of bodily fluid, such as blood, plasma, serum, lymph, ascites fluid, cystic fluid, or urine.
  • the test tissue sample is from a primary tumor.
  • the test tissue sample is from a metastasis.
  • test tissue samples are from multiple time points, for example, before treatment, during treatment, and/or after treatment.
  • test tissue samples are from different locations in the subject, for example, from a primary tumor and from a metastasis.
  • the test tissue sample is a paraffin-embedded fixed tissue sample.
  • the test tissue sample is a formalin-fixed paraffin embedded (FFPE) tissue sample.
  • the test tissue sample is a fresh tissue (e.g., tumor) sample.
  • the test tissue sample is a frozen tissue sample.
  • the test tissue sample is a fresh frozen (FF) tissue (e.g., tumor) sample.
  • the test tissue sample is a cell isolated from a fluid.
  • the test tissue sample comprises circulating tumor cells (CTCs).
  • the test tissue sample comprises tumorinfiltrating lymphocytes (TILs).
  • the test tissue sample comprises tumor cells and tumor-infiltrating lymphocytes (TILs). In some aspects, the test tissue sample comprises circulating lymphocytes. In some aspects, the test tissue sample is an archival tissue sample. In some aspects, the test tissue sample is an archival tissue sample with known diagnosis, treatment, and/or outcome history. In some aspects, the sample is a block of tissue. In some aspects, the test tissue sample is dispersed cells. In some aspects, the sample size is from about 1 cell to about 1 x 10 6 cells or more. In some aspects, the sample size is about 1 cell to about 1 x 10 5 cells. In some aspects, the sample size is about 1 cell to about 10,000 cells. In some aspects, the sample size is about 1 cell to about 1,000 cells. In some aspects, the sample size is about 1 cells to about 100 cells. In some aspects, the sample size is about 1 cell to about 10 cells. In some aspects, the sample size is a single cell.
  • LAG-3 and/or PD-L1 expression is assessed by performing an assay to detect the presence of LAG-3 and/or PD-L1 RNA, respectively.
  • the presence of LAG-3 and/or PD-L1 RNA is detected by RT-PCR, in situ hybridization or RNase protection.
  • LAG-3 and/or PD-L1 expression is assessed by performing an assay to detect the presence of LAG-3 and/or PD-L1 polypeptide, respectively.
  • the presence of LAG-3 and/or PD-L1 polypeptide is detected by immunohistochemistry (IHC), enzyme-linked immunosorbent assay (ELISA), in vivo imaging, or flow cytometry.
  • a LAG-3 antagonist for use in the methods of the disclosure includes, but is not limited to, LAG-3 binding agents and soluble LAG-3 polypeptides.
  • LAG-3 binding agents include antibodies that specifically bind to LAG-3 (/. ⁇ ?., an "anti -LAG-3 antibody”).
  • the term “LAG-3 antagonist” as used herein is interchangeable with the term “LAG-3 inhibitor. "
  • the LAG-3 antagonist is an anti-LAG-3 antibody.
  • An exemplary LAG-3 antibody useful in the present disclosure is 25F7 (described in U.S. Publ. No. 2011/0150892).
  • An additional exemplary LAG-3 antibody useful in the present disclosure is BMS-986016 (relatlimab).
  • an anti-LAG-3 antibody useful in the present disclosure cross-competes with 25F7 or BMS-986016.
  • an anti-LAG-3 antibody useful in the present disclosure binds to the same epitope as 25F7 or BMS-986016.
  • an anti-LAG-3 antibody comprises six CDRs of 25F7 or BMS-986016.
  • IMP731 H5L7BW
  • MK-4280 28G-10, favezelimab
  • WO2016028672 and U.S. Publication No. 2020/0055938, REGN3767 (fianlimab) described in Burova E, et al., J. Immunother. Cancer (2016); 4(Supp. 1):P195 and U.S. Patent No. 10,358,495, humanized BAP050 described in WO20 17/019894, GSK2831781, IMP-701 (LAG-525; ieramilimab) described in U.S.
  • These and other anti -LAG-3 antibodies useful in the claimed invention can be found in, for example: US 10,188,730, WO 2016/028672, WO 2017/106129, WO2017/062888, W02009/044273, WO2018/069500, WO2016/126858,
  • Anti-LAG-3 antibodies that can be used in the methods of the disclosure also include isolated antibodies that bind specifically to human LAG-3 and cross-compete for binding to human LAG-3 with any anti-LAG-3 antibody disclosed herein, e.g., relatlimab.
  • the anti-LAG-3 antibody binds the same epitope as any of the anti-LAG- 3 antibodies described herein, e.g., relatlimab.
  • the antibodies that cross-compete for binding to human LAG-3 with, or bind to the same epitope region as, any anti-LAG-3 antibody disclosed herein, e.g., relatlimab are monoclonal antibodies.
  • these crosscompeting antibodies are chimeric antibodies, engineered antibodies, or humanized or human antibodies.
  • Such chimeric, engineered, humanized or human monoclonal antibodies can be prepared and isolated by methods well known in the art.
  • cross-competing antibodies are expected to have functional properties very similar those of the reference antibody, e.g., relatlimab, by virtue of their binding to the same epitope region.
  • Cross-competing antibodies can be readily identified based on their ability to cross- compete in standard binding assays such as Biacore analysis, ELISA assays or flow cytometry (see, e.g., WO 2013/173223).
  • Anti-LAG-3 antibodies that can be used in the methods of the disclosure also include antigen-binding portions of any of the above full-length antibodies. It has been amply demonstrated that the antigen-binding function of an antibody can be performed by fragments of a full-length antibody.
  • the anti-LAG-3 antibody is a full-length antibody.
  • the anti-LAG-3 antibody is a monoclonal, human, humanized, chimeric, or multispecific antibody.
  • the multispecific antibody is a dualaffinity re-targeting antibody (DART), a DVD-Ig, or bispecific antibody.
  • the anti-LAG-3 antibody is a F(ab')2 fragment, a Fab' fragment, a Fab fragment, a Fv fragment, a scFv fragment, a dsFv fragment, a dAb fragment, or a single chain binding polypeptide.
  • the anti-LAG-3 antibody is BMS-986016 (relatlimab), IMP731 (H5L7BW), MK-4280 (28G-10, favezelimab), REGN3767 (fianlimab), GSK2831781, humanized BAP050, IMP-701 (LAG-525, ieramilimab), aLAG3(0414), aLAG3(0416), Sym022, TSR-033, TSR-075, XmAb22841, MGD013, BI754111, FS118, P 13B02-30, AVA-017, 25F7, AGEN1746, or comprises an antigen binding portion thereof.
  • the anti-LAG-3 antibody is relatlimab.
  • the methods of the disclosure comprise an anti-LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4.
  • the methods of the disclosure comprise an anti-LAG-3 antibody comprising: (a) a heavy chain variable region CDR1 comprising the sequence set forth in SEQ ID NO:5; (b) a heavy chain variable region CDR2 comprising the sequence set forth in SEQ ID NO:6; (c) a heavy chain variable region CDR3 comprising the sequence set forth in SEQ ID NO:7; (d) a light chain variable region CDR1 comprising the sequence set forth in SEQ ID NO:8; (e) a light chain variable region CDR2 comprising the sequence set forth in SEQ ID NO:9; and (f) a light chain variable region CDR3 comprising the sequence set forth in SEQ ID NO: 10. [0230] In some aspects, the methods of the disclosure comprise an anti-LAG-3 antibody comprising heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs:3 and 4, respectively.
  • the methods of the disclosure comprise an anti-LAG-3 antibody comprising heavy and light chains comprising the sequences set forth in SEQ ID NOs: l and 2, respectively.
  • the methods of the disclosure comprise an anti-LAG-3 antibody comprising heavy and light chains comprising the sequences set forth in SEQ ID NOs:21 and 2, respectively.
  • the anti-LAG-3 antibody is REGN3767 (fianlimab).
  • fianlimab is administered intravenously at a dose of about 1 mg/kg, about 3 mg/kg, about 10 mg/kg, or about 20 mg/kg once about every 3 weeks.
  • the methods of the disclosure comprise an anti-LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:25, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:26.
  • the methods of the disclosure comprise an anti-LAG-3 antibody comprising: (a) a heavy chain variable region CDR1 comprising the sequence set forth in SEQ ID NO:27; (b) a heavy chain variable region CDR2 comprising the sequence set forth in SEQ ID NO:28; (c) a heavy chain variable region CDR3 comprising the sequence set forth in SEQ ID NO:29; (d) a light chain variable region CDR1 comprising the sequence set forth in SEQ ID NO:30; (e) a light chain variable region CDR2 comprising the sequence set forth in SEQ ID NO:31; and (f) a light chain variable region CDR3 comprising the sequence set forth in SEQ ID NO:32.
  • the methods of the disclosure comprise an anti-LAG-3 antibody comprising heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs:25 and 26, respectively.
  • the methods of the disclosure comprise an anti-LAG-3 antibody comprising heavy and light chains comprising the sequences as set forth in SEQ ID NOs:23 and 24, respectively.
  • the anti-LAG-3 antibody is LAG525 (ieramilimab).
  • ieramilimab is administered intravenously at a dose of about 300 mg, about 400 mg, about 500 mg, about 600 mg, about 700 mg, about 800 mg, about 900 mg, about 1000 mg, about 1100 mg, about 1200 mg, or about 1300 mg once about every 2, 3, or 4 weeks.
  • the methods of the disclosure comprise an anti-LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:47, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:49.
  • the methods of the disclosure comprise an anti-LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:48, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:50.
  • the methods of the disclosure comprise an anti-LAG-3 antibody comprising: (a) a heavy chain variable region CDR1 comprising the sequence set forth in SEQ ID NO:51; (b) a heavy chain variable region CDR2 comprising the sequence set forth in SEQ ID NO:52; (c) a heavy chain variable region CDR3 comprising the sequence set forth in SEQ ID NO: 53; (d) a light chain variable region CDR1 comprising the sequence set forth in SEQ ID NO:54; (e) a light chain variable region CDR2 comprising the sequence set forth in SEQ ID NO:55; and (f) a light chain variable region CDR3 comprising the sequence set forth in SEQ ID NO:56.
  • the methods of the disclosure comprise an anti-LAG-3 antibody comprising heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs:47 and 49, respectively.
  • the methods of the disclosure comprise an anti-LAG-3 antibody comprising heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs:48 and 50, respectively.
  • the methods of the disclosure comprise an anti-LAG-3 antibody comprising heavy and light chains comprising the sequences as set forth in SEQ ID NOs:43 and 45, respectively.
  • the methods of the disclosure comprise an anti-LAG-3 antibody comprising heavy and light chains comprising the sequences as set forth in SEQ ID NOs:44 and 46, respectively.
  • the anti-LAG-3 antibody is MK4280.
  • MK4280 is administered intravenously at a dose of about 7 mg, 21 mg, 70 mg, 210 mg, or 700 mg once about every 3 weeks.
  • the methods of the disclosure comprise an anti-LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 69, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:70.
  • the methods of the disclosure comprise an anti-LAG-3 antibody comprising: (a) a heavy chain variable region CDR1 comprising the sequence set forth in SEQ ID NO:71; (b) a heavy chain variable region CDR2 comprising the sequence set forth in SEQ ID NO:72; (c) a heavy chain variable region CDR3 comprising the sequence set forth in SEQ ID NO:73; (d) a light chain variable region CDR1 comprising the sequence set forth in SEQ ID NO:74; (e) a light chain variable region CDR2 comprising the sequence set forth in SEQ ID NO:75; and (f) a light chain variable region CDR3 comprising the sequence set forth in SEQ ID NO:76.
  • the methods of the disclosure comprise an anti-LAG-3 antibody comprising heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs:69 and 70, respectively.
  • the methods of the disclosure comprise an anti-LAG-3 antibody comprising heavy and light chains comprising the sequences as set forth in SEQ ID NOs:67 and 68, respectively.
  • the LAG-3 antagonist is a soluble LAG-3 polypeptide.
  • the soluble LAG-3 polypeptide is a fusion polypeptide, e.g., a fusion protein comprising the extracellular portion of LAG-3.
  • the soluble LAG-3 polypeptide is a LAG-3-Fc fusion polypeptide capable of binding to MHC Class II.
  • the soluble LAG-3 polypeptide comprises a ligand binding fragment of the LAG- 3 extracellular domain.
  • the ligand binding fragment of the LAG-3 extracellular domain comprises an amino acid sequence with at least about 90%, at least about 95%, at least about 98%, at least about 99%, or about 100% sequence identity to SEQ ID NO:22.
  • the soluble LAG-3 polypeptide further comprises a half-life extending moiety.
  • the half-life extending moiety comprises an immunoglobulin constant region or a portion thereof, an immunoglobulin-binding polypeptide, an immunoglobulin G (IgG), albumin-binding polypeptide (ABP), a PASylation moiety, a HESylation moiety, XTEN, a PEGylation moiety, an Fc region, or any combination thereof.
  • the soluble LAG-3 polypeptide is IMP321 (eftilagimod alpha). See, e.g., Brignone C, et al., J. Immunol. (2QQTy, 179:4202-4211 and W02009/044273.
  • an anti-LAG-3 antibody is used to determine LAG-3 expression.
  • an anti-LAG-3 antibody is selected for its ability to bind to LAG-3 in formalin-fixed, paraffin-embedded (FFPE) tissue specimens.
  • FFPE paraffin-embedded
  • an anti- LAG-3 antibody is capable of binding to LAG-3 in frozen tissues.
  • an anti- LAG-3 antibody is capable of distinguishing membrane bound, cytoplasmic, and/or soluble forms of LAG-3.
  • an anti-LAG-3 antibody useful for assaying, detecting, and/or quantifying LAG-3 expression in accordance with the methods disclosed herein is the 17B4 mouse IgGl anti-human LAG-3 monoclonal antibody. See, e.g., Matsuzaki, J et al., PNAS (2010); 107:7875.
  • the LAG-3 antagonist is formulated for intravenous administration.
  • the LAG-3 antagonist is administered at a flat dose.
  • the LAG-3 antagonist is administered at a dose of from at least about 0.25 mg to about 2000 mg, about 0.25 mg to about 1600 mg, about 0.25 mg to about 1200 mg, about 0.25 mg to about 800 mg, about 0.25 mg to about 400 mg, about 0.25 mg to about 100 mg, about 0.25 mg to about 50 mg, about 0.25 mg to about 40 mg, about 0.25 mg to about 30 mg, about 0.25 mg to about 20 mg, about 20 mg to about 2000 mg, about 20 mg to about 1600 mg, about 20 mg to about 1200 mg, about 20 mg to about 800 mg, about 20 mg to about 400 mg, about 20 mg to about 100 mg, about 100 mg to about 2000 mg, about 100 mg to about 1800 mg, about 100 mg to about 1600 mg, about 100 mg to about 1400 mg, about 100 mg to about 1200 mg, about 100 mg to about 1000 mg, about 100 mg to about 800 mg, about 100 mg to about 600 mg, about 100 mg to about 400 mg, about 400 mg to about 2000 mg, about 400 mg to about 1800 mg, about 400 mg, about 0.25 mg to
  • the LAG-3 antagonist is administered at a dose of about 0.25 mg, about 0.5 mg, about 0.75 mg, about 1 mg, about 1.25 mg, about 1.5 mg, about 1.75 mg, about 2 mg, 2.25 mg, about 2.5 mg, about 2.75 mg, about 3 mg, about 3.25 mg, about 3.5 mg, about 3.75 mg, about 4 mg, about 4.25 mg, about 4.5 mg, about 4.75 mg, about 5 mg, about 5.25 mg, about 5.5 mg, about 5.75 mg, about 6 mg, about 6.25 mg, about 6.5 mg, about 6.75 mg, about 7 mg, about 7.25 mg, about 7.5 mg, about 7.75 mg, about 8 mg, about 8.25 mg, about 8.5 mg, about 8.75 mg, about 9 mg, about 9.25 mg, about 9.5 mg, about 9.75 mg, about 10 mg, about 20 mg, about 30 mg, about 40 mg, about 50 mg, about 60 mg, about 70 mg, about 80 mg, about 90 mg, about 100 mg, about 110 mg, about 120 mg, about 130 mg,
  • the LAG-3 antagonist is administered at a weight-based dose.
  • the LAG-3 antagonist is administered at a dose from about 0.003 mg/kg to about 25 mg/kg, about 0.003 mg/kg to about 20 mg/kg, about 0.003 mg/kg to about 15 mg/kg, about 0.003 mg/kg to about 10 mg/kg, about 0.003 mg/kg to about 5 mg/kg, about 0.003 mg/kg to about 1 mg/kg, about 0.003 mg/kg to about 0.9 mg/kg, about 0.003 mg/kg to about 0.8 mg/kg, about 0.003 mg/kg to about 0.7 mg/kg, about 0.003 mg/kg to about 0.6 mg/kg, about 0.003 mg/kg to about 0.5 mg/kg, about 0.003 mg/kg to about 0.4 mg/kg, about 0.003 mg/kg to about 0.3 mg/kg, about 0.003 mg/kg to about 0.2 mg/kg, about 0.003 mg/kg to about 0.1 mg/kg, about 0.1 mg/kg to about 25 mg/kg, about 0.1
  • the LAG-3 antagonist is administered at a dose of about 0.003 mg/kg, about 0.004 mg/kg, about 0.005 mg/kg, about 0.006 mg/kg, about 0.007 mg/kg, about 0.008 mg/kg, about 0.009 mg/kg, about 0.01 mg/kg, about 0.02 mg/kg, about 0.03 mg/kg, about 0.04 mg/kg, about 0.05 mg/kg, about 0.06 mg/kg, about 0.07 mg/kg, about 0.08 mg/kg, about 0.09 mg/kg, about 0.1 mg/kg, about 0.2 mg/kg, about 0.3 mg/kg, about 0.4 mg/kg, about 0.5 mg/kg, about 0.6 mg/kg, about 0.7 mg/kg, about 0.8 mg/kg, about 0.9 mg/kg, about 1.0 mg/kg, about 2.0 mg/kg, about 3.0 mg/kg, about 4.0 mg/kg, about 5.0 mg/kg, about 6.0 mg/kg, about 7.0 mg/kg, about 8.0 mg/
  • the dose is administered once about every one week, once about every two weeks, once about every three weeks, once about every four weeks, once about every five weeks, once about every six weeks, once about every seven weeks, once about every eight weeks, once about every nine weeks, once about every ten weeks, once about every eleven weeks, or once about every twelve weeks.
  • a LAG-3 antagonist as described herein is administered as a monotherapy, z.e., the LAG-3 antagonist is not administered in combination with one or more additional therapeutic agents.
  • a LAG-3 antagonist as described herein is administered as a combination therapy, z.e., the LAG-3 antagonist is administered in combination with one or more additional therapeutic agents.
  • the methods of the disclosure further comprise administering to the subject an additional therapeutic agent and/or anti-cancer therapy.
  • the additional anti-cancer therapy can comprise any therapy known in the art for the treatment of a tumor in a subject and/or any standard-of-care therapy, as disclosed herein.
  • the additional anti-cancer therapy comprises a surgery, a radiation therapy, a chemotherapy, an immunotherapy, or any combination thereof.
  • the additional anti-cancer therapy comprises a chemotherapy, including any chemotherapeutic agent disclosed herein.
  • the chemotherapy comprises platinum-doublet chemotherapy.
  • the additional therapeutic agent comprises an anti-cancer agent.
  • the anti-cancer agent comprises a tyrosine kinase inhibitor, an antiangiogenesis agent, a checkpoint inhibitor, a checkpoint stimulator, a chemotherapeutic agent, an immunotherapeutic agent, a platinum agent, an alkylating agent, a taxane, a nucleoside analog, an antimetabolite, a topisomerase inhibitor, an anthracycline, a vinca alkaloid, or any combination thereof.
  • the tyrosine kinase inhibitor comprises sorafenib (e.g., sorafenib tosylate, also known as NEXAVAR®), lenvatinib (e.g., lenvatinib mesylate, also known as LENVIMA®), regorafenib (e.g., STIVARGA®), cabozantinib (e.g., cabozantinib S- malate, also known as CABOMETYX®), sunitinib (e.g., sunitinib malate, also known as SUTENT®), brivanib, linifanib, erlotinib (e.g., erlotinib hydrocholoride, also known as TARCEVA®), pemigatinib (also known as PEMAZYRETM), everolimus (also known as AFINITOR® or ZORTRESS®), gefitinib (
  • the anti-angiogenesis agent comprises an inhibitor of a vascular endothelial growth factor (VEGF), VEGF receptor (VEGFR), platelet-derived growth factor (PDGF), PDGF receptor (PDGFR), angiopoietin (Ang), tyrosine kinase with Ig-like and EGF-like domains (Tie) receptor, hepatocyte growth factor (HGF), tyrosine-protein kinase Met (c-MET), C-type lectin family 14 member A (CLEC14A), multimerin 2 (MMRN2), shock protein 70-1A (HSP70-1A), a epidermal growth factor (EGF), EGF receptor (EGFR), or any combination thereof.
  • VEGF vascular endothelial growth factor
  • VGF VEGF receptor
  • PDGF platelet-derived growth factor
  • PDGFR PDGF receptor
  • Ang angiopoietin
  • Ang tyrosine kinase with Ig-
  • the anti-angiogenesis agent comprises bevacizumab (also known as AVASTIN®), ramucirumab (also known as CYRAMZA®), aflibercept (also known as EYLEA® or ZALTRAP®), tanibirumab, olaratumab (also known as LARTRUVOTM), nesvacumab, AMG780, MEDI3617, vanucizumab, rilotumumab, ficlatuzumab, TAK-701, onartuzumab, emibetuzumab, or any combination thereof.
  • the checkpoint stimulator comprises an agonist of B7-1, B7-2, CD28, 4-1BB (CD137), 4-1BBL, GITR, inducible T cell co-stimulator (ICOS), ICOS-L, 0X40, OX40L, CD70, CD27, CD40, death receptor 3 (DR3), CD28H, or any combination thereof.
  • the chemotherapeutic agent comprises an alkylating agent, an antimetabolite, an antineoplastic antibiotic, a mitotic inhibitor, a hormone or hormone modulator, a protein tyrosine kinase inhibitor, an epidermal growth factor inhibitor, a proteasome inhibitor, other neoplastic agent, or any combination thereof.
  • the immunotherapeutic agent comprises an antibody that specifically ICOS, CD137 (4- IBB), CD 134 (0X40), NKG2A, CD27, CD96, GITR, Herpes Virus Entry Mediator (HVEM), PD-1, PD-L1, CTLA-4, BTLA, TIM-3, A2aR, Killer cell Lectin-like Receptor G1 (KLRG-1), Natural Killer Cell Receptor 2B4 (CD244), CD 160, TIGIT, VISTA, KIR, TGFp, IL- 10, IL-8, B7-H4, Fas ligand, CSF1R, CXCR4, mesothelin, CEACAM-1, CD52, HER2, MICA, MICB, or any combination thereof.
  • the platinum agent comprises cisplatin, carboplatin, oxaliplatin, satraplatin, picoplatin, nedaplatin, triplatin (e.g., triplatin tetranitrate), lipoplatin, phenanthriplatin, or any combination thereof.
  • the alkylating agent comprises altretamine, bendamustine, busulfan, carboplatin, carmustine, chlorambucil, cisplatin, cyclophosphamide, dacarbazine, ifosfamide, lomustine, mechlorethamine, melphalan, oxaliplatin, procarbazine, streptozocin, temozolomide, thiotepa, or any combination thereof.
  • the taxane comprises paclitaxel, albumin-bound paclitaxel, docetaxel, cabazitaxel, or any combination thereof.
  • the nucleoside analog comprises cytarabine, gemcitabine, lamivudine, entecavir, telbivudine, or any combination thereof.
  • the antimetabolite comprises capecitabine, cladribine, clofarabine, cytarabine, floxuridine, fludarabine, fluorouracil, gemcitabine, mercaptopurine, methotrexate, pemetrexed, pentostatin, pralatrexate, thioguanine, or any combination thereof.
