WO2021236997A2 - Potent neutralizing antibodies against sars-cov-2, generation and uses thereof - Google Patents

Potent neutralizing antibodies against sars-cov-2, generation and uses thereof Download PDF

Info

Publication number
WO2021236997A2
WO2021236997A2 PCT/US2021/033512 US2021033512W WO2021236997A2 WO 2021236997 A2 WO2021236997 A2 WO 2021236997A2 US 2021033512 W US2021033512 W US 2021033512W WO 2021236997 A2 WO2021236997 A2 WO 2021236997A2
Authority
WO
WIPO (PCT)
Prior art keywords
seq
polypeptide sequence
cdr2
cdr1
cdr3
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2021/033512
Other languages
English (en)
French (fr)
Other versions
WO2021236997A3 (en
Inventor
David D. Ho
Yaoxing Huang
Lihong Liu
Manoj S. Nair
Pengfei Wang
Jian Yu
Yang Luo
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Columbia University in the City of New York
Original Assignee
Columbia University in the City of New York
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to MX2022014420A priority Critical patent/MX2022014420A/es
Priority to KR1020227044068A priority patent/KR20230024904A/ko
Priority to JP2022570668A priority patent/JP2023526469A/ja
Priority to CA3184184A priority patent/CA3184184A1/en
Priority to EP21807600.8A priority patent/EP4153625A4/en
Priority to CN202180059673.2A priority patent/CN116829177A/zh
Priority to PH1/2022/500025A priority patent/PH12022500025A1/en
Priority to US17/999,387 priority patent/US20230203134A1/en
Priority to IL298263A priority patent/IL298263A/en
Priority to AU2021277373A priority patent/AU2021277373A1/en
Application filed by Columbia University in the City of New York filed Critical Columbia University in the City of New York
Priority to BR112022023467A priority patent/BR112022023467A2/pt
Publication of WO2021236997A2 publication Critical patent/WO2021236997A2/en
Publication of WO2021236997A3 publication Critical patent/WO2021236997A3/en
Anticipated expiration legal-status Critical
Priority to CONC2022/0018192A priority patent/CO2022018192A2/es
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/08Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/10RNA viruses
    • C07K16/112Retroviridae (F), e.g. leukemia viruses
    • C07K16/114Lentivirus (G), e.g. human immunodeficiency virus [HIV], feline immunodeficiency virus [FIV] or simian immunodeficiency virus [SIV]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/08Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/10RNA viruses
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/08Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/10RNA viruses
    • C07K16/102Coronaviridae (F)
    • C07K16/104Severe acute respiratory syndrome coronavirus 2 [SARS‐CoV‐2]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2121/00Preparations for use in therapy
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • Coronavirus disease 2019 (COVID-19) is an infectious disease caused by the severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2). The disease affects multiple organs in the body including the lungs. There is an urgent need for the development of therapeutics to combat COVID-19.
  • SARS-CoV-2 severe acute respiratory syndrome coronavirus 2
  • the invention provides a bispecific molecule comprising a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain.
  • the first polypeptide chain and the second polypeptide chain are covalently bonded to one another.
  • the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 59 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 63.
  • the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 60 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 64.
  • the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 61 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 65.
  • the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 62 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 66.
  • the first heavy chain comprises SEQ ID NO: 59 or SEQ ID NO: 63.
  • the first light chain comprises SEQ ID NO: 60 or SEQ ID NO: 64.
  • the second heavy chain comprises SEQ ID NO: 61 or SEQ ID NO: 65.
  • the second light chain comprises SEQ ID NO: 62 or SEQ ID NO: 66.
  • the variable domain of the first heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 59 or CDR1, CDR2, and CDR3 of SEQ ID NO: 63.
  • the variable domain of the first light chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 60 or CDR1, CDR2, and CDR3 of SEQ ID NO: 64.
  • variable domain of the second heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 61 or CDR1, CDR2, and CDR3 of SEQ ID NO: 65.
  • variable domain of the second light chain comprises CDR1, CDR2, and CDR3 SEQ ID NO: 62 or CDR1, CDR2, and CDR3 of SEQ ID NO: 66.
  • variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27.
  • variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28.
  • variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13.
  • variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14.
  • the variable domain of the first heavy chain comprises SEQ ID NO: 13 or SEQ ID NO: 27.
  • variable domain of the first light chain comprises SEQ ID NO: 14 or SEQ ID NO: 28.
  • variable domain of the second heavy chain comprises SEQ ID NO: 27 or SEQ ID NO: 13.
  • the variable domain of the second light chain comprises SEQ ID NO: 28 or SEQ ID NO: 14.
  • the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 59, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 60, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 61, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%,
  • the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 63, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 64, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 65, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%
  • the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 13, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%,
  • the molecule comprises SEQ ID NOs: 59, 60, 61, and 62. In some embodiments, the molecule comprises SEQ ID NOs: 63, 64, 65, and 66. In some embodiments, the molecule comprises SEQ ID NOs: 13, 14, 27, and 28. [0013] In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus strain.
  • the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle.
  • the first epitope comprises at least a portion of a receptor binding domain (RBD) on an S protein of a SARS-CoV-2 particle.
  • the second epitope comprises at least a portion of a N-terminal domain (NTD) on an S protein of a SARS-CoV-2 particle.
  • the invention provides a method of treating a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a composition comprising a bispecific molecule, wherein the bispecific molecule comprises a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain.
  • the first polypeptide chain and the second polypeptide chain are covalently bonded to one another.
  • the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 59 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 63.
  • the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 60 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 64.
  • the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 61 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 65.
  • the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 62 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 66.
  • the first heavy chain comprises SEQ ID NO: 59 or SEQ ID NO: 63.
  • the first light chain comprises SEQ ID NO: 60 or SEQ ID NO: 64.
  • the second heavy chain comprises SEQ ID NO: 61 or SEQ ID NO: 65.
  • the second light chain comprises SEQ ID NO: 62 or SEQ ID NO: 66.
  • the variable domain of the first heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 59 or CDR1, CDR2, and CDR3 of SEQ ID NO: 63.
  • the variable domain of the first light chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 60 or CDR1, CDR2, and CDR3 of SEQ ID NO: 64.
  • variable domain of the second heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 61 or CDR1, CDR2, and CDR3 of SEQ ID NO: 65.
  • variable domain of the second light chain comprises CDR1, CDR2, and CDR3 SEQ ID NO: 62 or CDR1, CDR2, and CDR3 of SEQ ID NO: 66.
  • variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27.
  • variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28.
  • variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13.
  • variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14.
  • the variable domain of the first heavy chain comprises SEQ ID NO: 13 or SEQ ID NO: 27.
  • variable domain of the first light chain comprises SEQ ID NO: 14 or SEQ ID NO: 28.
  • variable domain of the second heavy chain comprises SEQ ID NO: 27 or SEQ ID NO: 13.
  • the variable domain of the second light chain comprises SEQ ID NO: 28 or SEQ ID NO: 14.
  • the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 59, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 60, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 61, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%,
  • the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 63, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 64, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 65, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%
  • the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 13, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%,
  • the molecule comprises SEQ ID NOs: 59, 60, 61, and 62. In some embodiments, the molecule comprises SEQ ID NOs: 63, 64, 65, and 66. In some embodiments, the molecule comprises SEQ ID NOs: 13, 14, 27, and 28. [0021] In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus strain.
  • the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle.
  • the first epitope comprises at least a portion of a receptor binding domain (RBD) on a spike protein of a SARS-CoV-2 particle.
  • the second epitope comprises at least a portion of a N-terminal domain (NTD) on a spike protein of a SARS-CoV-2 particle.
  • the composition is administered in combination with a second therapeutic agent.
  • the invention provides a method of preventing a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a composition comprising a bispecific molecule, wherein the bispecific molecule comprises a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain.
  • the first polypeptide chain and the second polypeptide chain are covalently bonded to one another.
  • the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 59 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 63.
  • the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 60 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 64.
  • the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 61 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 65.
  • the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 62 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 66.
  • the first heavy chain comprises SEQ ID NO: 59 or SEQ ID NO: 63.
  • the first light chain comprises SEQ ID NO: 60 or SEQ ID NO: 64.
  • the second heavy chain comprises SEQ ID NO: 61 or SEQ ID NO: 65.
  • the second light chain comprises SEQ ID NO: 62 or SEQ ID NO: 66.
  • the variable domain of the first heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 59 or CDR1, CDR2, and CDR3 of SEQ ID NO: 63.
  • the variable domain of the first light chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 60 or CDR1, CDR2, and CDR3 of SEQ ID NO: 64.
  • variable domain of the second heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 61 or CDR1, CDR2, and CDR3 of SEQ ID NO: 65.
  • variable domain of the second light chain comprises CDR1, CDR2, and CDR3 SEQ ID NO: 62 or CDR1, CDR2, and CDR3 of SEQ ID NO: 66.
  • variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27.
  • variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28.
  • variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13.
  • variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14.
  • the variable domain of the first heavy chain comprises SEQ ID NO: 13 or SEQ ID NO: 27.
  • variable domain of the first light chain comprises SEQ ID NO: 14 or SEQ ID NO: 28.
  • variable domain of the second heavy chain comprises SEQ ID NO: 27 or SEQ ID NO: 13.
  • the variable domain of the second light chain comprises SEQ ID NO: 28 or SEQ ID NO: 14.
  • the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 59, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 60, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 61, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%,
  • the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 63, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 64, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 65, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%
  • the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 13, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%,
  • the molecule comprises SEQ ID NOs: 59, 60, 61, and 62. In some embodiments, the molecule comprises SEQ ID NOs: 63, 64, 65, and 66. In some embodiments, the molecule comprises SEQ ID NOs: 13, 14, 27, and 28. [0030] In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus strain.
  • the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle.
  • the first epitope comprises at least a portion of a receptor binding domain (RBD) on an S protein of a SARS-CoV-2 particle.
  • the second epitope comprises at least a portion of a N-terminal domain (NTD) on an S protein of a SARS-CoV-2 particle.
  • the composition is administered in combination with a second therapeutic agent.
  • the invention provides a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable domain and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16.
  • the heavy chain variable domain comprises SEQ ID NO: 15.
  • the light chain variable domain comprises SEQ ID NO: 16.
  • the antibody comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15 and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16.
  • the antibody comprises SEQ ID NO: 15 and SEQ ID NO: 16.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 15.
  • the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 16.
  • the antibody neutralizes a coronavirus.
  • the coronavirus is SARS-CoV-2.
  • the antibody specifically binds an epitope on the surface of the coronavirus.
  • the epitope comprises at least a portion of a coronavirus spike protein.
  • the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein.
  • RBD receptor binding domain
  • the coronavirus is a SARS-CoV-2 coronavirus.
  • the invention provides a method of treating a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable domain and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16.
  • the heavy chain variable domain comprises SEQ ID NO: 15.
  • the light chain variable domain comprises SEQ ID NO: 16.
  • the antibody comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15 and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16.
  • the antibody comprises SEQ ID NO: 15 and SEQ ID NO: 16.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 15. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 16.
  • the antibody neutralizes a coronavirus. In some embodiments, the coronavirus is SARS-CoV-2. In some embodiments, the antibody neutralizes a coronavirus. In some embodiments, the coronavirus is SARS-CoV-2. In some embodiments, the antibody specifically binds an epitope on the surface of the coronavirus. In some embodiments, the epitope comprises at least a portion of a coronavirus spike protein.
  • the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein.
  • the coronavirus is a SARS- CoV-2 coronavirus.
  • the antibody is administered in combination with a second pharmaceutical agent.
  • the invention provides a method of preventing a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16.
  • the heavy chain variable domain comprises SEQ ID NO: 15.
  • the light chain variable domain comprises SEQ ID NO: 16.
  • the antibody comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15 and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16.
  • the antibody comprises SEQ ID NO: 15 and SEQ ID NO: 16.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 15. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 16.
  • the antibody neutralizes a coronavirus. In some embodiments, the coronavirus is SARS-CoV-2. In some embodiments, the antibody neutralizes a coronavirus. In some embodiments, the coronavirus is SARS-CoV-2. In some embodiments, the antibody specifically binds an epitope on the surface of the coronavirus. In some embodiments, the epitope comprises at least a portion of a coronavirus spike protein.
  • the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein.
  • the coronavirus is a SARS- CoV-2 coronavirus.
  • the antibody is administered in combination with a second pharmaceutical agent. [0046]
  • the invention provides a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable domain and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 3, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 7, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 9, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%,
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 19, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 21, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 25, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%,
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 33, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 37, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 39, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 4, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 8, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 10, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%,
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 20, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 22, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 26, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%,
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 34, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 38, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 40, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 3 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 4.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 7 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 8.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 9 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 10.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 11 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 12.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 17 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 18.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 19 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 20.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 21 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 22.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 25 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 26.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 29 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 30.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 31 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 32.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 33 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 34.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 37 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 38.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 39 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 40.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 43 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 44.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 45 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 46.
  • the heavy chain variable domain comprises SEQ ID NO: 3 and the light chain variable domain comprises SEQ ID NO: 4.
  • the heavy chain variable domain comprises SEQ ID NO: 7 and the light chain variable domain comprises SEQ ID NO: 8. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 9 and the light chain variable domain comprises SEQ ID NO: 10. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 11 and the light chain variable domain comprises SEQ ID NO: 12. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 17 and the light chain variable domain comprises SEQ ID NO: 18. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 19 and the light chain variable domain comprises SEQ ID NO: 20. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 21 and the light chain variable domain comprises SEQ ID NO: 22.
  • the heavy chain variable domain comprises SEQ ID NO: 25 and the light chain variable domain comprises SEQ ID NO: 26. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 29 and the light chain variable domain comprises SEQ ID NO: 30. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 31 and the light chain variable domain comprises SEQ ID NO: 32. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 33 and the light chain variable domain comprises SEQ ID NO: 34. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 37 and the light chain variable domain comprises SEQ ID NO: 38. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 39 and the light chain variable domain comprises SEQ ID NO: 40.
  • the heavy chain variable domain comprises SEQ ID NO: 43 and the light chain variable domain comprises SEQ ID NO: 44. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 45 and the light chain variable domain comprises SEQ ID NO: 46. [0056] In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 3; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 7; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 9; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 11; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 17.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 19; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 21; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 25; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 29; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 31.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 33; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 37; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 39; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 43; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 45.
  • the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 4; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 8; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 10; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 12; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 18.
  • the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 20; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 22; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 26; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 30; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 32.
  • the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 34; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 38; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 40; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 44; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 46.
  • the antibody neutralizes a coronavirus.
  • the coronavirus is a SARS-CoV-2 virus.
  • the coronavirus is a SARS-CoV-2 variant strain.
  • the variant strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427.
  • the antibody specifically binds an epitope on the surface of the coronavirus.
  • the epitope comprises at least a portion of a coronavirus spike protein.
  • the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein.
  • the at least a portion of a coronavirus spike protein comprises a N-Terminal domain (NTD) of a spike protein.
  • the coronavirus is a SARS-CoV-2 coronavirus.
  • the invention provides a method of treating or preventing a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable domain and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 3, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 7, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 9, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%,
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 19, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 21, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 25, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%,
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 33, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 37, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 39, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 4, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 8, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 10, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%,
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 20, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 22, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 26, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%,
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 34, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 38, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 40, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 3 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 4.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 7 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 8.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 9 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 10.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 11 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 12.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 17 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 18.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 19 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 20.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 21 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 22.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 25 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 26.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 29 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 30.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 31 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 32.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 33 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 34.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 37 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 38.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 39 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 40.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 43 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 44.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 45 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 46.
  • the heavy chain variable domain comprises SEQ ID NO: 3 and the light chain variable domain comprises SEQ ID NO: 4.
  • the heavy chain variable domain comprises SEQ ID NO: 7 and the light chain variable domain comprises SEQ ID NO: 8. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 9 and the light chain variable domain comprises SEQ ID NO: 10. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 11 and the light chain variable domain comprises SEQ ID NO: 12. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 17 and the light chain variable domain comprises SEQ ID NO: 18. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 19 and the light chain variable domain comprises SEQ ID NO: 20. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 21 and the light chain variable domain comprises SEQ ID NO: 22.
  • the heavy chain variable domain comprises SEQ ID NO: 25 and the light chain variable domain comprises SEQ ID NO: 26. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 29 and the light chain variable domain comprises SEQ ID NO: 30. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 31 and the light chain variable domain comprises SEQ ID NO: 32. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 33 and the light chain variable domain comprises SEQ ID NO: 34. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 37 and the light chain variable domain comprises SEQ ID NO: 38. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 39 and the light chain variable domain comprises SEQ ID NO: 40.
  • the heavy chain variable domain comprises SEQ ID NO: 43 and the light chain variable domain comprises SEQ ID NO: 44. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 45 and the light chain variable domain comprises SEQ ID NO: 46. [0070] In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 3; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 7; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 9; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 11; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 17.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 19; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 21; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 25; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 29; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 31.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 33; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 37; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 39; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 43; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 45.
  • the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 4; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 8; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 10; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 12; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 18.
  • the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 20; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 22; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 26; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 30; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 32.
  • the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 34; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 38; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 40; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 44; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 46.
  • the antibody neutralizes a coronavirus.
  • the coronavirus is a SARS-CoV-2 virus.
  • the coronavirus is a SARS-CoV-2 variant strain.
  • the variant strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427.
  • the antibody specifically binds an epitope on the surface of the coronavirus.
  • the epitope comprises at least a portion of a coronavirus spike protein.
  • the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein.
  • the at least a portion of a coronavirus spike protein comprises a N-Terminal domain (NTD) of a spike protein.
  • the coronavirus is a SARS-CoV-2 coronavirus.
  • the composition is administered in combination with a second therapeutic agent.
  • the invention provides a bispecific molecule comprising a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain.
  • the first polypeptide chain and the second polypeptide chain are covalently bonded to one another.
  • the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 51, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 55, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 67, a polypeptide
  • the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 52, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 56, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 68; a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 53, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 57, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 69, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%
  • the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 54, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 58, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 70, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 8
  • variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 8
  • variable domain of the first heavy chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 51; the CDR1, CDR2, and CDR3 of SEQ ID NO: 55; the CDR1, CDR2, and CDR3 of SEQ ID NO: 67; the CDR1, CDR2, and CDR3 of SEQ ID NO: 71; the CDR1, CDR2, and CDR3 of SEQ ID NO: 75; the CDR1, CDR2, and CDR3 of SEQ ID NO: 79; the CDR1, CDR2, and CDR3 of SEQ ID NO: 83; the CDR1, CDR2, and CDR3 of SEQ ID NO: 87; the CDR1, CDR2, and CDR3 of SEQ ID NO: 91; the CDR1, CDR2, and CDR3 of SEQ ID NO: 95; the CDR1, CDR2, and CDR3 of SEQ ID NO: 99; the CDR1, CDR2, and CDR3 of SEQ ID NO: 103; the CDR1, CDR2, and CDR3
  • variable domain of the first light chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 52; the CDR1, CDR2, and CDR3 of SEQ ID NO: 56; the CDR1, CDR2, and CDR3 of SEQ ID NO: 68; the CDR1, CDR2, and CDR3 of SEQ ID NO: 72; the CDR1, CDR2, and CDR3 of SEQ ID NO: 76; the CDR1, CDR2, and CDR3 of SEQ ID NO: 80; the CDR1, CDR2, and CDR3 of SEQ ID NO: 84; the CDR1, CDR2, and CDR3 of SEQ ID NO: 88; the CDR1, CDR2, and CDR3 of SEQ ID NO: 92; the CDR1, CDR2, and CDR3 of SEQ ID NO: 96; the CDR1, CDR2, and CDR3 of SEQ ID NO: 100; the CDR1, CDR2, and CDR3 of SEQ ID NO: 104; the CDR1, CDR2, and CDR3
  • variable domain of the second heavy chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 53; the CDR1, CDR2, and CDR3 of SEQ ID NO: 57; the CDR1, CDR2, and CDR3 of SEQ ID NO: 69; the CDR1, CDR2, and CDR3 of SEQ ID NO: 73; the CDR1, CDR2, and CDR3 of SEQ ID NO: 77; the CDR1, CDR2, and CDR3 of SEQ ID NO: 81; the CDR1, CDR2, and CDR3 of SEQ ID NO: 85; the CDR1, CDR2, and CDR3 of SEQ ID NO: 89; the CDR1, CDR2, and CDR3 of SEQ ID NO: 93; the CDR1, CDR2, and CDR3 of SEQ ID NO: 97; the CDR1, CDR2, and CDR3 of SEQ ID NO: 101; the CDR1, CDR2, and CDR3 of SEQ ID NO: 105;
  • variable domain of the second light chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 54; the CDR1, CDR2, and CDR3 of SEQ ID NO: 58; the CDR1, CDR2, and CDR3 of SEQ ID NO: 70; the CDR1, CDR2, and CDR3 of SEQ ID NO: 74; the CDR1, CDR2, and CDR3 of SEQ ID NO: 78; the CDR1, CDR2, and CDR3 of SEQ ID NO: 82; the CDR1, CDR2, and CDR3 of SEQ ID NO: 86; the CDR1, CDR2, and CDR3 of SEQ ID NO: 90; the CDR1, CDR2, and CDR3 of SEQ ID NO: 94; the CDR1, CDR2, and CDR3 of SEQ ID NO: 98; the CDR1, CDR2, and CDR3 of SEQ ID NO: 102; the CDR1, CDR2, and CDR3 of SEQ ID NO: 106;
  • the molecule comprises SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, and SEQ ID NO: 54. In some embodiments, the molecule comprises SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 57, and SEQ ID NO: 58. In some embodiments, the molecule comprises SEQ ID NO: 67, SEQ ID NO: 68, SEQ ID NO: 69, and SEQ ID NO: 70. In some embodiments, the molecule comprises SEQ ID NO: 71, SEQ ID NO: 72, SEQ ID NO: 73, and SEQ ID NO: 74.
  • the molecule comprises SEQ ID NO: 75, SEQ ID NO: 76, SEQ ID NO: 77, and SEQ ID NO: 78. In some embodiments, the molecule comprises SEQ ID NO: 79, SEQ ID NO: 80, SEQ ID NO: 81, and SEQ ID NO: 82. In some embodiments, the molecule comprises SEQ ID NO: 83, SEQ ID NO: 84, SEQ ID NO: 85, and SEQ ID NO: 86. In some embodiments, the molecule comprises SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, and SEQ ID NO: 90.
  • the molecule comprises SEQ ID NO: 91, SEQ ID NO: 92, SEQ ID NO: 93, and SEQ ID NO: 94. In some embodiments, the molecule comprises SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, and SEQ ID NO: 98. In some embodiments, the molecule comprises SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, and SEQ ID NO: 102. In some embodiments, the molecule comprises SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, and SEQ ID NO: 106.
  • the molecule comprises SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, and SEQ ID NO: 110. In some embodiments, the molecule comprises SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117, and SEQ ID NO: 118. In some embodiments, the molecule comprises SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, and SEQ ID NO: 122. [0087] In some embodiments, the molecule comprises SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, and SEQ ID NO: 126.
  • the molecule comprises SEQ ID NO: 127, SEQ ID NO: 128, SEQ ID NO: 129, and SEQ ID NO: 130. In some embodiments, the molecule comprises SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, and SEQ ID NO: 133. In some embodiments, the molecule comprises SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, and SEQ ID NO: 142. In some embodiments, the molecule comprises SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145, and SEQ ID NO: 146.
  • the molecule comprises SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, and SEQ ID NO: 150. In some embodiments, the molecule comprises SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, and SEQ ID NO: 154. In some embodiments, the molecule comprises SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, and SEQ ID NO: 158. In some embodiments, the molecule comprises SEQ ID NO: 159, SEQ ID NO: 160, SEQ ID NO: 161, and SEQ ID NO: 162.
  • the molecule comprises SEQ ID NO: 163, SEQ ID NO: 164, SEQ ID NO: 165, and SEQ ID NO: 166. In some embodiments, the molecule comprises SEQ ID NO: 167, SEQ ID NO: 168, SEQ ID NO: 169, and SEQ ID NO: 170. In some embodiments, the molecule comprises SEQ ID NO: 171, SEQ ID NO: 172, SEQ ID NO: 173, and SEQ ID NO: 174. In some embodiments, the molecule comprises SEQ ID NO: 175, SEQ ID NO: 176, SEQ ID NO: 177, and SEQ ID NO: 178.
  • the molecule comprises SEQ ID NO: 179, SEQ ID NO: 180, SEQ ID NO: 181, and SEQ ID NO: 182. In some embodiments, the molecule comprises SEQ ID NO: 183, SEQ ID NO: 184, SEQ ID NO: 185, and SEQ ID NO: 186. [0088] In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus.
  • the SARS- CoV-2 virus strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427.
  • the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle.
  • the first epitope comprises at least a portion of a receptor binding domain (RBD) on a spike protein of a SARS-CoV-2 particle.
  • the second epitope comprises at least a portion of a N- terminal domain (NTD) on a spike protein of a SARS-CoV-2 particle.
  • the invention provides a method of treating or preventing a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a composition comprising a bispecific molecule comprising a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain.
  • the first polypeptide chain and the second polypeptide chain are covalently bonded to one another.
  • the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 51, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 55, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 67, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 52, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 56, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 68; a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 53, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 57, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 69, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%
  • the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 54, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 58, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 70, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 8
  • variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 8
  • variable domain of the first heavy chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 51; the CDR1, CDR2, and CDR3 of SEQ ID NO: 55; the CDR1, CDR2, and CDR3 of SEQ ID NO: 67; the CDR1, CDR2, and CDR3 of SEQ ID NO: 71; the CDR1, CDR2, and CDR3 of SEQ ID NO: 75; the CDR1, CDR2, and CDR3 of SEQ ID NO: 79; the CDR1, CDR2, and CDR3 of SEQ ID NO: 83; the CDR1, CDR2, and CDR3 of SEQ ID NO: 87; the CDR1, CDR2, and CDR3 of SEQ ID NO: 91; the CDR1, CDR2, and CDR3 of SEQ ID NO: 95; the CDR1, CDR2, and CDR3 of SEQ ID NO: 99; the CDR1, CDR2, and CDR3 of SEQ ID NO: 103; the CDR1, CDR2, and CDR3
  • variable domain of the first light chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 52; the CDR1, CDR2, and CDR3 of SEQ ID NO: 56; the CDR1, CDR2, and CDR3 of SEQ ID NO: 68; the CDR1, CDR2, and CDR3 of SEQ ID NO: 72; the CDR1, CDR2, and CDR3 of SEQ ID NO: 76; the CDR1, CDR2, and CDR3 of SEQ ID NO: 80; the CDR1, CDR2, and CDR3 of SEQ ID NO: 84; the CDR1, CDR2, and CDR3 of SEQ ID NO: 88; the CDR1, CDR2, and CDR3 of SEQ ID NO: 92; the CDR1, CDR2, and CDR3 of SEQ ID NO: 96; the CDR1, CDR2, and CDR3 of SEQ ID NO: 100; the CDR1, CDR2, and CDR3 of SEQ ID NO: 104; the CDR1, CDR2, and CDR3
  • variable domain of the second heavy chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 53; the CDR1, CDR2, and CDR3 of SEQ ID NO: 57; the CDR1, CDR2, and CDR3 of SEQ ID NO: 69; the CDR1, CDR2, and CDR3 of SEQ ID NO: 73; the CDR1, CDR2, and CDR3 of SEQ ID NO: 77; the CDR1, CDR2, and CDR3 of SEQ ID NO: 81; the CDR1, CDR2, and CDR3 of SEQ ID NO: 85; the CDR1, CDR2, and CDR3 of SEQ ID NO: 89; the CDR1, CDR2, and CDR3 of SEQ ID NO: 93; the CDR1, CDR2, and CDR3 of SEQ ID NO: 97; the CDR1, CDR2, and CDR3 of SEQ ID NO: 101; the CDR1, CDR2, and CDR3 of SEQ ID NO: 105;
  • variable domain of the second light chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 54; the CDR1, CDR2, and CDR3 of SEQ ID NO: 58; the CDR1, CDR2, and CDR3 of SEQ ID NO: 70; the CDR1, CDR2, and CDR3 of SEQ ID NO: 74; the CDR1, CDR2, and CDR3 of SEQ ID NO: 78; the CDR1, CDR2, and CDR3 of SEQ ID NO: 82; the CDR1, CDR2, and CDR3 of SEQ ID NO: 86; the CDR1, CDR2, and CDR3 of SEQ ID NO: 90; the CDR1, CDR2, and CDR3 of SEQ ID NO: 94; the CDR1, CDR2, and CDR3 of SEQ ID NO: 98; the CDR1, CDR2, and CDR3 of SEQ ID NO: 102; the CDR1, CDR2, and CDR3 of SEQ ID NO: 106;
  • the molecule comprises SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, and SEQ ID NO: 54. In some embodiments, the molecule comprises SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 57, and SEQ ID NO: 58. In some embodiments, the molecule comprises SEQ ID NO: 67, SEQ ID NO: 68, SEQ ID NO: 69, and SEQ ID NO: 70. In some embodiments, the molecule comprises SEQ ID NO: 71, SEQ ID NO: 72, SEQ ID NO: 73, and SEQ ID NO: 74.
  • the molecule comprises SEQ ID NO: 75, SEQ ID NO: 76, SEQ ID NO: 77, and SEQ ID NO: 78. In some embodiments, the molecule comprises SEQ ID NO: 79, SEQ ID NO: 80, SEQ ID NO: 81, and SEQ ID NO: 82. In some embodiments, the molecule comprises SEQ ID NO: 83, SEQ ID NO: 84, SEQ ID NO: 85, and SEQ ID NO: 86. In some embodiments, the molecule comprises SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, and SEQ ID NO: 90.
  • the molecule comprises SEQ ID NO: 91, SEQ ID NO: 92, SEQ ID NO: 93, and SEQ ID NO: 94. In some embodiments, the molecule comprises SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, and SEQ ID NO: 98. In some embodiments, the molecule comprises SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, and SEQ ID NO: 102. In some embodiments, the molecule comprises SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, and SEQ ID NO: 106.
  • the molecule comprises SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, and SEQ ID NO: 110. In some embodiments, the molecule comprises SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117, and SEQ ID NO: 118. [0104] In some embodiments, the molecule comprises SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, and SEQ ID NO: 122. In some embodiments, the molecule comprises SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, and SEQ ID NO: 126.
  • the molecule comprises SEQ ID NO: 127, SEQ ID NO: 128, SEQ ID NO: 129, and SEQ ID NO: 130. In some embodiments, the molecule comprises SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, and SEQ ID NO: 133. In some embodiments, the molecule comprises SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, and SEQ ID NO: 142. In some embodiments, the molecule comprises SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145, and SEQ ID NO: 146.
  • the molecule comprises SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, and SEQ ID NO: 150. In some embodiments, the molecule comprises SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, and SEQ ID NO: 154. In some embodiments, the molecule comprises SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, and SEQ ID NO: 158. In some embodiments, the molecule comprises SEQ ID NO: 159, SEQ ID NO: 160, SEQ ID NO: 161, and SEQ ID NO: 162.
  • the molecule comprises SEQ ID NO: 163, SEQ ID NO: 164, SEQ ID NO: 165, and SEQ ID NO: 166. In some embodiments, the molecule comprises SEQ ID NO: 167, SEQ ID NO: 168, SEQ ID NO: 169, and SEQ ID NO: 170. In some embodiments, the molecule comprises SEQ ID NO: 171, SEQ ID NO: 172, SEQ ID NO: 173, and SEQ ID NO: 174. In some embodiments, the molecule comprises SEQ ID NO: 175, SEQ ID NO: 176, SEQ ID NO: 177, and SEQ ID NO: 178.
  • the molecule comprises SEQ ID NO: 179, SEQ ID NO: 180, SEQ ID NO: 181, and SEQ ID NO: 182. In some embodiments, the molecule comprises SEQ ID NO: 183, SEQ ID NO: 184, SEQ ID NO: 185, and SEQ ID NO: 186. [0105] In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus.
  • the SARS- CoV-2 virus strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427.
  • the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle.
  • the first epitope comprises at least a portion of a receptor binding domain (RBD) on a spike protein of a SARS-CoV-2 particle.
  • the second epitope comprises at least a portion of a N-terminal domain (NTD) on a spike protein of a SARS-CoV-2 particle.
  • the composition is administered in combination with a second therapeutic agent.
  • the invention provides a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable domain and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 41.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 1.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 23.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 42.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 2.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 24.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 41 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 42.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 1 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 2.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 23 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 24.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28.
  • the heavy chain variable domain comprises SEQ ID NO: 5 and the light chain variable domain comprises SEQ ID NO: 6.
  • the heavy chain variable domain comprises SEQ ID NO: 41 and the light chain variable domain comprises SEQ ID NO: 42. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 35 and the light chain variable domain comprises SEQ ID NO: 36. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 1 and the light chain variable domain comprises SEQ ID NO: 2. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 23 and the light chain variable domain comprises SEQ ID NO: 24. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 13 and the light chain variable domain comprises SEQ ID NO: 14. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 27 and the light chain variable domain comprises SEQ ID NO: 28.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 5. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 41. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 1. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 23. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 13. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 27.
  • the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 6. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 42. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 36. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 2. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 24. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 14.
  • the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 28.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 5 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 6.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 41 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 42.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 35 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 36. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 1 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 2. [0113] In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 23 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 24.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 13 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 14. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 27 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 28.
  • the antibody neutralizes a coronavirus.
  • the coronavirus is a SARS-CoV-2 virus. In some embodiments, the coronavirus is a SARS-CoV-2 variant strain.
  • the variant strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427.
  • the antibody specifically binds an epitope on the surface of the coronavirus.
  • the epitope comprises at least a portion of a coronavirus spike protein.
  • the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein.
  • the at least a portion of a coronavirus spike protein comprises a N-Terminal domain (NTD) of a spike protein.
  • the coronavirus is a SARS-CoV-2 coronavirus.
  • the invention provides a method of treating or preventing a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable domain and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 41.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 1.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 23.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 42.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 2.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 24.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 41 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 42.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 1 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 2.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 23 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 24.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28.
  • the heavy chain variable domain comprises SEQ ID NO: 5 and the light chain variable domain comprises SEQ ID NO: 6.
  • the heavy chain variable domain comprises SEQ ID NO: 41 and the light chain variable domain comprises SEQ ID NO: 42. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 35 and the light chain variable domain comprises SEQ ID NO: 36. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 1 and the light chain variable domain comprises SEQ ID NO: 2. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 23 and the light chain variable domain comprises SEQ ID NO: 24. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 13 and the light chain variable domain comprises SEQ ID NO: 14. [0121] In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 27 and the light chain variable domain comprises SEQ ID NO: 28.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 5. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 41. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 1. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 23. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 13. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 27.
  • the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 6. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 42. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 36. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 2. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 24. [0122] In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 14.
  • the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 28.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 5 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 6.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 41 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 42.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 35 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 36. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 1 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 2. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 23 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 24.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 13 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 14. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 27 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 28.
  • the antibody neutralizes a coronavirus.
  • the coronavirus is a SARS-CoV-2 virus. In some embodiments, the coronavirus is a SARS-CoV-2 variant strain.
  • the variant strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427.
  • the antibody specifically binds an epitope on the surface of the coronavirus.
  • the epitope comprises at least a portion of a coronavirus spike protein.
  • the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein.
  • the at least a portion of a coronavirus spike protein comprises a N-Terminal domain (NTD) of a spike protein.
  • the coronavirus is a SARS-CoV-2 coronavirus.
  • the antibody is administered in combination with a second pharmaceutical agent.
  • the invention provides a bispecific molecule comprising a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain.
  • the first polypeptide chain and the second polypeptide chain are covalently bonded to one another.
  • the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 47, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 111, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 135, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 48, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 112, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 136, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 49, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 113, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 137, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%
  • the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 50, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 114, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 138, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%
  • variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13.
  • variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14.
  • variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 45, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 43.
  • variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 46, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 44.
  • variable domain of the first heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 47; CDR1, CDR2, and CDR3 of SEQ ID NO: 111; CDR1, CDR2, and CDR3 of SEQ ID NO: 135; CDR1, CDR2, and CDR3 of SEQ ID NO: 187; or CDR1, CDR2, and CDR3 of SEQ ID NO: 211.
  • variable domain of the first light chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 48, CDR1, CDR2, and CDR3 of SEQ ID NO: 112; CDR1, CDR2, and CDR3 of SEQ ID NO: 136; CDR1, CDR2, and CDR3 of SEQ ID NO: 188; or CDR1, CDR2, and CDR3 of SEQ ID NO: 212.
  • variable domain of the second heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 49, CDR1, CDR2, and CDR3 of SEQ ID NO: 113; CDR1, CDR2, and CDR3 of SEQ ID NO: 137; CDR1, CDR2, and CDR3 of SEQ ID NO: 189; or CDR1, CDR2, and CDR3 of SEQ ID NO: 213.
  • variable domain of the second light chain comprises CDR1, CDR2, and CDR3 SEQ ID NO: 50, CDR1, CDR2, and CDR3 of SEQ ID NO: 114; CDR1, CDR2, and CDR3 of SEQ ID NO: 138; CDR1, CDR2, and CDR3 of SEQ ID NO: 190; or CDR1, CDR2, and CDR3 of SEQ ID NO: 214.
  • the molecule comprises SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, and SEQ ID NO: 50.
  • the molecule comprises SEQ ID NO:111, SEQ ID NO: 112, SEQ ID NO: 113, and SEQ ID NO: 114.
  • the molecule comprises SEQ ID NO: 135, SEQ ID NO: 135, SEQ ID NO: 137, and SEQ ID NO: 138. In some embodiments, the molecule comprises SEQ ID NO: 187, SEQ ID NO: 188, SEQ ID NO: 189, and SEQ ID NO: 190. In some embodiments, the molecule comprises SEQ ID NO: 211, SEQ ID NO: 212, SEQ ID NO: 213, and SEQ ID NO: 214. [0130] In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus.
  • the coronavirus is a SARS-CoV-2 virus.
  • the SARS- CoV-2 virus strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427.
  • the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle.
  • the first epitope comprises at least a portion of a receptor binding domain (RBD) on a spike protein of a SARS-CoV-2 particle.
  • the second epitope comprises at least a portion of a N-terminal domain (NTD) on a spike protein of a SARS-CoV-2 particle.
  • the invention provides a method of treating or preventing a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a composition comprising a bispecific molecule comprising a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain.
  • the first polypeptide chain and the second polypeptide chain are covalently bonded to one another.
  • the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 47, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 111, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 135, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 48, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 112, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 136, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 49, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 113, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 137, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%
  • the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 50, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 114, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 138, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%
  • variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13.
  • variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14.
  • variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 45, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 43.
  • variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 46, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 44.
  • variable domain of the first heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 47; CDR1, CDR2, and CDR3 of SEQ ID NO: 111; CDR1, CDR2, and CDR3 of SEQ ID NO: 135; CDR1, CDR2, and CDR3 of SEQ ID NO: 187; or CDR1, CDR2, and CDR3 of SEQ ID NO: 211.
  • variable domain of the first light chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 48, CDR1, CDR2, and CDR3 of SEQ ID NO: 112; CDR1, CDR2, and CDR3 of SEQ ID NO: 136; CDR1, CDR2, and CDR3 of SEQ ID NO: 188; or CDR1, CDR2, and CDR3 of SEQ ID NO: 212.
  • variable domain of the second heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 49, CDR1, CDR2, and CDR3 of SEQ ID NO: 113; CDR1, CDR2, and CDR3 of SEQ ID NO: 137; CDR1, CDR2, and CDR3 of SEQ ID NO: 189; or CDR1, CDR2, and CDR3 of SEQ ID NO: 213.
  • variable domain of the second light chain comprises CDR1, CDR2, and CDR3 SEQ ID NO: 50, CDR1, CDR2, and CDR3 of SEQ ID NO: 114; CDR1, CDR2, and CDR3 of SEQ ID NO: 138; CDR1, CDR2, and CDR3 of SEQ ID NO: 190; or CDR1, CDR2, and CDR3 of SEQ ID NO: 214.
  • the molecule comprises SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, and SEQ ID NO: 50.
  • the molecule comprises SEQ ID NO:111, SEQ ID NO: 112, SEQ ID NO: 113, and SEQ ID NO: 114.
  • the molecule comprises SEQ ID NO: 135, SEQ ID NO: 135, SEQ ID NO: 137, and SEQ ID NO: 138. In some embodiments, the molecule comprises SEQ ID NO: 187, SEQ ID NO: 188, SEQ ID NO: 189, and SEQ ID NO: 190. In some embodiments, the molecule comprises SEQ ID NO: 211, SEQ ID NO: 212, SEQ ID NO: 213, and SEQ ID NO: 214. [0139] In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus.
  • the coronavirus is a SARS-CoV-2 virus.
  • the SARS- CoV-2 virus strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427.
  • the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle.
  • the first epitope comprises at least a portion of a receptor binding domain (RBD) on a spike protein of a SARS-CoV-2 particle.
  • RBD receptor binding domain
  • the second epitope comprises at least a portion of a N- terminal domain (NTD) on a spike protein of a SARS-CoV-2 particle.
  • the composition is administered in combination with a second therapeutic agent.
  • NTD N- terminal domain
  • FIGS.1A-C show images of coronavirus.
  • FIG.1A shows a SARS-CoV-2 viral shows an electronic micrograph of coronavirus particles. The arrow denotes the viral spike protein on the viral membrane.
  • FIGS.2A-G show individual antibody responses to SARS-CoV-2 virus.
  • FIGS. 2A-F shows ELISA binding assays in which various COVID-19 patient plasma samples (indicated by different colored lines) were tested for their ability to bind to SARS-CoV-2 nucleocapsid antigen (FIGS.2A and D), SARS-CoV-2 envelope trimer antigen ( Figures 2B and E), and SARS-CoV envelope trimer antigen (FIGS.2C and F).
  • FIGS.2A-C show responses for patients with severe disease.
  • FIGS.2D-F show responses for patients with non-severe disease.
  • FIG.2G shows that a higher SARS-CoV-2 antibody responses are present in plasma samples of patients with severe COVID-19 as compared to patients with non-severe COVID-19.
  • FIGS.3A-J show antibody responses that neutralize SARS-CoV-2 potently.
  • FIGS.3A-F show individual neutralization assays for patients with severe disease (FIGS. 3A-C) and patients with non-severe disease (FIGS.3D-F).
  • FIGS.3A and D show neutralization of SARS-CoV-2 pseudovirus.
  • FIGS.3B and E show neutralization of SARS- CoV pseudovirus.
  • FIGS.3C and F show neutralization of SARS-CoV-2 live virus.
  • FIG.3G shows a plot of the infective dose (ID50), or the estimated number of virus particles required to produce a 50% infection, obtained from FIGS.3A-F.
  • FIGS.3H-J show correlation of the IC 50 values obtained by pseudovirus neutralization assays with live virus neutralization IC50 (FIG.3H), half-maximal plasma dilution (FIG.3I), and 1:400 OD450 (FIG.3J).
  • FIGS.4A-C show schematics for identifying potent neutralizing antibodies against COVID-19.
  • FIG.4A shows a schematic of producing potent neutralizing antibodies.
  • FIG.4B shows memory B cells sorted from a healthy individual and a COVID-19 patient.
  • FIG.4C shows a table of seven patient donors and the number of antibodies isolated from each donor.
  • FIGS.5A-D show binding and neutralization assays of mAbs against the SARS- CoV-2 virus.
  • FIG.5A shows a binding assay of synthesized antibodies with the SARS-CoV- 2 spike protein trimer.
  • FIG.5B shows a binding assay of synthesized antibodies with the SARS-CoV-2 receptor binding domain.
  • FIG.5C shows neutralization assay of synthesized antibodies with SARS-CoV-2 pseudovirus.
  • FIG.5D shows neutralization assay of synthesized antibodies with SARS-CoV-2 live virus.
  • FIGS.6A-F show epitope mapping of SARS-CoV-2 specific monoclonal antibodies by competition ELISA assay.
  • FIGS.6A-C show individual synthesized mAbs binding affinity to the receptor-binding domain (RBD), with antibody numbers 2-4, 2-15, and 2-38 specifically binding to the RBD.
  • FIGS.6D-F show individual synthesized mAbs binding affinity to the receptor-binding domain (RBD), with antibody numbers 2-51, 4-8, and 4-32 showing no binding affinity to the RBD.
  • FIGS.7A-E show surface plasmon resonance (SPR) assay for mAb binding to the spike protein trimers.
  • SPR surface plasmon resonance
  • FIG.7A shows mAb 2-4.
  • FIG.7B shows mAb 2-15.
  • FIG.7C shows mAb 2-38.
  • FIG.7D shows mAb 2-51.
  • FIG.7E shows mAb 4-8.
  • FIGS.8A-D show initial screenings of mAbs that bind and neutralize the SARS- CoV-2 virus.
  • FIG.8A shows mAbs binding to spike trimer protein.
  • FIG.8B shows mAbs binding to the receptor-binding domain (RBD).
  • FIG.8C shows IC 50 values for pseudotyped virus infection.
  • FIG.8D shows per cent inhibition values for live virus infection.
  • FIG.9 shows a summary of the SARS-CoV-2-specific mAb screening. Number of most potent neutralizing mAbs: 17.
  • FIGS.10A-I show binding of potent neutralizing mAbs to spike protein trimer, RBD and N-terminal domain (NTD).
  • FIGS.10A, D, and G show binding to spike protein trimer.
  • FIGS.10B, E, and H show binding to the RBD.
  • FIGS.10C, F, and I show binding to the NTD.
  • FIGS.10A-C show binding of mAbs, which potently bind the RBD.
  • FIGS.10A-C show binding of mAbs, which potently bind the RBD.
  • FIGS. 10D-F show binding of mAbs, which potently bind the NTD.
  • FIGS.10G-I show binding of mAb, which bind epitopes other than the RBD or the NTD.
  • FIGS.11A-F show SARS-CoV-2 neutralization activity of select mAbs.
  • FIG. 11A shows neutralization activity of RBD-targeting mAbs neutralizing a pseudovirus infection.
  • FIG.11B shows neutralization activity of NTD-targeting mAbs neutralizing a pseudovirus infection.
  • FIG.11C shows neutralization activity of mAbs, which target epitopes other than the RBD or the NTD, neutralizing a pseudovirus infection.
  • FIG.11D shows neutralization activity of RBD-targeting mAbs neutralizing a live virus infection.
  • FIG. 11E shows neutralization activity of NTD-targeting mAbs neutralizing a live virus infection.
  • FIG.11F shows neutralization activity of mAbs, which target epitopes other than the RBD or the NTD, neutralizing a live virus infection.
  • FIGS.12A-B show a CryoEM structure of an RBD-targeting monoclonal antibody.
  • FIG.12A shows a side view of the mAb.
  • FIG.12B shows a top view of the mAb.
  • FIGS.13A-B show a CryoEM structure of an NTD-targeting monoclonal antibody.
  • FIG.13A shows a side view of the mAb.
  • FIG.13B shows a top view of the mAb.
  • FIG.14 shows three SARS-CoV-2 neutralizing epitope clusters identified on the spike protein trimer.
  • FIGS.15A-E show isolation of SARS-CoV-2 mAbs from infected patients with severe disease.
  • FIG.15A shows plasma neutralization profile of 40 patients against SARS- CoV-2 pseudovirus (highlighted are 5 top neutralizers chosen). All 252 transfection supernatants were screened for binding to S trimer and RBD, as well as for neutralization against SARS-CoV-2 pseudovirus and live virus.
  • FIGS.16A-O show characterization of SARS-CoV-2 potent neutralizing mAbs.
  • FIGS.16A, D, and G show binding profiles of 19 purified potent neutralizing mAbs against SARS-CoV-2 S trimer (left).
  • FIGS.16B, E, and H show binding profiles of 19 purified potent neutralizing mAbs against SARS-CoV-2 RBD (middle).
  • FIGS.16C, F, and I show binding profiles of 19 purified potent neutralizing mAbs against SARS-CoV-2 NTD (right). Note that mAb 2-30 bound multiple proteins at high concentrations.
  • FIG.16J shows pseudovirus neutralization against SARS-CoV-2 RBD.
  • FIG.16K shows pseudovirus neutralization against SARS-CoV-2 NTD.
  • FIG.16L shows pseudovirus neutralization against other epitopes on the SARS-CoV-2 virion.
  • FIG.16M shows live virus neutralization against SARS-CoV-2 RBD.
  • FIG.16N shows live virus neutralization against SARS-CoV-2 NTD.
  • FIG.16O shows live virus neutralization against other epitopes on the SARS-CoV-2 virion.
  • the neutralization profiles are for the 19 purified mAbs. Single replicate of the binding experiment and triplicates of neutralization are presented as mean ⁇ SEM.
  • FIGS.17A-D show epitope mapping of select neutralizing and non-neutralizing mAbs.
  • FIG.17A shows a Venn diagram interpretation of results from FIG.17B.
  • FIG. 17D shows a Venn diagram interpretation of results from FIG.17B.
  • FIGS 18A-D show Cryo-EM reconstructions of Fab-spike complexes and visualization of neutralizing epitopes on the spike surface.
  • FIG.18A shows a Cryo-EM 3D reconstruction of antibody 2-4 in complex with S trimer at 3.2 ⁇ overall resolution. Density is colored according to spike domain with RBD in green, NTD in orange, with other regions colored grey.
  • FIG.18B shows a Cryo-EM reconstruction of antibody 4-8 in complex with S trimer (ribbon diagram, colored as in a) at 3.9 ⁇ overall resolution, with RBDs in the “all- down” configuration. The resolution of antibody density is limited by molecular motion.
  • FIG.18C shows a Cryo-EM reconstruction of the antibody 2- 43 in complex with S trimer at 7.8 ⁇ resolution reveals a quaternary epitope involving RBD from one subunit and NTD from the next.
  • FIG.18D shows mapping of the Venn diagrams from FIG.17B onto the surface of the viral spike.
  • FIG.19 shows Patient information.
  • FIG.20 shows summary of mAb screening.
  • FIG.21 shows Cryo-EM data collection, refinement, and validation statistics.
  • FIGS.22A-C show SARS-CoV-2 S trimer-specific antibody isolation strategy.
  • FIG 22A shows a schema for isolating of S trimer-specific mAbs from memory B cells in the blood of infected patients.
  • FIG.22B shows sorting results on the isolation of S trimer- specific memory B cells using flow cytometry.
  • FIG.22C shows magnified representation of the panel of S trimer-positive memory B cells for each patient. Inset numbers indicate the absolute number and the percentage of S trimer-specific memory B cells isolated from each case.
  • FIGS.23A-G show Genetic features of SARS-CoV-2-specific antibody repertoire.
  • FIG.23A shows that most of the 121 trimer S-specific antibodies are of IgG isotype.
  • FIG.23B shows the heavy chains The kappa (FIG.23C) and lambda (FIG.23D) light chains are comparably used.
  • IGHV3-30 and IGKV3-20 genes are over-represented in heavy and light chain repertoires, respectively (ß2-test, p ⁇ 0.05).
  • FIG.23E shows that the usage of IGHJ6 gene was significantly higher in antigen-specific antibodies (ß2-test, p ⁇ 0.05).
  • FIG.23G shows that for both heavy and light chains, the V region nucleotide somatic hypermutation levels are significantly lower than in antibodies of healthy donors (Kolmogorov–Smirnov test, p ⁇ 0.001).
  • FIG.24 shows The best-fit pseudovirus neutralization curves for 130 samples that were positive in at least one of the screens shown in FIGS.15B-E. The 18 transfection supernatants that showed evidently better potency are highlighted in colors, while others with non-neutralizing or weakly neutralizing activities are shown in grey. One additional supernatant (Patient 1) that was initially missed in the pseudovirus screen but later found to be a potent neutralizing mAb (1-87) is also highlighted.
  • FIG.25 shows The pseudovirus neutralization profiles for 12 purified mAbs that strongly bound the S trimer but with weak or no virus-neutralizing activities. The four mAbs with weak neutralizing activities against SARS-CoV-2 pseudovirus are shown in sold lines, and the remaining 8 non-neutralizing mAbs are shown in dashed lines.
  • FIGS.26A-C shows monoclonal Ab 2-43 bound to S trimer expressed on Expi293 cell surface can be competed out by mAbs directed to RBD but only minimally by mAbs to the NTD region.
  • FIG.26A shows results for 2-43 and proteins.
  • FIG.26B shows results for NTD-directed mAbs.
  • FIG.26C shows results for RBD-directed mAbs.
  • FIGS.27A-F show Cryo-EM data processing for antibody 2-4 in complex with the S trimer.
  • FIG.27A shows a representative micrograph and CTF of the micrograph.
  • FIG. 27B shows a representative 2D class averages.
  • FIG.27C shows a resolution of the consensus map with C3 symmetry as calculated by 3DFSC.
  • FIG 27D shows the local resolution of the full map as calculated by cryoSPARC at an FSC cutoff of 0.5.
  • FIGS.28A-E show Fab 2-4 binding.
  • FIG.28A shows Fab 2-4 binding interface with RBD.
  • FIG.28B shows positions of antibodies 2-4, S309 8 , and BD-23 9 on the trimeric CoV-2 spike.
  • FIG 28C shows somatic hypermutations found only in the antibody 2-4 heavy chain, shown in brown. The mutation A60T creates an NxT sequence leading to N58 glycosylation.
  • FIG.28D shows antibody 2-4 in complex with S trimer. CDR loops are indicated in colors, 751 and side chains are shown for interacting residues.
  • FIG.28E shows antibody BD-23 9 in complex with S trimer.
  • FIGS.29A-F show Cryo-EM data processing for antibody 4-8 in complex with the S trimer.
  • FIG 29A shows a representative micrograph and CTF of the micrograph.
  • FIG. 29B shows a representative 2D class averages.
  • FIG.29C shows resolution of the spike in the RBD down conformation in complex with Fab 4-8.
  • FIG.29D shows resolution of the spike in the RBD up conformation in complex with Fab 4-8.
  • FIG.29E shows local resolution of the spike in the RBD down conformation in complex with Fab 4-8 at an FSC cutoff of 0.5. Two thresholds are shown.
  • FIG.29F shows local resolution of the spike in the RBD up conformation in complex with Fab 4-8 at an FSC cutoff of 0.5. Two thresholds are shown.