  • the topoisomerase inhibitor comprises etoposide, mitoxantrone, doxorubicin, irinotecan, topotecan, camptothecin, or any combination thereof.
  • the anthracycline is doxorubicin, daunorubicin, epirubicin, idarubicin, or any combination thereof.
  • the vinca alkaloid is vinblastine, vincristine, vinorelbine, vindesine, vincaminol,êtdine, vinburnine, or any combination thereof.
  • the anti-cancer agent that is administered as an additional therapeutic agent in the methods of the disclosure is a checkpoint inhibitor.
  • the checkpoint inhibitor comprises a programmed death-1 (PD-1) pathway inhibitor, a cytotoxic T-lymphocyte-associated protein 4 (CTLA-4) inhibitor, a T cell immunoglobulin and ITIM domain (TIGIT) inhibitor, a T cell immunoglobulin and mucin-domain containing-3 (TIM-3) inhibitor, a TIM-1 inhibitor, a TIM-4 inhibitor, a B7- H3 inhibitor, a B7-H4 inhibitor, a B and T cell lymphocyte attenuator (BTLA) inhibitor, a V-domain Ig suppressor of T cell activation (VISTA) inhibitor, an indoleamine 2,3- dioxygenase (IDO) inhibitor, a nicotinamide adenine dinucleotide phosphate oxidase isoform 2 (N0X2) inhibitor, a killer-cell immunoglobulin-like receptor (KIR) inhibitor, an adenosine A2a receptor (A2aR) inhibitor,
  • PD-1 programmed death
  • the checkpoint inhibitor is formulated for intravenous administration.
  • the LAG-3 antagonist and the checkpoint inhibitor are formulated separately. In some aspects, each checkpoint inhibitor is formulated separately when the checkpoint inhibitor comprises more than one checkpoint inhibitor. In some aspects, the checkpoint inhibitor is administered before the LAG-3 antagonist. In some aspects, the LAG-3 antagonist is administered before the checkpoint inhibitor.
  • the LAG-3 antagonist and the checkpoint inhibitor are formulated together.
  • two or more checkpoint inhibitors are formulated together when the checkpoint inhibitor comprises more than one checkpoint inhibitor.
  • the LAG-3 antagonist and the checkpoint inhibitor are administered concurrently.
  • the checkpoint inhibitor is administered at a flat dose.
  • the checkpoint inhibitor is administered at a dose of from at least about 0.25 mg to about 2000 mg, about 0.25 mg to about 1600 mg, about 0.25 mg to about 1200 mg, about 0.25 mg to about 800 mg, about 0.25 mg to about 400 mg, about 0.25 mg to about 100 mg, about 0.25 mg to about 50 mg, about 0.25 mg to about 40 mg, about 0.25 mg to about 30 mg, about 0.25 mg to about 20 mg, about 20 mg to about 2000 mg, about 20 mg to about 1600 mg, about 20 mg to about 1200 mg, about 20 mg to about 800 mg, about 20 mg to about 400 mg, about 20 mg to about 100 mg, about 100 mg to about 2000 mg, about 100 mg to about 1800 mg, about 100 mg to about 1600 mg, about 100 mg to about 1400 mg, about 100 mg to about 1200 mg, about 100 mg to about 1000 mg, about 100 mg to about 800 mg, about 100 mg to about 600 mg, about 100 mg to about 400 mg, about 400 mg to about 2000 mg, about 400 mg to about 1800 mg, about 400 mg, about 0.25 mg to about
  • the checkpoint inhibitor is administered at a dose of about 0.25 mg, about 0.5 mg, about 0.75 mg, about 1 mg, about 1.25 mg, about 1.5 mg, about 1.75 mg, about 2 mg, about 2.25 mg, about 2.5 mg, about 2.75 mg, about 3 mg, about 3.25 mg, about 3.5 mg, about 3.75 mg, about 4 mg, about 4.25 mg, about 4.5 mg, about 4.75 mg, about 5 mg, about 5.25 mg, about 5.5 mg, about 5.75 mg, about 6 mg, about 6.25 mg, about 6.5 mg, about 6.75 mg, about 7 mg, about 7.25 mg, about 7.5 mg, about 7.75 mg, about 8 mg, about 8.25 mg, about 8.5 mg, about 8.75 mg, about 9 mg, about 9.25 mg, about 9.5 mg, about 9.75 mg, about 10 mg, about 20 mg, about 30 mg, about 40 mg, about 50 mg, about 60 mg, about 70 mg, about 80 mg, about 90 mg, about 100 mg, about 110 mg, about 120 mg, about 130 mg,
  • the checkpoint inhibitor is administered at a dose from about 0.003 mg/kg to about 25 mg/kg, about 0.003 mg/kg to about 20 mg/kg, about 0.003 mg/kg to about 15 mg/kg, about 0.003 mg/kg to about 10 mg/kg, about 0.003 mg/kg to about 5 mg/kg, about 0.003 mg/kg to about 1 mg/kg, about 0.003 mg/kg to about 0.9 mg/kg, about 0.003 mg/kg to about 0.8 mg/kg, about 0.003 mg/kg to about 0.7 mg/kg, about 0.003 mg/kg to about 0.6 mg/kg, about 0.003 mg/kg to about 0.5 mg/kg, about 0.003 mg/kg to about 0.4 mg/kg, about 0.003 mg/kg to about 0.3 mg/kg, about 0.003 mg/kg to about 0.2 mg/kg, about 0.003 mg/kg to about 0.1 mg/kg, about 0.1 mg/kg to about 25 mg/kg, about 0.1 mg
  • the checkpoint inhibitor is administered at a dose of about 0.003 mg/kg, about 0.004 mg/kg, about 0.005 mg/kg, about 0.006 mg/kg, about 0.007 mg/kg, about 0.008 mg/kg, about 0.009 mg/kg, about 0.01 mg/kg, about 0.02 mg/kg, about 0.03 mg/kg, about 0.04 mg/kg, about 0.05 mg/kg, about 0.06 mg/kg, about 0.07 mg/kg, about 0.08 mg/kg, about 0.09 mg/kg, about 0.1 mg/kg, about 0.2 mg/kg, about 0.3 mg/kg, about 0.4 mg/kg, about 0.5 mg/kg, about 0.6 mg/kg, about 0.7 mg/kg, about 0.8 mg/kg, about 0.9 mg/kg, about 1.0 mg/kg, about 2.0 mg/kg, about 3.0 mg/kg, about 4.0 mg/kg, about 5.0 mg/kg, about 6.0 mg/kg, about 7.0 mg/kg, about 8.0 mg/kg, about 1.0 mg/kg
  • the dose of the checkpoint inhibitor is administered every one week, every two weeks, every three weeks, every four weeks, every five weeks, every six weeks, every seven weeks, every eight weeks, every nine weeks, every ten weeks, every eleven weeks, or every twelve weeks.
  • each dose of the LAG-3 antagonist and/or the checkpoint inhibitor is administered in a constant amount.
  • each dose of the LAG-3 antagonist and/or the checkpoint inhibitor is administered in a varying amount.
  • the maintenance (or follow-on) dose of the LAG-3 antagonist and/or the checkpoint inhibitor can be higher or the same as the loading dose which is first administered.
  • the maintenance dose of the LAG-3 antagonist and/or the checkpoint inhibitor can be lower or the same as the loading dose.
  • the checkpoint inhibitor for use in the methods of the disclosure comprises a PD-1 pathway inhibitor.
  • the PD-1 pathway inhibitor is a PD-1 inhibitor and/or a PD-L1 inhibitor.
  • the PD-1 inhibitor and/or PD-L1 inhibitor is a small molecule.
  • the PD-1 inhibitor and/or PD-L1 inhibitor is a millamolecule.
  • the PD-1 inhibitor and/or PD-L1 inhibitor is a macrocyclic peptide.
  • the PD-1 inhibitor and/or PD-L1 inhibitor is BMS-986189.
  • the PD-1 inhibitor is an inhibitor disclosed in International Publication No. WO2014/151634, which is incorporated by reference herein in its entirety.
  • the PD-1 inhibitor is INCMGA00012 (Insight Pharmaceuticals).
  • the PD-1 inhibitor comprises a combination of an anti-PD-1 antibody disclosed herein and a PD-1 small molecule inhibitor.
  • the PD-L1 inhibitor comprises a millamolecule having a formula set forth in formula (I): wherein R x -R 13 are amino acid side chains, R a -R n are hydrogen, methyl, or form a ring with a vicinal R group, and R 14 is -C(O)NHR 15 , wherein R 15 is hydrogen, or a glycine residue optionally substituted with additional glycine residues and/or tails which can improve pharmacokinetic properties.
  • the PD-L1 inhibitor comprises a compound disclosed in International Publication No. WO2014/151634, which is incorporated by reference herein in its entirety.
  • the PD-L1 inhibitor comprises a compound disclosed in International Publication No. WO2016/039749, WO2016/149351, WO20 16/077518, W02016/100285, WO2016/100608, WO2016/126646,
  • the PD-L1 inhibitor comprises a small molecule PD-L1 inhibitor disclosed in International Publication No. W02015/034820, W02015/160641, WO20 18/044963, WO2017/066227, W02018/009505, WO2018/183171,
  • the PD-1 pathway inhibitor is a soluble PD-L2 polypeptide.
  • the soluble PD-L2 polypeptide is a fusion polypeptide.
  • the soluble PD-L2 polypeptide comprises a ligand binding fragment of the PD-L2 extracellular domain.
  • the soluble PD-L2 polypeptide further comprises a half-life extending moiety.
  • the half-life extending moiety comprises an immunoglobulin constant region or a portion thereof, an immunoglobulin-binding polypeptide, an immunoglobulin G (IgG), albumin-binding polypeptide (ABP), a PASylation moiety, a HESylation moiety, XTEN, a PEGylation moiety, an Fc region, or any combination thereof.
  • the soluble PD-L2 polypeptide is AMP-224 (see, e.g., US 2013/0017199).
  • the PD-1 pathway inhibitor is an anti-PD-1 antibody and/or an anti -PD -LI antibody.
  • Anti-PD-1 antibodies that are known in the art can be used in the methods of the disclosure.
  • Various human monoclonal antibodies that bind specifically to PD-1 with high affinity have been disclosed in U.S. Patent No. 8,008,449.
  • Anti-PD-1 antibodies that can be used in the methods of the disclosure include nivolumab (also known as OPDIVO®, 5C4, BMS-936558, MDX-1106, and ONO-4538), pembrolizumab (Merck; also known as KEYTRUDA®, lambrolizumab, and MK-3475; see WO 2008/156712), PDR001 (Novartis; also known as spartalizumab; see WO 2015/112900 and U.S. Patent No.
  • nivolumab also known as OPDIVO®, 5C4, BMS-936558, MDX-1106, and ONO-4538
  • pembrolizumab Merck; also known as KEYTRUDA®, lambrolizumab, and MK-3475; see WO 2008/156712
  • PDR001 Novartis; also known as spartalizumab; see WO 2015/112900 and U.S. Patent No.
  • MEDI-0680 (AstraZeneca; also known as AMP-514; see WO 2012/145493), TSR-042 (Tesaro Biopharmaceutical; also known as ANB011 or dostarlimab; see WO 2014/179664), cemiplimab (Regeneron; also known as LIBTAYO® orREGN-2810; see WO 2015/112800 and U.S. Patent No. 9,987,500), JS001 (TAIZHOU JUNSHI PHARMA; also known as toripalimab; see Si-Yang Liu et al., J. Hematol. Oncol.
  • PF-06801591 Pfizer; also known as sasanlimab; US 2016/0159905), BGB-A317 (Beigene; also known as tislelizumab; see WO 2015/35606 and US 2015/0079109), BI 754091 (Boehringer Ingelheim; see Zettl M etal., Cancer. Res. (2016);78(13 Suppl): Abstract 4558), INCSHR1210 (Jiangsu Hengrui Medicine; also known as SHR-1210 or camrelizumab; see WO 2015/085847; Si-Yang Liu et al., J. Hematol. Oncol.
  • Anti-PD-1 antibodies that can be used in the methods of the disclosure also include isolated antibodies that bind specifically to human PD-1 and cross-compete for binding to human PD-1 with any anti-PD-1 antibody disclosed herein, e.g., nivolumab (see, e.g., U.S. Patent No. 8,008,449 and 8,779,105; WO 2013/173223).
  • the anti-PD-1 antibody binds the same epitope as any of the anti-PD-1 antibodies described herein, e.g., nivolumab.
  • the antibodies that cross-compete for binding to human PD-1 with, or bind to the same epitope region as, any anti-PD-1 antibody disclosed herein, e.g., nivolumab are monoclonal antibodies.
  • these cross- competing antibodies are chimeric antibodies, engineered antibodies, or humanized or human antibodies.
  • Such chimeric, engineered, humanized or human monoclonal antibodies can be prepared and isolated by methods well known in the art.
  • Anti-PD-1 antibodies that can be used in the methods of the disclosure also include antigen-binding portions of any of the above full-length antibodies.
  • Anti-PD-1 antibodies that can be used in the methods of the disclosure are antibodies that bind to PD-1 with high specificity and affinity, block the binding of PD-L1 and or PD-L2, and inhibit the immunosuppressive effect of the PD-1 signaling pathway.
  • an anti-PD-1 "antibody” includes an antigen-binding portion or fragment that binds to the PD-1 receptor and exhibits the functional properties similar to those of whole antibodies in inhibiting ligand binding and up-regulating the immune system.
  • the anti-PD-1 antibody or antigenbinding portion thereof cross-competes with nivolumab for binding to human PD-1.
  • the anti-PD-1 antibody is a full-length antibody. In some aspects, the anti-PD-1 antibody is a monoclonal, human, humanized, chimeric, or multispecific antibody. In some aspects, the multispecific antibody is a DART, a DVD-Ig, or bispecific antibody.
  • the anti-PD-1 antibody is a F(ab')2 fragment, a Fab' fragment, a Fab fragment, a Fv fragment, a scFv fragment, a dsFv fragment, a dAb fragment, or a single chain binding polypeptide.
  • the anti-PD-1 antibody is nivolumab, pembrolizumab, PDR001 (spartalizumab), MEDI-0680, TSR-042, cemiplimab, JS001, PF-06801591, BGB-A317, BI 754091, INCSHR1210, GLS-010, AM-001, STI-1110, AGEN2034, MGA012, BCD-100, IBI308, SSI-361, or comprises an antigen binding portion thereof.
  • the anti-PD-1 antibody is nivolumab.
  • Nivolumab is a fully human IgG4 (S228P) PD-1 immune checkpoint inhibitor antibody that selectively prevents interaction with PD-1 ligands (PD-L1 and PD-L2), thereby blocking the down-regulation of antitumor T-cell functions (U.S. Patent No. 8,008,449; Wang et al., 2014 Cancer Immunol Res. 2(9/846-56).
  • nivolumab is administered at a flat dose of about 240 mg once about every 2 weeks. In some aspects, nivolumab is administered at a flat dose of about 240 mg once about every 3 weeks. In some aspects, nivolumab is administered at a flat dose of about 360 mg once about every 3 weeks. In some aspects, nivolumab is administered at a flat dose of about 480 mg once about every 4 weeks.
  • the methods of the disclosure comprise an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14.
  • the methods of the disclosure comprise an anti-PD-1 antibody comprising: (a) a heavy chain variable region CDR1 comprising the sequence set forth in SEQ ID NO:15; (b) a heavy chain variable region CDR2 comprising the sequence set forth in SEQ ID NO: 16; (c) a heavy chain variable region CDR3 comprising the sequence set forth in SEQ ID NO: 17; (d) a light chain variable region CDR1 comprising the sequence set forth in SEQ ID NO: 18; (e) a light chain variable region CDR2 comprising the sequence set forth in SEQ ID NO: 19; and (f) a light chain variable region CDR3 comprising the sequence set forth in SEQ ID NO:20.
  • the methods of the disclosure comprise an anti-PD-1 antibody comprising heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs: 13 and 14, respectively.
  • the methods of the disclosure comprise an anti-PD-1 antibody comprising heavy and light chains comprising the sequences as set forth in SEQ ID NOs: 11 and 12, respectively.
  • the methods of the disclosure include a combination of relatlimab and nivolumab.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4; and (b) an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising a heavy chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID NO:5, SEQ ID NO:6, and SEQ ID NO:7, respectively, and a light chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID NO:8, SEQ ID NO:9, and SEQ ID NO: 10, respectively, and (b) an anti- PD-1 antibody comprising a heavy chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID NO: 15, SEQ ID NO: 16, and SEQ ID NO: 17, respectively, and a light chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID NO: 18, SEQ ID NO: 19, and SEQ ID NO:20, respectively.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs:3 and 4, respectively, and (b) an anti-PD-1 antibody comprising heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs: 13 and 14, respectively.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising heavy and light chains comprising the sequences set forth in SEQ ID NOs: 1 and 2, respectively, and (b) an anti-PD-1 antibody comprises heavy and light chains comprising the sequences as set forth in SEQ ID NOs: 11 and 12, respectively.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising heavy and light chains comprising the sequences set forth in SEQ ID NOs:21 and 2, respectively, and (b) an anti-PD-1 antibody comprises heavy and light chains comprising the sequences as set forth in SEQ ID NOs: 11 and 12, respectively.
  • the anti-PD-1 antibody is pembrolizumab.
  • Pembrolizumab is a humanized monoclonal IgG4 (S228P) antibody directed against human cell surface receptor PD-1.
  • S228P humanized monoclonal IgG4
  • Pembrolizumab is described, for example, in U.S. Patent Nos. 8,354,509 and 8,900,587.
  • pembrolizumab is administered at a flat dose of about 200 mg once about every 2 weeks. In some aspects, pembrolizumab is administered at a flat dose of about 200 mg once about every 3 weeks. In some aspects, pembrolizumab is administered at a flat dose of about 400 mg once about every 4 weeks. In some aspects, pembrolizumab is administered at a flat dose of about 400 mg once about every 6 weeks. In some aspects, pembrolizumab is administered at a flat dose of about 300 mg once about every 4-5 weeks.
  • the methods of the disclosure comprise an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:79, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:80.
  • the methods of the disclosure comprise an anti-PD-1 antibody comprising: (a) a heavy chain variable region CDR1 comprising the sequence set forth in SEQ ID NO:81; (b) a heavy chain variable region CDR2 comprising the sequence set forth in SEQ ID NO:82; (c) a heavy chain variable region CDR3 comprising the sequence set forth in SEQ ID NO: 83; (d) a light chain variable region CDR1 comprising the sequence set forth in SEQ ID NO:84; (e) a light chain variable region CDR2 comprising the sequence set forth in SEQ ID NO:85; and (f) a light chain variable region CDR3 comprising the sequence set forth in SEQ ID NO:86.
  • the methods of the disclosure comprise an anti-PD-1 antibody comprising heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs:79 and 80, respectively.
  • the methods of the disclosure comprise an anti-PD-1 antibody comprising heavy and light chains comprising the sequences as set forth in SEQ ID NOs:77 and 78, respectively.
  • the methods of the disclosure comprise a combination of bootszelimab and pembrolizumab.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 69, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:70; and (b) an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:79, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:80.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising a heavy chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID NO:71, SEQ ID NO: 72, and SEQ ID NO: 73, respectively, and a light chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID NO:74, SEQ ID NO:75, and SEQ ID NO:76, respectively, and (b) an anti- PD-1 antibody comprising a heavy chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID NO:81, SEQ ID NO:82, and SEQ ID NO:83, respectively, and a light chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID NO:84, SEQ ID NO:85, and SEQ ID NO:86, respectively.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs:69 and 70, respectively, and (b) an anti-PD-1 antibody comprising heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs:79 and 80, respectively.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising heavy and light chains comprising the sequences set forth in SEQ ID NOs:67 and 68, respectively, and (b) an anti-PD-1 antibody comprises heavy and light chains comprising the sequences as set forth in SEQ ID NOs:77 and 78, respectively.
  • the anti-PD-1 antibody is cemiplimab (REGN2810).
  • Cemiplimab is described, for example, in WO 2015/112800 and U.S. Patent No. 9,987,500.
  • cemiplimab is administered intravenously at a dose of about 3 mg/kg or about 350 mg once about every 3 weeks.
  • the methods of the disclosure comprise an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:35, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:36.
  • the methods of the disclosure comprise an anti-PD-1 antibody comprising: (a) a heavy chain variable region CDR1 comprising the sequence set forth in SEQ ID NO:37; (b) a heavy chain variable region CDR2 comprising the sequence set forth in SEQ ID NO:38; (c) a heavy chain variable region CDR3 comprising the sequence set forth in SEQ ID NO:39; (d) a light chain variable region CDR1 comprising the sequence set forth in SEQ ID NO:40; (e) a light chain variable region CDR2 comprising the sequence set forth in SEQ ID NO:41; and (f) a light chain variable region CDR3 comprising the sequence set forth in SEQ ID NO:42.
  • the methods of the disclosure comprise an anti-PD-1 antibody comprising heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs:35 and 36, respectively.
  • the methods of the disclosure comprise an anti-PD-1 antibody comprising heavy and light chains comprising the sequences as set forth in SEQ ID NOs:33 and 34, respectively.
  • the methods of the disclosure comprise a combination of fianlimab and cemiplimab.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:25, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:26; and (b) an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:35, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:36.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising a heavy chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID NO:27, SEQ ID NO:28, and SEQ ID NO:29, respectively, and a light chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID NO:30, SEQ ID NO:31, and SEQ ID NO:32, respectively, and (b) an anti- PD-1 antibody comprising a heavy chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID NO:37, SEQ ID NO:38, and SEQ ID NO:39, respectively, and a light chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID NO:40, SEQ ID NO:41, and SEQ ID NO:42, respectively.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs:25 and 26, respectively, and (b) an anti-PD-1 antibody comprising heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs:35 and 36, respectively.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising heavy and light chains comprising the sequences set forth in SEQ ID NOs:23 and 24, respectively, and (b) an anti-PD-1 antibody comprises heavy and light chains comprising the sequences as set forth in SEQ ID NOs:33 and 34, respectively.
  • the anti-PD-1 antibody is spartalizumab (PDR001). Spartalizumab is described, for example, in WO 2015/112900 and U.S. Patent No. 9,683,048.
  • spartalizumab is administered intravenously at a dose of about 300 mg once about every 3 weeks or 400 mg once about every 4 weeks.
  • the methods of the disclosure comprise an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:59, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:60.