  • FIG.30 shows 3D reconstructions of NTD-targeting neutralizing antibody 4-8 in complex with the SARS-CoV-2 spike trimer with the 1-RBD-up conformation.
  • FIGS.31A-D show Cryo-EM data processing for antibody 2-43 in complex with the S trimer.
  • FIG.31A shows a representative micrograph and CTF of the micrograph.
  • FIG. 31B shows representative 2D class averages.
  • FIG.31C shows resolution of Fab 2-43 in complex with S trimer.
  • FIG.31D shows the local resolution of the full map as calculated by cryoSPARC at an FSC cutoff of 0.5.
  • FIGS.32A-B show monoclonal antibody 2-15mut.
  • FIG.32A shows virus neutralization with the 2-15mut antibody.
  • FIG.32B shows potency of the 2-15mut antibody.
  • FIGS.33A-B show select mutants of the 4-8 monoclonal antibody.
  • FIG.33A shows neutralization with antibodies 4-8 (39/51) and 4-8(39/51/57).
  • FIG.33B shows potency of antibodies 4-8 (39/51) and 4-8(39/51/57).
  • FIG.34 shows IC 50 and IC 90 values of selected monoclonal antibody mutants.
  • FIG.35 shows that antibody 2-36 is a potent neutralizer against SARS-CoV pseudovirus.
  • FIGS.36A-B show ELISA binding of antibody 2-36 to SARS-CoV-2 Spike trimer (FIG.36A) and SARS-CoV Spike trimer (FIG.36B).
  • Antibody CR3022 an antibody previously reported to have cross-activity, served as a control.
  • FIGS.37A-D show the binding affinities of antibody 2-36 and antibody 2-4 to SARS-CoV-2 Spike trimer and to SARS-CoV Spike trimer, as measured by SPR.
  • Antibody 2-36 was confirmed to binds to both SARS-CoV-2 (FIG.37A) and SARS-CoV (FIG.37B) spikes, but with a higher affinity to SARS-CoV-2 spike.
  • FIGS.38A-B show neutralization assay results. Antibody 2-36 neutralized both SARS-CoV-2 (FIG.38A) and SARS-CoV (FIG.38B), as compared to the control antibody CR3022 that neutralized SARS-CoV (FIG.38B) but only very weakly neutralized SARS- CoV-2 (FIG.38A); and as compared to the SARS-CoV-2 specific antibody 2-4 that only neutralize SARS-CoV-2 (FIG.38A).
  • FIGS.39A-B show that antibody 2-36 neutralizes SARS-like coronaviruses using hACE2.
  • FIG.39A shows the lineage of coronavirus, including several from bats and pangolins.
  • FIG.39B shows that antibody 2-36 could neutralize SARS-CoV and SARS-CoV- 2 and their related lineage viruses, but that antibody 2-36 could not neutralize MERS-CoV and 229E, indicating its breadth.
  • FIGS.40A-D show the cryo-EM structure of antibody 2-36 complexed with SARS-CoV-2.
  • FIG.40A shows the cryo-EM structure of 2-36 in complex with SARS-CoV- 2 Spike trimer and FIG.40B further details how 2-36 interacts with spike at the CDR level.
  • FIG.40C shows that antibody 2-36 binds to the side of the RBD and can compete with ACE2 for RBD binding, although its epitope does not overlap the ACE2-binding site.
  • FIG. 40D depicts that the spike protein is highly conserved.
  • FIG.41 shows a schematic representation of an engineered bispecific antibody combining the binding specificity of two neutralizing antibodies into one.
  • FIG.42 shows that the 2-17/1-57 bispecific antibody against SARS-CoV-2 does not enhance potency compared to respective single arm counterpart.
  • FIG.43 shows potent neutralization of bispecific antibody 2-17/2-7 against SARS-CoV-2 compared to respective single arm counterpart. Ab X and Ab Y are single arm irrelevant controls.
  • X PGDM1400 (HIV neutralization Ab).
  • Y A32 (HIV neutralization Ab).
  • FIG.44 shows potent neutralization of bispecific antibody 2-17/2-15 against SARS-CoV-2 compared to respective single arm counterpart. Ab X and Ab Y are single arm irrelevant controls.
  • X PGDM1400 (HIV neutralization Ab).
  • Y A32 (HIV neutralization Ab).
  • FIG.45 shows potent neutralization of bispecific antibody 2-17/2-30 against SARS-CoV-2 compared to respective single arm counterpart.
  • Ab X and Ab Y are single arm irrelevant controls.
  • X PGDM1400 (HIV neutralization Ab).
  • Y A32 (HIV neutralization Ab).
  • FIG.46 shows potent neutralization of bispecific antibody 2-17/4-20 against SARS-CoV-2 compared to respective single arm counterpart.
  • Ab X and Ab Y are single arm irrelevant controls.
  • X PGDM1400 (HIV neutralization Ab).
  • Y A32 (HIV neutralization Ab).
  • FIG.47 shows potent neutralization of bispecific antibody 5-24/1-57 against SARS-CoV-2 compared to respective single arm counterpart.
  • FIG.48 shows potent neutralization of bispecific antibody 5-24/2-15 against SARS-CoV-2 compared to respective single arm counterpart. Ab X and Ab Y are single arm irrelevant controls.
  • FIG.49 shows bispecific antibody 5-24/4-20 against SARS-CoV-2 does not enhance potency (IC50) compared to respective single arm counterpart.
  • Ab X and Ab Y are single arm irrelevant controls.
  • X PGDM1400 (HIV neutralization Ab).
  • FIG.50 shows potent neutralization of bispecific antibody 1-20/1-68 against SARS-CoV-2 compared to respective single arm counterpart.
  • Ab X and Ab Y are single arm irrelevant controls.
  • X PGDM1400 (HIV neutralization Ab).
  • Y A32 (HIV neutralization Ab).
  • FIG.51 shows potent neutralization of bispecific antibody 1-20/2-17 against SARS-CoV-2 compared to respective single arm counterpart.
  • Ab X and Ab Y are single arm irrelevant controls.
  • X PGDM1400 (HIV neutralization Ab).
  • Y A32 (HIV neutralization Ab).
  • FIG.52 shows potent neutralization of bispecific antibody 1-20/4-18 against SARS-CoV-2 compared to respective single arm counterpart.
  • Ab X and Ab Y are single arm irrelevant controls.
  • X PGDM1400 (HIV neutralization Ab).
  • Y A32 (HIV neutralization Ab).
  • FIG.53 shows potent neutralization of bispecific antibody 1-20/5-24 against SARS-CoV-2 compared to respective single arm counterpart.
  • Ab X and Ab Y are single arm irrelevant controls.
  • X PGDM1400 (HIV neutralization Ab).
  • Y A32 (HIV neutralization Ab).
  • FIG.54 shows potent neutralization against SARS-CoV-2.
  • Bispecific antibodies with 2-17 as a component are more potent than the single arm control (2-17/A32, A32 is a control antibody which shows no activity against SARS-CoV-2), indicating both arms are contributing to the neutralization activity of the bispecific molecule.
  • FIG.55 shows potent neutralization against SARS-CoV-2 with bispecific antibodies containing 5-24 as a component. In antibody 5-24/A32, A32 is a control antibody which shows no activity against SARS-CoV-2, indicating both arms are contributing to the neutralization activity of the bispecific molecule.
  • FIG.56 shows potent neutralization against SARS-CoV-2 with bispecific antibodies containing 1-20 as a component.
  • FIGS.57A-E show bispecific antibodies with 1-20 (RBD) as a parental antibody.
  • FIG.57A shows virus neutralization with bispecific antibodies 1-20/5-24, 1-20/4-18, 1-20/2- 17, and 1-20/1-68.
  • FIG.57B shows virus neutralization with the bispecific antibody 1-20/5- 24 compared to control antibodies.
  • FIG.57C shows virus neutralization with the bispecific antibody 1-20/4-18 compared to control antibodies.
  • FIG.57D shows virus neutralization with the bispecific antibody 1-20/2-17 compared to control antibodies.
  • FIG.57E shows virus neutralization with the bispecific antibody 1-20/1-68 compared to control antibodies.
  • FIG.58 shows potencies of bispecific antibodies with 1-20 (RBD) as a parental antibody.
  • FIGS.59A-G show bispecific antibodies with 2-17 (NTD) as a parental antibody.
  • FIG.59A shows virus neutralization with bispecific antibodies 2-17/2-7, 2-17/1-57, 2-36/2- 17, 2-17/4-20, 2-17/2-30, and 2-17/2-15.
  • FIG.59B shows virus neutralization with the bispecific antibody 2-17/2-7 compared to control antibodies.
  • FIG.59C shows virus neutralization with the bispecific antibody 2-17/1-57 compared to control antibodies.
  • FIG.59D shows virus neutralization with the bispecific antibody 2-17/2-15 compared to control antibodies.
  • FIG.59E shows virus neutralization with the bispecific antibody 2-17/4-20 compared to control antibodies.
  • FIG.59F shows virus neutralization with the bispecific antibody 2-17/2-30 compared to control antibodies.
  • FIG.59G shows virus neutralization with the bispecific antibody 2-36/2-17 compared to control antibodies.
  • FIG.60 shows potencies of bispecific antibodies with 2-17 (NTD) as a parental antibody.
  • FIGS.61A-D show bispecific antibodies with 5-24 (NTD) as a parental antibody.
  • FIG.61A shows virus neutralization with bispecific antibodies 5-24/4-20, 5-24/1-57, 5-24/2- 15, and 1-20/5-24.
  • FIG.61B shows virus neutralization with the bispecific antibody 5-24/2- 15 compared to control antibodies.
  • FIG.61C shows virus neutralization with the bispecific antibody 5-24/1-57 compared to control antibodies.
  • FIG.61D shows virus neutralization with the bispecific antibody 5-24/4-20 compared to control antibodies.
  • FIG.62 shows potencies of bispecific antibodies with 5-24 (NTD) as a parental antibody.
  • FIGS.63A-D show bispecific antibodies with 2-36 (RBD) as a parental antibody.
  • FIG.63A shows virus neutralization with bispecific antibodies 2-36/1-68, 2-36/4-18, and 2- 36/2-17.
  • FIG.63B shows virus neutralization with the bispecific antibody 2-36/2-17 compared to control antibodies.
  • FIG.63C shows virus neutralization with the bispecific antibody 2-36/1-68 compared to control antibodies.
  • FIG.63D shows virus neutralization with the bispecific antibody 2-36/4-18 compared to control antibodies.
  • FIG.64 shows potencies of bispecific antibodies with 2-36 (RBD) as a parental antibody.
  • FIGS.65A-C show bispecific antibodies with 2-30 (RBD) as a parental antibody.
  • FIG.65A shows virus neutralization with bispecific antibodies 2-30/4-18 and 2-30/1-68.
  • FIG.65B shows virus neutralization with the bispecific antibody 2-30/1-68 compared to control antibodies.
  • FIG.65C shows virus neutralization with the bispecific antibody 2-30/4- 18 compared to control antibodies.
  • FIG.66 show potencies of bispecific antibodies with 2-30 (RBD) as a parental antibody.
  • FIGS.67A-D show comparative evaluations of bispecific antibody 2-17/2-7.
  • FIG.67A shows the potency of the 2-17/2-7 bispecific antibody to antibodies where one arm resembles the individual parental component of the bispecific antibody while the other arm is an irrelevant control. It also compares the potency of the bispecific antibody to the combination of the two single arm IgG controls.
  • FIG.67B shows virus neutralization with a combination of the parental antibodies and each of the parental antibodies.
  • FIG.67C shows virus neutralization with the bispecific antibody 2-17/2-7 compared to a combination of the parental antibodies.
  • FIG.67D shows potency of combination parental monoclonal antibodies tested each at half of the amount of the corresponding bispecific antibody. As each monoclonal antibody has two identical arms and each bispecific antibody has only one arm for each monoclonal antibody, testing at half of the amount allows for the same concentration of each monoclonal antibody arm to be compared to the bispecific antibody and the monoclonal antibody combination.
  • FIGS.68A-D show comparative evaluations of bispecific antibody 1-20/4-18.
  • FIG.68A compares the potency of the 1-20/4-18 bispecific antibody to an antibody where one arm resembles the individual parental component of the bispecific antibody while the other arm is an irrelevant control. It also compares the potency of the bispecific antibody to the combination of the two single arm IgG controls.
  • FIG.68B shows virus neutralization with a combination of the parental antibodies and each of the parental antibodies.
  • FIG.68C shows virus neutralization with the bispecific antibody 1-20/4-18 compared to a combination of the parental antibodies.
  • FIG.68D shows potency of combination parental monoclonal antibodies tested each at half of the amount of the corresponding bispecific antibody.
  • FIGS.69A-D show comparative evaluations of bispecific antibody 1-20/5-24.
  • FIG.69A compares the potency of the 1-20/5-24 bispecific antibody to an antibody where one arm resembles the individual parental component of the bispecific antibody while the other arm is an irrelevant control. It also compares the potency of the bispecific antibody to the combination of the two single arm IgG controls.
  • FIG.69B shows virus neutralization with a combination of the parental antibodies and each of the parental antibodies.
  • FIG.69C shows virus neutralization with the bispecific antibody 1-20/5-24 compared to a combination of the parental antibodies.
  • FIG.69D shows potency of combination parental monoclonal antibodies tested each at half of the amount of the corresponding bispecific antibody.
  • FIGS.70A-D show comparative evaluations of bispecific antibody 2-17/4-20.
  • FIG.70A compares the potency of the 2-17/4-20 bispecific antibody to an antibody where one arm resembles the individual parental component of the bispecific antibody while the other arm is an irrelevant control. It also compares the potency of the bispecific antibody to the combination of the two single arm IgG controls.
  • FIG.70B shows virus neutralization with a combination of the parental antibodies and each of the parental antibodies.
  • FIG.70C shows virus neutralization with the bispecific antibody 2-17/4-20 compared to a combination of the parental antibodies.
  • FIG.70D shows potency of combination parental monoclonal antibodies tested each at half of the amount of the corresponding bispecific antibody.
  • FIGS.71A-B show in vitro potency of bispecific antibodies against SARS-CoV-2 authentic virus, strain USA/WA1.
  • FIG.71A shows neutralization for ten bispecific antibodies with IC 90 concentrations between 0.004 ⁇ g/ml and 0.025 ⁇ g/ml.
  • FIG.71B shows neutralization for nine bispecific antibodies with IC 90 concentrations between 0.026 ⁇ g/ml and 0.046 ⁇ g/ml.
  • Authentic virus is another usage term for “infectious” virus. The term can also refer to “live virus”.
  • the USA/WA1 strain is the first strain isolated in the United States and is provided by BEI resources.
  • FIG.72 shows in vitro potency of bispecific antibodies presented from smallest to highest IC90 concentration. Highlighted antibodies were tested with controls.
  • FIGS.73A-B show in vitro potency of bispecific antibodies showing IC 90 and IC 50 concentrations.
  • FIG.73A shows in vitro potency of bispecific antibodies showing IC 90 and IC50 concentrations relative to a 0.05 ⁇ g/ml threshold.
  • FIG.73B shows in vitro potency of bispecific antibodies showing IC 90 and IC 50 concentrations relative to a 0.01 ⁇ g/ml threshold.
  • FIGS.74A-D show comparative evaluation of the bispecific antibody 1-57/1-68.
  • FIG.74A shows virus neutralization with the bispecific antibody 1-57/1-68 compared to two control bispecific antibodies, each comprising a parental antibody arm and a control antibody arm, and compared to a mix of the two control bispecific antibodies.
  • AbX is an irrelevant control antibody arm, wherein AbX is PGDM1400.
  • FIG.74B shows virus neutralization with a combination of the parental antibodies and each of the parental antibodies.
  • FIG.74C shows virus neutralization with the bispecific antibody 1-57/1-68 compared to a combination of the parental antibodies.
  • FIG.74D shows potency of the bispecific antibody 1-57/1-68 and a mix of each parental monoclonal antibodies tested each at half of the amount of the corresponding bispecific antibody.
  • the comparative data are from a single experiment, while, the data in the summary table are averaged from multiple repeats.
  • FIGS.75A-D show comparative evaluation of the bispecific antibody 2-17/2-7.
  • FIG.75A shows virus neutralization with the bispecific antibody 2-17/2-7 compared to two control bispecific antibodies, each comprising a parental antibody arm and a control antibody arm, and compared to a mix of the two control bispecific antibodies.
  • AbX and AbY are irrelevant control antibody arms, wherein AbX is PGDM1400 and AbY is A32.
  • FIG.75B shows virus neutralization with a combination of the parental antibodies and each of the parental antibodies.
  • FIG.75C shows virus neutralization with the bispecific antibody 2-17/2- 7 compared to a combination of the parental antibodies.
  • FIG.75D shows potency of the bispecific antibody 2-17/2-7 and a mix of each parental monoclonal antibodies tested each at half of the amount of the corresponding bispecific antibody.
  • FIGS.76A-D show comparative evaluation of the bispecific antibody 1-20/4-18.
  • FIG.76A shows virus neutralization with the bispecific antibody 1-20/4-18 compared to two control bispecific antibodies, each comprising a parental antibody arm and a control antibody arm, and compared to a mix of the two control bispecific antibodies.
  • AbX and AbY are irrelevant control antibody arms, wherein AbX is PGDM1400 and AbY is A32.
  • FIG.76B shows virus neutralization with a combination of the parental antibodies and each of the parental antibodies.
  • FIG.76C shows virus neutralization with the bispecific antibody 1-20/4- 18 compared to a combination of the parental antibodies.
  • FIG.76D shows potency of the bispecific antibody 1-20/4-18 and a mix of each parental monoclonal antibodies tested each at half of the amount of the corresponding bispecific antibody.
  • the comparative data are from a single experiment, while, the data in the summary table are averaged from multiple repeats.
  • FIGS.77A-D show comparative evaluation of the bispecific antibody 1-20/5-24.
  • FIG.77A shows virus neutralization with the bispecific antibody 1-20/5-24 compared to two control bispecific antibodies, each comprising a parental antibody arm and a control antibody arm, and compared to a mix of the two control bispecific antibodies.
  • AbX and AbY are irrelevant control antibody arms, wherein AbX is PGDM1400 and AbY is A32.
  • FIG.77B shows virus neutralization with a combination of the parental antibodies and each of the parental antibodies.
  • FIG.77C shows virus neutralization with the bispecific antibody 1-20/5- 24 compared to a combination of the parental antibodies.
  • FIG.77D shows potency of the bispecific antibody 1-20/5-24 and a mix of each parental monoclonal antibodies tested each at half of the amount of the corresponding bispecific antibody.
  • the comparative data are from a single experiment, while, the data in the summary table are averaged from multiple repeats.
  • FIGS.78A-D show comparative evaluation of the bispecific antibody 2-30/1-68.
  • FIG.78A shows virus neutralization with the bispecific antibody 2-30/1-68 compared to two control bispecific antibodies, each comprising a parental antibody arm and a control antibody arm, and compared to a mix of the two control bispecific antibodies.
  • AbX is an irrelevant control antibody arms, wherein AbX is PGDM1400.
  • FIG.78B shows virus neutralization with a combination of the parental antibodies and each of the parental antibodies.
  • FIG.78C shows virus neutralization with the bispecific antibody 2-30/1-68 compared to a combination of the parental antibodies.
  • FIG.78D shows potency of the bispecific antibody 2-30/1-68 and a mix of each parental monoclonal antibodies tested each at half of the amount of the corresponding bispecific antibody.
  • FIGS.79A-D show comparative evaluation of the bispecific antibody 2-7/4-8 (39/51).
  • FIG.79A shows virus neutralization with the bispecific antibody 2-7/4-8 (39/51) compared to two control bispecific antibodies, each comprising a parental antibody arm and a control antibody arm, and compared to a mix of the two control bispecific antibodies.
  • AbX is an irrelevant control antibody arms, wherein AbX is PGDM1400.
  • FIG.79B shows virus neutralization with a combination of the parental antibodies and each of the parental antibodies.
  • FIG.79C shows virus neutralization with the bispecific antibody 2-7/4-8 (39/51) compared to a combination of the parental antibodies.
  • FIG.79D shows potency of the bispecific antibody 2-7/4-8 (39/51) and a mix of each parental monoclonal antibodies tested each at half of the amount of the corresponding bispecific antibody.
  • the comparative data are from a single experiment, while, the data in the summary table are averaged from multiple repeats.
  • FIGS.80A-D show comparative evaluation of the bispecific antibody 1-57/1-87.
  • FIG.80A shows virus neutralization with the bispecific antibody 1-57/1-87 compared to two control bispecific antibodies, each comprising a parental antibody arm and a control antibody arm, and compared to a mix of the two control bispecific antibodies.
  • AbX is an irrelevant control antibody arms, wherein AbX is PGDM1400.
  • FIG.80B shows virus neutralization with a combination of the parental antibodies and each of the parental antibodies.
  • FIG.80C shows virus neutralization with the bispecific antibody 1-57/1-87 compared to a combination of the parental antibodies.
  • FIG.80D shows potency of the bispecific antibody 1-57/1-87 and a mix of each parental monoclonal antibodies tested each at half of the amount of the corresponding bispecific antibody.
  • the comparative data are from a single experiment, while, the data in the summary table are averaged from multiple repeats.
  • FIG.81 shows potency of additional bispecific antibodies.
  • FIGS.82A-B show neutralizing activities of engineered bispecific antibodies.
  • FIG.82A shows neutralizing activities against wild-type virus (WA1) at various antibody concentrations for bispecific antibodies 2-17/2-7, 1-57/5-7, 5-7/1-57, 2-7/5-7, 5-7/2-7.
  • FIG. 82B shows antibody potency (IC50 and IC90) against wild-type virus (WA1) for bispecific antibodies 2-17/2-7, 1-57/5-7, 5-7/1-57, 2-7/5-7, 5-7/2-7.
  • FIGS.83A-B show 2-7/5-7 bispecific antibody and parental antibodies activities.
  • FIG.83A shows neutralizing activities against wild-type virus (WA1) at various antibody concentrations for bispecific antibody 2-7/5-7, parental antibodies 2-7, 5-7, and a combination of 2-7 and 5-7 parental antibodies.
  • FIG.83B shows IC 50 concentrations for bispecific antibody 2-7/5-7, parental antibodies 2-7, 5-7, and a combination of 2-7 and 5-7 parental antibodies.
  • FIGS.84A-B show activities of bispecific antibody 2-7/5-7 against SARS-CoV-2 wild-type (WA1) and variant strains B1.1.7 (UK), B1.526 (New York), B1.351 (South Africa) and P.1 (Brazil).
  • FIG.84A shows neutralization activity of bispecific antibody 2-7/5- 7 against various SARS-CoV-2 strains at different antibody concentrations.
  • FIG.84B shows IC 50 and IC 90 concentrations for bispecific antibody 2-7/5-7 against various SARS-CoV-2 strains.
  • FIGS.85A-D show neutralization of pseudoviruses having mutations associated with SARS-CoV-2 variants with the bispecific 2-7/5-7 antibody.
  • FIG.85A shows antibody neutralization curves against circulating SARS-CoV-2 virus variants.
  • FIG.85B shows antibody potency against circulating SARS-CoV-2 virus variants.
  • FIG.85C shows antibody neutralization curves against SARS-CoV-2 variants with high frequency mutations.
  • FIG. 85D shows antibody potency against SARS-CoV-2 variants with high frequency mutations.
  • FIGS.86A-F show neutralization of pseudoviruses with SARS-CoV-2 mutations corresponding to “variants of concern” using the bispecific antibody 2-7/5-7.
  • FIG.86A shows antibody neutralization curves against B.1.1.7 (UK virus variant) with NTD mutations.
  • FIG.86B shows antibody potency against B.1.1.7 (UK virus variant) with NTD mutations.
  • FIG.86C shows antibody neutralization curves against B.1.352 (SA) virus variant with NTD mutations.
  • FIG.86D shows antibody potency against B.1.352 (SA) virus variant with NTD mutations.
  • FIG.86E shows antibody neutralization curves against P.1 (BZ) virus variant with NTD mutations.
  • FIG.86F shows antibody potency against P.1 (BZ) virus variant with NTD mutations.
  • FIGS.87A-F show neutralization of pseudoviruses with SARS-CoV-2 mutations corresponding to “variants of interest” using the bispecific antibody 2-7/5-7.
  • FIG.87A shows antibody neutralization curves against B.1.427 (CA) virus variant with NTD mutations.
  • FIG. 87B shows antibody potency against B.1.427 (CA) virus variant with NTD mutations.
  • FIG. 87C shows antibody neutralization curves against B.1.526 (NY) variant with NTD mutations.
  • FIG.87D shows antibody potency against B.1.526 (NY) variant with NTD mutations.
  • FIG. 87E show antibody neuralization curves against NJ variant with NTD mutations.
  • FIG.87F show antibody potency against NJ variant with NTD mutations.
  • FIG.88 shows summary of bispecific antibody 2-7/5-7 activity against variants. IC50 is shown in circles. IC90 is shown in squares.
  • FIGS.89A-C shows neutralization activity of bispecific antibody 2-7/5-7 and parental 2-7 and 5-7 monoclonal antibodies against SARS-CoV-2 variants (live viruses).
  • FIG.89A shows the neutralization curve for bispecific antibody 2-7/5-7.
  • FIG.89B shows the neutralization curve for parental antibody 2-7.
  • FIG.89C shows the neutralization curve for parental antibody 5-7.
  • FIGS.90A-D show virus neutralization with monoclonal antibody 2-36.
  • FIG. 90A shows screening of transfection supernatant for neutralization activity against SARS- CoV-2 pseudovirus.
  • FIG.90B shows screening of transfection supernatant for neutralization activity against SARS-CoV pseudovirus.
  • FIG.90C shows 2-36 neutralization IC50 ( ⁇ g/mL) against SARS-CoV-2 pseudovirus (PV) and live virus (LV).
  • FIG.90D shows 2-36 neutralization IC50 ( ⁇ g/mL) against SARS-CoV pseudovirus (PV) and live virus (LV).
  • FIGS.91A-B show binding of monoclonal antibody 2-36 to SARS-CoV-2 (FIG. 91A) and SARS-CoV (FIG.91B) spike as determined by ELISA.
  • FIGS.92A-H show binding affinity for monoclonal antibodies 2-36 and 2-4 to SARS-CoV-2 and SARS-CoV viruses as measured by SPR.
  • FIG.92A shows 2-36 binding affinity to SARS-CoV-2 spike protein.
  • FIG.92B shows 2-4 binding affinity to SARS-CoV-2 spike protein.
  • FIG.92C shows 2-36 binding affinity to SARS-CoV spike protein.
  • FIG.92D shows 2-4 binding affinity to SARS-CoV spike protein.
  • FIG.92E shows 2-36 binding affinity to SARS-CoV-2 receptor binding domain (RBD).
  • FIG.92F shows 2-4 binding affinity to SARS-CoV-2 RBD.
  • FIG.92G shows 2-36 binding affinity to SARS-CoV RBD.
  • FIG.92H shows 2-4 binding affinity to SARS-CoV RBD.
  • FIGS.93A-B show binding to SARS-CoV-2 spike protein.
  • FIG.93A shows that binding of monoclonal antibody 2-36 to SARS-CoV-2 spike is inhibited by CR3022.
  • FIG. 93B shows that monoclonal antibody 2-36 inhibits hACE2 binding to SARS-CoV-2 spike protein.
  • FIG.94 shows conservation analysis on the RBD among SARS CoV-2, SARS CoV-1, Bat CoVs, and Human CoVs virus strains. The analysis shows that the 2-36 binding site is highly conserved; with regions of high conservation in grey and low conservation in red. The 2-36 binding site is outlined in blue.
  • FIGS.95A-D show that monoclonal antibody 2-36 neutralizes SARS-CoV-2 variants and SARS-like coronaviruses using hACE2.
  • FIG.95A shows neutralization against live variants.
  • FIG.95B shows neutralization against pseudovariants.
  • FIG.95C shows evolution tree of viruses.
  • FIG.95D shows antibody potency against viruses.
  • FIGS.96A-D shows that monoclonal antibody 2-36 neutralizes SARS-like coronaviruses using hACE2.
  • FIG.96A shows virus neutralization with 2-36 antibody.
  • FIG. 96B shows virus neutralization with S309 antibody.
  • FIG.96C shows virus neutralization with COVA1-16 antibody.
  • FIG.96D shows virus neutralization with CR3022 antibody.
  • FIGS.97A-D show in vitro selection of 2-36 antibody escape mutations.
  • FIG. 97A shows evolution of escape mutations during in vitro passage of SARS-CoV-2 USA/WA1 in Vero E6 cells in the presence of 2-36.
  • FIG.97B shows 2-36 neutralization activity tested against virus passages.
  • FIG.97C shows spike protein with selected mutation localized.
  • FIG.97D shows that the selected escape mutations were introduced into pseudoviruses and then 2-36 neutralization activity was tested against these viruses.
  • DETAILED DESCRIPTION OF THE INVENTION [0239] Definitions [0240] The following are definitions of terms used in the present specification.
  • the term “subject” refers to a vertebrate animal.
  • the subject is a mammal or a mammalian species.
  • the subject is a human.
  • the subject is a healthy human adult.
  • the subject is a non-human vertebrate animal, including, without limitation, non-human primates, laboratory animals, livestock, racehorses, domesticated animals, and non-domesticated animals.
  • the term “human subjects” means a population of healthy human adults.
  • the term “patient” refers to a human or animal.
  • the term “mammal” includes, but is not limited to, a human, mouse, rat, guinea pig, dog, cat, horse, cow, pig, or non-human primate, such as a monkey, chimpanzee, baboon or rhesus. In one embodiment, the mammal is a human.
  • the term “therapeutically effective” includes prophylaxis, as well as treatment of a subject having suspected of having a viral infection.
  • the invention provides a bispecific molecule comprising a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain. [0248] In some embodiments, the first polypeptide chain and the second polypeptide chain are covalently bonded to one another.
  • the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 59 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 63.
  • the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 60 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 64.
  • the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 61 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 65.
  • the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 62 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 66.
  • the first heavy chain comprises SEQ ID NO: 59 or SEQ ID NO: 63.
  • the first light chain comprises SEQ ID NO: 60 or SEQ ID NO: 64.
  • the second heavy chain comprises SEQ ID NO: 61 or SEQ ID NO: 65.
  • the second light chain comprises SEQ ID NO: 62 or SEQ ID NO: 66.
  • the variable domain of the first heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 59 or CDR1, CDR2, and CDR3 of SEQ ID NO: 63.
  • the variable domain of the first light chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 60 or CDR1, CDR2, and CDR3 of SEQ ID NO: 64.
  • variable domain of the second heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 61 or CDR1, CDR2, and CDR3 of SEQ ID NO: 65.
  • variable domain of the second light chain comprises CDR1, CDR2, and CDR3 SEQ ID NO: 62 or CDR1, CDR2, and CDR3 of SEQ ID NO: 66.
  • variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27.
  • variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28.
  • variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13.
  • variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14.
  • the variable domain of the first heavy chain comprises SEQ ID NO: 13 or SEQ ID NO: 27.
  • variable domain of the first light chain comprises SEQ ID NO: 14 or SEQ ID NO: 28.
  • variable domain of the second heavy chain comprises SEQ ID NO: 27 or SEQ ID NO: 13.
  • the variable domain of the second light chain comprises SEQ ID NO: 28 or SEQ ID NO: 14.
  • the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 59, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 60, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 61, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%,
  • the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 63, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 64, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 65, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%
  • the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 13, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%,
  • the molecule comprises SEQ ID NOs: 59, 60, 61, and 62. In some embodiments, the molecule comprises SEQ ID NOs: 63, 64, 65, and 66. In some embodiments, the molecule comprises SEQ ID NOs: 13, 14, 27, and 28. [0255] In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus strain.
  • the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle.
  • the first epitope comprises at least a portion of a receptor binding domain (RBD) on an S protein of a SARS-CoV-2 particle.
  • the second epitope comprises at least a portion of a N-terminal domain (NTD) on an S protein of a SARS-CoV-2 particle.
  • the invention provides a method of treating a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a composition comprising a bispecific molecule, wherein the bispecific molecule comprises a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain.
  • the first polypeptide chain and the second polypeptide chain are covalently bonded to one another.
  • the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 59 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 63.
  • the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 60 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 64.
  • the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 61 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 65.
  • the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 62 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 66.
  • the first heavy chain comprises SEQ ID NO: 59 or SEQ ID NO: 63.
  • the first light chain comprises SEQ ID NO: 60 or SEQ ID NO: 64.
  • the second heavy chain comprises SEQ ID NO: 61 or SEQ ID NO: 65.
  • the second light chain comprises SEQ ID NO: 62 or SEQ ID NO: 66.
  • the variable domain of the first heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 59 or CDR1, CDR2, and CDR3 of SEQ ID NO: 63.
  • the variable domain of the first light chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 60 or CDR1, CDR2, and CDR3 of SEQ ID NO: 64.
  • variable domain of the second heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 61 or CDR1, CDR2, and CDR3 of SEQ ID NO: 65.
  • variable domain of the second light chain comprises CDR1, CDR2, and CDR3 SEQ ID NO: 62 or CDR1, CDR2, and CDR3 of SEQ ID NO: 66.
  • variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27.
  • variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28.
  • variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13.
  • variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14.
  • the variable domain of the first heavy chain comprises SEQ ID NO: 13 or SEQ ID NO: 27.
  • variable domain of the first light chain comprises SEQ ID NO: 14 or SEQ ID NO: 28.
  • variable domain of the second heavy chain comprises SEQ ID NO: 27 or SEQ ID NO: 13.
  • the variable domain of the second light chain comprises SEQ ID NO: 28 or SEQ ID NO: 14.
  • the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 59, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 60, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 61, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%,
  • the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 63, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 64, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 65, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%
  • the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 13, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%,
  • the molecule comprises SEQ ID NOs: 59, 60, 61, and 62. In some embodiments, the molecule comprises SEQ ID NOs: 63, 64, 65, and 66. In some embodiments, the molecule comprises SEQ ID NOs: 13, 14, 27, and 28. [0263] In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus strain.
  • the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle.
  • the first epitope comprises at least a portion of a receptor binding domain (RBD) on a spike protein of a SARS-CoV-2 particle.
  • the second epitope comprises at least a portion of a N-terminal domain (NTD) on a spike protein of a SARS-CoV-2 particle.
  • the composition is administered in combination with a second therapeutic agent.
  • the invention provides a method of preventing a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a composition comprising a bispecific molecule, wherein the bispecific molecule comprises a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain.
  • the first polypeptide chain and the second polypeptide chain are covalently bonded to one another.
  • the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 59 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 63.
  • the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 60 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 64.
  • the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 61 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 65.
  • the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 62 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 66.
  • the first heavy chain comprises SEQ ID NO: 59 or SEQ ID NO: 63.
  • the first light chain comprises SEQ ID NO: 60 or SEQ ID NO: 64.
  • the second heavy chain comprises SEQ ID NO: 61 or SEQ ID NO: 65.
  • the second light chain comprises SEQ ID NO: 62 or SEQ ID NO: 66.
  • the variable domain of the first heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 59 or CDR1, CDR2, and CDR3 of SEQ ID NO: 63.
  • the variable domain of the first light chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 60 or CDR1, CDR2, and CDR3 of SEQ ID NO: 64.
  • variable domain of the second heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 61 or CDR1, CDR2, and CDR3 of SEQ ID NO: 65.
  • variable domain of the second light chain comprises CDR1, CDR2, and CDR3 SEQ ID NO: 62 or CDR1, CDR2, and CDR3 of SEQ ID NO: 66.
  • variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27.
  • variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28.
  • variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13.
  • variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14.
  • the variable domain of the first heavy chain comprises SEQ ID NO: 13 or SEQ ID NO: 27.
  • variable domain of the first light chain comprises SEQ ID NO: 14 or SEQ ID NO: 28.
  • variable domain of the second heavy chain comprises SEQ ID NO: 27 or SEQ ID NO: 13.
  • the variable domain of the second light chain comprises SEQ ID NO: 28 or SEQ ID NO: 14.
  • the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 59, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 60, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 61, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%,
  • the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 63, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 64, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 65, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%
  • the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 13, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%,
  • the molecule comprises SEQ ID NOs: 59, 60, 61, and 62. In some embodiments, the molecule comprises SEQ ID NOs: 63, 64, 65, and 66. In some embodiments, the molecule comprises SEQ ID NOs: 13, 14, 27, and 28. [0272] In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus strain.
  • the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle.
  • the first epitope comprises at least a portion of a receptor binding domain (RBD) on an S protein of a SARS-CoV-2 particle.
  • the second epitope comprises at least a portion of a N-terminal domain (NTD) on an S protein of a SARS-CoV-2 particle.
  • the composition is administered in combination with a second therapeutic agent.
  • the invention provides a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable domain and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16.
  • the heavy chain variable domain comprises SEQ ID NO: 15.
  • the light chain variable domain comprises SEQ ID NO: 16.
  • the antibody comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15 and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16.
  • the antibody comprises SEQ ID NO: 15 and SEQ ID NO: 16.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 15.
  • the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 16.
  • the antibody neutralizes a coronavirus.
  • the coronavirus is SARS-CoV-2.
  • the antibody specifically binds an epitope on the surface of the coronavirus.
  • the epitope comprises at least a portion of a coronavirus spike protein.
  • the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein.
  • RBD receptor binding domain
  • the coronavirus is a SARS-CoV-2 coronavirus.
  • the invention provides a method of treating a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable domain and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16.
  • the heavy chain variable domain comprises SEQ ID NO: 15.
  • the light chain variable domain comprises SEQ ID NO: 16.
  • the antibody comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15 and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16.
  • the antibody comprises SEQ ID NO: 15 and SEQ ID NO: 16.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 15. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 16.
  • the antibody neutralizes a coronavirus. In some embodiments, the coronavirus is SARS-CoV-2. In some embodiments, the antibody neutralizes a coronavirus. In some embodiments, the coronavirus is SARS-CoV-2. In some embodiments, the antibody specifically binds an epitope on the surface of the coronavirus. In some embodiments, the epitope comprises at least a portion of a coronavirus spike protein.
  • the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein.
  • the coronavirus is a SARS- CoV-2 coronavirus.
  • the antibody is administered in combination with a second pharmaceutical agent.
  • the invention provides a method of preventing a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16.
  • the heavy chain variable domain comprises SEQ ID NO: 15.
  • the light chain variable domain comprises SEQ ID NO: 16.
  • the antibody comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15 and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16.
  • the antibody comprises SEQ ID NO: 15 and SEQ ID NO: 16.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 15. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 16.
  • the antibody neutralizes a coronavirus. In some embodiments, the coronavirus is SARS-CoV-2. In some embodiments, the antibody neutralizes a coronavirus. In some embodiments, the coronavirus is SARS-CoV-2. In some embodiments, the antibody specifically binds an epitope on the surface of the coronavirus. In some embodiments, the epitope comprises at least a portion of a coronavirus spike protein.
  • the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein.
  • the coronavirus is a SARS- CoV-2 coronavirus.
  • the antibody is administered in combination with a second pharmaceutical agent.
  • the invention provides a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable domain and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 3, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 7, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 9, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%,
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 19, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 21, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 25, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%,
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 33, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 37, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 39, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 4, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 8, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 10, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%,
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 20, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 22, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 26, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%,
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 34, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 38, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 40, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 3 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 4.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 7 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 8.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 9 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 10.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 11 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 12.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 17 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 18.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 19 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 20.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 21 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 22.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 25 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 26.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 29 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 30.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 31 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 32.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 33 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 34.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 37 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 38.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 39 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 40.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 43 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 44.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 45 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 46.
  • the heavy chain variable domain comprises SEQ ID NO: 3 and the light chain variable domain comprises SEQ ID NO: 4.
  • the heavy chain variable domain comprises SEQ ID NO: 7 and the light chain variable domain comprises SEQ ID NO: 8. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 9 and the light chain variable domain comprises SEQ ID NO: 10. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 11 and the light chain variable domain comprises SEQ ID NO: 12. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 17 and the light chain variable domain comprises SEQ ID NO: 18. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 19 and the light chain variable domain comprises SEQ ID NO: 20. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 21 and the light chain variable domain comprises SEQ ID NO: 22.
  • the heavy chain variable domain comprises SEQ ID NO: 25 and the light chain variable domain comprises SEQ ID NO: 26. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 29 and the light chain variable domain comprises SEQ ID NO: 30. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 31 and the light chain variable domain comprises SEQ ID NO: 32. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 33 and the light chain variable domain comprises SEQ ID NO: 34. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 37 and the light chain variable domain comprises SEQ ID NO: 38. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 39 and the light chain variable domain comprises SEQ ID NO: 40.
  • the heavy chain variable domain comprises SEQ ID NO: 43 and the light chain variable domain comprises SEQ ID NO: 44. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 45 and the light chain variable domain comprises SEQ ID NO: 46. [0298] In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 3; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 7; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 9; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 11; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 17.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 19; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 21; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 25; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 29; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 31.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 33; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 37; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 39; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 43; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 45.
  • the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 4; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 8; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 10; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 12; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 18.
  • the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 20; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 22; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 26; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 30; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 32.
  • the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 34; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 38; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 40; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 44; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 46.
  • the antibody neutralizes a coronavirus.
  • the coronavirus is a SARS-CoV-2 virus.
  • the coronavirus is a SARS-CoV-2 variant strain.
  • the variant strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427.
  • the antibody specifically binds an epitope on the surface of the coronavirus.
  • the epitope comprises at least a portion of a coronavirus spike protein.
  • the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein.
  • the at least a portion of a coronavirus spike protein comprises a N-Terminal domain (NTD) of a spike protein.
  • the coronavirus is a SARS-CoV-2 coronavirus.
  • the invention provides a method of treating or preventing a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable domain and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 3, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 7, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 9, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%,
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 19, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 21, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 25, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%,
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 33, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 37, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 39, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 4, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 8, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 10, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%,
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 20, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 22, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 26, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%,
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 34, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 38, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 40, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 3 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 4.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 7 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 8.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 9 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 10.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 11 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 12.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 17 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 18.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 19 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 20.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 21 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 22.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 25 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 26.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 29 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 30.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 31 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 32.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 33 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 34.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 37 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 38.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 39 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 40.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 43 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 44.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 45 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 46.
  • the heavy chain variable domain comprises SEQ ID NO: 3 and the light chain variable domain comprises SEQ ID NO: 4.
  • the heavy chain variable domain comprises SEQ ID NO: 7 and the light chain variable domain comprises SEQ ID NO: 8. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 9 and the light chain variable domain comprises SEQ ID NO: 10. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 11 and the light chain variable domain comprises SEQ ID NO: 12. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 17 and the light chain variable domain comprises SEQ ID NO: 18. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 19 and the light chain variable domain comprises SEQ ID NO: 20. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 21 and the light chain variable domain comprises SEQ ID NO: 22.
  • the heavy chain variable domain comprises SEQ ID NO: 25 and the light chain variable domain comprises SEQ ID NO: 26. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 29 and the light chain variable domain comprises SEQ ID NO: 30. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 31 and the light chain variable domain comprises SEQ ID NO: 32. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 33 and the light chain variable domain comprises SEQ ID NO: 34. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 37 and the light chain variable domain comprises SEQ ID NO: 38. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 39 and the light chain variable domain comprises SEQ ID NO: 40.
  • the heavy chain variable domain comprises SEQ ID NO: 43 and the light chain variable domain comprises SEQ ID NO: 44. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 45 and the light chain variable domain comprises SEQ ID NO: 46. [0312] In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 3; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 7; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 9; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 11; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 17.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 19; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 21; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 25; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 29; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 31.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 33; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 37; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 39; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 43; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 45.
  • the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 4; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 8; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 10; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 12; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 18.
  • the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 20; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 22; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 26; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 30; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 32.
  • the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 34; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 38; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 40; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 44; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 46.
  • the antibody neutralizes a coronavirus.
  • the coronavirus is a SARS-CoV-2 virus.
  • the coronavirus is a SARS-CoV-2 variant strain.
  • the variant strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427.
  • the antibody specifically binds an epitope on the surface of the coronavirus.
  • the epitope comprises at least a portion of a coronavirus spike protein.
  • the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein.
  • the at least a portion of a coronavirus spike protein comprises a N-Terminal domain (NTD) of a spike protein.
  • the coronavirus is a SARS-CoV-2 coronavirus.
  • the composition is administered in combination with a second therapeutic agent.
  • the invention provides a bispecific molecule comprising a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain.
  • the first polypeptide chain and the second polypeptide chain are covalently bonded to one another.
  • the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 51, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 55, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 67, a polypeptide
  • the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 52, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 56, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 68; a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 53, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 57, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 69, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%
  • the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 54, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 58, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 70, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 8
  • variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 8
  • variable domain of the first heavy chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 51; the CDR1, CDR2, and CDR3 of SEQ ID NO: 55; the CDR1, CDR2, and CDR3 of SEQ ID NO: 67; the CDR1, CDR2, and CDR3 of SEQ ID NO: 71; the CDR1, CDR2, and CDR3 of SEQ ID NO: 75; the CDR1, CDR2, and CDR3 of SEQ ID NO: 79; the CDR1, CDR2, and CDR3 of SEQ ID NO: 83; the CDR1, CDR2, and CDR3 of SEQ ID NO: 87; the CDR1, CDR2, and CDR3 of SEQ ID NO: 91; the CDR1, CDR2, and CDR3 of SEQ ID NO: 95; the CDR1, CDR2, and CDR3 of SEQ ID NO: 99; the CDR1, CDR2, and CDR3 of SEQ ID NO: 103; the CDR1, CDR2, and CDR3
  • variable domain of the first light chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 52; the CDR1, CDR2, and CDR3 of SEQ ID NO: 56; the CDR1, CDR2, and CDR3 of SEQ ID NO: 68; the CDR1, CDR2, and CDR3 of SEQ ID NO: 72; the CDR1, CDR2, and CDR3 of SEQ ID NO: 76; the CDR1, CDR2, and CDR3 of SEQ ID NO: 80; the CDR1, CDR2, and CDR3 of SEQ ID NO: 84; the CDR1, CDR2, and CDR3 of SEQ ID NO: 88; the CDR1, CDR2, and CDR3 of SEQ ID NO: 92; the CDR1, CDR2, and CDR3 of SEQ ID NO: 96; the CDR1, CDR2, and CDR3 of SEQ ID NO: 100; the CDR1, CDR2, and CDR3 of SEQ ID NO: 104; the CDR1, CDR2, and CDR3
  • variable domain of the second heavy chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 53; the CDR1, CDR2, and CDR3 of SEQ ID NO: 57; the CDR1, CDR2, and CDR3 of SEQ ID NO: 69; the CDR1, CDR2, and CDR3 of SEQ ID NO: 73; the CDR1, CDR2, and CDR3 of SEQ ID NO: 77; the CDR1, CDR2, and CDR3 of SEQ ID NO: 81; the CDR1, CDR2, and CDR3 of SEQ ID NO: 85; the CDR1, CDR2, and CDR3 of SEQ ID NO: 89; the CDR1, CDR2, and CDR3 of SEQ ID NO: 93; the CDR1, CDR2, and CDR3 of SEQ ID NO: 97; the CDR1, CDR2, and CDR3 of SEQ ID NO: 101; the CDR1, CDR2, and CDR3 of SEQ ID NO: 105;
  • variable domain of the second light chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 54; the CDR1, CDR2, and CDR3 of SEQ ID NO: 58; the CDR1, CDR2, and CDR3 of SEQ ID NO: 70; the CDR1, CDR2, and CDR3 of SEQ ID NO: 74; the CDR1, CDR2, and CDR3 of SEQ ID NO: 78; the CDR1, CDR2, and CDR3 of SEQ ID NO: 82; the CDR1, CDR2, and CDR3 of SEQ ID NO: 86; the CDR1, CDR2, and CDR3 of SEQ ID NO: 90; the CDR1, CDR2, and CDR3 of SEQ ID NO: 94; the CDR1, CDR2, and CDR3 of SEQ ID NO: 98; the CDR1, CDR2, and CDR3 of SEQ ID NO: 102; the CDR1, CDR2, and CDR3 of SEQ ID NO: 106;
  • the molecule comprises SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, and SEQ ID NO: 54. In some embodiments, the molecule comprises SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 57, and SEQ ID NO: 58. In some embodiments, the molecule comprises SEQ ID NO: 67, SEQ ID NO: 68, SEQ ID NO: 69, and SEQ ID NO: 70. In some embodiments, the molecule comprises SEQ ID NO: 71, SEQ ID NO: 72, SEQ ID NO: 73, and SEQ ID NO: 74.
  • the molecule comprises SEQ ID NO: 75, SEQ ID NO: 76, SEQ ID NO: 77, and SEQ ID NO: 78. In some embodiments, the molecule comprises SEQ ID NO: 79, SEQ ID NO: 80, SEQ ID NO: 81, and SEQ ID NO: 82. In some embodiments, the molecule comprises SEQ ID NO: 83, SEQ ID NO: 84, SEQ ID NO: 85, and SEQ ID NO: 86. In some embodiments, the molecule comprises SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, and SEQ ID NO: 90.
  • the molecule comprises SEQ ID NO: 91, SEQ ID NO: 92, SEQ ID NO: 93, and SEQ ID NO: 94. In some embodiments, the molecule comprises SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, and SEQ ID NO: 98. In some embodiments, the molecule comprises SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, and SEQ ID NO: 102. In some embodiments, the molecule comprises SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, and SEQ ID NO: 106.
  • the molecule comprises SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, and SEQ ID NO: 110. In some embodiments, the molecule comprises SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117, and SEQ ID NO: 118. In some embodiments, the molecule comprises SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, and SEQ ID NO: 122. [0329] In some embodiments, the molecule comprises SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, and SEQ ID NO: 126.
  • the molecule comprises SEQ ID NO: 127, SEQ ID NO: 128, SEQ ID NO: 129, and SEQ ID NO: 130. In some embodiments, the molecule comprises SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, and SEQ ID NO: 133. In some embodiments, the molecule comprises SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, and SEQ ID NO: 142. In some embodiments, the molecule comprises SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145, and SEQ ID NO: 146.
  • the molecule comprises SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, and SEQ ID NO: 150. In some embodiments, the molecule comprises SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, and SEQ ID NO: 154. In some embodiments, the molecule comprises SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, and SEQ ID NO: 158. In some embodiments, the molecule comprises SEQ ID NO: 159, SEQ ID NO: 160, SEQ ID NO: 161, and SEQ ID NO: 162.
  • the molecule comprises SEQ ID NO: 163, SEQ ID NO: 164, SEQ ID NO: 165, and SEQ ID NO: 166. In some embodiments, the molecule comprises SEQ ID NO: 167, SEQ ID NO: 168, SEQ ID NO: 169, and SEQ ID NO: 170. In some embodiments, the molecule comprises SEQ ID NO: 171, SEQ ID NO: 172, SEQ ID NO: 173, and SEQ ID NO: 174. In some embodiments, the molecule comprises SEQ ID NO: 175, SEQ ID NO: 176, SEQ ID NO: 177, and SEQ ID NO: 178.
  • the molecule comprises SEQ ID NO: 179, SEQ ID NO: 180, SEQ ID NO: 181, and SEQ ID NO: 182. In some embodiments, the molecule comprises SEQ ID NO: 183, SEQ ID NO: 184, SEQ ID NO: 185, and SEQ ID NO: 186. [0330] In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus.
  • the SARS- CoV-2 virus strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427.
  • the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle.
  • the first epitope comprises at least a portion of a receptor binding domain (RBD) on a spike protein of a SARS-CoV-2 particle.
  • the second epitope comprises at least a portion of a N- terminal domain (NTD) on a spike protein of a SARS-CoV-2 particle.
  • the invention provides a method of treating or preventing a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a composition comprising a bispecific molecule comprising a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain.
  • the first polypeptide chain and the second polypeptide chain are covalently bonded to one another.
  • the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 51, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 55, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 67, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 52, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 56, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 68; a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 53, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 57, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 69, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%
  • the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 54, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 58, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 70, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 8
  • variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 8
  • variable domain of the first heavy chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 51; the CDR1, CDR2, and CDR3 of SEQ ID NO: 55; the CDR1, CDR2, and CDR3 of SEQ ID NO: 67; the CDR1, CDR2, and CDR3 of SEQ ID NO: 71; the CDR1, CDR2, and CDR3 of SEQ ID NO: 75; the CDR1, CDR2, and CDR3 of SEQ ID NO: 79; the CDR1, CDR2, and CDR3 of SEQ ID NO: 83; the CDR1, CDR2, and CDR3 of SEQ ID NO: 87; the CDR1, CDR2, and CDR3 of SEQ ID NO: 91; the CDR1, CDR2, and CDR3 of SEQ ID NO: 95; the CDR1, CDR2, and CDR3 of SEQ ID NO: 99; the CDR1, CDR2, and CDR3 of SEQ ID NO: 103; the CDR1, CDR2, and CDR3
  • variable domain of the first light chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 52; the CDR1, CDR2, and CDR3 of SEQ ID NO: 56; the CDR1, CDR2, and CDR3 of SEQ ID NO: 68; the CDR1, CDR2, and CDR3 of SEQ ID NO: 72; the CDR1, CDR2, and CDR3 of SEQ ID NO: 76; the CDR1, CDR2, and CDR3 of SEQ ID NO: 80; the CDR1, CDR2, and CDR3 of SEQ ID NO: 84; the CDR1, CDR2, and CDR3 of SEQ ID NO: 88; the CDR1, CDR2, and CDR3 of SEQ ID NO: 92; the CDR1, CDR2, and CDR3 of SEQ ID NO: 96; the CDR1, CDR2, and CDR3 of SEQ ID NO: 100; the CDR1, CDR2, and CDR3 of SEQ ID NO: 104; the CDR1, CDR2, and CDR3
  • variable domain of the second heavy chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 53; the CDR1, CDR2, and CDR3 of SEQ ID NO: 57; the CDR1, CDR2, and CDR3 of SEQ ID NO: 69; the CDR1, CDR2, and CDR3 of SEQ ID NO: 73; the CDR1, CDR2, and CDR3 of SEQ ID NO: 77; the CDR1, CDR2, and CDR3 of SEQ ID NO: 81; the CDR1, CDR2, and CDR3 of SEQ ID NO: 85; the CDR1, CDR2, and CDR3 of SEQ ID NO: 89; the CDR1, CDR2, and CDR3 of SEQ ID NO: 93; the CDR1, CDR2, and CDR3 of SEQ ID NO: 97; the CDR1, CDR2, and CDR3 of SEQ ID NO: 101; the CDR1, CDR2, and CDR3 of SEQ ID NO: 105;
  • variable domain of the second light chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 54; the CDR1, CDR2, and CDR3 of SEQ ID NO: 58; the CDR1, CDR2, and CDR3 of SEQ ID NO: 70; the CDR1, CDR2, and CDR3 of SEQ ID NO: 74; the CDR1, CDR2, and CDR3 of SEQ ID NO: 78; the CDR1, CDR2, and CDR3 of SEQ ID NO: 82; the CDR1, CDR2, and CDR3 of SEQ ID NO: 86; the CDR1, CDR2, and CDR3 of SEQ ID NO: 90; the CDR1, CDR2, and CDR3 of SEQ ID NO: 94; the CDR1, CDR2, and CDR3 of SEQ ID NO: 98; the CDR1, CDR2, and CDR3 of SEQ ID NO: 102; the CDR1, CDR2, and CDR3 of SEQ ID NO: 106;
  • the molecule comprises SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, and SEQ ID NO: 54. In some embodiments, the molecule comprises SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 57, and SEQ ID NO: 58. In some embodiments, the molecule comprises SEQ ID NO: 67, SEQ ID NO: 68, SEQ ID NO: 69, and SEQ ID NO: 70. In some embodiments, the molecule comprises SEQ ID NO: 71, SEQ ID NO: 72, SEQ ID NO: 73, and SEQ ID NO: 74.