  • the methods of the disclosure comprise an anti-PD-1 antibody comprising: (a) a heavy chain variable region CDR1 comprising the sequence set forth in SEQ ID NO:61; (b) a heavy chain variable region CDR2 comprising the sequence set forth in SEQ ID NO:62; (c) a heavy chain variable region CDR3 comprising the sequence set forth in SEQ ID NO:63; (d) a light chain variable region CDR1 comprising the sequence set forth in SEQ ID NO:64; (e) a light chain variable region CDR2 comprising the sequence set forth in SEQ ID NO:65; and (f) a light chain variable region CDR3 comprising the sequence set forth in SEQ ID NO:66.
  • the methods of the disclosure comprise an anti-PD-1 antibody comprising heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs:59 and 60, respectively.
  • the methods of the disclosure comprise an anti-PD-1 antibody comprising heavy and light chains comprising the sequences as set forth in SEQ ID NOs:57 and 58, respectively.
  • the methods of the disclosure comprise a combination of ieramilimab and spartalizumab.
  • ieramilimab is administered intravenously at a dose of about 400 mg once about every three weeks and spartalizumab is administered intravenously at a dose of about 300 mg once about every 3 weeks.
  • ieramilimab is administered intravenously at a dose of about 600 mg once about every four weeks and spartalizumab is administered intravenously at a dose of about 400 mg once about every 4 weeks.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:47, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:49; and (b) an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:59, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:60.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:48, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:50; and (b) an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:59, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:60.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising a heavy chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID N0:51, SEQ ID NO:52, and SEQ ID NO:53, respectively, and a light chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID NO:54, SEQ ID NO:55, and SEQ ID NO:56, respectively, and (b) an anti- PD-1 antibody comprising a heavy chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID NO:61, SEQ ID NO:62, and SEQ ID NO:63, respectively, and a light chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID NO:64, SEQ ID NO:65, and SEQ ID NO:66, respectively.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs:47 and 49, respectively, and (b) an anti-PD-1 antibody comprising heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs:59 and 60, respectively.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs:48 and 50, respectively, and (b) an anti-PD-1 antibody comprising heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs:59 and 60, respectively.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising heavy and light chains comprising the sequences set forth in SEQ ID NOs:43 and 45, respectively, and (b) an anti-PD-1 antibody comprises heavy and light chains comprising the sequences as set forth in SEQ ID NOs:57 and 58, respectively.
  • the methods of the disclosure comprise: (a) an anti-LAG-3 antibody comprising heavy and light chains comprising the sequences set forth in SEQ ID NOs:44 and 46, respectively, and (b) an anti-PD-1 antibody comprises heavy and light chains comprising the sequences as set forth in SEQ ID NOs:57 and 58, respectively.
  • a method of treating a human subject afflicted with HCC comprising administering to the subject: (a) an anti-LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4, and (b) an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14, wherein the method is a first line therapy.
  • a method of treating a human subject afflicted with unresectable HCC comprising administering to the subject: (a) an anti-LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4, and (b) an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14, wherein the method is a first line therapy.
  • a method of treating a human subject afflicted with metastatic HCC comprising administering to the subject: (a) an anti-LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4, and (b) an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14, wherein the method is a first line therapy.
  • a method of treating a human subject afflicted with HCC comprising administering to the subject: (a) a dose of about 480 mg of an anti- LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4, and (b) a dose of about 480 mg of an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14, wherein the method is a first line therapy.
  • a method of treating a human subject afflicted with unresectable HCC comprising administering to the subject: (a) a dose of about 480 mg of an anti -LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4, and (b) a dose of about 480 mg of an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14, wherein the method is a first line therapy.
  • a method of treating a human subject afflicted with metastatic HCC comprising administering to the subject: (a) a dose of about 480 mg of an anti -LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4, and (b) a dose of about 480 mg of an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14, wherein the method is a first line therapy.
  • a method of treating a human subject afflicted with HCC comprising administering to the subject: (a) a dose of about 960 mg of an anti- LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4, and (b) a dose of about 480 mg of an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14, wherein the method is a first line therapy.
  • a method of treating a human subject afflicted with unresectable HCC comprising administering to the subject: (a) a dose of about 960 mg of an anti -LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4, and (b) a dose of about 480 mg of an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14, wherein the method is a first line therapy.
  • a method of treating a human subject afflicted with metastatic HCC comprising administering to the subject: (a) a dose of about 960 mg of an anti -LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4, and (b) a dose of about 480 mg of an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14, wherein the method is a first line therapy.
  • a method of treating a human subject afflicted with HCC comprising administering to the subject: (a) an anti -LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4, and (b) an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14, wherein the subject has progressed on or is intolerant of a prior therapy.
  • a method of treating a human subject afflicted with unresectable HCC comprising administering to the subject: (a) an anti -LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4, and (b) an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14, wherein the subject has progressed on or is intolerant of a prior therapy.
  • a method of treating a human subject afflicted with metastatic HCC comprising administering to the subject: (a) an anti -LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4, and (b) an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14, wherein the subject has progressed on or is intolerant of a prior therapy.
  • a method of treating a human subject afflicted with HCC comprising administering to the subject: (a) a dose of about 480 mg of an anti- LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4, and (b) a dose of about 480 mg of an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14, wherein the subject has progressed on or is intolerant of a prior therapy.
  • a method of treating a human subject afflicted with unresectable HCC comprising administering to the subject: (a) a dose of about 480 mg of an anti -LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4, and (b) a dose of about 480 mg of an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14, wherein the subject has progressed on or is intolerant of a prior therapy.
  • a method of treating a human subject afflicted with metastatic HCC comprising administering to the subject: (a) a dose of about 480 mg of an anti -LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4, and (b) a dose of about 480 mg of an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14, wherein the subject has progressed on or is intolerant of a prior therapy.
  • a method of treating a human subject afflicted with HCC comprising administering to the subject: (a) a dose of about 960 mg of an anti- LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4, and (b) a dose of about 480 mg of an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14, wherein the subject has progressed on or is intolerant of a prior therapy.
  • a method of treating a human subject afflicted with unresectable HCC comprising administering to the subject: (a) a dose of about 960 mg of an anti -LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4, and (b) a dose of about 480 mg of an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14, wherein the subject has progressed on or is intolerant of a prior therapy.
  • a method of treating a human subject afflicted with metastatic HCC comprising administering to the subject: (a) a dose of about 960 mg of an anti -LAG-3 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO:3, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO:4, and (b) a dose of about 480 mg of an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 13, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 14, wherein the subject has progressed on or is intolerant of a prior therapy.
  • the anti-LAG-3 antibody comprises a heavy chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID NO:5, SEQ ID NO: 6, and SEQ ID NO: 7, respectively, and a light chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID NO:8, SEQ ID NO:9, and SEQ ID NO: 10, respectively
  • the anti-PD-1 antibody comprises a heavy chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID NO: 15, SEQ ID NO: 16, and SEQ ID NO: 17, respectively, and a light chain variable region CDR1, CDR2, and CDR3 comprising the sequence set forth in SEQ ID NO: 18, SEQ ID NO: 19, and SEQ ID NO:20, respectively.
  • the anti-LAG-3 antibody comprises heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs:3 and 4, respectively, and the anti-PD-1 antibody comprises heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs: 13 and 14, respectively.
  • the anti-LAG-3 antibody comprises heavy and light chains comprising the sequences set forth in SEQ ID NOs: 1 and 2, respectively, and the anti-PD- 1 antibody comprises heavy and light chains comprising the sequences as set forth in SEQ ID NOs: l l and 12, respectively.
  • the anti-LAG-3 antibody comprises heavy and light chains comprising the sequences set forth in SEQ ID NOs:21 and 2, respectively, and the anti-PD- 1 antibody comprises heavy and light chains comprising the sequences as set forth in SEQ ID NOs: l l and 12, respectively.
  • the LAG-3 antibody and the anti-PD-1 antibody are administered every four weeks.
  • Anti-PD-Ll antibodies that are known in the art can be used in the methods of the disclosure.
  • Examples of anti-PD-Ll antibodies useful in the compositions and methods of the present disclosure include the antibodies disclosed in US Patent No. 9,580,507.
  • 9,580,507 have been demonstrated to exhibit one or more of the following characteristics: (a) bind to human PD- L1 with a KD of 1 x 10' 7 M or less, as determined by surface plasmon resonance using a Biacore biosensor system; (b) increase T-cell proliferation in a Mixed Lymphocyte Reaction (MLR) assay; (c) increase interferon-y production in an MLR assay; (d) increase IL-2 secretion in an MLR assay; (e) stimulate antibody responses; and (f) reverse the effect of T regulatory cells on T cell effector cells and/or dendritic cells.
  • Anti-PD-Ll antibodies usable in the present disclosure include monoclonal antibodies that bind specifically to human PD-L1 and exhibit at least one, in some aspects, at least five, of the preceding characteristics.
  • Anti-PD-Ll antibodies that can be used in the methods of the disclosure include BMS-936559 (also known as 12A4, MDX-1105; see, e.g, U.S. Patent No. 7,943,743 and WO 2013/173223), atezolizumab (Roche; also known as TECENTRIQ®; MPDL3280A, RG7446; see US 8,217,149; see, also, Herbst et al.
  • Anti-PD-Ll antibodies that can be used in the methods of the disclosure also include isolated antibodies that bind specifically to human PD-L1 and cross-compete for binding to human PD-L1 with any anti-PD-Ll antibody disclosed herein, e.g., atezolizumab, durvalumab, and/or avelumab.
  • the anti-PD-Ll antibody binds the same epitope as any of the anti-PD-Ll antibodies described herein, e.g., atezolizumab, durvalumab, and/or avelumab.
  • the antibodies that cross-compete for binding to human PD-L1 with, or bind to the same epitope region as, any anti-PD-Ll antibody disclosed herein, e.g., atezolizumab, durvalumab, and/or avelumab are monoclonal antibodies.
  • these cross-competing antibodies are chimeric antibodies, engineered antibodies, or humanized or human antibodies.
  • Such chimeric, engineered, humanized or human monoclonal antibodies can be prepared and isolated by methods well known in the art.
  • Anti-PD-Ll antibodies that can be used in the methods of the disclosure also include antigen-binding portions of any of the above full-length antibodies.
  • Anti-PD-Ll antibodies that can be used in the methods of the disclosure are antibodies that bind to PD-L1 with high specificity and affinity, block the binding of PD- 1, and inhibit the immunosuppressive effect of the PD-1 signaling pathway.
  • an anti-PD-Ll "antibody” includes an antigenbinding portion or fragment that binds to PD-L1 and exhibits the functional properties similar to those of whole antibodies in inhibiting receptor binding and up-regulating the immune system.
  • the anti-PD-Ll antibody or antigen-binding portion thereof cross-competes with atezolizumab, durvalumab, and/or avelumab for binding to human PD-L1.
  • an anti-PD-Ll antibody is substituted for the anti-PD-1 antibody in any of the methods disclosed herein.
  • the anti-PD-Ll antibody is a full-length antibody.
  • the anti-PD-Ll antibody is a monoclonal, human, humanized, chimeric, or multispecific antibody.
  • the multispecific antibody is a DART, a DVD-Ig, or bispecific antibody.
  • the anti-PD-Ll antibody is a F(ab')2 fragment, a Fab' fragment, a Fab fragment, a Fv fragment, a scFv fragment, a dsFv fragment, a dAb fragment, or a single chain binding polypeptide.
  • the anti-PD-Ll antibody is BMS-936559, atezolizumab, durvalumab, avelumab, STI-1014, CX-072, KN035, LY3300054, BGB-A333, ICO 36, FAZ053, CK-301, or comprises an antigen binding portion thereof.
  • the PD-L1 antibody is atezolizumab.
  • Atezolizumab is a fully humanized IgGl monoclonal anti-PD-Ll antibody.
  • atezolizumab is administered as a flat dose of about 800 mg once about every 2 weeks. In some aspects, atezolizumab is administered as a flat dose of about 840 mg once about every 2 weeks.
  • the PD-L1 antibody is durvalumab.
  • Durvalumab is a human IgGl kappa monoclonal anti-PD-Ll antibody.
  • durvalumab is administered at a dose of about 10 mg/kg once about every 2 weeks.
  • durvalumab is administered as a flat dose of about 800 mg/kg once about every 2 weeks.
  • durvalumab is administered as a flat dose of about 1200 mg/kg once about every 3 weeks
  • the PD-L1 antibody is avelumab.
  • Avelumab is a human IgGl lambda monoclonal anti-PD-Ll antibody.
  • avelumab is administered as a flat dose of about 800 mg once about every 2 weeks.
  • the checkpoint inhibitor a disclosed herein comprises a CTLA-4 inhibitor.
  • the CTLA-4 inhibitor is an anti-CTLA-4 antibody.
  • Anti-CTLA-4 antibodies that can be used in the methods of the disclosure bind to human CTLA-4 and disrupt the interaction of CTLA-4 with a human B7 receptor. Because the interaction of CTLA-4 with B7 transduces a signal leading to inactivation of T-cells bearing the CTLA-4 receptor, disruption of the interaction effectively induces, enhances, or prolongs the activation of such T cells, thereby inducing, enhancing or prolonging an immune response.
  • 6,984,720 have been demonstrated to exhibit one or more of the following characteristics: (a) binds specifically to human CTLA-4 with a binding affinity reflected by an equilibrium association constant (K a ) of at least about 10 7 M' 1 , or about 10 9 M' 1 , or about IO 10 M' 1 to 10 11 M' 1 or higher, as determined by Biacore analysis; (b) a kinetic association constant of at least about 10 3 , about 10 4 , or about 10 5 m' 1 s' 1 ; (c) a kinetic disassociation constant (kd ) of at least about 10 3 , about 10 4 , or about 10 5 m' 1 s' 1 ; and (d) inhibits the binding of CTLA-4 to B7-1 (CD80) and B7-2 (CD86).
  • Anti-CTLA-4 antibodies useful for the present disclosure include monoclonal antibodies that bind specifically to human CTLA-4 and exhibit at least one, at least two, or at least three of the preceding characteristics.
  • Anti-CTLA-4 antibodies that can be used in the methods of the disclosure include ipilimumab (also known as YERVOY®, MDX-010, 10D1; see U.S. Patent No. 6,984,720), MK-1308 (Merck), AGEN-1884 (Agenus Inc.; see WO 2016/196237), and tremelimumab (AstraZeneca; also known as ticilimumab, CP-675,206; see WO 2000/037504 and Ribas, Update Cancer Ther. 2(3): 133-39 (2007)).
  • the anti-CTLA-4 antibody binds specifically to human CTLA-4 and cross-competes for binding to human CTLA-4 with any anti-CTLA-4 antibody disclosed herein, e.g., ipilimumab and/or tremelimumab.
  • the anti-CTLA- 4 antibody binds the same epitope as any of the anti-CTLA-4 antibodies described herein, e.g., ipilimumab and/or tremelimumab.
  • the antibodies that cross-compete for binding to human CTLA-4 with, or bind to the same epitope region as, any anti-CTLA-4 antibody disclosed herein, e.g., ipilimumab and/or tremelimumab, are monoclonal antibodies.
  • these cross-competing antibodies are chimeric antibodies, engineered antibodies, or humanized or human antibodies.
  • Anti-CTLA-4 antibodies that can be used in the methods of the disclosure also include antigen-binding portions of any of the above full-length antibodies.
  • the anti-CTLA-4 antibody is a full-length antibody.
  • the anti-CTLA-4 antibody is a monoclonal, human, humanized, chimeric, or multispecific antibody.
  • the multispecific antibody is a DART, a DVD-Ig, or bispecific antibody.
  • the anti-CTLA-4 antibody is a F(ab')2 fragment, a Fab' fragment, a Fab fragment, a Fv fragment, a scFv fragment, a dsFv fragment, a dAb fragment, or a single chain binding polypeptide.
  • the anti-CTLA-4 antibody is ipilimumab, tremelimumab, MK- 1308, AGEN-1884, or comprises an antigen binding portion thereof.
  • the anti-CTLA-4 antibody is ipilimumab.
  • Ipilimumab is a fully human, IgGl monoclonal antibody that blocks the binding of CTLA-4 to its B7 ligands, thereby stimulating T cell activation.
  • ipilimumab is administered at a dose of about 3 mg/kg once about every 3 weeks.
  • ipilimumab is administered at a dose of about 10 mg/kg once about every 3 weeks.
  • ipilimumab is administered at a dose of about 10 mg/kg once about every 12 weeks.
  • the ipilimumab is administered for four doses.
  • Therapeutic agents of the present disclosure can be constituted in a composition, e.g., a pharmaceutical composition containing an inhibitor, antibody, and/or agent as disclosed herein and a pharmaceutically acceptable carrier.
  • a pharmaceutically acceptable carrier includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible.
  • the carrier for a composition containing an inhibitor, antibody, and/or agent as disclosed herein is suitable for intravenous, intramuscular, subcutaneous, parenteral, spinal or epidermal administration (e.g., by injection or infusion).
  • the carrier is suitable for non-parenteral, e.g., oral, administration.
  • a subcutaneous injection is based on Halozyme Therapeutics’ ENHANZE® drug-delivery technology (see U.S. Patent No. 7,767,429, which is incorporated by reference herein in its entirety).
  • ENHANZE® uses a co-formulation of an antibody with recombinant human hyaluronidase enzyme (rHuPH20), which removes traditional limitations on the volume of biologies and drugs that can be delivered subcutaneously due to the extracellular matrix (see U.S. Patent No. 7,767,429).
  • a pharmaceutical composition of the disclosure can include one or more pharmaceutically acceptable salts, anti-oxidant, aqueous and nonaqueous carriers, and/or adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents.
  • the pharmaceutical composition for the present disclosure can further comprise recombinant human hyaluronidase enzyme, e.g., rHuPH20.
  • Treatment is continued as long as clinical benefit is observed or until unacceptable toxicity or disease progression occurs.
  • Dosage and frequency vary depending on the halflife of the inhibitor, antibody, and/or agent in the subject.
  • human antibodies show the longest half-life, followed by humanized antibodies, chimeric antibodies, and nonhuman antibodies.
  • the dosage and frequency of administration can vary depending on whether the treatment is prophylactic or therapeutic.
  • a relatively low dosage is typically administered at relatively infrequent intervals over a long period of time. Some patients continue to receive treatment for the rest of their lives.
  • a relatively high dosage at relatively short intervals is sometimes required until progression of the disease is reduced or terminated, and preferably until the patient shows partial or complete amelioration of symptoms of disease. Thereafter, the patient can be administered a prophylactic regime.
  • compositions of the present disclosure can be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being unduly toxic to the patient.
  • the selected dosage level will depend upon a variety of pharmacokinetic factors including the activity of the particular compositions of the present disclosure employed, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.
  • a composition of the present disclosure can be administered via one or more routes of administration using one or more of a variety of methods well known in the art. As will be appreciated by the skilled artisan, the route and/or mode of administration will vary depending upon the desired results.