  • the molecule comprises SEQ ID NO: 75, SEQ ID NO: 76, SEQ ID NO: 77, and SEQ ID NO: 78. In some embodiments, the molecule comprises SEQ ID NO: 79, SEQ ID NO: 80, SEQ ID NO: 81, and SEQ ID NO: 82. In some embodiments, the molecule comprises SEQ ID NO: 83, SEQ ID NO: 84, SEQ ID NO: 85, and SEQ ID NO: 86. In some embodiments, the molecule comprises SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, and SEQ ID NO: 90.
  • the molecule comprises SEQ ID NO: 91, SEQ ID NO: 92, SEQ ID NO: 93, and SEQ ID NO: 94. In some embodiments, the molecule comprises SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, and SEQ ID NO: 98. In some embodiments, the molecule comprises SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, and SEQ ID NO: 102. In some embodiments, the molecule comprises SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, and SEQ ID NO: 106.
  • the molecule comprises SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, and SEQ ID NO: 110. In some embodiments, the molecule comprises SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117, and SEQ ID NO: 118. [0346] In some embodiments, the molecule comprises SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, and SEQ ID NO: 122. In some embodiments, the molecule comprises SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, and SEQ ID NO: 126.
  • the molecule comprises SEQ ID NO: 127, SEQ ID NO: 128, SEQ ID NO: 129, and SEQ ID NO: 130. In some embodiments, the molecule comprises SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, and SEQ ID NO: 133. In some embodiments, the molecule comprises SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, and SEQ ID NO: 142. In some embodiments, the molecule comprises SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145, and SEQ ID NO: 146.
  • the molecule comprises SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, and SEQ ID NO: 150. In some embodiments, the molecule comprises SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, and SEQ ID NO: 154. In some embodiments, the molecule comprises SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, and SEQ ID NO: 158. In some embodiments, the molecule comprises SEQ ID NO: 159, SEQ ID NO: 160, SEQ ID NO: 161, and SEQ ID NO: 162.
  • the molecule comprises SEQ ID NO: 163, SEQ ID NO: 164, SEQ ID NO: 165, and SEQ ID NO: 166. In some embodiments, the molecule comprises SEQ ID NO: 167, SEQ ID NO: 168, SEQ ID NO: 169, and SEQ ID NO: 170. In some embodiments, the molecule comprises SEQ ID NO: 171, SEQ ID NO: 172, SEQ ID NO: 173, and SEQ ID NO: 174. In some embodiments, the molecule comprises SEQ ID NO: 175, SEQ ID NO: 176, SEQ ID NO: 177, and SEQ ID NO: 178.
  • the molecule comprises SEQ ID NO: 179, SEQ ID NO: 180, SEQ ID NO: 181, and SEQ ID NO: 182. In some embodiments, the molecule comprises SEQ ID NO: 183, SEQ ID NO: 184, SEQ ID NO: 185, and SEQ ID NO: 186. [0347] In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus.
  • the SARS- CoV-2 virus strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427.
  • the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle.
  • the first epitope comprises at least a portion of a receptor binding domain (RBD) on a spike protein of a SARS-CoV-2 particle.
  • the second epitope comprises at least a portion of a N-terminal domain (NTD) on a spike protein of a SARS-CoV-2 particle.
  • the composition is administered in combination with a second therapeutic agent.
  • the invention provides a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable domain and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 41.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 1.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 23.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 42.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 2.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 24.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 41 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 42.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 1 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 2.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 23 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 24.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28.
  • the heavy chain variable domain comprises SEQ ID NO: 5 and the light chain variable domain comprises SEQ ID NO: 6.
  • the heavy chain variable domain comprises SEQ ID NO: 41 and the light chain variable domain comprises SEQ ID NO: 42. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 35 and the light chain variable domain comprises SEQ ID NO: 36. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 1 and the light chain variable domain comprises SEQ ID NO: 2. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 23 and the light chain variable domain comprises SEQ ID NO: 24. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 13 and the light chain variable domain comprises SEQ ID NO: 14. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 27 and the light chain variable domain comprises SEQ ID NO: 28.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 5. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 41. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 1. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 23. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 13. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 27.
  • the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 6. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 42. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 36. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 2. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 24. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 14.
  • the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 28.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 5 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 6.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 41 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 42.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 35 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 36. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 1 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 2. [0355] In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 23 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 24.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 13 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 14. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 27 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 28.
  • the antibody neutralizes a coronavirus.
  • the coronavirus is a SARS-CoV-2 virus. In some embodiments, the coronavirus is a SARS-CoV-2 variant strain.
  • the variant strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427.
  • the antibody specifically binds an epitope on the surface of the coronavirus.
  • the epitope comprises at least a portion of a coronavirus spike protein.
  • the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein.
  • the at least a portion of a coronavirus spike protein comprises a N-Terminal domain (NTD) of a spike protein.
  • the coronavirus is a SARS-CoV-2 coronavirus.
  • the invention provides a method of treating or preventing a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable domain and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 41.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 1.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 23.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 42.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 2.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 24.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 41 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 42.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 1 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 2.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 23 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 24.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28.
  • the heavy chain variable domain comprises SEQ ID NO: 5 and the light chain variable domain comprises SEQ ID NO: 6.
  • the heavy chain variable domain comprises SEQ ID NO: 41 and the light chain variable domain comprises SEQ ID NO: 42. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 35 and the light chain variable domain comprises SEQ ID NO: 36. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 1 and the light chain variable domain comprises SEQ ID NO: 2. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 23 and the light chain variable domain comprises SEQ ID NO: 24. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 13 and the light chain variable domain comprises SEQ ID NO: 14. [0363] In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 27 and the light chain variable domain comprises SEQ ID NO: 28.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 5. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 41. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 1. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 23. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 13. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 27.
  • the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 6. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 42. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 36. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 2. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 24. [0364] In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 14.
  • the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 28.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 5 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 6.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 41 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 42.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 35 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 36. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 1 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 2. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 23 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 24.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 13 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 14. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 27 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 28.
  • the antibody neutralizes a coronavirus.
  • the coronavirus is a SARS-CoV-2 virus. In some embodiments, the coronavirus is a SARS-CoV-2 variant strain.
  • the variant strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427.
  • the antibody specifically binds an epitope on the surface of the coronavirus.
  • the epitope comprises at least a portion of a coronavirus spike protein.
  • the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein.
  • the at least a portion of a coronavirus spike protein comprises a N-Terminal domain (NTD) of a spike protein.
  • the coronavirus is a SARS-CoV-2 coronavirus.
  • the antibody is administered in combination with a second pharmaceutical agent.
  • the invention provides a bispecific molecule comprising a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain.
  • the first polypeptide chain and the second polypeptide chain are covalently bonded to one another.
  • the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 47, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 111, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 135, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 48, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 112, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 136, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 49, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 113, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 137, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%
  • the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 50, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 114, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 138, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%
  • variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13.
  • variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14.
  • variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 45, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 43.
  • variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 46, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 44.
  • variable domain of the first heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 47; CDR1, CDR2, and CDR3 of SEQ ID NO: 111; CDR1, CDR2, and CDR3 of SEQ ID NO: 135; CDR1, CDR2, and CDR3 of SEQ ID NO: 187; or CDR1, CDR2, and CDR3 of SEQ ID NO: 211.
  • variable domain of the first light chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 48, CDR1, CDR2, and CDR3 of SEQ ID NO: 112; CDR1, CDR2, and CDR3 of SEQ ID NO: 136; CDR1, CDR2, and CDR3 of SEQ ID NO: 188; or CDR1, CDR2, and CDR3 of SEQ ID NO: 212.
  • variable domain of the second heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 49, CDR1, CDR2, and CDR3 of SEQ ID NO: 113; CDR1, CDR2, and CDR3 of SEQ ID NO: 137; CDR1, CDR2, and CDR3 of SEQ ID NO: 189; or CDR1, CDR2, and CDR3 of SEQ ID NO: 213.
  • variable domain of the second light chain comprises CDR1, CDR2, and CDR3 SEQ ID NO: 50, CDR1, CDR2, and CDR3 of SEQ ID NO: 114; CDR1, CDR2, and CDR3 of SEQ ID NO: 138; CDR1, CDR2, and CDR3 of SEQ ID NO: 190; or CDR1, CDR2, and CDR3 of SEQ ID NO: 214.
  • the molecule comprises SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, and SEQ ID NO: 50.
  • the molecule comprises SEQ ID NO:111, SEQ ID NO: 112, SEQ ID NO: 113, and SEQ ID NO: 114.
  • the molecule comprises SEQ ID NO: 135, SEQ ID NO: 135, SEQ ID NO: 137, and SEQ ID NO: 138. In some embodiments, the molecule comprises SEQ ID NO: 187, SEQ ID NO: 188, SEQ ID NO: 189, and SEQ ID NO: 190. In some embodiments, the molecule comprises SEQ ID NO: 211, SEQ ID NO: 212, SEQ ID NO: 213, and SEQ ID NO: 214. [0372] In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus.
  • the coronavirus is a SARS-CoV-2 virus.
  • the SARS- CoV-2 virus strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427.
  • the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle.
  • the first epitope comprises at least a portion of a receptor binding domain (RBD) on a spike protein of a SARS-CoV-2 particle.
  • the second epitope comprises at least a portion of a N-terminal domain (NTD) on a spike protein of a SARS-CoV-2 particle.
  • the invention provides a method of treating or preventing a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a composition comprising a bispecific molecule comprising a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain.
  • the first polypeptide chain and the second polypeptide chain are covalently bonded to one another.
  • the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 47, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 111, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 135, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 48, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 112, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 136, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 49, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 113, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 137, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%
  • the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 50, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 114, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 138, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%
  • variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13.
  • variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14.
  • variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 45, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 43.
  • variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 46, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 44.
  • variable domain of the first heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 47; CDR1, CDR2, and CDR3 of SEQ ID NO: 111; CDR1, CDR2, and CDR3 of SEQ ID NO: 135; CDR1, CDR2, and CDR3 of SEQ ID NO: 187; or CDR1, CDR2, and CDR3 of SEQ ID NO: 211.
  • variable domain of the first light chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 48, CDR1, CDR2, and CDR3 of SEQ ID NO: 112; CDR1, CDR2, and CDR3 of SEQ ID NO: 136; CDR1, CDR2, and CDR3 of SEQ ID NO: 188; or CDR1, CDR2, and CDR3 of SEQ ID NO: 212.
  • variable domain of the second heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 49, CDR1, CDR2, and CDR3 of SEQ ID NO: 113; CDR1, CDR2, and CDR3 of SEQ ID NO: 137; CDR1, CDR2, and CDR3 of SEQ ID NO: 189; or CDR1, CDR2, and CDR3 of SEQ ID NO: 213.
  • variable domain of the second light chain comprises CDR1, CDR2, and CDR3 SEQ ID NO: 50, CDR1, CDR2, and CDR3 of SEQ ID NO: 114; CDR1, CDR2, and CDR3 of SEQ ID NO: 138; CDR1, CDR2, and CDR3 of SEQ ID NO: 190; or CDR1, CDR2, and CDR3 of SEQ ID NO: 214.
  • the molecule comprises SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, and SEQ ID NO: 50.
  • the molecule comprises SEQ ID NO:111, SEQ ID NO: 112, SEQ ID NO: 113, and SEQ ID NO: 114.
  • the molecule comprises SEQ ID NO: 135, SEQ ID NO: 135, SEQ ID NO: 137, and SEQ ID NO: 138. In some embodiments, the molecule comprises SEQ ID NO: 187, SEQ ID NO: 188, SEQ ID NO: 189, and SEQ ID NO: 190. In some embodiments, the molecule comprises SEQ ID NO: 211, SEQ ID NO: 212, SEQ ID NO: 213, and SEQ ID NO: 214. [0381] In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus.
  • the coronavirus is a SARS-CoV-2 virus.
  • the SARS- CoV-2 virus strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427.
  • the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle.
  • the first epitope comprises at least a portion of a receptor binding domain (RBD) on a spike protein of a SARS-CoV-2 particle.
  • RBD receptor binding domain
  • the second epitope comprises at least a portion of a N- terminal domain (NTD) on a spike protein of a SARS-CoV-2 particle.
  • the composition is administered in combination with a second therapeutic agent.
  • the invention provides a bispecific molecule comprising a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain.
  • the first polypeptide chain and the second polypeptide chain are covalently bonded to one another.
  • the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 59 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 63.
  • the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 60 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 64.
  • the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 61 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 65.
  • the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 62 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 66.
  • the first heavy chain comprises SEQ ID NO: 59 or SEQ ID NO: 63.
  • the first light chain comprises SEQ ID NO: 60 or SEQ ID NO: 64.
  • the second heavy chain comprises SEQ ID NO: 61 or SEQ ID NO: 65.
  • the second light chain comprises SEQ ID NO: 62 or SEQ ID NO: 66.
  • the variable domain of the first heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 59 or CDR1, CDR2, and CDR3 of SEQ ID NO: 63.
  • the variable domain of the first light chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 60 or CDR1, CDR2, and CDR3 of SEQ ID NO: 64.
  • variable domain of the second heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 61 or CDR1, CDR2, and CDR3 of SEQ ID NO: 65.
  • variable domain of the second light chain comprises CDR1, CDR2, and CDR3 SEQ ID NO: 62 or CDR1, CDR2, and CDR3 of SEQ ID NO: 66.
  • variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27.
  • variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28.
  • variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13.
  • variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14.
  • the variable domain of the first heavy chain comprises SEQ ID NO: 13 or SEQ ID NO: 27.
  • variable domain of the first light chain comprises SEQ ID NO: 14 or SEQ ID NO: 28.
  • variable domain of the second heavy chain comprises SEQ ID NO: 27 or SEQ ID NO: 13.
  • the variable domain of the second light chain comprises SEQ ID NO: 28 or SEQ ID NO: 14.
  • the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 59, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 60, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 61, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%,
  • the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 63, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 64, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 65, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%
  • the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 13, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%,
  • the molecule comprises SEQ ID NOs: 59, 60, 61, and 62. In some embodiments, the molecule comprises SEQ ID NOs: 63, 64, 65, and 66. In some embodiments, the molecule comprises SEQ ID NOs: 13, 14, 27, and 28. [0391] In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus strain.
  • the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle.
  • the first epitope comprises at least a portion of a receptor binding domain (RBD) on an S protein of a SARS-CoV-2 particle.
  • the second epitope comprises at least a portion of a N-terminal domain (NTD) on an S protein of a SARS-CoV-2 particle.
  • the invention provides a method of treating a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a composition comprising a bispecific molecule, wherein the bispecific molecule comprises a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain.
  • the first polypeptide chain and the second polypeptide chain are covalently bonded to one another.
  • the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 59 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 63.
  • the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 60 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 64.
  • the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 61 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 65.
  • the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 62 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 66.
  • the first heavy chain comprises SEQ ID NO: 59 or SEQ ID NO: 63.
  • the first light chain comprises SEQ ID NO: 60 or SEQ ID NO: 64.
  • the second heavy chain comprises SEQ ID NO: 61 or SEQ ID NO: 65.
  • the second light chain comprises SEQ ID NO: 62 or SEQ ID NO: 66.
  • the variable domain of the first heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 59 or CDR1, CDR2, and CDR3 of SEQ ID NO: 63.
  • the variable domain of the first light chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 60 or CDR1, CDR2, and CDR3 of SEQ ID NO: 64.
  • variable domain of the second heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 61 or CDR1, CDR2, and CDR3 of SEQ ID NO: 65.
  • variable domain of the second light chain comprises CDR1, CDR2, and CDR3 SEQ ID NO: 62 or CDR1, CDR2, and CDR3 of SEQ ID NO: 66.
  • variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27.
  • variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28.
  • variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13.
  • variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14.
  • the variable domain of the first heavy chain comprises SEQ ID NO: 13 or SEQ ID NO: 27.
  • variable domain of the first light chain comprises SEQ ID NO: 14 or SEQ ID NO: 28.
  • variable domain of the second heavy chain comprises SEQ ID NO: 27 or SEQ ID NO: 13.
  • the variable domain of the second light chain comprises SEQ ID NO: 28 or SEQ ID NO: 14.
  • the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 59, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 60, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 61, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%,
  • the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 63, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 64, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 65, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%
  • the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 13, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%,
  • the molecule comprises SEQ ID NOs: 59, 60, 61, and 62. In some embodiments, the molecule comprises SEQ ID NOs: 63, 64, 65, and 66. In some embodiments, the molecule comprises SEQ ID NOs: 13, 14, 27, and 28. [0399] In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus strain.
  • the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle.
  • the first epitope comprises at least a portion of a receptor binding domain (RBD) on a spike protein of a SARS-CoV-2 particle.
  • the second epitope comprises at least a portion of a N-terminal domain (NTD) on a spike protein of a SARS-CoV-2 particle.
  • the composition is administered in combination with a second therapeutic agent.
  • the invention provides a method of preventing a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a composition comprising a bispecific molecule, wherein the bispecific molecule comprises a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain.
  • the first polypeptide chain and the second polypeptide chain are covalently bonded to one another.
  • the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 59 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 63.
  • the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 60 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 64.
  • the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 61 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 65.
  • the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 62 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 66.
  • the first heavy chain comprises SEQ ID NO: 59 or SEQ ID NO: 63.
  • the first light chain comprises SEQ ID NO: 60 or SEQ ID NO: 64.
  • the second heavy chain comprises SEQ ID NO: 61 or SEQ ID NO: 65.
  • the second light chain comprises SEQ ID NO: 62 or SEQ ID NO: 66.
  • the variable domain of the first heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 59 or CDR1, CDR2, and CDR3 of SEQ ID NO: 63.
  • the variable domain of the first light chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 60 or CDR1, CDR2, and CDR3 of SEQ ID NO: 64.
  • variable domain of the second heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 61 or CDR1, CDR2, and CDR3 of SEQ ID NO: 65.
  • variable domain of the second light chain comprises CDR1, CDR2, and CDR3 SEQ ID NO: 62 or CDR1, CDR2, and CDR3 of SEQ ID NO: 66.
  • variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27.
  • variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28.
  • variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13.
  • variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14.
  • the variable domain of the first heavy chain comprises SEQ ID NO: 13 or SEQ ID NO: 27.
  • variable domain of the first light chain comprises SEQ ID NO: 14 or SEQ ID NO: 28.
  • variable domain of the second heavy chain comprises SEQ ID NO: 27 or SEQ ID NO: 13.
  • the variable domain of the second light chain comprises SEQ ID NO: 28 or SEQ ID NO: 14.
  • the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 59, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 60, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 61, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%,
  • the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 63, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 64, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 65, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%
  • the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 13, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%,
  • the molecule comprises SEQ ID NOs: 59, 60, 61, and 62. In some embodiments, the molecule comprises SEQ ID NOs: 63, 64, 65, and 66. In some embodiments, the molecule comprises SEQ ID NOs: 13, 14, 27, and 28. [0408] In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus strain.
  • the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle.
  • the first epitope comprises at least a portion of a receptor binding domain (RBD) on an S protein of a SARS-CoV-2 particle.
  • the second epitope comprises at least a portion of a N-terminal domain (NTD) on an S protein of a SARS-CoV-2 particle.
  • the composition is administered in combination with a second therapeutic agent.
  • the invention provides a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable domain and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16.
  • the heavy chain variable domain comprises SEQ ID NO: 15.
  • the light chain variable domain comprises SEQ ID NO: 16.
  • the antibody comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15 and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16.
  • the antibody comprises SEQ ID NO: 15 and SEQ ID NO: 16.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 15.
  • the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 16.
  • the antibody neutralizes a coronavirus.
  • the coronavirus is SARS-CoV-2.
  • the antibody specifically binds an epitope on the surface of the coronavirus.
  • the epitope comprises at least a portion of a coronavirus spike protein.
  • the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein.
  • RBD receptor binding domain
  • the coronavirus is a SARS-CoV-2 coronavirus.
  • the invention provides a method of treating a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable domain and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16.
  • the heavy chain variable domain comprises SEQ ID NO: 15.
  • the light chain variable domain comprises SEQ ID NO: 16.
  • the antibody comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15 and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16.
  • the antibody comprises SEQ ID NO: 15 and SEQ ID NO: 16.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 15. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 16.
  • the antibody neutralizes a coronavirus. In some embodiments, the coronavirus is SARS-CoV-2. In some embodiments, the antibody neutralizes a coronavirus. In some embodiments, the coronavirus is SARS-CoV-2. In some embodiments, the antibody specifically binds an epitope on the surface of the coronavirus. In some embodiments, the epitope comprises at least a portion of a coronavirus spike protein.
  • the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein.
  • the coronavirus is a SARS- CoV-2 coronavirus.
  • the antibody is administered in combination with a second pharmaceutical agent.
  • the invention provides a method of preventing a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16.
  • the heavy chain variable domain comprises SEQ ID NO: 15.
  • the light chain variable domain comprises SEQ ID NO: 16.
  • the antibody comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15 and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16.
  • the antibody comprises SEQ ID NO: 15 and SEQ ID NO: 16.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 15. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 16.
  • the antibody neutralizes a coronavirus. In some embodiments, the coronavirus is SARS-CoV-2. In some embodiments, the antibody neutralizes a coronavirus. In some embodiments, the coronavirus is SARS-CoV-2. In some embodiments, the antibody specifically binds an epitope on the surface of the coronavirus. In some embodiments, the epitope comprises at least a portion of a coronavirus spike protein.
  • the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein.
  • the coronavirus is a SARS- CoV-2 coronavirus.
  • the antibody is administered in combination with a second pharmaceutical agent.
  • the invention provides a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable domain and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 3, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 7, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 9, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%,
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 19, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 21, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 25, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%,
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 33, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 37, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 39, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 4, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 8, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 10, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%,
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 20, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 22, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 26, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%,
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 34, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 38, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 40, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 3 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 4.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 7 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 8.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 9 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 10.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 11 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 12.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 17 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 18.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 19 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 20.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 21 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 22.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 25 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 26.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 29 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 30.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 31 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 32.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 33 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 34.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 37 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 38.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 39 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 40.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 43 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 44.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 45 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 46.
  • the heavy chain variable domain comprises SEQ ID NO: 3 and the light chain variable domain comprises SEQ ID NO: 4.
  • the heavy chain variable domain comprises SEQ ID NO: 7 and the light chain variable domain comprises SEQ ID NO: 8. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 9 and the light chain variable domain comprises SEQ ID NO: 10. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 11 and the light chain variable domain comprises SEQ ID NO: 12. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 17 and the light chain variable domain comprises SEQ ID NO: 18. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 19 and the light chain variable domain comprises SEQ ID NO: 20. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 21 and the light chain variable domain comprises SEQ ID NO: 22.
  • the heavy chain variable domain comprises SEQ ID NO: 25 and the light chain variable domain comprises SEQ ID NO: 26. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 29 and the light chain variable domain comprises SEQ ID NO: 30. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 31 and the light chain variable domain comprises SEQ ID NO: 32. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 33 and the light chain variable domain comprises SEQ ID NO: 34. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 37 and the light chain variable domain comprises SEQ ID NO: 38. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 39 and the light chain variable domain comprises SEQ ID NO: 40.
  • the heavy chain variable domain comprises SEQ ID NO: 43 and the light chain variable domain comprises SEQ ID NO: 44. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 45 and the light chain variable domain comprises SEQ ID NO: 46. [0433] In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 3; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 7; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 9; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 11; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 17.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 19; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 21; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 25; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 29; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 31.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 33; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 37; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 39; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 43; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 45.
  • the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 4; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 8; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 10; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 12; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 18.
  • the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 20; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 22; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 26; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 30; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 32.
  • the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 34; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 38; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 40; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 44; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 46.
  • the antibody neutralizes a coronavirus.
  • the coronavirus is a SARS-CoV-2 virus.
  • the coronavirus is a SARS-CoV-2 variant strain.
  • the variant strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427.
  • the antibody specifically binds an epitope on the surface of the coronavirus.
  • the epitope comprises at least a portion of a coronavirus spike protein.
  • the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein.
  • the at least a portion of a coronavirus spike protein comprises a N-Terminal domain (NTD) of a spike protein.
  • the coronavirus is a SARS-CoV-2 coronavirus.
  • the invention provides a method of treating or preventing a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable domain and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 3, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 7, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 9, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%,
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 19, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 21, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 25, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%,
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 33, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 37, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 39, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 4, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 8, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 10, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%,
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 20, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 22, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 26, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%,
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 34, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 38, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 40, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 3 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 4.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 7 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 8.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 9 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 10.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 11 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 12.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 17 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 18.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 19 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 20.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 21 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 22.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 25 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 26.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 29 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 30.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 31 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 32.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 33 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 34.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 37 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 38.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 39 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 40.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 43 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 44.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 45 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 46.
  • the heavy chain variable domain comprises SEQ ID NO: 3 and the light chain variable domain comprises SEQ ID NO: 4.
  • the heavy chain variable domain comprises SEQ ID NO: 7 and the light chain variable domain comprises SEQ ID NO: 8. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 9 and the light chain variable domain comprises SEQ ID NO: 10. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 11 and the light chain variable domain comprises SEQ ID NO: 12. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 17 and the light chain variable domain comprises SEQ ID NO: 18. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 19 and the light chain variable domain comprises SEQ ID NO: 20. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 21 and the light chain variable domain comprises SEQ ID NO: 22.
  • the heavy chain variable domain comprises SEQ ID NO: 25 and the light chain variable domain comprises SEQ ID NO: 26. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 29 and the light chain variable domain comprises SEQ ID NO: 30. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 31 and the light chain variable domain comprises SEQ ID NO: 32. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 33 and the light chain variable domain comprises SEQ ID NO: 34. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 37 and the light chain variable domain comprises SEQ ID NO: 38. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 39 and the light chain variable domain comprises SEQ ID NO: 40.