  • compositions comprising an anti-LAG-3 antibody and an anti-PD-1 antibody as described herein at any of the doses or combinations of doses described herein.
  • pharmaceutical composition is for treating a human subject with HCC as described herein, including unresectable or metastatic HCC.
  • a method for treating a human subject with HCC as described herein comprises administering a pharmaceutical composition as described herein.
  • the pharmaceutical composition comprises a dose of relatlimab and a dose of an anti-PD-1 antibody as described herein.
  • the anti-PD-1 antibody is nivolumab, pembrolizumab, cemiplimab, or spartalizumab. In some aspects, the anti-PD-1 antibody is nivolumab.
  • the pharmaceutical composition comprises a dose of favezelimab and a dose of an anti-PD-1 antibody as described herein.
  • the anti-PD-1 antibody is nivolumab, pembrolizumab, cemiplimab, or spartalizumab. In some aspects, the anti-PD-1 antibody is pembrolizumab.
  • the pharmaceutical composition comprises a dose of fianlimab and a dose of an anti-PD-1 antibody as described herein.
  • the anti-PD-1 antibody is nivolumab, pembrolizumab, cemiplimab, or spartalizumab. In some aspects, the anti-PD-1 antibody is cemiplimab.
  • the pharmaceutical composition comprises a dose of ieramilimab and a dose of an anti-PD-1 antibody as described herein.
  • the anti-PD-1 antibody is nivolumab, pembrolizumab, cemiplimab, or spartalizumab. In some aspects, the anti-PD-1 antibody is spartalizumab.
  • the pharmaceutical composition comprises a ratio of anti-LAG-3 antibody to anti-PD-1 antibody of about 1:1, about 1:2, about 1:3, about 1:4, about 1:5, about 1:6, about 1:7, about 1:8, about 1:9, about 1:10, about 1:15, about 1:20, about 1:30, about 1:40, about 1:50, about 1:60, about 1:70, about 1:80, about 1:90, about 1:100, about 1:120, about 1:140, about 1:160, about 1:180, about 1:200, about 200:1, about 180:1, about 160:1, about 140:1, about 120:1, about 100:1, about 90:1, about 80:1, about 70:1, about 60:1, about 50:1, about 40:1, about 30:1, about 20:1, about 15:1, about 10:1, about 9:1, about 8:1, about 7:1, about 6:1, about 5:1, about 4:1, about 3:1, or about 2:1.
  • the pharmaceutical composition comprises a ratio of anti-LAG-3 antibody to anti-PD-1 antibody of about 1:3.
  • the pharmaceutical composition comprises a ratio of anti-LAG-3 antibody to anti-PD-1 antibody of about 1:1 [0427] In some aspects, the pharmaceutical composition comprises a ratio of anti-LAG-3 antibody to anti-PD-1 antibody of about 2: 1.
  • the total amount of anti-LAG-3 and anti-PD-1 antibodies in the pharmaceutical composition is about 20 mg/mL, about 25 mg/mL, about 30 mg/mL, about 35 mg/mL, about 40 mg/mL, about 45 mg/mL, about 50 mg/mL, about 55 mg/mL, about 60 mg/mL, about 65 mg/mL, about 70 mg/mL, about 75 mg/mL, about 80 mg/mL, about 85 mg/mL, about 90 mg/mL, about 95 mg/mL, about 100 mg/mL, about 105 mg/mL, about 110 mg/mL, about 115 mg/mL, about 120 mg/mL, about 125 mg/mL, about 130 mg/mL, about 135 mg/mL, about 140 mg/mL, about 145 mg/mL, about 150 mg/mL, about 155 mg/mL, about 160 mg/mL, about 165 mg/mL, about 170 mg/mL, about 1
  • 1640 mg about 1650 mg, about 1660 mg, about 1670 mg, about 1680 mg, about 1690 mg, about 1700 mg, about 1710 mg, about 1720 mg, about 1730 mg, about 1740 mg, about
  • the total amount of anti -LAG-3 and anti-PD-1 antibodies in the pharmaceutical composition is about 50 mg/mL.
  • the total amount of anti -LAG-3 and anti-PD-1 antibodies in the pharmaceutical composition is about 150 mg/mL.
  • the total amount of anti -LAG-3 and anti-PD-1 antibodies in the pharmaceutical composition is about 320 mg.
  • the total amount of anti -LAG-3 and anti-PD-1 antibodies in the pharmaceutical composition is about 640 mg.
  • the total amount of anti -LAG-3 and anti-PD-1 antibodies in the pharmaceutical composition is about 960 mg.
  • the total amount of anti -LAG-3 and anti-PD-1 antibodies in the pharmaceutical composition is about 1440 mg.
  • the pharmaceutical composition comprises about 10 mg/mL, about
  • 12.5 mg/mL about 15 mg/mL, about 17.5 mg/mL, about 20 mg/mL, about 22.5 mg/mL, about 25 mg/mL, about 27.5 mg/mL, about 30 mg/mL, about 32.5 mg/mL, about 35 mg/mL, about 37.5 mg/mL, about 40 mg/mL, about 42.5 mg/mL, about 45 mg/mL, about
  • the pharmaceutical composition comprises about 10 mg/mL, about
  • the pharmaceutical composition comprises about 12.5 mg/mL of an anti-LAG-3 antibody and about 37.5 mg/mL of an anti-PD-1 antibody.
  • the pharmaceutical composition comprises about 75 mg/mL of an anti-LAG-3 antibody and about 75 mg/mL of an anti-PD-1 antibody.
  • the pharmaceutical composition comprises about 100 mg/mL of an anti-LAG-3 antibody and about 50 mg/mL of an anti-PD-1 antibody. [0440] In some aspects, the pharmaceutical composition comprises about 80 mg of an anti- LAG-3 antibody and about 240 mg of an anti-PD-1 antibody.
  • the pharmaceutical composition comprises about 160 mg of an anti -LAG-3 antibody and about 480 mg of an anti-PD-1 antibody.
  • the pharmaceutical composition comprises about 480 mg of an anti -LAG-3 antibody and about 480 mg of an anti-PD-1 antibody.
  • the pharmaceutical composition comprises about 960 mg of an anti -LAG-3 antibody and about 480 mg of an anti-PD-1 antibody.
  • the pharmaceutical composition comprises from about 5 mM to about 50 mM of histidine, from about 50 mM to about 300 mM of sucrose, from about 5 pM to about 1 mM of diethylenetriaminepentaacetic acid (DTPA) or ethylenediaminetetraacetic acid (EDTA), and from about 0.001% to about 1% (w/v) of polysorbate or pol oxamer (e.g., polysorbate 80 (PS80), polysorbate 20 (PS20), pol oxamer 188 (PX188), or any combination thereof).
  • polysorbate 80 PS80
  • PS20 polysorbate 20
  • PX188 pol oxamer 188
  • the pharmaceutical composition comprises about 20 mM histidine, about 250 mM sucrose, about 50 pM DTPA, and 0.05% PS80.
  • the pH of the pharmaceutical composition is from about 5 to about 6.5. In some aspects, the pH is about 5.3 to about 6.3. In some aspects, the pH is 5.8. In some aspects, the pH is 5.7.
  • a pharmaceutical composition comprising a ratio of relatlimab to nivolumab of about 1 : 1, about 20 mM histidine, about 250 mM sucrose, about 50 pM DTPA, and about 0.05% PS80, wherein the pH of the pharmaceutical composition is about 5.8.
  • a pharmaceutical composition comprising about 480 mg of relatlimab and about 480 mg of nivolumab, about 20 mM histidine, about 250 mM sucrose, about 50 pM DTPA, and about 0.05% PS80, wherein the pH of the pharmaceutical composition is about 5.8.
  • a pharmaceutical composition comprising about 75 mg/mL relatlimab, about 75 mg/mL nivolumab, about 20 mM histidine, about 250 mM sucrose, about 50 pM DTPA, and about 0.05% PS80, wherein the pH of the pharmaceutical composition is about 5.8.
  • a pharmaceutical composition comprising a total amount of relatlimab and nivolumab of about 150 mg/mL, about 20 mM histidine, about 250 mM sucrose, about 50 pM DTP A, and about 0.05% PS80, wherein the pH of the pharmaceutical composition is about 5.8.
  • a pharmaceutical composition comprising a ratio of relatlimab to nivolumab of about 2: 1, about 20 mM histidine, about 250 mM sucrose, about 50 pM DTP A, and about 0.05% PS80, wherein the pH of the pharmaceutical composition is about 5.7.
  • a pharmaceutical composition comprising about 960 mg of relatlimab and about 480 mg of nivolumab, about 20 mM histidine, about 250 mM sucrose, about 50 pM DTP A, and about 0.05% PS80, wherein the pH of the pharmaceutical composition is about 5.7.
  • a pharmaceutical composition comprising about 100 mg/mL relatlimab and about 50 mg/mL nivolumab, about 20 mM histidine, about 250 mM sucrose, about 50 pM DTP A, and about 0.05% PS80, wherein the pH of the pharmaceutical composition is about 5.7.
  • a pharmaceutical composition comprising a total amount of relatlimab and nivolumab of about 150 mg/mL, about 20 mM histidine, about 250 mM sucrose, about 50 pM DTP A, and about 0.05% PS80, wherein the pH of the pharmaceutical composition is about 5.7.
  • a vial, syringe, or intravenous bag comprising a pharmaceutical composition as described herein.
  • the disclosure includes an autoinjector comprising a pharmaceutical composition described herein.
  • a vial comprises a pharmaceutical composition as described herein, and the vial further comprises a stopper and a seal.
  • the total volume in the vial is about 5 mL, about 6 mL, about 7 mL, about 8 mL, about 9 mL, about 10 mL, about 11 mL, about 12 mL, about 13 mL, about 14 mL, about 15 mL, about 16 mL, about 17 mL, about 18 mL, about 19 mL, or about 20 mL.
  • kits for treating a human subject with HCC as described herein comprising any of the antibodies, therapeutic agents, and/or anti-cancer therapies described herein.
  • Kits typically include a label indicating the intended use of the contents of the kit and instructions for use.
  • label includes any writing, or recorded material supplied on or with the kit, or which otherwise accompanies the kit.
  • kits for treating a human subject afflicted with HCC comprising: (a) a dose of an anti -LAG-3 antibody; (b) a dose of an anti-PD-1 antibody; and (c) instructions for using the anti -LAG-3 antibody and the anti-PD-1 antibody in a method for treating a human subject afflicted with HCC.
  • the anti -LAG-3 antibody and the anti-PD-1 antibodies can be provided at any of the doses or combinations of doses described herein.
  • the kit comprises a dose of relatlimab and a dose of an anti-PD-1 antibody as described herein.
  • the anti-PD-1 antibody is nivolumab, pembrolizumab, cemiplimab, or spartalizumab. In some aspects, the anti-PD-1 antibody is nivolumab.
  • the kit comprises a dose of favezelimab and a dose of an anti-PD- 1 antibody as described herein.
  • the anti-PD-1 antibody is nivolumab, pembrolizumab, cemiplimab, or spartalizumab. In some aspects, the anti-PD-1 antibody is pembrolizumab.
  • the kit comprises fianlimab and an anti-PD-1 antibody as described herein.
  • the anti-PD-1 antibody is nivolumab, pembrolizumab, cemiplimab, or spartalizumab. In some aspects, the anti-PD-1 antibody is cemiplimab.
  • the kit comprises ieramilimab and an anti-PD-1 antibody as described herein.
  • the anti-PD-1 antibody is nivolumab, pembrolizumab, cemiplimab, or spartalizumab. In some aspects, the anti-PD-1 antibody is spartalizumab.
  • the kit comprises a ratio of the anti-LAG-3 antibody to the anti- PD-1 antibody of about 1 : 1, about 1 :2, about 1 :3, about 1 :4, about 1 :5, about 1 :6, about 1 :7, about 1 :8, about 1 :9, about 1 : 10, about 1 :15, about 1 :20, about 1 :30, about 1 :40, about 1 :50, about 1 :60, about 1 :70, about 1 :80, about 1 :90, about 1 : 100, about 1 : 120, about 1 : 140, about 1 : 160, about 1 :180, about 1 :200, about 200: 1, about 180: 1, about 160: 1, about 140: 1, about 120: 1, about 100:1, about 90: 1, about 80: 1, about 70: 1, about 60: 1, about 50: 1, about 40: 1, about 30: 1, about 20: 1, about 15: 1, about 10: 1, about 9: 1, about 8: 1, about 7: 1, about 6: 1, about 5
  • the kit comprises a ratio of the anti-LAG-3 antibody to the anti- PD-1 antibody of about 1 : 1
  • the kit comprises a ratio of the anti-LAG-3 antibody to the anti- PD-1 antibody of about 2: 1.
  • the total amount of anti-LAG-3 and anti-PD-1 antibodies in the kit is about 20 mg/mL, about 25 mg/mL, about 30 mg/mL, about 35 mg/mL, about 40 mg/mL, about 45 mg/mL, about 50 mg/mL, about 55 mg/mL, about 60 mg/mL, about 65 mg/mL, about 70 mg/mL, about 75 mg/mL, about 80 mg/mL, about 85 mg/mL, about 90 mg/mL, about 95 mg/mL, about 100 mg/mL, about 105 mg/mL, about 110 mg/mL, about 115 mg/mL, about 120 mg/mL, about 125 mg/mL, about 130 mg/mL, about 135 mg/mL, about 140 mg/mL, about 145 mg/mL, about 150 mg/mL, about 155 mg/mL, about 160 mg/mL, about 165 mg/mL, about 170 mg/mL, about 175
  • the total amount of anti -LAG-3 and anti-PD-1 antibodies in the kit is about 50 mg/mL.
  • the total amount of anti -LAG-3 and anti-PD-1 antibodies in the kit is about 150 mg/mL.
  • the kit comprises about 10 mg/mL, about 12.5 mg/mL, about 15 mg/mL, about 17.5 mg/mL, about 20 mg/mL, about 22.5 mg/mL, about 25 mg/mL, about 27.5 mg/mL, about 30 mg/mL, about 32.5 mg/mL, about 35 mg/mL, about 37.5 mg/mL, about 40 mg/mL, about 42.5 mg/mL, about 45 mg/mL, about 47.5 mg/mL, about 50 mg/mL, about 55 mg/mL, about 60 mg/mL, about 65 mg/mL, about 70 mg/mL, about 75 mg/mL, about 80 mg/mL, about 85 mg/mL, about 90 mg/mL, about 95 mg/mL, about 100 mg/mL, about 105 mg/mL, about 110 mg/mL, about 115 mg/mL, about 120 mg/mL, about 125 mg/mL, about 130 mg/mL, about 1
  • the kit comprises about 10 mg/mL, about 12.5 mg/mL, about 15 mg/mL, about 17.5 mg/mL, about 20 mg/mL, about 22.5 mg/mL, about 25 mg/mL, about 27.5 mg/ml, about 30 mg/mL, about 32.5 mg/mL, about 35 mg/mL, about 37.5 mg/mL, about 40 mg/mL, about 42.5 mg/mL, about 45 mg/mL, about 47.5 mg/mL, about 50 mg/mL, about 55 mg/mL, about 60 mg/mL, about 65 mg/mL, about 70 mg/mL, about 75 mg/mL, about 80 mg/mL, about 85 mg/mL, about 90 mg/mL, about 95 mg/mL, about 100 mg/mL, about 105 mg/mL, about 110 mg/mL, about 115 mg/mL, about 120 mg/mL, about 125 mg/mL, 130 mg/mL, about 135
  • the kit comprises about 12.5 mg/mL of an anti-LAG-3 antibody and about 37.5 mg/mL of an anti-PD-1 antibody.
  • the kit comprises about 75 mg/mL of an anti-LAG-3 antibody and about 75 mg/mL of an anti-PD-1 antibody.
  • the kit comprises about 100 mg/mL of an anti-LAG-3 antibody and about 50 mg/mL of an anti-PD-1 antibody.
  • the kit comprises about 80 mg of the anti-LAG-3 antibody.
  • the kit comprises about 160 mg of the anti-LAG-3 antibody.
  • the kit comprises about 480 mg of the anti-LAG-3 antibody.
  • the kit comprises about 960 mg of the anti-LAG-3 antibody.
  • the kit comprises about 240 mg of the anti-PD-1 antibody. [0482] In some aspects, the kit comprises about 480 mg of the anti-PD-1 antibody.
  • kits for treating a human subject afflicted with HCC comprising: (a) about 480 mg of an anti-LAG-3 antibody; (b) about 480 mg of an anti-PD- 1 antibody; and (c) instructions for using the anti-LAG-3 antibody and the anti-PD-1 antibody in a method for treating a human subject afflicted with HCC.
  • kits for treating a human subject afflicted with HCC comprising: (a) about 960 mg of an anti-LAG-3 antibody; (b) about 480 mg of an anti-PD-1 antibody; and (c) instructions for using the anti-LAG-3 antibody and the anti-PD-1 antibody in a method for treating a human subject afflicted with HCC.
  • kits for treating a human subject afflicted with HCC comprising: (a) an anti-LAG-3 antibody; (b) an anti-PD-1 antibody; and (c) instructions for preparing each of the antibodies in an amount of about 480 mg and using the antibodies in a method for treating a human subject afflicted with HCC.
  • kits for treating a human subject afflicted with HCC comprising: (a) an anti-LAG-3 antibody; (b) an anti-PD-1 antibody; and (c) instructions for preparing the anti-LAG-3 and anti-PD-1 antibodies in an amount of about 960 mg and about 480 mg, respectively, and using the antibodies in a method for treating a human subject afflicted with HCC.
  • the anti-LAG-3 and anti-PD-1 antibodies are co-packaged in a single unit dosage form.
  • the anti-LAG-3 and anti-PD-1 antibodies are packaged as separate unit dosage forms.
  • about 80 mg of the anti-LAG-3 antibody is provided in a unit dosage form.
  • about 160 mg of the anti-LAG-3 antibody is provided in a unit dosage form.
  • about 480 mg of the anti-LAG-3 antibody is provided in a unit dosage form.
  • about 960 mg of the anti-LAG-3 antibody is provided in a unit dosage form.
  • about 50 mg/mL of the anti-LAG-3 antibody is provided in a unit dosage form.
  • about 100 mg/mL of the anti -LAG-3 antibody is provided in a unit dosage form.
  • about 130 mg/mL of the anti -LAG-3 antibody is provided in a unit dosage form.
  • about 150 mg/mL of the anti -LAG-3 antibody is provided in a unit dosage form.
  • about 175 mg/mL of the anti -LAG-3 antibody is provided in a unit dosage form.
  • about 200 mg/mL of the anti-LAG-3 antibody is provided in a unit dosage form.
  • about 40 mg of the anti-PD-1 antibody is provided in a unit dosage form.
  • about 100 mg of the anti-PD-1 antibody is provided in a unit dosage form.
  • about 240 mg of the anti-PD-1 antibody is provided in a unit dosage form.
  • about 480 mg of the anti-PD-1 antibody is provided in a unit dosage form.
  • about 10 mg/mL of the anti-PD-1 antibody is provided in a unit dosage form.
  • about 50 mg/mL of the anti-PD-1 antibody is provided in a unit dosage form.
  • about 100 mg/mL of the anti-PD-1 antibody is provided in a unit dosage form.
  • about 150 mg/mL of the anti-PD-1 antibody is provided in a unit dosage form.
  • about 175 mg/mL of the anti-PD-1 antibody is provided in a unit dosage form.
  • about 200 mg/mL of the anti-PD-1 antibody is provided in a unit dosage form.
  • the unit dosage form comprises from about 5 mM to about 50 mM of histidine, from about 50 mM to about 300 mM of sucrose, from about 5 pM to about 1 mM of diethylenetriaminepentaacetic acid (DTP A) or ethylenediaminetetraacetic acid (EDTA), and from about 0.001% to about 1% (w/v) of polysorbate or poloxamer (e.g., polysorbate 80 (PS80), polysorbate 20 (PS20), poloxamer 188 (PX188), or any combination thereof).
  • DTP A diethylenetriaminepentaacetic acid
  • EDTA ethylenediaminetetraacetic acid
  • polysorbate or poloxamer e.g., polysorbate 80 (PS80), polysorbate 20 (PS20), poloxamer 188 (PX188), or any combination thereof.
  • the unit dosage form comprises about 20 mM histidine, about 250 mM sucrose, about 50 pM DTP A, and 0.05% PS80.
  • the unit dosage form comprises a pH of from about 5 to about 6.5. In some aspects, the pH is about 5.3 to about 6.3. In some aspects, the pH is 5.8. In some aspects, the pH is 5.7.
  • the unit dosage form comprises a ratio of relatlimb to nivolumab of about 1 : 1, about 20 mM histidine, about 250 mM sucrose, about 50 pM DTP A, about 0.05% PS80, and a pH of about 5.8.
  • the unit dosage form comprises about 480 mg of relatlimab and about 480 mg of nivolumab, about 20 mM histidine, about 250 mM sucrose, about 50 pM DTP A, about 0.05% PS80, and a pH of about 5.8.
  • the unit dosage form comprises about 75 mg/mL relatlimab and about 75 mg/mL nivolumab, about 20 mM histidine, about 250 mM sucrose, about 50 pM DTP A, about 0.05% PS80, and a pH of about 5.8.
  • the unit dosage form comprises a total amount of relatlimab and nivolumab of about 150 mg/mL, about 20 mM histidine, about 250 mM sucrose, about 50 pM DTP A, about 0.05% PS80, and a pH of about 5.8.
  • the unit dosage form comprises a ratio of anti-LAG-3 antibody to anti-PD-1 antibody of about 2: 1, about 20 mM histidine, about 250 mM sucrose, about 50 pM DTP A, about 0.05% PS80, and a pH of about 5.7.
  • the unit dosage form comprises about 960 mg of relatlimab and about 480 mg of nivolumab, about 20 mM histidine, about 250 mM sucrose, about 50 pM DTP A, about 0.05% PS80, and a pH of about 5.7.
  • the unit dosage form comprises about 100 mg/mL relatlimab and about 50 mg/mL nivolumab, about 20 mM histidine, about 250 mM sucrose, about 50 pM DTP A, about 0.05% PS80, and a pH of about 5.7.
  • the unit dosage form comprises a total amount of relatlimab and nivolumab of about 150 mg/mL, about 20 mM histidine, about 250 mM sucrose, about 50 pM DTP A, about 0.05% PS80, and a pH of about 5.7.
  • the unit dosage form is a vial, syringe, or intravenous bag. In some aspects, the unit dosage form is an autoinjector. In some aspects, the unit dosage form is a vial comprising a stopper and a seal. In some aspects, the total volume in the vial is about 5 mL, about 6 mL, about 7 mL, about 8 mL, about 9 mL, about 10 mL, about 11 mL, about 12 mL, about 13 mL, about 14 mL, about 15 mL, about 16 mL, about 17 mL, about 18 mL, about 19 mL, or about 20 mL.
  • a randomized, open-label Phase 2 study will evaluate the safety and efficacy of relatlimab in combination with nivolumab as compared to nivolumab monotherapy in the second line treatment of HCC.
  • Patients will be male and female adults (> 18 years) selected based on the following eligibility criteria: (1) patients will have had no prior IO therapy and will have progressed on or be intolerant to prior sorafenib or lenvatinib therapy in the advanced/metastatic setting; (2) patients will have LAG-3+ (LAG-3 expression in > 1% of nucleated cells within tumor region) or LAG-3- (LAG-3 expression in ⁇ 1% of nucleated cells within tumor region) advanced HCC that is not eligible for curative surgical and/or locoregional therapies or that is progressive disease after surgical and/or locoregional therapies; (3) histologic confirmation of HCC; (4) at least one RECIST 1.1 measurable untreated lesion; (5) cirrhotic status of Child-Pugh Class A; and (6) Eastern Cooperative Oncology Group (ECOG) performance status (PS) 0 or 1.
  • ECOG Eastern Cooperative Oncology Group
  • Patients will be randomized 2: 1 :2 in Arms A, B, and C, respectively.
  • Patients in Arm A will be administered 480 mg of nivolumab once every 4 weeks.
  • the study design ensures that enough LAG-3+ participants will be enrolled for efficacy analysis. Furthermore, a weighted average of the results will be analyzed for inference to the true prevalence in the pre-treated advanced HCC population.
  • Anti-LAG-3 antibody (relatlimab) in combination with anti-PD-1 antibody (nivolumab) was evaluated as a treatment of HCC in patients with no prior IO therapy.
  • a tumor tissue sample was obtained from each patient for determination of LAG-3 expression. Patients were stratified as LAG-3 expressers or non-expressers based on LAG- 3 expression in tissue samples of > 1% or less than 1%, respectively. [0536] Patients were treated with 80 mg of relatlimab once every 2 weeks in combination with 240 mg nivolumab once every 2 weeks.
  • the best overall response (BOR) summary for all response evaluable subjects is shown in Table 1.
  • the objective response rate (ORR) was defined as the proportion of treated subjects whose BOR was either a complete response (CR) or a partial response (PR) based on blinded independent clinical review (BICR) assessments by RECIST 1.1 Criteria. 2-sided 95% exact confidence intervals were determined by the Clopper-Pearson method.
  • ADSVKGRFTISRDNSKNTLYLQMNSLKGEDTAVYYCVKWGNIYFDYWGQGTLVTVSS SEQ ID NO:36 Light Chain Variable Region (VL) Amino Acid Sequence; Anti-PD-1 mAh (REGN2810)