  • the heavy chain variable domain comprises SEQ ID NO: 43 and the light chain variable domain comprises SEQ ID NO: 44. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 45 and the light chain variable domain comprises SEQ ID NO: 46. [0447] In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 3; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 7; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 9; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 11; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 17.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 19; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 21; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 25; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 29; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 31.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 33; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 37; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 39; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 43; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 45.
  • the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 4; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 8; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 10; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 12; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 18.
  • the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 20; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 22; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 26; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 30; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 32.
  • the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 34; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 38; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 40; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 44; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 46.
  • the antibody neutralizes a coronavirus.
  • the coronavirus is a SARS-CoV-2 virus.
  • the coronavirus is a SARS-CoV-2 variant strain.
  • the variant strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427.
  • the antibody specifically binds an epitope on the surface of the coronavirus.
  • the epitope comprises at least a portion of a coronavirus spike protein.
  • the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein.
  • the at least a portion of a coronavirus spike protein comprises a N-Terminal domain (NTD) of a spike protein.
  • the coronavirus is a SARS-CoV-2 coronavirus.
  • the composition is administered in combination with a second therapeutic agent.
  • the invention provides a bispecific molecule comprising a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain.
  • the first polypeptide chain and the second polypeptide chain are covalently bonded to one another.
  • the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 51, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 55, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 67, a polypeptide
  • the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 52, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 56, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 68; a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 53, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 57, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 69, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%
  • the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 54, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 58, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 70, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 8
  • variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 8
  • variable domain of the first heavy chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 51; the CDR1, CDR2, and CDR3 of SEQ ID NO: 55; the CDR1, CDR2, and CDR3 of SEQ ID NO: 67; the CDR1, CDR2, and CDR3 of SEQ ID NO: 71; the CDR1, CDR2, and CDR3 of SEQ ID NO: 75; the CDR1, CDR2, and CDR3 of SEQ ID NO: 79; the CDR1, CDR2, and CDR3 of SEQ ID NO: 83; the CDR1, CDR2, and CDR3 of SEQ ID NO: 87; the CDR1, CDR2, and CDR3 of SEQ ID NO: 91; the CDR1, CDR2, and CDR3 of SEQ ID NO: 95; the CDR1, CDR2, and CDR3 of SEQ ID NO: 99; the CDR1, CDR2, and CDR3 of SEQ ID NO: 103; the CDR1, CDR2, and CDR3
  • variable domain of the first light chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 52; the CDR1, CDR2, and CDR3 of SEQ ID NO: 56; the CDR1, CDR2, and CDR3 of SEQ ID NO: 68; the CDR1, CDR2, and CDR3 of SEQ ID NO: 72; the CDR1, CDR2, and CDR3 of SEQ ID NO: 76; the CDR1, CDR2, and CDR3 of SEQ ID NO: 80; the CDR1, CDR2, and CDR3 of SEQ ID NO: 84; the CDR1, CDR2, and CDR3 of SEQ ID NO: 88; the CDR1, CDR2, and CDR3 of SEQ ID NO: 92; the CDR1, CDR2, and CDR3 of SEQ ID NO: 96; the CDR1, CDR2, and CDR3 of SEQ ID NO: 100; the CDR1, CDR2, and CDR3 of SEQ ID NO: 104; the CDR1, CDR2, and CDR3
  • variable domain of the second heavy chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 53; the CDR1, CDR2, and CDR3 of SEQ ID NO: 57; the CDR1, CDR2, and CDR3 of SEQ ID NO: 69; the CDR1, CDR2, and CDR3 of SEQ ID NO: 73; the CDR1, CDR2, and CDR3 of SEQ ID NO: 77; the CDR1, CDR2, and CDR3 of SEQ ID NO: 81; the CDR1, CDR2, and CDR3 of SEQ ID NO: 85; the CDR1, CDR2, and CDR3 of SEQ ID NO: 89; the CDR1, CDR2, and CDR3 of SEQ ID NO: 93; the CDR1, CDR2, and CDR3 of SEQ ID NO: 97; the CDR1, CDR2, and CDR3 of SEQ ID NO: 101; the CDR1, CDR2, and CDR3 of SEQ ID NO: 105;
  • variable domain of the second light chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 54; the CDR1, CDR2, and CDR3 of SEQ ID NO: 58; the CDR1, CDR2, and CDR3 of SEQ ID NO: 70; the CDR1, CDR2, and CDR3 of SEQ ID NO: 74; the CDR1, CDR2, and CDR3 of SEQ ID NO: 78; the CDR1, CDR2, and CDR3 of SEQ ID NO: 82; the CDR1, CDR2, and CDR3 of SEQ ID NO: 86; the CDR1, CDR2, and CDR3 of SEQ ID NO: 90; the CDR1, CDR2, and CDR3 of SEQ ID NO: 94; the CDR1, CDR2, and CDR3 of SEQ ID NO: 98; the CDR1, CDR2, and CDR3 of SEQ ID NO: 102; the CDR1, CDR2, and CDR3 of SEQ ID NO: 106;
  • the molecule comprises SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, and SEQ ID NO: 54. In some embodiments, the molecule comprises SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 57, and SEQ ID NO: 58. In some embodiments, the molecule comprises SEQ ID NO: 67, SEQ ID NO: 68, SEQ ID NO: 69, and SEQ ID NO: 70. In some embodiments, the molecule comprises SEQ ID NO: 71, SEQ ID NO: 72, SEQ ID NO: 73, and SEQ ID NO: 74.
  • the molecule comprises SEQ ID NO: 75, SEQ ID NO: 76, SEQ ID NO: 77, and SEQ ID NO: 78. In some embodiments, the molecule comprises SEQ ID NO: 79, SEQ ID NO: 80, SEQ ID NO: 81, and SEQ ID NO: 82. In some embodiments, the molecule comprises SEQ ID NO: 83, SEQ ID NO: 84, SEQ ID NO: 85, and SEQ ID NO: 86. In some embodiments, the molecule comprises SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, and SEQ ID NO: 90.
  • the molecule comprises SEQ ID NO: 91, SEQ ID NO: 92, SEQ ID NO: 93, and SEQ ID NO: 94. In some embodiments, the molecule comprises SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, and SEQ ID NO: 98. In some embodiments, the molecule comprises SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, and SEQ ID NO: 102. In some embodiments, the molecule comprises SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, and SEQ ID NO: 106.
  • the molecule comprises SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, and SEQ ID NO: 110. In some embodiments, the molecule comprises SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117, and SEQ ID NO: 118. In some embodiments, the molecule comprises SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, and SEQ ID NO: 122. [0464] In some embodiments, the molecule comprises SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, and SEQ ID NO: 126.
  • the molecule comprises SEQ ID NO: 127, SEQ ID NO: 128, SEQ ID NO: 129, and SEQ ID NO: 130. In some embodiments, the molecule comprises SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, and SEQ ID NO: 133. In some embodiments, the molecule comprises SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, and SEQ ID NO: 142. In some embodiments, the molecule comprises SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145, and SEQ ID NO: 146.
  • the molecule comprises SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, and SEQ ID NO: 150. In some embodiments, the molecule comprises SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, and SEQ ID NO: 154. In some embodiments, the molecule comprises SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, and SEQ ID NO: 158. In some embodiments, the molecule comprises SEQ ID NO: 159, SEQ ID NO: 160, SEQ ID NO: 161, and SEQ ID NO: 162.
  • the molecule comprises SEQ ID NO: 163, SEQ ID NO: 164, SEQ ID NO: 165, and SEQ ID NO: 166. In some embodiments, the molecule comprises SEQ ID NO: 167, SEQ ID NO: 168, SEQ ID NO: 169, and SEQ ID NO: 170. In some embodiments, the molecule comprises SEQ ID NO: 171, SEQ ID NO: 172, SEQ ID NO: 173, and SEQ ID NO: 174. In some embodiments, the molecule comprises SEQ ID NO: 175, SEQ ID NO: 176, SEQ ID NO: 177, and SEQ ID NO: 178.
  • the molecule comprises SEQ ID NO: 179, SEQ ID NO: 180, SEQ ID NO: 181, and SEQ ID NO: 182. In some embodiments, the molecule comprises SEQ ID NO: 183, SEQ ID NO: 184, SEQ ID NO: 185, and SEQ ID NO: 186. [0465] In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus.
  • the SARS- CoV-2 virus strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427.
  • the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle.
  • the first epitope comprises at least a portion of a receptor binding domain (RBD) on a spike protein of a SARS-CoV-2 particle.
  • the second epitope comprises at least a portion of a N- terminal domain (NTD) on a spike protein of a SARS-CoV-2 particle.
  • the invention provides a method of treating or preventing a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a composition comprising a bispecific molecule comprising a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain.
  • the first polypeptide chain and the second polypeptide chain are covalently bonded to one another.
  • the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 51, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 55, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 67, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 52, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 56, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 68; a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 53, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 57, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 69, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%
  • the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 54, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 58, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 70, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 8
  • variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 8
  • variable domain of the first heavy chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 51; the CDR1, CDR2, and CDR3 of SEQ ID NO: 55; the CDR1, CDR2, and CDR3 of SEQ ID NO: 67; the CDR1, CDR2, and CDR3 of SEQ ID NO: 71; the CDR1, CDR2, and CDR3 of SEQ ID NO: 75; the CDR1, CDR2, and CDR3 of SEQ ID NO: 79; the CDR1, CDR2, and CDR3 of SEQ ID NO: 83; the CDR1, CDR2, and CDR3 of SEQ ID NO: 87; the CDR1, CDR2, and CDR3 of SEQ ID NO: 91; the CDR1, CDR2, and CDR3 of SEQ ID NO: 95; the CDR1, CDR2, and CDR3 of SEQ ID NO: 99; the CDR1, CDR2, and CDR3 of SEQ ID NO: 103; the CDR1, CDR2, and CDR3
  • variable domain of the first light chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 52; the CDR1, CDR2, and CDR3 of SEQ ID NO: 56; the CDR1, CDR2, and CDR3 of SEQ ID NO: 68; the CDR1, CDR2, and CDR3 of SEQ ID NO: 72; the CDR1, CDR2, and CDR3 of SEQ ID NO: 76; the CDR1, CDR2, and CDR3 of SEQ ID NO: 80; the CDR1, CDR2, and CDR3 of SEQ ID NO: 84; the CDR1, CDR2, and CDR3 of SEQ ID NO: 88; the CDR1, CDR2, and CDR3 of SEQ ID NO: 92; the CDR1, CDR2, and CDR3 of SEQ ID NO: 96; the CDR1, CDR2, and CDR3 of SEQ ID NO: 100; the CDR1, CDR2, and CDR3 of SEQ ID NO: 104; the CDR1, CDR2, and CDR3
  • variable domain of the second heavy chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 53; the CDR1, CDR2, and CDR3 of SEQ ID NO: 57; the CDR1, CDR2, and CDR3 of SEQ ID NO: 69; the CDR1, CDR2, and CDR3 of SEQ ID NO: 73; the CDR1, CDR2, and CDR3 of SEQ ID NO: 77; the CDR1, CDR2, and CDR3 of SEQ ID NO: 81; the CDR1, CDR2, and CDR3 of SEQ ID NO: 85; the CDR1, CDR2, and CDR3 of SEQ ID NO: 89; the CDR1, CDR2, and CDR3 of SEQ ID NO: 93; the CDR1, CDR2, and CDR3 of SEQ ID NO: 97; the CDR1, CDR2, and CDR3 of SEQ ID NO: 101; the CDR1, CDR2, and CDR3 of SEQ ID NO: 105;
  • variable domain of the second light chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 54; the CDR1, CDR2, and CDR3 of SEQ ID NO: 58; the CDR1, CDR2, and CDR3 of SEQ ID NO: 70; the CDR1, CDR2, and CDR3 of SEQ ID NO: 74; the CDR1, CDR2, and CDR3 of SEQ ID NO: 78; the CDR1, CDR2, and CDR3 of SEQ ID NO: 82; the CDR1, CDR2, and CDR3 of SEQ ID NO: 86; the CDR1, CDR2, and CDR3 of SEQ ID NO: 90; the CDR1, CDR2, and CDR3 of SEQ ID NO: 94; the CDR1, CDR2, and CDR3 of SEQ ID NO: 98; the CDR1, CDR2, and CDR3 of SEQ ID NO: 102; the CDR1, CDR2, and CDR3 of SEQ ID NO: 106;
  • the molecule comprises SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, and SEQ ID NO: 54. In some embodiments, the molecule comprises SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 57, and SEQ ID NO: 58. In some embodiments, the molecule comprises SEQ ID NO: 67, SEQ ID NO: 68, SEQ ID NO: 69, and SEQ ID NO: 70. In some embodiments, the molecule comprises SEQ ID NO: 71, SEQ ID NO: 72, SEQ ID NO: 73, and SEQ ID NO: 74.
  • the molecule comprises SEQ ID NO: 75, SEQ ID NO: 76, SEQ ID NO: 77, and SEQ ID NO: 78. In some embodiments, the molecule comprises SEQ ID NO: 79, SEQ ID NO: 80, SEQ ID NO: 81, and SEQ ID NO: 82. In some embodiments, the molecule comprises SEQ ID NO: 83, SEQ ID NO: 84, SEQ ID NO: 85, and SEQ ID NO: 86. In some embodiments, the molecule comprises SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, and SEQ ID NO: 90.
  • the molecule comprises SEQ ID NO: 91, SEQ ID NO: 92, SEQ ID NO: 93, and SEQ ID NO: 94. In some embodiments, the molecule comprises SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, and SEQ ID NO: 98. In some embodiments, the molecule comprises SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, and SEQ ID NO: 102. In some embodiments, the molecule comprises SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, and SEQ ID NO: 106.
  • the molecule comprises SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, and SEQ ID NO: 110. In some embodiments, the molecule comprises SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117, and SEQ ID NO: 118. [0481] In some embodiments, the molecule comprises SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, and SEQ ID NO: 122. In some embodiments, the molecule comprises SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, and SEQ ID NO: 126.
  • the molecule comprises SEQ ID NO: 127, SEQ ID NO: 128, SEQ ID NO: 129, and SEQ ID NO: 130. In some embodiments, the molecule comprises SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, and SEQ ID NO: 133. In some embodiments, the molecule comprises SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, and SEQ ID NO: 142. In some embodiments, the molecule comprises SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145, and SEQ ID NO: 146.
  • the molecule comprises SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, and SEQ ID NO: 150. In some embodiments, the molecule comprises SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, and SEQ ID NO: 154. In some embodiments, the molecule comprises SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, and SEQ ID NO: 158. In some embodiments, the molecule comprises SEQ ID NO: 159, SEQ ID NO: 160, SEQ ID NO: 161, and SEQ ID NO: 162.
  • the molecule comprises SEQ ID NO: 163, SEQ ID NO: 164, SEQ ID NO: 165, and SEQ ID NO: 166. In some embodiments, the molecule comprises SEQ ID NO: 167, SEQ ID NO: 168, SEQ ID NO: 169, and SEQ ID NO: 170. In some embodiments, the molecule comprises SEQ ID NO: 171, SEQ ID NO: 172, SEQ ID NO: 173, and SEQ ID NO: 174. In some embodiments, the molecule comprises SEQ ID NO: 175, SEQ ID NO: 176, SEQ ID NO: 177, and SEQ ID NO: 178.
  • the molecule comprises SEQ ID NO: 179, SEQ ID NO: 180, SEQ ID NO: 181, and SEQ ID NO: 182. In some embodiments, the molecule comprises SEQ ID NO: 183, SEQ ID NO: 184, SEQ ID NO: 185, and SEQ ID NO: 186. [0482] In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus.
  • the SARS- CoV-2 virus strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427.
  • the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle.
  • the first epitope comprises at least a portion of a receptor binding domain (RBD) on a spike protein of a SARS-CoV-2 particle.
  • the second epitope comprises at least a portion of a N-terminal domain (NTD) on a spike protein of a SARS-CoV-2 particle.
  • the composition is administered in combination with a second therapeutic agent.
  • the invention provides a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable domain and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 41.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 1.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 23.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 42.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 2.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 24.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 41 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 42.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 1 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 2.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 23 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 24.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28.
  • the heavy chain variable domain comprises SEQ ID NO: 5 and the light chain variable domain comprises SEQ ID NO: 6.
  • the heavy chain variable domain comprises SEQ ID NO: 41 and the light chain variable domain comprises SEQ ID NO: 42. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 35 and the light chain variable domain comprises SEQ ID NO: 36. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 1 and the light chain variable domain comprises SEQ ID NO: 2. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 23 and the light chain variable domain comprises SEQ ID NO: 24. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 13 and the light chain variable domain comprises SEQ ID NO: 14. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 27 and the light chain variable domain comprises SEQ ID NO: 28.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 5. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 41. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 1. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 23. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 13. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 27.
  • the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 6. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 42. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 36. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 2. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 24. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 14.
  • the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 28.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 5 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 6.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 41 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 42.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 35 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 36. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 1 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 2. [0490] In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 23 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 24.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 13 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 14. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 27 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 28.
  • the antibody neutralizes a coronavirus.
  • the coronavirus is a SARS-CoV-2 virus. In some embodiments, the coronavirus is a SARS-CoV-2 variant strain.
  • the variant strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427.
  • the antibody specifically binds an epitope on the surface of the coronavirus.
  • the epitope comprises at least a portion of a coronavirus spike protein.
  • the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein.
  • the at least a portion of a coronavirus spike protein comprises a N-Terminal domain (NTD) of a spike protein.
  • the coronavirus is a SARS-CoV-2 coronavirus.
  • the invention provides a method of treating or preventing a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable domain and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 41.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 1.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 23.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 42.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 2.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 24.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14.
  • the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 41 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 42.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 1 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 2.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 23 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 24.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14.
  • the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28.
  • the heavy chain variable domain comprises SEQ ID NO: 5 and the light chain variable domain comprises SEQ ID NO: 6.
  • the heavy chain variable domain comprises SEQ ID NO: 41 and the light chain variable domain comprises SEQ ID NO: 42. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 35 and the light chain variable domain comprises SEQ ID NO: 36. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 1 and the light chain variable domain comprises SEQ ID NO: 2. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 23 and the light chain variable domain comprises SEQ ID NO: 24. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 13 and the light chain variable domain comprises SEQ ID NO: 14. [0498] In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 27 and the light chain variable domain comprises SEQ ID NO: 28.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 5. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 41. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 1. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 23. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 13. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 27.
  • the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 6. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 42. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 36. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 2. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 24. [0499] In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 14.
  • the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 28.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 5 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 6.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 41 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 42.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 35 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 36. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 1 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 2. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 23 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 24.
  • the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 13 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 14. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 27 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 28.
  • the antibody neutralizes a coronavirus.
  • the coronavirus is a SARS-CoV-2 virus. In some embodiments, the coronavirus is a SARS-CoV-2 variant strain.
  • the variant strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427.
  • the antibody specifically binds an epitope on the surface of the coronavirus.
  • the epitope comprises at least a portion of a coronavirus spike protein.
  • the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein.
  • the at least a portion of a coronavirus spike protein comprises a N-Terminal domain (NTD) of a spike protein.
  • the coronavirus is a SARS-CoV-2 coronavirus.
  • the antibody is administered in combination with a second pharmaceutical agent.
  • the invention provides a bispecific molecule comprising a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain.
  • the first polypeptide chain and the second polypeptide chain are covalently bonded to one another.
  • the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 47, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 111, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 135, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 48, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 112, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 136, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 49, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 113, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 137, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%
  • the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 50, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 114, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 138, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%
  • variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13.
  • variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14.
  • variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 45, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 43.
  • variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 46, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 44.
  • variable domain of the first heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 47; CDR1, CDR2, and CDR3 of SEQ ID NO: 111; CDR1, CDR2, and CDR3 of SEQ ID NO: 135; CDR1, CDR2, and CDR3 of SEQ ID NO: 187; or CDR1, CDR2, and CDR3 of SEQ ID NO: 211.
  • variable domain of the first light chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 48, CDR1, CDR2, and CDR3 of SEQ ID NO: 112; CDR1, CDR2, and CDR3 of SEQ ID NO: 136; CDR1, CDR2, and CDR3 of SEQ ID NO: 188; or CDR1, CDR2, and CDR3 of SEQ ID NO: 212.
  • variable domain of the second heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 49, CDR1, CDR2, and CDR3 of SEQ ID NO: 113; CDR1, CDR2, and CDR3 of SEQ ID NO: 137; CDR1, CDR2, and CDR3 of SEQ ID NO: 189; or CDR1, CDR2, and CDR3 of SEQ ID NO: 213.
  • variable domain of the second light chain comprises CDR1, CDR2, and CDR3 SEQ ID NO: 50, CDR1, CDR2, and CDR3 of SEQ ID NO: 114; CDR1, CDR2, and CDR3 of SEQ ID NO: 138; CDR1, CDR2, and CDR3 of SEQ ID NO: 190; or CDR1, CDR2, and CDR3 of SEQ ID NO: 214.
  • the molecule comprises SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, and SEQ ID NO: 50.
  • the molecule comprises SEQ ID NO:111, SEQ ID NO: 112, SEQ ID NO: 113, and SEQ ID NO: 114.
  • the molecule comprises SEQ ID NO: 135, SEQ ID NO: 135, SEQ ID NO: 137, and SEQ ID NO: 138. In some embodiments, the molecule comprises SEQ ID NO: 187, SEQ ID NO: 188, SEQ ID NO: 189, and SEQ ID NO: 190. In some embodiments, the molecule comprises SEQ ID NO: 211, SEQ ID NO: 212, SEQ ID NO: 213, and SEQ ID NO: 214. [0507] In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus.
  • the coronavirus is a SARS-CoV-2 virus.
  • the SARS- CoV-2 virus strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427.
  • the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle.
  • the first epitope comprises at least a portion of a receptor binding domain (RBD) on a spike protein of a SARS-CoV-2 particle.
  • the second epitope comprises at least a portion of a N-terminal domain (NTD) on a spike protein of a SARS-CoV-2 particle.
  • the invention provides a method of treating or preventing a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a composition comprising a bispecific molecule comprising a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain.
  • the first polypeptide chain and the second polypeptide chain are covalently bonded to one another.
  • the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 47, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 111, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 135, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 48, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 112, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 136, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%,
  • the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 49, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 113, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 137, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%
  • the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 50, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 114, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 138, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%
  • variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13.
  • variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14.
  • variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 45, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 43.
  • variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 46, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 44.
  • variable domain of the first heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 47; CDR1, CDR2, and CDR3 of SEQ ID NO: 111; CDR1, CDR2, and CDR3 of SEQ ID NO: 135; CDR1, CDR2, and CDR3 of SEQ ID NO: 187; or CDR1, CDR2, and CDR3 of SEQ ID NO: 211.
  • variable domain of the first light chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 48, CDR1, CDR2, and CDR3 of SEQ ID NO: 112; CDR1, CDR2, and CDR3 of SEQ ID NO: 136; CDR1, CDR2, and CDR3 of SEQ ID NO: 188; or CDR1, CDR2, and CDR3 of SEQ ID NO: 212.
  • variable domain of the second heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 49, CDR1, CDR2, and CDR3 of SEQ ID NO: 113; CDR1, CDR2, and CDR3 of SEQ ID NO: 137; CDR1, CDR2, and CDR3 of SEQ ID NO: 189; or CDR1, CDR2, and CDR3 of SEQ ID NO: 213.
  • variable domain of the second light chain comprises CDR1, CDR2, and CDR3 SEQ ID NO: 50, CDR1, CDR2, and CDR3 of SEQ ID NO: 114; CDR1, CDR2, and CDR3 of SEQ ID NO: 138; CDR1, CDR2, and CDR3 of SEQ ID NO: 190; or CDR1, CDR2, and CDR3 of SEQ ID NO: 214.
  • the molecule comprises SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, and SEQ ID NO: 50.
  • the molecule comprises SEQ ID NO:111, SEQ ID NO: 112, SEQ ID NO: 113, and SEQ ID NO: 114.
  • the molecule comprises SEQ ID NO: 135, SEQ ID NO: 135, SEQ ID NO: 137, and SEQ ID NO: 138. In some embodiments, the molecule comprises SEQ ID NO: 187, SEQ ID NO: 188, SEQ ID NO: 189, and SEQ ID NO: 190. In some embodiments, the molecule comprises SEQ ID NO: 211, SEQ ID NO: 212, SEQ ID NO: 213, and SEQ ID NO: 214. [0516] In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus.
  • the coronavirus is a SARS-CoV-2 virus.
  • the SARS- CoV-2 virus strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427.
  • the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle.
  • the first epitope comprises at least a portion of a receptor binding domain (RBD) on a spike protein of a SARS-CoV-2 particle.
  • RBD receptor binding domain
  • the second epitope comprises at least a portion of a N- terminal domain (NTD) on a spike protein of a SARS-CoV-2 particle.
  • the composition is administered in combination with a second therapeutic agent.
  • Antibodies are glycoproteins with an immunoglobulin (Ig) monomeric functional domain. Secreted antibodies can have multiple Ig units.
  • the Ig monomer is a “Y”-shaped molecule with four polypeptide chains: two identical heavy chains and two identical light chains. The chains can be connected by disulfide bonds.
  • each heavy chain comprises of two regions – the constant region and the variable region.
  • the constant region is identical in all antibodies of the same isotype, but differs in antibodies of different isotypes.
  • the variable region of the heavy chain differs in antibodies produced by different B cells, but is the same for all antibodies produced by a single B cell or a B cell clone.
  • the variable region of each heavy chain is approximately 110 amino acids long.
  • a light chain comprises of two domains, the constant domain and the variable domain.
  • the approximate length of the light chain is 211 to 217 amino acids.
  • Each antibody contains two identical light chains.
  • the two arms of the Y-shaped antibody molecule include the antibody binding sites, which that can bind two antigens.
  • the two antigens can be identical or they can be different for example in bispecific antibodies.
  • This region of the antibody is called the Fab (fragment, antigen binding) region and it confers the antibody with its specificity.
  • the Fab includes one constant and one variable domain from each heavy and each light chain of the antibody.
  • the variable domain also called the Fv region, is the most important region for recognizing and binding to antigens such as viral proteins or receptors on the surface of host cells.
  • variable loops light chain VL
  • variable loops on the heavy chain of the antibody which are responsible for binding to the antigen.
  • the loops are called the complementarity determining regions (CDRs).
  • CDRs complementarity determining regions
  • the base of the Y-shaped molecule is called the Fc (Fragment, crystallizable) region and it is important for modulating immune cell activity.
  • the Fc includes two heavy chains and it can bind to specific to ensure that each antibody generates an appropriate immune response for a particular antigen. It can also mediate different physiological effects including opsonization, cell lysis, and degranulation of mast cells, basophils and eosinophils.
  • the subject matter described herein relates to monoclonal and bispecific antibodies, variants, fusion proteins comprising an antibody portion with an antigen recognition site of the required specificity.
  • antigen-binding fragment of an antibody is a portion of an antibody that possesses an at least one antigen recognition site. Fragments include for example but not limited to Fab, Fab', F(ab')2 Fv), and single chain (scFv).
  • the antibodies can be produced recombinantly by any means known in the art.
  • such an antibody is sequenced and the polynucleotide sequence is then cloned into a vector for expression or propagation.
  • the antibody is synthesized.