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Epidemiology (AREA)
  • Dermatology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicinal Preparation (AREA)
PCT/US2021/048002 2020-08-28 2021-08-27 Lag-3 antagonist therapy for hepatocellular carcinoma Ceased WO2022047189A1 (en)

Priority Applications (10)

Application Number Priority Date Filing Date Title
AU2021331476A AU2021331476A1 (en) 2020-08-28 2021-08-27 Lag-3 antagonist therapy for hepatocellular carcinoma
MX2023002332A MX2023002332A (es) 2020-08-28 2021-08-27 Terapia con antagonistas del gen 3 de activacion de linfocitos (lag-3) para carcinoma hepatocelular.
EP21789895.6A EP4204095A1 (en) 2020-08-28 2021-08-27 Lag-3 antagonist therapy for hepatocellular carcinoma
KR1020237009984A KR20230058442A (ko) 2020-08-28 2021-08-27 간세포성 암종에 대한 lag-3 길항제 요법
US18/043,562 US20230265188A1 (en) 2020-08-28 2021-08-27 Lag-3 antagonist therapy for hepatocellular carcinoma
BR112023003427A BR112023003427A2 (pt) 2020-08-28 2021-08-27 Terapia com antagonista de lag-3 para carcinoma hepatocelular
JP2023513856A JP2023540255A (ja) 2020-08-28 2021-08-27 肝細胞癌のためのlag-3アンタゴニスト療法
CN202180071182.XA CN116529261A (zh) 2020-08-28 2021-08-27 用于肝细胞癌的lag-3拮抗剂疗法
CA3193421A CA3193421A1 (en) 2020-08-28 2021-08-27 Lag-3 antagonist therapy for hepatocellular carcinoma
IL300813A IL300813A (en) 2020-08-28 2021-08-27 LAG-3 antagonist therapy for hepatocellular carcinoma