  • the sequence encoding the antibody of interest may be maintained in a vector in a host cell and the host cell can then be expanded and frozen for future use.
  • the polynucleotide sequence of such antibodies may be used for genetic manipulation to generate the bispecific molecules described herein.
  • Antibody therapy uses monoclonal or bispecific antibodies to bind to pre- determined antigens. This therapy can stimulate the patient's immune system to attack those antigens such as viruses. In the clinical setting, the most common route of administration of therapeutic antibodies is the intravenous (IV) infusion.
  • the monoclonal and bispecific antibodies described herein can be administered to a subject through any useful method known in the art.
  • the monoclonal and bispecific antibodies described herein can be administered daily.
  • the monoclonal and bispecific antibodies described herein can be administered twice, three times, four times, five times, or several times a day.
  • the monoclonal and bispecific antibodies described herein can be administered for 1, 2, 3, 4, 5, 6 days or for 1 or 2 weeks. In some embodiments, the monoclonal and bispecific antibodies described herein can be administered for a period longer than two weeks.
  • FIG.1A shows a SARS-CoV-2 viral particle schematic diagram.
  • FIG.1B shows the spike protein trimer, the protein that located on the surface of the virus and binds to a cell receptor on the target cells.
  • the RBD is a critical component of the viral spike glycoprotein that is found on coronaviruses including SARS-CoV-2 and plays the most important role in viral attachment, fusion and entry into the host cell.
  • the receptor binding domain (RBD) is shown in green on top.
  • the spike protein also has an N-terminal domain (NTD).
  • RBD and NTD are targeted by antibodies against SARS-CoV-2 and variant strains.
  • the spike protein trimer can be used to isolate B-cells from convalescent patient samples.
  • FIG.1C shows an electronic micrograph of coronavirus particles. The arrow denotes the viral spike protein on the viral membrane.
  • the subject matter described herein relates to the isolation, characterization and providing the sequences of potent monoclonal antibodies (mAbs) against the SARS-CoV-2 virus, which causes COVID-19.
  • the subject matter disclosed herein describes the optimal COVID-19 patients from which to isolate potent mAbs against SARS-CoV-2.
  • the mAbs can be isolated from blood samples from patients diagnosed with COVID-19 or patients exhibiting COVID-19 related symptoms. Once the antibody sequences are determined from these samples, the mAbs can be synthesized in vitro. In some embodiments, the mAb sequences can be modified and optimized prior to synthesis. These mAb can be used for subsequent characterization experiments.
  • the subject matter disclosed herein relates to the identification of mAbs significantly more potent, with than any other SARS-CoV-2 mAb known in the art to date.
  • the mAb lower IC50 and/or IC90 values.
  • the SARS-CoV-2 neutralizing mAbs described herein can be used for treatment of subjects infected with SARS-CoV-2.
  • the mAbs described herein reduce SARS-CoV-2 viral load in a subject in need thereof.
  • the mAbs described herein decrease disease severity in a subject in need thereof.
  • the mAbs described herein improve clinical outcome of COVID-19 in subjects in need thereof.
  • the mAbs described herein can be used as prophylaxis to prevent high risk subjects and individuals from becoming infected with SARS-CoV-2.
  • the high risk subject can be healthcare workers in close proximity to COVID-19 patients or the family members of these healthcare workers.
  • the mAbs described herein can be used as prophylaxis for the general population at large.
  • Flow Through of Identification Process for the Potent COVID-19 mAbs [0534] In one embodiment, the subject matter disclosed herein related to identification, isolation from patients, and characterization of potent mAbs against SARS-CoV-2, its variants, or any coronavirus.
  • the treatment includes administration of one type of monoclonal antibody.
  • the treatment includes administration of a cocktail of two or more monoclonal antibodies.
  • Plasma samples from COVID-19 patients with severe disease or symptomology can have stronger antiviral activities than plasma samples from COVID-19 patients with non-severe disease.
  • Plasma sample which are determined to have the strongest activity can be used to select patients for further analysis of monoclonal antibodies.
  • Peripheral blood mononuclear cells PMBCs
  • PMBCs Peripheral blood mononuclear cells
  • These B-cells contain mAb-sequences that can be responsible for the strong plasma antiviral activity identified above.
  • the antibody sequences can be recovered from these single B cells by any high throughput sequencing methods known in the art.
  • the genes from the single B cells encoding for these mAb sequences can be synthesized and cloned into expression vectors.
  • the encoded monoclonal antibodies can then be expressed in vitro and purified for subsequent analyses and characterization.
  • In vitro-produced and purified monoclonal antibodies can then tested for their ability to: A) bind to the virus envelope of SARS-CoV-2 or a variant strain (analysis can be by ELISA); and B) neutralize SARS-CoV-2 or a variant strain, thus stopping or preventing infections caused by coronaviruses.
  • Neutralization analysis can be performed by both pseudotyped virus assay and/or live virus neutralization assays.
  • Antibody performance can be indicated by potency, IC50 concentration, and IC90 concentration.
  • An IC50 is a quantitative measure used to indicated the concentration of an antibody needed to inhibit a virus or a virus population by 50%.
  • An IC90 is a quantitative measure used to indicated the concentration of an antibody needed to inhibit a virus or a virus population by 90%. These are measures of the potency of the antibody.
  • the subject matter described herein relates to monoclonal antibodies with significantly higher potency than any other SARS-CoV-2 mAb known in the art to date.
  • the subject matter described herein relates to monoclonal antibodies with significantly lower IC50 and IC90 concentration values than any other mAb known in the art to date against SARS-CoV-2 or a variant strain.
  • additional monoclonal antibodies are identified from the samples in the screening pipeline and if additional plasma samples from COVID-19 patient are screened for their ability to neutralize SARS-CoV-2.
  • the mAbs generated through the process described herein are significantly more potent than other antibodies known in the art against SARS-CoV-2 or a variant strain.
  • the subject matter described herein relates to mAbs against SARS-CoV-2 with high antiviral activity in subjects.
  • the high antiviral activity is higher than the activity of SARS-CoV-2 known in the art.
  • the subjects are humans. In some embodiments, the subjects are human patients. [0541]
  • more potent antibodies require smaller amounts (lower concentrations) to be administered to the subject in need thereof to achieve the desired COVID-19-related clinical effects. This can be achieved through administration of lower dosages to subjects. Therefore fewer potential side effects will be observed with less frequent dosing regimens or smaller amount of antibodies. This potentially will lower the antibody production costs.
  • the mAb against SARS-CoV-2 lead to faster recovery of subjects with COVID-19 and greater efficacy overall.
  • the mAb described herein target multiple epitopes on the SARS-CoV-2 virus or a variant strain.
  • the subject matter disclosed herein relates to an antibody combination cocktails to be administered to the subject.
  • the antibodies in the cocktails target multiple epitopes on the SARS-CoV-2 virus or a variant strain.
  • the antibody combination cocktails provide even greater efficacy and lower the possibility of viral resistance than each individual antibody of the cocktail.
  • the mAb described herein can be used for treatment and/or prevention of COVID-19 infection.
  • the mAbs described herein can be administered to the subject as a prevention or prophylaxis.
  • the mAbs can be used for diagnosis of COVID-19 subject exposure. In some embodiment, the mAbs described herein can be utilized in laboratory research and development activities. [0544] Sequences of the mAbs described herein against SARS-CoV-2 or a variant strain [0545] Underlined and italicized amino acids represent the respective complementarity- determining regions (CDRs). There are three CDRs per sequence, appearing on the sequence in the order CDR1, CDR2, and CDR3. [0546] In one embodiment, the monoclonal antibody 2-4 comprises SEQ ID NOs: 1 and 2. [0547] SEQ ID NO: 1 is the variable region of the heavy chain of antibody number 2-4.
  • SEQ ID NO: 2 is the variable region of the light chain of antibody number 2-4.
  • the monoclonal antibody 4-8 comprises SEQ ID NOs: 3 and 4.
  • SEQ ID NO: 3 is the variable region of the heavy chain of antibody number 4-8.
  • Q [0551] SEQ ID NO: 4 is the variable region of the light chain of antibody number 4-8.
  • the monoclonal antibody 2-15 comprises SEQ ID NOs: 5 and 6.
  • SEQ ID NO: 5 is the variable region of the heavy chain of antibody number 2-15.
  • SEQ ID NO: 6 is the variable region of the light chain of antibody number 2-15.
  • the monoclonal antibody 2-38 comprises SEQ ID NOs: 7 and 8.
  • SEQ ID NO: 7 is the variable region of the heavy chain of antibody number 2-38.
  • SEQ ID NO: 8 is the variable region of the light chain of antibody number 2-38.
  • SSELTQDPAVSVALGQTVRITCQGDSLRSSYASWYQQKPGQAPILVIYDKNNRPSGIPD RFSGSSSGNTASLTITGAQAEDEADYYCNSRDSSGILFGGGTKLTVL
  • the monoclonal antibody 2-51 comprises SEQ ID NOs: 9 and 10.
  • SEQ ID NO: 9 is the variable region of the heavy chain of antibody number 2-51.
  • Q [0560] SEQ ID NO: 10 is the variable region of the light chain of antibody number 2-51.
  • the monoclonal antibody 4-32 comprises SEQ ID NOs: 11 and 12.
  • SEQ ID NO: 11 is the variable region of the heavy chain of antibody number 4- 32.
  • SEQ ID NO: 12 is the variable region of the light chain of antibody number 4-32.
  • the monoclonal antibody 2-7 comprises SEQ ID NOs: 13 and 14.
  • SEQ ID NO: 13 is the variable region of the heavy chain of antibody number 2-7, which specifically recognizes the receptor binding domain (RBD).
  • SEQ ID NO: 14 is the variable region of the light chain of antibody number 2-7, which specifically recognizes the RBD.
  • the monoclonal antibody 1-57 comprises SEQ ID NOs: 15 and 16.
  • SEQ ID NO: 15 is the variable region of the heavy chain of antibody number 1- 57, which specifically recognizes the RBD.
  • Q [0569]
  • SEQ ID NO: 16 is the variable region of the light chain of antibody number 1-57, which specifically recognizes the RBD.
  • the monoclonal antibody 1-20 comprises SEQ ID NOs: 17 and 18.
  • SEQ ID NO: 17 is the variable region of the heavy chain of antibody number 1- 20, which specifically recognizes the RBD.
  • VSS is the variable region of the light chain of antibody number 1-20, which specifically recognizes the RBD.
  • the monoclonal antibody 2-30 comprises SEQ ID NOs: 19 and 20.
  • SEQ ID NO: 19 is the variable region of the heavy chain of antibody number 2- 30, which specifically recognizes the RBD.
  • SEQ ID NO: 20 is the variable region of the light chain of antibody number 2-30, which specifically recognizes the RBD.
  • the monoclonal antibody 4-20 comprises SEQ ID NOs: 21 and 22.
  • SEQ ID NO: 21 is the variable region of the heavy chain of antibody number 4- 20, which specifically recognizes the RBD.
  • SEQ ID NO: 22 is the variable region of the light chain of antibody number 4-20, which specifically recognizes the RBD.
  • the monoclonal antibody 4-18 comprises SEQ ID NOs: 23 and 24.
  • SEQ ID NO: 23 is the variable region of the heavy chain of antibody number 4- 18, which specifically recognizes the N-Terminal domain (NTD).
  • Q SEQ ID NO: 24 is the variable region of the light chain of antibody number 4-18, which specifically recognizes the NTD.
  • the monoclonal antibody 5-24 comprises SEQ ID NOs: 25 and 26.
  • SEQ ID NO: 25 is the variable region of the heavy chain of antibody number 5- 24, which specifically recognizes the NTD.
  • SEQ ID NO: 26 is the variable region of the light chain of antibody number 5-24, which specifically recognizes the NTD.
  • the monoclonal antibody 5-7 comprises SEQ ID NOs: 27 and 28.
  • SEQ ID NO: 27 is the variable region of the heavy chain of antibody number 5-7, which specifically recognizes the NTD.
  • SEQ ID NO: 28 is the variable region of the light chain of antibody number 5-7, which specifically recognizes the NTD.
  • the monoclonal antibody 1-68 comprises SEQ ID NOs: 29 and 30.
  • SEQ ID NO: 29 is the variable region of the heavy chain of antibody number 1- 68, which specifically recognize the NTD.
  • SEQ ID NO: 30 is the variable region of the light chain of antibody number 1-68, which specifically recognizes the NTD.
  • the monoclonal antibody 2-43 comprises SEQ ID NOs: 31 and 32.
  • SEQ ID NO: 31 is the variable region of the heavy chain of antibody number 2- 43, which recognizes an epitope other than the RBD or the NTD.
  • SEQ ID NO: 32 is the variable region of the light chain of antibody number 2-43, which recognizes an epitope other than the RBD or the NTD.
  • the monoclonal antibody 4-19 comprises SEQ ID NOs: 33 and 34.
  • SEQ ID NO: 33 is the variable region of the heavy chain of antibody number 4- 19, which recognizes an epitope other than the RBD or the NTD.
  • SEQ ID NO: 34 is the variable region of the light chain of antibody number 4-19, which recognizes an epitope other than the RBD or the NTD.
  • the monoclonal antibody 2-17 comprises SEQ ID NOs: 35 and 36.
  • SEQ ID NO: 35 is the variable region of the heavy chain of antibody number 2- 17, which recognizes an epitope other than the RBD or the NTD.
  • SEQ ID NO: 36 is the variable region of the light chain of antibody number 2-17, which recognizes an epitope other than the RBD or the NTD.
  • RBD binders [0600]
  • the monoclonal antibody 2-36 comprises SEQ ID NOs: 37 and 38.
  • SEQ ID NO: 37 is the variable region of the heavy chain of antibody number 2- 36, which specifically recognizes the RBD.
  • SEQ ID NO: 38 is the variable region of the light chain of antibody number 2-36, which specifically recognizes the RBD.
  • the monoclonal antibody 1-87 comprises SEQ ID NOs: 39 and 40.
  • SEQ ID NO: 39 is the variable region of the heavy chain of antibody number 1- 87, which specifically recognizes the NTD.
  • SEQ ID NO: 40 is the variable region of the light chain of antibody number 1-87, which specifically recognizes the NTD.
  • the monoclonal antibody 2-15mut comprises SEQ ID NOs: 41 and 42.
  • SEQ ID NO: 41 is the variable region of the heavy chain of the 2-15mut mAb.
  • SEQ ID NO: 42 is the variable region of the light chain of the 2-15mut mAb.
  • the monoclonal antibody 4-8(39/51) comprises SEQ ID NOs: 43 and 44.
  • SEQ ID NO: 43 is the variable region of the heavy chain of the 4-8(39/51) mAb.
  • Q Q Q GQGTTVTVSS [0611]
  • SEQ ID NO: 44 is the variable region of the light chain of the 4-8(39/51) mAb.
  • the monoclonal antibody 4-8(39/51/57) comprises SEQ ID NOs: 45 and 46.
  • SEQ ID NO: 45 is the variable region of the heavy chain of the 4-8(39/51/57) mAb.
  • GQG V VSS SEQ ID NO: 46 is the variable region of the light chain of the 4-8(39/51/57) mAb.
  • nucleic acid sequences of the monoclonal antibodies described herein against SARS-CoV-2 or variant strains relates to DNA sequences that encode any of the monoclonal antibodies disclosed herein.
  • the subject matter disclosed herein relates to mRNA sequences that encode any of the antibodies disclosed herein.
  • nucleic acid and nucleotide sequence refer to both DNA and RNA molecules, including base-modified, sugar-modified or backbone-modified DNA or RNA molecules.
  • the subject matter disclosed herein relates to an isolated nucleic acid having a nucleotide sequence encoding any of the antibodies of the present disclosure.
  • the nucleotide sequences encoding any of the antibodies of the present disclosure are codon-optimized for efficient expression in a host system.
  • the nucleotide sequences encoding any of the antibodies of the present disclosure are codon-optimized to increase the translational efficiency of the nucleotide sequences.
  • the nucleotide sequences encoding any of the antibodies of the present disclosure are codon-optimized to accommodate the codon bias of the host system.
  • the nucleotide sequences encoding any of the antibodies of the present disclosure are codon-optimized to remove redundancy and/or evolutionary constraints, including, but not limited to, the availability of tRNA isoacceptors, TATA box, Shine-Dalgarno sequences.
  • the subject matter disclosed herein relates to a codon- optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 1.
  • the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 2.
  • the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 3. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 4. In some embodiments, the subject matter disclosed herein relates to a codon- optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 5.
  • the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 6. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 7. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 8.
  • the subject matter disclosed herein relates to a codon- optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 9. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 10. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 11.
  • the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 12. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 13. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 14.
  • the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 15. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 16. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 17.
  • the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 18. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 19. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 20.
  • the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 21. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 22. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 23.
  • the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 24. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 25. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 26.
  • the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 27. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 28. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 29.
  • the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 30. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 31. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 32.
  • the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 33. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 34. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 35.
  • the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 36. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 37. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 38.
  • the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 39. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 40. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 41.
  • the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 42. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 43. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 44.
  • the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 45. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 46. [0619] In some embodiments, the subject matter disclosed herein relates to a pharmaceutical composition comprising an isolated nucleic acid having a nucleotide sequence encoding any of the antibodies of the present disclosure and a pharmaceutically acceptable carrier.
  • the subject matter disclosed herein relates to a pharmaceutical composition
  • a pharmaceutical composition comprising a codon-optimized, isolated nucleic acid having a nucleotide sequence encoding any of the antibodies of the present disclosure and a pharmaceutically acceptable carrier.
  • COVID-19 Therapeutics with bispecific antibodies [0621] Monoclonal antibodies are homogeneous in their nature of interaction with the ligands/antigens and thereby generate an absolute mono-specificity for their target. However, sometimes this absolute specificity for a single antigen target can result in some limitations for treating agents such as viruses that are known to evolve their target epitopes and thereby escape from the targeting by monoclonal antibodies.
  • bispecific antibodies capable of neutralizing the SARS-CoV-2 virus and or variant strains.
  • the SARS-CoV-2 bispecific antibodies described herein can be used for treatment of subjects infected with SARS-CoV-2 or a variant strain.
  • the bispecific antibodies described herein reduce viral load in a subject in need thereof. In some embodiments, the bispecific antibodies described herein decrease disease severity in a subject in need thereof. In some embodiments, the bispecific antibodies described herein improve clinical outcome of COVID-19 in subjects in need thereof. [0623] In some embodiments, the bispecific antibodies described herein can be used as prophylaxis to prevent high risk subjects and individuals from becoming infected with SARS- CoV-2 or a variant strain. In some embodiments, the high risk subject can be healthcare workers in close proximity to COVID-19 patients or the family members of these healthcare workers. In some embodiments, the bispecific antibodies described herein can be used as prophylaxis for the general population at large.
  • more potent antibodies require smaller amounts to be administered to the subject to achieve the desired COVID-19-related recovery effects. This can be through lower dosages administered to the subjects and therefore less potential side effects, less frequent dosing regimens, or lower antibody production costs.
  • potency is measured by IC50 and IC90 concentration values.
  • the bispecific antibodies described herein target multiple epitopes on the SARS-CoV-2 virus or a variant strain.
  • the subject matter disclosed herein relates to bispecific antibody combination cocktails.
  • the antibodies in the cocktails target multiple epitopes on the SARS-CoV-2 virus or a variant strain.
  • the bispecific antibody combination cocktails provide even greater efficacy and lower the possibility of viral resistance than each individual antibody of the cocktail.
  • the bispecific antibodies described herein can be utilized in laboratory research and development activities.
  • the bispecific antibodies describe herein includes the variable regions of a first and a second antibody, in which the first antibody binds to an epitope on the receptor binding domain (RBD) of the coronavirus, while the second binds to an epitope on the N-terminal domain (NTD) of the coronavirus. [0626] Pairing the anti-RBD and the anti-NTD domain antibodies in such a bispecific format would mainly provide for increasing the genetic barrier for the virus to achieve resistance against the antibodies.
  • bispecific antibodies are administered in a cocktail of two or more antibodies.
  • bispecific antibodies present an economical alternative to producing in a single molecule format, those combinations of monoclonal antibodies known to increase the threshold of resistance to SARS-CoV-2.
  • the subject matter disclosed herein relates to bispecific antibodies engineered for treatment and prevention of COVID-19 infections.
  • Engineered bispecific antibodies can combine the binding specificity of two antibodies in only one molecule.
  • Bispecific antibodies can recognize two antigens on different cells or on the same cell.
  • engineered bispecific antibodies can bring two cells in close proximity or activate two receptors simultaneously. Additionally, blocking two target proteins with one antibody instead of two may be more efficient.
  • bispecific antibodies can target two viral epitopes providing higher barrier for viral escape.
  • bispecific antibodies can have synergetic effect on potency against the viral target.
  • the engineered antibodies achieve bispecificity using the CrossMab format (Schaefer, 2011).
  • the CrossMab engineering format allows for the bispecific antibody to adopt a more native antibody-like structure. This can facilitate binding of the bispecific antibody to weakly-expressed antigens, while avoiding overstimulation of immune responses.
  • bispecific antibodies in the CrossMab format can be anchored to a host cell membrane. This allows for improved local antibody concentration, targeting of sequential and/or interdependent virus entry steps, and compensating for monovalent binding.
  • the CrossMab format for engineering bispecific antibodies can be utilized to engineer bispecific antibodies against the SARS-CoV-2 virus or a variant strain.
  • the creation of a ‘‘knob’’ in one heavy chain and a ‘‘hole’’ in the other heavy chain of the bispecific antibody favors the formation of heavy chain heterodimers, while the ‘‘crossover’’ of CL and CH1 sequences (the constant domains, heavy and light chains) in one arm of the antibody favors correct Heavy-Light chain pairings in both arms.
  • the CrossMab format allows for correct assembly of two heavy chains and two light chains from different parental antibodies into one bispecific antibody molecule that resembles a typical monoclonal antibody in terms of mass and architecture, and with no artificial linkers required.
  • Each antibody arm can be selected from different potent neutralizing antibodies against SARS-CoV-2 or a variant strain.
  • the bispecific antibody comprises two polypeptide chains, one from each parental monoclonal antibody.
  • the first parental polypeptide arm comprises the light chain and the heavy chain polypeptides of the first parental antibody.
  • the light chain can include the light chain variable domain (VL) comprising the light chain binding region and the light chain constant domain (CL) if the first parental antibody.
  • the heavy chain can include the heavy chain variable domain (VH) comprising the heavy chain binding region and the heavy chain constant domain (CH) of the first parental antibody.
  • the first parental polypeptide arm also includes a domain, which promotes heterodimerization with the second polypeptide. In one embodiment, this heterodimerization domain can covalently bond the first parental polypeptide to the second parental polypeptide of the bispecific antibody.
  • the second parental polypeptide arm comprises a light chain and a heavy chain polypeptides of the second parental antibody.
  • the light chain can include the light chain variable domain (VL) comprising the light chain binding region and the light chain constant domain (CL) of the second parental antibody.
  • the heavy chain can include the heavy chain variable domain (VH) comprising the heavy chain binding region and the heavy chain constant domain (CH) of the second parental antibody.
  • the second parental polypeptide arm also includes a domain, which promotes heterodimerization with the second polypeptide. In one embodiment, this heterodimerization domain can covalently bond the first parental polypeptide to the second parental polypeptide of the bispecific antibody.
  • the bispecific antibody further comprises linkers and disulfide bonds connecting the two parental polypeptides of the antibody.
  • the linkers can be any suitable sequence of amino acids.
  • the bispecific antibodies described herein include the variable regions of a first and a second antibody, in which the first antibody binds to an epitope on the receptor binding domain (RBD) of the coronavirus and is selected from 8 monoclonal Abs (1-20, 1-57, 2-7, 2- 15, 2-30, 2-36, 2-43 and 4-20) while the second binds to an epitope on the N-terminal domain (NTD) of the coronavirus and is also selected from 8 monoclonal Abs (1-68, 1-87, 2-17, 2- 51, 4-8, 4-18, 4-19 and 5-24).
  • RBD receptor binding domain
  • NTD N-terminal domain
  • the CrossMabs described herein utilize human IgG isotype 1 Fc backbone.
  • the backbone can have additional mutations engineered for reduced Fc-effector function with the L234F, L235E and P331S mutations and for half-life with the M428L and N434S mutations.
  • the cells were measured for the cytopathic effects induced by the live virus replication. Difference in the extent of infection from the control wells bearing no antibodies was converted to percentage and the value for inhibition of 50% of the virus (IC50) and 90% of the virus (IC90) was calculated using non- linear regression analysis.
  • the bispecific antibodies of merit were nominated based on their fold enhancement of the IC 90 concentrations that they achieved in comparison to their parental antibodies. Bispecific antibodies that had a potency with IC50 ⁇ 10 ng/mL and with IC 90 ⁇ 50 ng/mL were chosen as the ones that would be capable of achieving the greatest barrier to resistance by SARS-CoV-2.
  • Ab X and Ab Y are irrelevant single arm Fab controls.
  • Selected bispecific antibody candidates achieve similar potency as co-administration of the two parental mAbs.
  • SARS-CoV-2 Variant Strains [0637]
  • the bispecific antibodies exhibit neutralization activity against wild-type SARS-CoV-2 virus (WA1).
  • the bispecific antibodies exhibit neutralization activity against SARS-CoV-2 variants.
  • the bispecific antibodies disclosed herein show potent neutralization activities against SARS- CoV-2 wild-type and multiple variant virus strains.
  • the SARS-CoV-2 variants are B.1.1.7 (UK variant), B.1.351 (SA variant), B.1.526 (NY variant), or P.1 (Brazil variant).
  • each arm of the bispecific antibody constructed is selected from 19 potent neutralizing antibodies against SARS-CoV-2. Additional bispecific antibodies 2-7/5-7, 2-7/1-57 and the CrossMab formats with reverse the knob and hole arms, namely 5- 7/2-7 or 1-57/2-7, showed high potencies when tested against the wild-type virus.
  • bispecific antibodies with potent neutralization activities against SARS-CoV-2 and the variants offer new therapeutics for the treatment and prevention of COVID-19, as a single antibody molecule to provide a higher genetic barrier for viral escape and lower cost than antibody combination. We expect the activity enhancement observed can be extended to other engineered bispecific antibody format.
  • Antibody sequences for bispecific antibodies [0640] Underlined and italicized amino acids represent the respective complementarity- determining regions (CDRs). There are three CDRs per sequence, appearing on the sequence in the order CDR1, CDR2, and CDR3.