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US202063071698P 2020-08-28 2020-08-28
US63/071,698 2020-08-28
US202163144174P 2021-02-01 2021-02-01
US63/144,174 2021-02-01

Publications (1)

Publication Number Publication Date
WO2022047189A1 true WO2022047189A1 (en) 2022-03-03

Family

ID=78086031

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2021/048002 Ceased WO2022047189A1 (en) 2020-08-28 2021-08-27 Lag-3 antagonist therapy for hepatocellular carcinoma

Country Status (10)

Country Link
US (1) US20230265188A1 (https=)
EP (1) EP4204095A1 (https=)
JP (1) JP2023540255A (https=)
KR (1) KR20230058442A (https=)
AU (1) AU2021331476A1 (https=)
BR (1) BR112023003427A2 (https=)
CA (1) CA3193421A1 (https=)
IL (1) IL300813A (https=)
MX (1) MX2023002332A (https=)
WO (1) WO2022047189A1 (https=)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2025117889A3 (en) * 2023-11-30 2025-07-24 Regeneron Pharmaceuticals, Inc. Methods of treating cancer by administering a combination therapy including a neoadjuvant pd-1 inhibitor
WO2025245489A1 (en) 2024-05-24 2025-11-27 Bristol-Myers Squibb Company Treatment of tumors in subjects having fgl-1 positive samples
US12565528B2 (en) 2020-10-23 2026-03-03 Bristol-Myers Squibb Company LAG-3 antagonist therapy for lung cancer

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP6595458B2 (ja) * 2013-09-20 2019-10-23 ブリストル−マイヤーズ スクイブ カンパニー 腫瘍を処置するための抗lag−3抗体と抗pd−1抗体との組合せ
ES2965352T3 (es) 2017-05-30 2024-04-12 Bristol Myers Squibb Co Tratamiento de tumores positivos a gen 3 de activación de linfocitos (LAG-3)

Citations (109)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5977318A (en) 1991-06-27 1999-11-02 Bristol Myers Squibb Company CTLA4 receptor and uses thereof
US6051227A (en) 1995-07-25 2000-04-18 The Regents Of The University Of California, Office Of Technology Transfer Blockade of T lymphocyte down-regulation associated with CTLA-4 signaling
WO2000037504A2 (en) 1998-12-23 2000-06-29 Pfizer Inc. Human monoclonal antibodies to ctla-4
US6682736B1 (en) 1998-12-23 2004-01-27 Abgenix, Inc. Human monoclonal antibodies to CTLA-4
US6808710B1 (en) 1999-08-23 2004-10-26 Genetics Institute, Inc. Downmodulating an immune response with multivalent antibodies to PD-1
US6984720B1 (en) 1999-08-24 2006-01-10 Medarex, Inc. Human CTLA-4 antibodies
US7034121B2 (en) 2000-01-27 2006-04-25 Genetics Institue, Llc Antibodies against CTLA4
WO2007113648A2 (en) 2006-04-05 2007-10-11 Pfizer Products Inc. Ctla4 antibody combination therapy
WO2008156712A1 (en) 2007-06-18 2008-12-24 N. V. Organon Antibodies to human programmed death receptor pd-1
US7488802B2 (en) 2002-12-23 2009-02-10 Wyeth Antibodies against PD-1
WO2009044273A2 (en) 2007-10-05 2009-04-09 Immutep Use of recombinant lag-3 or the derivatives thereof for eliciting monocyte immune response
US7767429B2 (en) 2003-03-05 2010-08-03 Halozyme, Inc. Soluble hyaluronidase glycoprotein (sHASEGP), process for preparing the same, uses and pharmaceutical compositions comprising thereof
US20110007023A1 (en) 2009-07-09 2011-01-13 Sony Ericsson Mobile Communications Ab Display device, touch screen device comprising the display device, mobile device and method for sensing a force on a display device
US7943743B2 (en) 2005-07-01 2011-05-17 Medarex, Inc. Human monoclonal antibodies to programmed death ligand 1 (PD-L1)
WO2011066389A1 (en) 2009-11-24 2011-06-03 Medimmmune, Limited Targeted binding agents against b7-h1
US20110150892A1 (en) 2008-08-11 2011-06-23 Medarex, Inc. Human antibodies that bind lymphocyte activation gene-3 (lag-3) and uses thereof
US8008449B2 (en) 2005-05-09 2011-08-30 Medarex, Inc. Human monoclonal antibodies to programmed death 1 (PD-1) and methods for treating cancer using anti-PD-1 antibodies alone or in combination with other immunotherapeutics
US8168757B2 (en) 2008-03-12 2012-05-01 Merck Sharp & Dohme Corp. PD-1 binding proteins
US8217149B2 (en) 2008-12-09 2012-07-10 Genentech, Inc. Anti-PD-L1 antibodies, compositions and articles of manufacture
WO2012122444A1 (en) 2011-03-10 2012-09-13 Provectus Pharmaceuticals, Inc. Combination of local and systemic immunomodulative therapies for enhanced treatment of cancer
WO2012145493A1 (en) 2011-04-20 2012-10-26 Amplimmune, Inc. Antibodies and other molecules that bind b7-h1 and pd-1
US20130017199A1 (en) 2009-11-24 2013-01-17 AMPLIMMUNE ,Inc. a corporation Simultaneous inhibition of pd-l1/pd-l2
WO2013079174A1 (en) 2011-11-28 2013-06-06 Merck Patent Gmbh Anti-pd-l1 antibodies and uses thereof
WO2013173223A1 (en) 2012-05-15 2013-11-21 Bristol-Myers Squibb Company Cancer immunotherapy by disrupting pd-1/pd-l1 signaling
WO2013181634A2 (en) 2012-05-31 2013-12-05 Sorrento Therapeutics Inc. Antigen binding proteins that bind pd-l1
US20140093511A1 (en) 2012-07-02 2014-04-03 Bristol-Myers Squibb Company Optimization of antibodies that bind lymphocyte activation gene-3 (lag-3), and uses thereof
WO2014140180A1 (en) 2013-03-15 2014-09-18 Glaxosmithkline Intellectual Property Development Limited Anti-lag-3 binding proteins
WO2014151634A1 (en) 2013-03-15 2014-09-25 Bristol-Myers Squibb Company Macrocyclic inhibitors of the pd-1/pd-l1 and cd80(b7-1)/pd-l1 protein/protein interactions
WO2014179664A2 (en) 2013-05-02 2014-11-06 Anaptysbio, Inc. Antibodies directed against programmed death-1 (pd-1)
WO2014194302A2 (en) 2013-05-31 2014-12-04 Sorrento Therapeutics, Inc. Antigen binding proteins that bind pd-1
WO2014206107A1 (zh) 2013-06-26 2014-12-31 上海君实生物医药科技有限公司 抗pd-1抗体及其应用
WO2015034820A1 (en) 2013-09-04 2015-03-12 Bristol-Myers Squibb Company Compounds useful as immunomodulators
US20150079109A1 (en) 2013-09-13 2015-03-19 Beigene, Ltd. Anti-PD1 Antibodies and their Use as Therapeutics and Diagnostics
WO2015042246A1 (en) 2013-09-20 2015-03-26 Bristol-Myers Squibb Company Combination of anti-lag-3 antibodies and anti-pd-1 antibodies to treat tumors
WO2015085847A1 (zh) 2013-12-12 2015-06-18 上海恒瑞医药有限公司 Pd-1抗体、其抗原结合片段及其医药用途
WO2015112800A1 (en) 2014-01-23 2015-07-30 Regeneron Pharmaceuticals, Inc. Human antibodies to pd-1
WO2015112900A1 (en) 2014-01-24 2015-07-30 Dana-Farber Cancer Institue, Inc. Antibody molecules to pd-1 and uses thereof
WO2015160641A2 (en) 2014-04-14 2015-10-22 Bristol-Myers Squibb Company Compounds useful as immunomodulators
WO2015200119A1 (en) 2014-06-26 2015-12-30 Macrogenics, Inc. Covalently bonded diabodies having immunoreactivity with pd-1 and lag-3, and methods of use thereof
WO2016028672A1 (en) 2014-08-19 2016-02-25 Merck Sharp & Dohme Corp. Anti-lag3 antibodies and antigen-binding fragments
WO2016039749A1 (en) 2014-09-11 2016-03-17 Bristol-Myers Squibb Company Macrocyclic inhibitors of the pd-1/pd-l1 and cd80 (b7-1)/pd-li protein/protein interactions
WO2016057624A1 (en) 2014-10-10 2016-04-14 Bristol-Myers Squibb Company Immunomodulators
WO2016077518A1 (en) 2014-11-14 2016-05-19 Bristol-Myers Squibb Company Macrocyclic peptides useful as immunomodulators
US20160159905A1 (en) 2014-12-09 2016-06-09 Rinat Neuroscience Corp. Anti-pd-1 antibodies and methods of use thereof
WO2016100285A1 (en) 2014-12-18 2016-06-23 Bristol-Myers Squibb Company Immunomodulators
WO2016100608A1 (en) 2014-12-19 2016-06-23 Bristol-Myers Squibb Company Immunomodulators
WO2016106159A1 (en) 2014-12-22 2016-06-30 Enumeral Biomedical Holding, Inc. Anti-pd-1 antibodies
WO2016126858A2 (en) 2015-02-03 2016-08-11 Anaptysbio, Inc. Antibodies directed against lymphocyte activation gene 3 (lag-3)
WO2016126646A1 (en) 2015-02-04 2016-08-11 Bristol-Myers Squibb Company Immunomodulators
WO2016149351A1 (en) 2015-03-18 2016-09-22 Bristol-Myers Squibb Company Immunomodulators
WO2016149201A2 (en) 2015-03-13 2016-09-22 Cytomx Therapeutics, Inc. Anti-pdl1 antibodies, activatable anti-pdl1 antibodies, and methods of use thereof
WO2016196237A1 (en) 2015-05-29 2016-12-08 Agenus Inc. Anti-ctla-4 antibodies and methods of use thereof
WO2016200782A1 (en) 2015-06-08 2016-12-15 Macrogenics, Inc. Lag-3-binding molecules and methods of use thereof
WO2016197367A1 (en) 2015-06-11 2016-12-15 Wuxi Biologics (Shanghai) Co. Ltd. Novel anti-pd-l1 antibodies
WO2017015560A2 (en) 2015-07-22 2017-01-26 Sorrento Therapeutics, Inc. Antibody therapeutics that bind lag3
WO2017019846A1 (en) 2015-07-30 2017-02-02 Macrogenics, Inc. Pd-1-binding molecules and methods use thereof
WO2017019894A1 (en) 2015-07-29 2017-02-02 Novartis Ag Combination therapies comprising antibody molecules to lag-3
WO2017020291A1 (en) 2015-08-06 2017-02-09 Wuxi Biologics (Shanghai) Co. Ltd. Novel anti-pd-l1 antibodies
WO2017025016A1 (en) 2015-08-10 2017-02-16 Innovent Biologics (Suzhou) Co., Ltd. Pd-1 antibodies
WO2017025051A1 (en) 2015-08-11 2017-02-16 Wuxi Biologics (Shanghai) Co. Ltd. Novel anti-pd-1 antibodies
WO2017025498A1 (en) 2015-08-07 2017-02-16 Pieris Pharmaceuticals Gmbh Novel fusion polypeptide specific for lag-3 and pd-1
WO2017024515A1 (en) 2015-08-11 2017-02-16 Wuxi Biologics (Cayman) Inc. Novel anti-pd-1 antibodies
WO2017034916A1 (en) 2015-08-24 2017-03-02 Eli Lilly And Company Pd-l1 ("programmed death-ligand 1") antibodies
WO2017040790A1 (en) 2015-09-01 2017-03-09 Agenus Inc. Anti-pd-1 antibodies and methods of use thereof
WO2017062888A1 (en) 2015-10-09 2017-04-13 Regeneron Pharmaceuticals, Inc. Anti-lag3 antibodies and uses thereof
WO2017066227A1 (en) 2015-10-15 2017-04-20 Bristol-Myers Squibb Company Compounds useful as immunomodulators
WO2017086367A1 (ja) 2015-11-18 2017-05-26 中外製薬株式会社 免疫抑制機能を有する細胞に対するt細胞リダイレクト抗原結合分子を用いた併用療法
WO2017087589A2 (en) 2015-11-18 2017-05-26 Merck Sharp & Dohme Corp. Pd1 and/or lag3 binders
WO2017086419A1 (ja) 2015-11-18 2017-05-26 中外製薬株式会社 液性免疫応答の増強方法
WO2017087901A2 (en) 2015-11-19 2017-05-26 Sutro Biopharma, Inc. Anti-lag3 antibodies, compositions comprising anti-lag3 antibodies and methods of making and using anti-lag3 antibodies
WO2017106129A1 (en) 2015-12-16 2017-06-22 Merck Sharp & Dohme Corp. Anti-lag3 antibodies and antigen-binding fragments
WO2017106061A1 (en) 2015-12-14 2017-06-22 Macrogenics, Inc. Bispecific molecules having immunoreactivity with pd-1 and ctla-4, and methods of use thereof
WO2017123557A1 (en) 2016-01-11 2017-07-20 Armo Biosciences, Inc. Interleukin-10 in production of antigen-specific cd8+ t cells and methods of use of same
WO2017132827A1 (en) 2016-02-02 2017-08-10 Innovent Biologics (Suzhou) Co., Ltd. Pd-1 antibodies
WO2017132825A1 (zh) 2016-02-02 2017-08-10 华为技术有限公司 确定发射功率的方法、用户设备和基站
WO2017149143A1 (en) 2016-03-04 2017-09-08 Agency For Science, Technology And Research Anti-lag-3 antibodies
WO2017151830A1 (en) 2016-03-04 2017-09-08 Bristol-Myers Squibb Company Immunomodulators
US20170260271A1 (en) 2014-05-13 2017-09-14 Chugai Seiyaku Kabushiki Kaisha T Cell-Redirected Antigen-Binding Molecule For Cells Having Immunosuppression Function
WO2017176608A1 (en) 2016-04-05 2017-10-12 Bristol-Myers Squibb Company Macrocyclic inhibitors of the pd-1/pd-l1 and cd80/pd-l1 protein/protein interactions
WO2017198741A1 (en) 2016-05-18 2017-11-23 Boehringer Ingelheim International Gmbh Anti pd-1 and anti-lag3 antibodies for cancer treatment
WO2017220569A1 (en) 2016-06-20 2017-12-28 F-Star Delta Limited Binding molecules binding pd-l1 and lag-3
WO2017219995A1 (zh) 2016-06-23 2017-12-28 江苏恒瑞医药股份有限公司 Lag-3抗体、其抗原结合片段及其医药用途
WO2017220555A1 (en) 2016-06-20 2017-12-28 F-Star Beta Limited Lag -3 binding members
WO2018009505A1 (en) 2016-07-08 2018-01-11 Bristol-Myers Squibb Company 1,3-dihydroxy-phenyl derivatives useful as immunomodulators
WO2018034227A1 (ja) 2016-08-15 2018-02-22 国立大学法人北海道大学 抗lag-3抗体
WO2018044963A1 (en) 2016-09-01 2018-03-08 Bristol-Myers Squibb Company Biaryl compounds useful as immunomodulators
WO2018071500A1 (en) 2016-10-11 2018-04-19 Agenus Inc. Anti-lag-3 antibodies and methods of use thereof
WO2018069500A2 (en) 2016-10-13 2018-04-19 Symphogen A/S Anti-lag-3 antibodies and compositions
WO2018083087A2 (en) 2016-11-02 2018-05-11 Glaxosmithkline Intellectual Property (No.2) Limited Binding proteins
WO2018085750A2 (en) 2016-11-07 2018-05-11 Bristol-Myers Squibb Company Immunomodulators
WO2018118848A1 (en) 2016-12-20 2018-06-28 Bristol-Myers Squibb Company Compounds useful as immunomodulators
WO2018152687A1 (en) * 2017-02-22 2018-08-30 I-Mab Anti-lymphocyte activation gene-3 (lag-3) antibodies and uses thereof
WO2018183171A1 (en) 2017-03-27 2018-10-04 Bristol-Myers Squibb Company Substituted isoquionline derivatives as immunomudulators
WO2018185046A1 (en) 2017-04-05 2018-10-11 F. Hoffmann-La Roche Ag Anti-lag3 antibodies
WO2018185043A1 (en) 2017-04-05 2018-10-11 F. Hoffmann-La Roche Ag Bispecific antibodies specifically binding to pd1 and lag3
WO2018201096A1 (en) 2017-04-27 2018-11-01 Tesaro, Inc. Antibody agents directed against lymphocyte activation gene-3 (lag-3) and uses thereof
WO2018204374A1 (en) 2017-05-02 2018-11-08 Merck Sharp & Dohme Corp. Formulations of anti-lag3 antibodies and co-formulations of anti-lag3 antibodies and anti-pd-1 antibodies
WO2018208868A1 (en) 2017-05-10 2018-11-15 Smet Pharmaceutical Inc Human monoclonal antibodies against lag3 and uses thereof
WO2018217940A2 (en) 2017-05-24 2018-11-29 Sutro Biopharma, Inc. Pd-1/lag3 bi-specific antibodies, compositions thereof, and methods of making and using the same
US20180346569A1 (en) 2015-11-18 2018-12-06 Lyvgen Biopharma Holdings Limited Anti-pd-1 antibodies and therapeutic uses thereof
WO2018222718A1 (en) * 2017-05-30 2018-12-06 Bristol-Myers Squibb Company Treatment of lag-3 positive tumors
WO2018237153A1 (en) 2017-06-23 2018-12-27 Bristol-Myers Squibb Company IMMUNOMODULATORS ACTING AS PD-1 ANTAGONISTS
WO2019011306A1 (en) 2017-07-13 2019-01-17 Nanjing Leads Biolabs Co., Ltd. LAG-3 BINDING ANTIBODIES AND USES THEREOF
WO2019018730A1 (en) 2017-07-20 2019-01-24 Novartis Ag DOSAGE REGIMES FOR ANTI-LAG3 ANTIBODIES AND USES THEREOF
WO2019070643A1 (en) 2017-10-03 2019-04-11 Bristol-Myers Squibb Company IMMUNOMODULATORS
WO2019147662A1 (en) 2018-01-23 2019-08-01 Bristol-Myers Squibb Company 2,8-diacyl-2,8-diazaspiro[5.5]undecane compounds useful as immunomodulators
WO2019169123A1 (en) 2018-03-01 2019-09-06 Bristol-Myers Squibb Company Compounds useful as immunomodulators
WO2019241098A1 (en) * 2018-06-11 2019-12-19 Yale University Novel immune checkpoint inhibitors
US10711060B2 (en) 2014-03-14 2020-07-14 Novartis Ag Antibody molecules to LAG-3 and uses thereof

Patent Citations (124)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5977318A (en) 1991-06-27 1999-11-02 Bristol Myers Squibb Company CTLA4 receptor and uses thereof
US6051227A (en) 1995-07-25 2000-04-18 The Regents Of The University Of California, Office Of Technology Transfer Blockade of T lymphocyte down-regulation associated with CTLA-4 signaling
WO2000037504A2 (en) 1998-12-23 2000-06-29 Pfizer Inc. Human monoclonal antibodies to ctla-4
US6682736B1 (en) 1998-12-23 2004-01-27 Abgenix, Inc. Human monoclonal antibodies to CTLA-4
US6808710B1 (en) 1999-08-23 2004-10-26 Genetics Institute, Inc. Downmodulating an immune response with multivalent antibodies to PD-1
US6984720B1 (en) 1999-08-24 2006-01-10 Medarex, Inc. Human CTLA-4 antibodies
US7034121B2 (en) 2000-01-27 2006-04-25 Genetics Institue, Llc Antibodies against CTLA4
US7488802B2 (en) 2002-12-23 2009-02-10 Wyeth Antibodies against PD-1
US7767429B2 (en) 2003-03-05 2010-08-03 Halozyme, Inc. Soluble hyaluronidase glycoprotein (sHASEGP), process for preparing the same, uses and pharmaceutical compositions comprising thereof
US8779105B2 (en) 2005-05-09 2014-07-15 Medarex, L.L.C. Monoclonal antibodies to programmed death 1 (PD-1)
US8008449B2 (en) 2005-05-09 2011-08-30 Medarex, Inc. Human monoclonal antibodies to programmed death 1 (PD-1) and methods for treating cancer using anti-PD-1 antibodies alone or in combination with other immunotherapeutics
US7943743B2 (en) 2005-07-01 2011-05-17 Medarex, Inc. Human monoclonal antibodies to programmed death ligand 1 (PD-L1)
US9580507B2 (en) 2005-07-01 2017-02-28 E.R. Squibb & Sons, L. L. C. Human monoclonal antibodies to programmed death ligand 1 (PD-L1)
WO2007113648A2 (en) 2006-04-05 2007-10-11 Pfizer Products Inc. Ctla4 antibody combination therapy
WO2008156712A1 (en) 2007-06-18 2008-12-24 N. V. Organon Antibodies to human programmed death receptor pd-1
US8900587B2 (en) 2007-06-18 2014-12-02 Merck Sharp & Dohme Corp. Antibodies to human programmed death receptor PD-1
US8354509B2 (en) 2007-06-18 2013-01-15 Msd Oss B.V. Antibodies to human programmed death receptor PD-1
WO2009044273A2 (en) 2007-10-05 2009-04-09 Immutep Use of recombinant lag-3 or the derivatives thereof for eliciting monocyte immune response
US8168757B2 (en) 2008-03-12 2012-05-01 Merck Sharp & Dohme Corp. PD-1 binding proteins
US20110150892A1 (en) 2008-08-11 2011-06-23 Medarex, Inc. Human antibodies that bind lymphocyte activation gene-3 (lag-3) and uses thereof
US8217149B2 (en) 2008-12-09 2012-07-10 Genentech, Inc. Anti-PD-L1 antibodies, compositions and articles of manufacture
US20110007023A1 (en) 2009-07-09 2011-01-13 Sony Ericsson Mobile Communications Ab Display device, touch screen device comprising the display device, mobile device and method for sensing a force on a display device
US20130017199A1 (en) 2009-11-24 2013-01-17 AMPLIMMUNE ,Inc. a corporation Simultaneous inhibition of pd-l1/pd-l2
WO2011066389A1 (en) 2009-11-24 2011-06-03 Medimmmune, Limited Targeted binding agents against b7-h1
WO2012122444A1 (en) 2011-03-10 2012-09-13 Provectus Pharmaceuticals, Inc. Combination of local and systemic immunomodulative therapies for enhanced treatment of cancer
WO2012145493A1 (en) 2011-04-20 2012-10-26 Amplimmune, Inc. Antibodies and other molecules that bind b7-h1 and pd-1
WO2013079174A1 (en) 2011-11-28 2013-06-06 Merck Patent Gmbh Anti-pd-l1 antibodies and uses thereof
WO2013173223A1 (en) 2012-05-15 2013-11-21 Bristol-Myers Squibb Company Cancer immunotherapy by disrupting pd-1/pd-l1 signaling
WO2013181634A2 (en) 2012-05-31 2013-12-05 Sorrento Therapeutics Inc. Antigen binding proteins that bind pd-l1
US20140093511A1 (en) 2012-07-02 2014-04-03 Bristol-Myers Squibb Company Optimization of antibodies that bind lymphocyte activation gene-3 (lag-3), and uses thereof
WO2014151634A1 (en) 2013-03-15 2014-09-25 Bristol-Myers Squibb Company Macrocyclic inhibitors of the pd-1/pd-l1 and cd80(b7-1)/pd-l1 protein/protein interactions
WO2014140180A1 (en) 2013-03-15 2014-09-18 Glaxosmithkline Intellectual Property Development Limited Anti-lag-3 binding proteins
WO2014179664A2 (en) 2013-05-02 2014-11-06 Anaptysbio, Inc. Antibodies directed against programmed death-1 (pd-1)
WO2014194302A2 (en) 2013-05-31 2014-12-04 Sorrento Therapeutics, Inc. Antigen binding proteins that bind pd-1
WO2014206107A1 (zh) 2013-06-26 2014-12-31 上海君实生物医药科技有限公司 抗pd-1抗体及其应用
US20160272708A1 (en) 2013-06-26 2016-09-22 Shanghai Junshi Biosciences Inc. Anti-pd-1 antibody and use thereof
WO2015034820A1 (en) 2013-09-04 2015-03-12 Bristol-Myers Squibb Company Compounds useful as immunomodulators
US20150079109A1 (en) 2013-09-13 2015-03-19 Beigene, Ltd. Anti-PD1 Antibodies and their Use as Therapeutics and Diagnostics
WO2015035606A1 (en) 2013-09-13 2015-03-19 Beigene, Ltd. Anti-pd1 antibodies and their use as therapeutics and diagnostics
WO2015042246A1 (en) 2013-09-20 2015-03-26 Bristol-Myers Squibb Company Combination of anti-lag-3 antibodies and anti-pd-1 antibodies to treat tumors
WO2015085847A1 (zh) 2013-12-12 2015-06-18 上海恒瑞医药有限公司 Pd-1抗体、其抗原结合片段及其医药用途
WO2015112800A1 (en) 2014-01-23 2015-07-30 Regeneron Pharmaceuticals, Inc. Human antibodies to pd-1
US9987500B2 (en) 2014-01-23 2018-06-05 Regeneron Pharmaceuticals, Inc. Human antibodies to PD-1
WO2015112900A1 (en) 2014-01-24 2015-07-30 Dana-Farber Cancer Institue, Inc. Antibody molecules to pd-1 and uses thereof
US9683048B2 (en) 2014-01-24 2017-06-20 Novartis Ag Antibody molecules to PD-1 and uses thereof
US10711060B2 (en) 2014-03-14 2020-07-14 Novartis Ag Antibody molecules to LAG-3 and uses thereof
WO2015160641A2 (en) 2014-04-14 2015-10-22 Bristol-Myers Squibb Company Compounds useful as immunomodulators
US20170260271A1 (en) 2014-05-13 2017-09-14 Chugai Seiyaku Kabushiki Kaisha T Cell-Redirected Antigen-Binding Molecule For Cells Having Immunosuppression Function
WO2015200119A1 (en) 2014-06-26 2015-12-30 Macrogenics, Inc. Covalently bonded diabodies having immunoreactivity with pd-1 and lag-3, and methods of use thereof
US10188730B2 (en) 2014-08-19 2019-01-29 Merck Sharp & Dohme Corp. Anti-LAG3 antibodies and antigen-binding fragments
WO2016028672A1 (en) 2014-08-19 2016-02-25 Merck Sharp & Dohme Corp. Anti-lag3 antibodies and antigen-binding fragments
WO2016039749A1 (en) 2014-09-11 2016-03-17 Bristol-Myers Squibb Company Macrocyclic inhibitors of the pd-1/pd-l1 and cd80 (b7-1)/pd-li protein/protein interactions
WO2016057624A1 (en) 2014-10-10 2016-04-14 Bristol-Myers Squibb Company Immunomodulators
WO2016077518A1 (en) 2014-11-14 2016-05-19 Bristol-Myers Squibb Company Macrocyclic peptides useful as immunomodulators
US20160159905A1 (en) 2014-12-09 2016-06-09 Rinat Neuroscience Corp. Anti-pd-1 antibodies and methods of use thereof
WO2016100285A1 (en) 2014-12-18 2016-06-23 Bristol-Myers Squibb Company Immunomodulators
WO2016100608A1 (en) 2014-12-19 2016-06-23 Bristol-Myers Squibb Company Immunomodulators
WO2016106159A1 (en) 2014-12-22 2016-06-30 Enumeral Biomedical Holding, Inc. Anti-pd-1 antibodies
WO2016126858A2 (en) 2015-02-03 2016-08-11 Anaptysbio, Inc. Antibodies directed against lymphocyte activation gene 3 (lag-3)
WO2016126646A1 (en) 2015-02-04 2016-08-11 Bristol-Myers Squibb Company Immunomodulators
WO2016149201A2 (en) 2015-03-13 2016-09-22 Cytomx Therapeutics, Inc. Anti-pdl1 antibodies, activatable anti-pdl1 antibodies, and methods of use thereof
WO2016149351A1 (en) 2015-03-18 2016-09-22 Bristol-Myers Squibb Company Immunomodulators
WO2016196237A1 (en) 2015-05-29 2016-12-08 Agenus Inc. Anti-ctla-4 antibodies and methods of use thereof
WO2016200782A1 (en) 2015-06-08 2016-12-15 Macrogenics, Inc. Lag-3-binding molecules and methods of use thereof
WO2016197367A1 (en) 2015-06-11 2016-12-15 Wuxi Biologics (Shanghai) Co. Ltd. Novel anti-pd-l1 antibodies
WO2017015560A2 (en) 2015-07-22 2017-01-26 Sorrento Therapeutics, Inc. Antibody therapeutics that bind lag3
WO2017019894A1 (en) 2015-07-29 2017-02-02 Novartis Ag Combination therapies comprising antibody molecules to lag-3
WO2017019846A1 (en) 2015-07-30 2017-02-02 Macrogenics, Inc. Pd-1-binding molecules and methods use thereof
WO2017020291A1 (en) 2015-08-06 2017-02-09 Wuxi Biologics (Shanghai) Co. Ltd. Novel anti-pd-l1 antibodies
WO2017020858A1 (en) 2015-08-06 2017-02-09 Wuxi Biologics (Shanghai) Co. Ltd. Novel anti-pd-l1 antibodies
WO2017025498A1 (en) 2015-08-07 2017-02-16 Pieris Pharmaceuticals Gmbh Novel fusion polypeptide specific for lag-3 and pd-1
WO2017025016A1 (en) 2015-08-10 2017-02-16 Innovent Biologics (Suzhou) Co., Ltd. Pd-1 antibodies
WO2017024465A1 (en) 2015-08-10 2017-02-16 Innovent Biologics (Suzhou) Co., Ltd. Pd-1 antibodies
WO2017024515A1 (en) 2015-08-11 2017-02-16 Wuxi Biologics (Cayman) Inc. Novel anti-pd-1 antibodies
WO2017025051A1 (en) 2015-08-11 2017-02-16 Wuxi Biologics (Shanghai) Co. Ltd. Novel anti-pd-1 antibodies
WO2017034916A1 (en) 2015-08-24 2017-03-02 Eli Lilly And Company Pd-l1 ("programmed death-ligand 1") antibodies
WO2017040790A1 (en) 2015-09-01 2017-03-09 Agenus Inc. Anti-pd-1 antibodies and methods of use thereof
WO2017062888A1 (en) 2015-10-09 2017-04-13 Regeneron Pharmaceuticals, Inc. Anti-lag3 antibodies and uses thereof
US10358495B2 (en) 2015-10-09 2019-07-23 Regeneron Pharmaceuticals, Inc. Anti-LAG3 antibodies and uses thereof
WO2017066227A1 (en) 2015-10-15 2017-04-20 Bristol-Myers Squibb Company Compounds useful as immunomodulators
WO2017086367A1 (ja) 2015-11-18 2017-05-26 中外製薬株式会社 免疫抑制機能を有する細胞に対するt細胞リダイレクト抗原結合分子を用いた併用療法
US20180346569A1 (en) 2015-11-18 2018-12-06 Lyvgen Biopharma Holdings Limited Anti-pd-1 antibodies and therapeutic uses thereof
WO2017086419A1 (ja) 2015-11-18 2017-05-26 中外製薬株式会社 液性免疫応答の増強方法
WO2017087589A2 (en) 2015-11-18 2017-05-26 Merck Sharp & Dohme Corp. Pd1 and/or lag3 binders
WO2017087901A2 (en) 2015-11-19 2017-05-26 Sutro Biopharma, Inc. Anti-lag3 antibodies, compositions comprising anti-lag3 antibodies and methods of making and using anti-lag3 antibodies
WO2017106061A1 (en) 2015-12-14 2017-06-22 Macrogenics, Inc. Bispecific molecules having immunoreactivity with pd-1 and ctla-4, and methods of use thereof
WO2017106129A1 (en) 2015-12-16 2017-06-22 Merck Sharp & Dohme Corp. Anti-lag3 antibodies and antigen-binding fragments
WO2017123557A1 (en) 2016-01-11 2017-07-20 Armo Biosciences, Inc. Interleukin-10 in production of antigen-specific cd8+ t cells and methods of use of same
WO2017132825A1 (zh) 2016-02-02 2017-08-10 华为技术有限公司 确定发射功率的方法、用户设备和基站
WO2017133540A1 (en) 2016-02-02 2017-08-10 Innovent Biologics (Suzhou) Co., Ltd. Pd-1 antibodies
WO2017132827A1 (en) 2016-02-02 2017-08-10 Innovent Biologics (Suzhou) Co., Ltd. Pd-1 antibodies
WO2017151830A1 (en) 2016-03-04 2017-09-08 Bristol-Myers Squibb Company Immunomodulators
WO2017149143A1 (en) 2016-03-04 2017-09-08 Agency For Science, Technology And Research Anti-lag-3 antibodies
WO2017176608A1 (en) 2016-04-05 2017-10-12 Bristol-Myers Squibb Company Macrocyclic inhibitors of the pd-1/pd-l1 and cd80/pd-l1 protein/protein interactions
WO2017198741A1 (en) 2016-05-18 2017-11-23 Boehringer Ingelheim International Gmbh Anti pd-1 and anti-lag3 antibodies for cancer treatment
WO2017220569A1 (en) 2016-06-20 2017-12-28 F-Star Delta Limited Binding molecules binding pd-l1 and lag-3
WO2017220555A1 (en) 2016-06-20 2017-12-28 F-Star Beta Limited Lag -3 binding members
WO2017219995A1 (zh) 2016-06-23 2017-12-28 江苏恒瑞医药股份有限公司 Lag-3抗体、其抗原结合片段及其医药用途
WO2018009505A1 (en) 2016-07-08 2018-01-11 Bristol-Myers Squibb Company 1,3-dihydroxy-phenyl derivatives useful as immunomodulators
WO2018034227A1 (ja) 2016-08-15 2018-02-22 国立大学法人北海道大学 抗lag-3抗体
WO2018044963A1 (en) 2016-09-01 2018-03-08 Bristol-Myers Squibb Company Biaryl compounds useful as immunomodulators
WO2018071500A1 (en) 2016-10-11 2018-04-19 Agenus Inc. Anti-lag-3 antibodies and methods of use thereof
WO2018069500A2 (en) 2016-10-13 2018-04-19 Symphogen A/S Anti-lag-3 antibodies and compositions
WO2018083087A2 (en) 2016-11-02 2018-05-11 Glaxosmithkline Intellectual Property (No.2) Limited Binding proteins
WO2018085750A2 (en) 2016-11-07 2018-05-11 Bristol-Myers Squibb Company Immunomodulators
WO2018118848A1 (en) 2016-12-20 2018-06-28 Bristol-Myers Squibb Company Compounds useful as immunomodulators
WO2018152687A1 (en) * 2017-02-22 2018-08-30 I-Mab Anti-lymphocyte activation gene-3 (lag-3) antibodies and uses thereof
WO2018183171A1 (en) 2017-03-27 2018-10-04 Bristol-Myers Squibb Company Substituted isoquionline derivatives as immunomudulators
WO2018185046A1 (en) 2017-04-05 2018-10-11 F. Hoffmann-La Roche Ag Anti-lag3 antibodies
WO2018185043A1 (en) 2017-04-05 2018-10-11 F. Hoffmann-La Roche Ag Bispecific antibodies specifically binding to pd1 and lag3
WO2018201096A1 (en) 2017-04-27 2018-11-01 Tesaro, Inc. Antibody agents directed against lymphocyte activation gene-3 (lag-3) and uses thereof
WO2018204374A1 (en) 2017-05-02 2018-11-08 Merck Sharp & Dohme Corp. Formulations of anti-lag3 antibodies and co-formulations of anti-lag3 antibodies and anti-pd-1 antibodies
US20200055938A1 (en) 2017-05-02 2020-02-20 Merck Sharp & Dohme Corp. Formulations of anti-lag3 antibodies and co-formulations of anti-lag3 antibodies and anti-pd-1 antibodies
WO2018208868A1 (en) 2017-05-10 2018-11-15 Smet Pharmaceutical Inc Human monoclonal antibodies against lag3 and uses thereof
WO2018217940A2 (en) 2017-05-24 2018-11-29 Sutro Biopharma, Inc. Pd-1/lag3 bi-specific antibodies, compositions thereof, and methods of making and using the same
WO2018222718A1 (en) * 2017-05-30 2018-12-06 Bristol-Myers Squibb Company Treatment of lag-3 positive tumors
WO2018237153A1 (en) 2017-06-23 2018-12-27 Bristol-Myers Squibb Company IMMUNOMODULATORS ACTING AS PD-1 ANTAGONISTS
WO2019011306A1 (en) 2017-07-13 2019-01-17 Nanjing Leads Biolabs Co., Ltd. LAG-3 BINDING ANTIBODIES AND USES THEREOF
WO2019018730A1 (en) 2017-07-20 2019-01-24 Novartis Ag DOSAGE REGIMES FOR ANTI-LAG3 ANTIBODIES AND USES THEREOF
US20200172617A1 (en) 2017-07-20 2020-06-04 Novartis Ag Dosage regimens of anti-lag-3 antibodies and uses thereof
WO2019070643A1 (en) 2017-10-03 2019-04-11 Bristol-Myers Squibb Company IMMUNOMODULATORS
WO2019147662A1 (en) 2018-01-23 2019-08-01 Bristol-Myers Squibb Company 2,8-diacyl-2,8-diazaspiro[5.5]undecane compounds useful as immunomodulators
WO2019169123A1 (en) 2018-03-01 2019-09-06 Bristol-Myers Squibb Company Compounds useful as immunomodulators
WO2019241098A1 (en) * 2018-06-11 2019-12-19 Yale University Novel immune checkpoint inhibitors

Non-Patent Citations (32)

* Cited by examiner, † Cited by third party
Title
"GenBank", Database accession no. NP -002277
"Oxford Dictionary Of Biochemistry And Molecular Biology", 2006, OXFORD UNIVERSITY PRESS
ANDREWS LAWRENCE P ET AL: "Inhibitory receptors and ligands beyond PD-1, PD-L1 and CTLA-4: breakthroughs or backups", NATURE IMMULOGY, NATURE PUBLISHING GROUP US, NEW YORK, vol. 20, no. 11, 14 October 2019 (2019-10-14), pages 1425 - 1434, XP036912480, ISSN: 1529-2908, [retrieved on 20191014], DOI: 10.1038/S41590-019-0512-0 *
ANONYMOUS: "Investigator-Initiated Phase I Trial of CYT001 for unresectable advanced HCC will be started at Chiba University", 9 August 2019 (2019-08-09), pages 1 - 1, XP055865579, Retrieved from the Internet <URL:https://www.cytlimic.com/news/20190809_01_en.html> [retrieved on 20211124] *
BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426
BRIGNONE C ET AL., J. IMMUNOL., vol. 179, 2007, pages 4202 - 4211
BRISTOL-MYERS SQUIBB: "History of Changes for Study: NCT01968109 - 07.08.2020 (v76)", 7 August 2020 (2020-08-07), pages 1 - 12, XP055865401, Retrieved from the Internet <URL:https://clinicaltrials.gov/ct2/history/NCT01968109?V_76=View#StudyPageTop> [retrieved on 20211124] *
BUROVA E ET AL., J. IMMUNOTHER. CANCER, vol. 4, 2016, pages 195
CHENG AL ET AL., LANCET ONCOL, vol. 10, no. 1, 2009, pages 25 - 34
COLAGRANDE S ET AL., WORLD J. HEPATOL., vol. 7, no. 8, 2015, pages 1041 - 1053
DESAI ET AL., JCO, vol. 36, 2018, pages TPS3113
FENG XU ET AL: "Immune checkpoint therapy in liver cancer", JOURNAL OF EXPERIMENTAL & CLINICAL CANCER RESEARCH, vol. 37, no. 1, 29 May 2018 (2018-05-29), XP055625551, DOI: 10.1186/s13046-018-0777-4 *
FORNER A ET AL., LANCET, vol. 391, no. 10127, 2018, pages 1301 - 1314
HERBST ET AL., J CLIN ONCOL, vol. 31, 2013, pages 3000
HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883
JUO, PEI-SHOW: "Concise Dictionary of Biomedicine and Molecular Biology", 2002, CRC PRESS
KAPLON ET AL., MABS, vol. 10, no. 2, 2018, pages 183 - 203
KATSIARYNA MARHELAVA ET AL: "Targeting Negative and Positive Immune Checkpoints with Monoclonal Antibodies in Therapy of Cancer", CANCERS, vol. 11, no. 11, 8 November 2019 (2019-11-08), pages 1756, XP055658872, DOI: 10.3390/cancers11111756 *
LLOVET JM ET AL., N. ENGL. J. MED., vol. 359, no. 4, 2008, pages 378 - 90
MATSUZAKI, J ET AL., PNAS, vol. 107, 2010, pages 7875
MELERO I ET AL: "Nivolumab dose escalation and expansion in patients with advanced hepatocellular carcinoma (HCC): The CheckMate 040 study. | Journal of Clinical Oncology", JOURNAL OF CLINICAL ONCOLOGY 35, NO. 4_SUPPL (FEBRUARY 01, 2017) 226-226., 1 February 2017 (2017-02-01), pages 1 - 4, XP055865733, Retrieved from the Internet <URL:https://ascopubs.org/doi/10.1200/JCO.2017.35.4_suppl.226> [retrieved on 20211125] *
PAPADOPOULOS KYRIAKOS P. ET AL: "First-in-human study of REGN3767 (R3767), a human LAG-3 monoclonal antibody (mAb), cemiplimab in patients (pts) with advanced malignancies.", JOURNAL OF CLINICAL ONCOLOGY, vol. 37, no. 15_suppl, 20 May 2019 (2019-05-20), US, pages 2508 - 2508, XP055865351, ISSN: 0732-183X, Retrieved from the Internet <URL:https://investor.regeneron.com/static-files/06ea4a1c-405b-456e-9d31-b0f8e6251c69> DOI: 10.1200/JCO.2019.37.15_suppl.2508 *
REN Z ET AL., ANAL. CELL. PATHOL. (AMST.), 2020
RIBAS, UPDATE CANCER THER., vol. 2, no. 3, 2007, pages 133 - 39
SI-YANG LIU ET AL., J. HEMATOL. ONCOL., vol. 70, 2017, pages 136
SOLINAS CINZIA ET AL: "LAG3: The Biological Processes That Motivate Targeting This Immune Checkpoint Molecule in Human Cancer", CANCERS, vol. 11, no. 8, 20 August 2019 (2019-08-20), pages 1213, XP055865575, Retrieved from the Internet <URL:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6721578/pdf/cancers-11-01213.pdf> DOI: 10.3390/cancers11081213 *
WANG ET AL., CANCER IMMUNOL RES., vol. 2, no. 9, 2014, pages 846 - 56
WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 46
YAU T ET AL: "CheckMate 459: A randomized, multi-center phase III study of nivolumab (NIVO) vs sorafenib (SOR) as first-line (1L) treatment in patients (pts) with advanced hepatocellular carcinoma (aHCC)", ANNALS OF ONCOLOGY, vol. 30, no. S5, 1 October 2019 (2019-10-01), pages v874, XP055865228, Retrieved from the Internet <URL:https://www.annalsofoncology.org/action/showPdf?pii=S0923-7534(19)60389-3> *
ZETTL M ET AL., CANCER. RES., vol. 78, 2018
ZHANG ET AL., CELL DISCOV, vol. 7, March 2017 (2017-03-01), pages 3
ZHOU GUOYING ET AL: "Antibodies Against Immune Checkpoint Molecules Restore Functions of Tumor-Infiltrating T Cells in Hepatocellular Carcinomas", GASTROENTEROLOGY, ELSEVIER INC, US, vol. 153, no. 4, 23 June 2017 (2017-06-23), pages 1107, XP085196401, ISSN: 0016-5085, DOI: 10.1053/J.GASTRO.2017.06.017 *

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12565528B2 (en) 2020-10-23 2026-03-03 Bristol-Myers Squibb Company LAG-3 antagonist therapy for lung cancer
WO2025117889A3 (en) * 2023-11-30 2025-07-24 Regeneron Pharmaceuticals, Inc. Methods of treating cancer by administering a combination therapy including a neoadjuvant pd-1 inhibitor
WO2025245489A1 (en) 2024-05-24 2025-11-27 Bristol-Myers Squibb Company Treatment of tumors in subjects having fgl-1 positive samples

Also Published As

Publication number Publication date
AU2021331476A9 (en) 2023-07-06
JP2023540255A (ja) 2023-09-22
CA3193421A1 (en) 2022-03-03
KR20230058442A (ko) 2023-05-03
US20230265188A1 (en) 2023-08-24
MX2023002332A (es) 2023-03-21
AU2021331476A1 (en) 2023-05-04
IL300813A (en) 2023-04-01
BR112023003427A2 (pt) 2023-03-21
EP4204095A1 (en) 2023-07-05

Similar Documents

Publication Publication Date Title
US12565528B2 (en) LAG-3 antagonist therapy for lung cancer
WO2022047189A1 (en) Lag-3 antagonist therapy for hepatocellular carcinoma
EP4469477A1 (en) Combination therapy for hepatocellular carcinoma
EP4482866A1 (en) Combination therapy for colorectal carcinoma
US20240417473A1 (en) Lag-3 antagonist therapy for hematological cancer
WO2024137776A1 (en) Combination therapy for lung cancer
WO2025245489A1 (en) Treatment of tumors in subjects having fgl-1 positive samples
CN116529261A (zh) 用于肝细胞癌的lag-3拮抗剂疗法

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21789895

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2023513856

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 3193421

Country of ref document: CA

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112023003427

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112023003427

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20230224

ENP Entry into the national phase

Ref document number: 20237009984

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 202317021805

Country of ref document: IN

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021789895

Country of ref document: EP

Effective date: 20230328

WWE Wipo information: entry into national phase

Ref document number: 202180071182.X

Country of ref document: CN

ENP Entry into the national phase

Ref document number: 2021331476

Country of ref document: AU

Date of ref document: 20210827

Kind code of ref document: A