  • the 2-17/2-7 bispecific antibody sequence can comprise: [0642] SEQ ID NO: 47 is the amino acid sequence defining the 2-17 derived heavy chain of the 2-17/2-7 antibody 2-17HC-Hole-Cross QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGNIPIFGT [0643] SEQ ID NO: 48 is the amino acid sequence defining the 2-17 derived Light chain of the 2-17/2-7 antibody 2-17VLCH1 [0644] SEQ ID NO: 49 is the amino acid sequence defining the 2-7 derived heavy chain of the 2-17/2-7 antibody 2-7HC-Knob [0645] SEQ ID NO: 50 is the amino acid sequence defining the 2-7 derived light chain of the 2-17/2-7 antibody 2-7LC [0646] The 1-57/5-7 bispecific antibody sequence can comprise: [0647] SEQ ID NO: 51 is the amino acid sequence defining the 1-57 derived heavy chain of the 1-57/5-7 antibody 1-57HC-Hole-
  • SEQ ID NO: 56 is the amino acid sequence defining the 5-7 derived Light chain of the 5-7/1-57 antibody 5-7VLCH1
  • SEQ ID NO: 57 is the amino acid sequence defining the 1-57 derived heavy chain of the 5-7/1-57 antibody 1-57HC-Knob
  • SEQ ID NO: 58 is the amino acid sequence defining the 1-57 derived light chain of the 5-7/1-57 antibody 1-57LC
  • the 2-7/5-7 bispecific antibody sequence can comprise: [0657]
  • SEQ ID NO: 59 is the amino acid sequence defining the 2-7 derived heavy chain of the 2-7/5-7 antibody 2-7HC-Hole-Cross QITLKESGPTLVKPTQTLTLTCTFSGFSLSTSGVGVGWIRQPPGKALEWLALIYWDDDK [0658]
  • SEQ ID NO: 60 is the amino acid sequence defining the 2-7 derived light chain of the 2-7/5-7 antibody 2-7VLCH1 [0659]
  • SEQ ID NO: 61 is the amino acid
  • SEQ ID NO: 90 is the amino acid sequence defining the 2-15 derived light chain of the 5-24/2-15 antibody 2-15LC Q
  • the 5-24/4-20 bispecific antibody sequence can comprise: [0697]
  • SEQ ID NO: 91 is the amino acid sequence defining the 5-24 derived heavy chain of the 5-24/4-20 antibody 5-24HC-Hole-Cross QVQLVESGGGVVQPGRSLRLSCAASGLTFSSYVMHWVRQAPGKGLDWVGVIWYDGS Q
  • SEQ ID NO: 92 is the amino acid sequence defining the 5-24 derived light chain of the 5-24/4-20 antibody 5-24VLCH1 VV V SSS G Q CNVN SN V V SC
  • SEQ ID NO: 93 is the amino acid sequence defining the 4-20 derived heavy chain of the 5-24/4-20 antibody 4-20HC-Knob
  • SEQ ID NO: 94 is the amino acid sequence defining the 4-20 derived light chain of the 5-24/4-20 antibody 4-20LC
  • the 1-20/1-68 bispecific antibody sequence can comprise: [0702]
  • SEQ ID NO: 95 is the amino acid sequence defining the 1-20 derived heavy chain of the 1-20/1-68 antibody 1-20HC-Hole-Cross
  • SEQ ID NO: 96 is the amino acid sequence defining the 1-20 derived light chain of the 1-20/1-68 antibody 1-20VLCH1
  • SEQ ID NO: 97 is the amino acid sequence defining the 1-68 derived heavy chain of the 1-20/1-68 antibody 1-68HC-Knob
  • SEQ ID NO: 98 is the amino acid sequence defining the 1-68 derived light chain of the 1-20/1-68 antibody 1-68LC
  • the 1-20/2-17 bispecific antibody sequence can comprise: [0707]
  • SEQ ID NO: 99 is the amino acid sequence defining the 1-20 derived heavy chain of the 1-20/2-17 antibody 1-20HC-Hole-Cross
  • SEQ ID NO: 100 is the amino acid sequence defining the 1-20 derived light chain of the 1-20/2-17 antibody 1-20VLCH1
  • SEQ ID NO: 101 is the amino acid sequence defining the 2-17 derived heavy chain of the 1-20/2-17 antibody 2-17HC-Knob QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGNIPIFGT
  • SEQ ID NO: 102 is the amino acid sequence defining the 2-17 derived light chain of the 1-20/2-17 antibody 2-17LC EIVMTQSPATLSVSPGERATLSCRASQSVSSDL
  • SEQ ID NO: 152 is the amino acid sequence defining the 2-15 derived light chain of the 2-15/4-8(39/51) antibody 2-15VLCH1 QSALTQPASVSGSPGQSITISCTGTSSDVGGYNFVSWYQQHPGKAPKLMIYDVSKRPSG
  • SEQ ID NO: 153 is the amino acid sequence defining the 4-8(39/51) derived heavy chain of the 2-15/4-8(39/51) antibody 4-8(39/51) HC-Knob QVQLVQSGAEVKKAGSSVKVSCKASGGTFSSHTITWVRLAPGQGLEWMGRNIPILGI
  • SEQ ID NO: 154 is the amino acid sequence defining the 4-8(39/51) derived light chain of the 2-15/4-8(39/51) antibody 4-8(39/51)LC SYELTQPPSVSVSPGQTASITCSGDKLGDKYACWYQQKPGQSPVLVIYQDNKRPSGIPE [0777
  • SEQ ID NO: 156 is the amino acid sequence defining the 1-57 derived light chain of the 1-57/4-18 antibody 1-57VLCH1
  • SEQ ID NO: 157 is the amino acid sequence defining the 4-18 derived heavy chain of the 1-57/4-18 antibody 4-18HC-Knob
  • SEQ ID NO: 158 is the amino acid sequence defining the 4-18 derived light chain of the 1-57/4-18 antibody 4-18LC
  • the 2-7/1-68 bispecific antibody can comprise: [0783]
  • SEQ ID NO: 159 is the amino acid sequence defining the 2-7 derived heavy chain of the 2-7/1-68 antibody 2-7HC-Hole-Cross [0784]
  • SEQ ID NO: 160 is the amino acid sequence defining the 2-7 derived light chain of the 2-7/1-68 antibody 2-7VLCH1 [0785]
  • SEQ ID NO: 161 is the amino acid sequence defining the 1-68 derived heavy chain of the 2-7/1-68 antibody 1-68HC-Knob [07
  • SEQ ID NO: 190 is the amino acid sequence defining the 4-8(39/51/57) derived light chain of the 2-7/4-8(39/51/57) antibody 4-8LC
  • the 2-17/2-36 bispecific antibody sequence can comprise: [0824]
  • SEQ ID NO: 191 is the amino acid sequence defining the 2-17 derived heavy chain of the 2-17/2-36 antibody 2-17HC-Hole-Cross [0825]
  • SEQ ID NO: 192 is the amino acid sequence defining the 2-17 derived light chain of the 2-17/2-36 antibody 2-17VLCH1 [0826]
  • SEQ ID NO: 193 is the amino acid sequence defining the 2-36 derived heavy chain of the 2-17/2-36 antibody 2-36HC-Knob [0827]
  • SEQ ID NO: 194 is the amino acid sequence defining the 2-36 derived light chain of the 2-17/2-36 antibody 2-36LC [0828]
  • SEQ ID NO: 195
  • SEQ ID NO: 240 is the amino acid sequence defining the 4-20 derived light chain of the 4-20/4-18 antibody 4-20VLCH1 Q
  • SEQ ID NO: 241 is the amino acid sequence defining the 4-18 derived heavy chain of the 4-20/4-18 antibody 4-18HC-Knob
  • SEQ ID NO: 242 is the amino acid sequence defining the 4-18 derived light chain of the 4-20/4-18 antibody 4-18LC
  • the 2-15mut/2-51 bispecific antibody sequence can comprise: [0889]
  • SEQ ID NO: 243 is the amino acid sequence defining the 2-15mut derived heavy chain of the 2-15mut/2-51 antibody 2-15HC-Hole-Cross [0890]
  • SEQ ID NO: 244 is the amino acid sequence defining the 2-15mut derived Light chain of the 2-15mut/2-51 antibody 2-15mutVLCH1 [0891]
  • SEQ ID NO: 245 is the amino acid sequence defining the 2-51 derived heavy chain of the 2-15mut/2-51 antibody 2-51
  • the subject matter disclosed herein related to the DNA sequence encoding a bispecific antibody comprising any SEQ ID NO from 1-262 or a combination of SEQ ID NOs 1-262.
  • the subject matter disclosed herein related to the RNA sequence encoding a bispecific antibody comprising any SEQ ID NO from 1-262 or a combination of SEQ ID NOs 1-262.
  • Example 1 – Patient Antibody Response By studying 40 COVID-19 patient cases in great detail, it was found that patients with more severe disease develop more robust antibodies in their blood to the coronavirus. These antibodies include antibodies specific to the spike protein trimer. For the disease to be classified as severe, the COVID-19 patients need mechanical ventilation in an intensive care unit and treatment with hydroxychloroquine, remdesivir, and/or tocilizumab. For the disease to be classified as non-severe, the COVID-19 patients do not require intensive care. FIGS.
  • FIGS.2A-G show ELISA binding data in which various COVID-19 patient plasma samples, indicated by different colored lines, were tested for their ability to bind to SARS-CoV-2 nucleocapsid antigen (FIGS.2A and D), SARS-CoV-2 envelope trimer antigen (FIGS.2B and E), or SARS-CoV envelope trimer antigen (FIGS.2C and F).
  • This binding assay is used to determine whether the plasma samples contain an element, most likely antibodies, that can interact with SARS-CoV-2 and SARS-CoV antigens, suggesting an immune response to the antigens.
  • FIG.2G shows a plot of the data from FIGS.2A-F, which illustrates that higher SARS-CoV-2 antibody responses are present in plasma samples of patients with severe COVID-19 as compared to those patients with non-severe COVID-19.
  • Example 2 - antibody responses correlated potencies in neutralizing SARS-CoV-2
  • FIGS.3A-J shows that stronger binding antibody responses correlate well with greater potencies in neutralizing SARS-CoV-2.
  • Neutralization assays in which various COVID-19 patient plasma samples, indicated by different colored lines, were tested for their ability to protect the target cells from infection by SARS-CoV-2 in a single-cycle pseudovirus infectivity assay (FIGS.3A and D), by SARS-CoV in a single-cycle pseudovirus infectivity assay (FIGS.3B and E), and by SARS-CoV-2 in a replication competent live virus infectivity assay (FIGS.3C and F). This assay is used to determine whether the plasma samples contain an element, most likely antibodies, that can effectively block SARS-CoV-2 or SARS-CoV infection.
  • FIG.3G shows plotting the dilution (ID50) from FIGS.3A-F at which the plasma inhibits 50% of virus infection.
  • ID50 dilution
  • Higher SARS-CoV-2 inhibitory dilutions are present in plasma samples of patients with severe COVID-19, indicating a potentially more potent antibody response in these patients.
  • FIGS.3H-J show that the IC50 values obtained by pseudovirus neutralization assay correlate well with the IC50 values obtained from live virus neutralization assay (FIG.3H), the dilutions of plasmas achieving half of the readout of OD 450 values tested by ELISA in FIG.2 (FIG.3I), and with the OD 450 values of the plasma binding to S trimer when diluted 400-fold in FIG.2 (FIG.3J).
  • the data here indicates that the antibody binding ability to SARS-CoV-2 S trimer in the COVID-19 plasma samples are well correlated with the neutralization ability, suggesting that the single B cells sorted by SARS-CoV-2 S trimer from COIVD-19 patients should have neutralization ability in their secreted antibodies.
  • Example 3 Schematics for identifying potent neutralizing antibodies against COVID-19
  • blood sample was obtained and subjected to the experimental schema depicted in FIGS.4A-C in order to identify monoclonal antibodies that could powerfully neutralize the SARS-CoV-2 virus.
  • the antibody-producing cells known as CD27+ memory B cells were isolated.
  • the subset of cells that could bind the viral spike protein trimer were isolated.
  • the experimental protocol can include the following steps.
  • PBMCs from infected individuals were collected and stained with LIVE/DEADTM Fixable Yellow Dead Cell Stain Kit (Invitrogen, cat: L34959) at room temperature for 20 minutes to exclude dead cells. Then the cells were incubated with 10 ⁇ g/ml spike trimer firstly and further an antibody cocktail for identification of SARS-CoV-2 S trimer specific B cells.
  • the cocktail consisted of CD3-PE- CF594(BD Biosciences, cat:562406), CD19-PE-cy7(Biolegend, cat:302216), CD20-APC- cy7(Biolegend, cat:302314), IgM-V450(BD Biosciences, cat:561286), CD27-PerCP- Cy5.5(BD Biosciences, cat:560612) and Anti-His-PE (Biolegend, cat:362603).
  • Spiker trimer- specific single B cells were gated as CD3-CD19 CD27+Spike trimer+ and sorted into Eppendorf® LoBind microcentrifuge tubes (Sigma, cat: Z666505).
  • mAbs monoclonal antibodies
  • the binding antibodies include 121 spike protein trimer targeting mAbs, 38 RBD-targeting mAbs, and 83 non-RBD-targeting mAbs.
  • the pseudovirus neutralizing mAbs include 52 spike protein trimer-targeting mAbs, 28 RBD- targeting mAbs, and 24 non-RBD-targeting mAbs.
  • the live virus neutralizing antibodies include 32 spike protein targeting mAbs, 13 RBD-targeting mAbs, and 19 non-RBD- targeting mAbs. 217 mAbs were tested for live virus neutralization.
  • FIGS.5A-D show characterization of the initially identified six monoclonal antibodies that were synthesized and purified, including the high binding ability to the SARS- CoV-2 S trimer (FIG.5A) and to the virus receptor binding domain (FIG.5B), and the neutralization capacity of the virus with high potency in both pseudovirus (FIG.5C) and live replication competent virus (FIG.5D) assays. Each colored line indicates a different monoclonal antibody.
  • SARS-CoV antibody CR3022 is a control which can bind to but not neutralize SARS-CoV-2.
  • SARS-CoV-2 S trimer and three of them are RBD binders and three non-RBD binders. All of these six antibodies have neutralization activity against SARS-CoV-2 pseudovirus and live viruses and 2-15 is the most potent one.
  • the binding data showed that these antibodies could be divided into at least two groups with different mechanisms in neutralizing the virus.
  • each antibody was biotinylated, mixed with other serial diluted antibodies and then incubated with the spike protein (S) trimer. The binding of biotinylated antibodies to S trimer with the presence of other monoclonal antibodies was detected by ELISA. Each colored line represents a different monoclonal antibody.
  • RBD binding FIGS.6A-C
  • non-RBD binding FIGS.6D-F
  • Example 5 To further characterize the binding affinity of these new monoclonal antibodies, surface plasmon resonance experiments were performed to determine the binding affinity of the most promising monoclonal antibodies to the SARS-CoV-2 spike trimer. As shown in FIGS.7A-E, each panel represents the binding affinity and binding kinetics of the indicated monoclonal antibody (i.e., 2-4, 2-15, 2-38, etc.) to the SARS-CoV-2 spike timer. The lower KD1 value indicates a higher antibody binding affinity.
  • FIGS.8A-D show initial screenings of mAbs that bind and neutralize the SARS- CoV-2 virus.
  • FIG.8A shows mAbs binding to spike trimer protein.
  • FIG.8B shows mAbs binding to the receptor-binding domain (RBD).
  • FIG.8C shows IC 50 values for pseudotyped virus infection.
  • FIG.8D shows per cent inhibition values for live virus infection.
  • FIG.9 shows summary of synthesized antibodies.
  • Example 7 the potent neutralizing mAbs disclosed herein can bind to the receptor binding domain of the spike protein trimer, to the N-terminal domain of the spike protein trimer or to a different epitope on the spike protein trimer.
  • Each colored line shown in FIGS.10A-I indicates a different monoclonal antibody utilized in an ELISA binding assay.
  • FIGS.10A, D, and G show binding to spike protein trimer.
  • FIGS.10B, E, and H show binding to the RBD.
  • FIGS.10C, F, and I show binding to the NTD.
  • FIGS. 10A-C show binding of mAbs, which potently bind the RBD.
  • FIGS.10D-F show binding of mAbs, which potently bind the NTD.
  • FIGS.10G-I show binding of mAb, which bind epitopes other than the RBD or the NTD.
  • Monoclonal antibodies 2-15, 2-7, 1-57, 2-4, 2-38, 1-20, 2-30, and 4-20 specifically target the RBD of the spike protein trimer. They show no binding affinity for the NTD of the spike protein trimer as shown in FIG.10C.
  • Monoclonal antibodies 4-18, 5-24, 5-7, and 1-68 specifically target the NTD of the spike protein trimer. These antibodies show no binding affinity for the RBD of the spike protein trimer as shown in FIG.10E.
  • FIGS.11A-F show SARS-CoV-2 neutralization activity of select mAbs.
  • FIG. 11A shows neutralization activity of RBD-targeting mAbs neutralizing a pseudovirus infection.
  • the range of IC 50 concentrations for these antibodies is from 0.005 ⁇ g/ml to 0.512 ⁇ g/ml.
  • FIG.11B shows neutralization activity of NTD-targeting mAbs neutralizing a pseudovirus infection.
  • FIG.11C shows neutralization activity of mAbs, which target epitopes other than the RBD or the NTD, neutralizing a pseudovirus infection.
  • the range of IC50 concentrations for these antibodies is from 0.070 ⁇ g/ml to 0.652 ⁇ g/ml.
  • FIG.11D shows neutralization activity of RBD-targeting mAbs neutralizing a live virus infection.
  • the range of IC50 concentrations for these antibodies is from 0.001 ⁇ g/ml to 0.103 ⁇ g/ml.
  • FIG.11E shows neutralization activity of NTD-targeting mAbs neutralizing a live virus infection.
  • FIGS.12A-B show a CryoEM structure of an RBD-targeting monoclonal antibody.
  • FIG.12A shows a side view of the structure while FIG.12B shows a top view of the structure.
  • the mAb is shown in blue ribbon directly adjacent to the RBD, which is shown in green ribbon.
  • FIGS.13A-B show a CryoEM structure of an NTD-targeting monoclonal antibody.
  • FIG.13A shows a side view of the structure while FIG.13B shows a top view of the structure.
  • the mAb is shown in blue ribbon directly adjacent to the NTD, which is shown in brown ribbon.
  • the CryoEM structure suggests that the mAb targeting the NTD does not directly interact with the RBD, which is shown in green ribbon.
  • FIG.14 shows three SARS-CoV-2 neutralizing epitope clusters identified on the spike protein trimer. The NTD cluster is shown in blue ribbon.
  • Example 10 Potent Neutralizing Monoclonal Antibodies Directed to Multiple Epitopes on the SARS-CoV-2 Spike
  • Abstract [0942] The SARS-CoV-2 pandemic rages on with devasting consequences on human lives and the global economy. The discovery and development of virus-neutralizing monoclonal antibodies could be one approach to treat or prevent infection by this novel coronavirus. Here we report the isolation of 61 SARS-CoV-2-neutralizing monoclonal antibodies from 5 infected patients hospitalized with severe disease.
  • SARS-CoV-2 1,2 A novel coronavirus, now termed SARS-CoV-2 1,2 , has caused nearly 8 million confirmed infections globally, leading to about 450,000 deaths. This pandemic has also put much of the world on pause, with unprecedented disruption of lives and unparalleled damage to the economy. A return to some semblance of normalcy will depend on science to deliver an effective solution, and the scientific community has responded admirably.
  • SARS-CoV-2-neutralizing monoclonal antibodies that could be used as therapeutic or prophylactic agents.
  • the primary target for such antibodies is the viral spike, a trimeric protein 3,4 that is responsible for binding to the ACE2 receptor on the host cell 1,3,5,6 .
  • the spike protein is comprised of two subunits.
  • the S1 subunit has two major structural elements: RBD and NTD; the S2 subunit mediates virus-cell membrane fusion after the RBD engages ACE2. Reports of discovery of neutralizing mAbs that target the RBD have been published recently 7-11 .
  • the sorting strategy focused on live memory B lymphocytes that were CD3-negative, CD19-positive, and CD27-positive (FIG.22B).
  • the final step focused on those cells that bound the SARS- CoV-2 spike trimer (S trimer) 4 .
  • S trimer-positive memory B cells were enriched (0.4% to 1.4%) in the 5 patients as compared to a normal health donor (0.2%) (FIG.22C).
  • the cells were then placed into the 10X Chromium (10X Genomics) for single-cell 5’mRNA and V(D)J sequencing to obtain paired heavy (H) and light (L) chain sequences.
  • a careful bioinformatic analysis was carried out on 1,145 paired sequences to downselect “high-confidence” antigen-specific mAbs.
  • a total of 331 mAb sequences were recovered, representing 252 individual clones. Only 6 mAbs were from Patient 3, whereas 44 to 100 mAbs were identified from each of the other patients (FIG.20).
  • VH and VL sequences of 252 antibodies were codon-optimized and synthesized, and each VH and VL gene was then cloned into an expression plasmid with corresponding constant region of H chain and L chain of human IgG1, and mAbs were expressed by co-transfection of paired full-length H chain and L chain genes into Expi293 cells. The supernatant from each transfection was collected for the screening assays and antibody purification.
  • Two antibodies neutralized with IC50 of 0.071 and 0.652 ⁇ g/mL, with mAb 2-51 exhibiting the plateauing effect typical of NTD antibodies.
  • Antibody neutralization of the authentic or live SARS-CoV-2 was carried out using Vero cells inoculated with a multiplicity of infection of 0.1.
  • the RBD- directed antibodies again neutralized the virus but with IC 50 of 0.0007 to 0.209 ⁇ g/mL; the NTD-directed antibodies showed similar potency, with IC 50 ranging from 0.007 to 0.109 ⁇ g/mL.
  • the plateauing effect seen in the pseudovirus neutralization assay was less apparent.
  • Antibodies 2-43 and 2-51 neutralized the live virus with IC50 of 0.003 and 0.007 ⁇ g/mL, respectively.
  • IC50 0.009 ⁇ g/mL or less, including four directed to RBD (2-15, 2-7, 1-57, and 1-20), three to NTD (2-17, 5-24, and 4-8), and two to undetermined regions on the S trimer (2-43 and 2-51). It is remarkable that Patient 2 alone contributed five of the top nine SARS-CoV-2 neutralizing mAbs.
  • cluster E is directed to the ACE2-binding interface of RBD.
  • cluster G connects to both cluster E and cluster G, the location of which is defined by its member CR3022 15 .
  • cluster G overlaps another cluster (H), which includes 1-97 that strongly inhibited the binding of 2-30 to the S trimer. This finding suggests that cluster H may be proximal to one edge of cluster E.
  • FIGS.17A-B and FIGS.26A-C could be represented by two sets of Venn diagrams shown in FIGS.17C-D.
  • the potent neutralizing mAbs reside exclusively in cluster A and bind a patch on the NTD. Weaker neutralizing mAbs recognize a region at the interface between clusters A and B. In the RBD region, the most potent neutralizing mAbs also group together within one cluster (E). Given that all block ACE2 binding, it is likely they recognize the top of RBD and neutralize the virus by competitive inhibition of receptor binding.
  • Cluster G contains CR3022, a mAb known to be directed to an epitope on a cryptic site on the side of RBD when it is in the “up” position 15 . Cluster F is therefore likely situated between the top and this “cryptic” site.
  • Fab of 2-4 bound the spike protein near the apex, with all RBDs in the “down” orientation, and the structure of the antibody-bound spike protein was highly similar to previously published unliganded spike structures in the “all-down” conformation3,4.
  • the 2-4 epitope on RBD has a buried surface area of 751 ⁇ 2, sharing 284 ⁇ 2 with the interface of ACE2. Detailed interactions between 2-4 and RBD, along with comparative analyses, are discussed and exhibited in FIG.28.
  • FIG.18A shows that neutralization of SARS- CoV-2 by mAb 2-4 likely results from locking RBD in the down conformation while also occluding access to ACE2.
  • FIG.18C suggests that 2-43 could block SARS-CoV-2 infection by occluding the site necessary for ACE2 binding.
  • FIG.18D Discussion
  • SARS-CoV-2-neutralizing mAbs that are not only potent but also diverse.
  • Nine of these antibodies can neutralize the authentic virus in vitro at concentrations of 9 ng/mL of less (FIG.16B), including 4 directed to RBD, 3 directed to NTD, and 2 to quaternary epitopes nearby.
  • many of the these mAbs have V(D)J sequences close to germline sequences, without extensive somatic hypermutations (FIG.23E), a finding that bodes well for vaccine development.
  • SARS-CoV-2 NTD (aa1-290) with an HRV-3C protease cleavage site, a mFc tag, and an 8xHis tag at the C-terminus was also cloned into mammalian expression vector pCAGGS.
  • Each expression vector was transiently transfected into Expi293 cells using 1 mg/mL of polyethylenimine (Polysciences). Five days post transfection, the S trimer was purified using Strep-Tactin XT Resin (Zymo Research), and the RBD-mFc and NTD-mFc were purified using protein A agarose (ThermoFisher Scientific).
  • the cells were washed again and incubated with a cocktail of flow cytometry and hashtag antibodies, containing CD3 PE-CF594 (BD Biosciences), CD19 PE-Cy7 (Biolegend), CD20 APC-Cy7 (Biolegend), IgM V450 (BD Biosciences), CD27 PerCP- Cy5.5 (BD Biosciences), anti-His PE (Biolegend), and human Hashtag 3 (Biolegend) at 4 ⁇ C for 1 hr. Stained cells were then washed, resuspended in RPMI-1640 complete medium and sorted for S trimer-specific memory B cells (CD3-CD19+CD27+S trimer+ live single lymphocytes).
  • the sorted cells were mixed with mononuclear cells from the same donor, labeled with Hashtag 1, and loaded into the 10X Chromium chip of the 5’ Single Cell Immune Profiling Assay (10X Genomics) at the Columbia University Human Immune Monitoring Core (HIMC; RRID:SCR_016740).
  • the library preparation and quality control were performed according to manufacturer’s protocol and sequenced on a NextSeq 500 sequencer (Illumina).
  • Identification of S Trimer-Specific Antibody Transcripts [0976] For each sample, full-length antibody transcripts were assembled using the VDJ module in Cell Ranger (version 3.1.0, 10X Genomics) with default parameters and the GRCh38 genome as reference.
  • V(D)J genes were assigned for each transcript using BLAST 27 with customized parameters against a germline gene database obtained from the international ImMunoGeneTics information system (IMGT) database 26,28 .
  • IMGT international ImMunoGeneTics information system
  • CDR3 was identified using the conserved second cysteine in the V region and WGXG (H chain) or FGXG (L chain) motifs in the J region (X represents any amino acid).
  • H chain transcripts the constant domain 1 (CH1) sequences were used to assign isotype using BLAST with default parameters against a database of human CH1 genes obtained from IMGT.
  • a BLAST E-value threshold of 1E-6 was used to find significant isotype assignments, and the CH1 allele with the lowest E-value was used. Sequences other than the V(D)J region were removed and transcripts containing incomplete V(D)J or/and frame shift were excluded. We then aligned each of the remaining transcripts to the assigned germline V gene using CLUSTALO 29 and calculated the somatic hypermutation level. [0979] To select representative antibodies for functional characterization, we first clustered all antibodies using USEARCH 30 with the following criteria: identical heavy chain V and J gene assignments, the same length of CDRH3, and CDRH3 identity higher than 0.9. For each cluster, cells with the same light chain V and J gene assignments were grouped into a clone.
  • variable genes were optimized for human cell expression and synthesized by GenScript. VH and VL were inserted separately into plasmids (gWiz or pcDNA3.4) that encode the constant region for H chain and L chain. Monoclonal antibodies were expressed in Expi293 (ThermoFisher, A14527) by co-transfection of H chain and L chain expressing plasmids using polyethylenimine and culture in 37°C shaker at 125 RPM and 8% CO2.
  • IC50 was defined as the dilution at which the relative light units were reduced by 50% compared with the virus control wells (virus + cells) after subtraction of the background in the control groups with cells only. The IC50 values were calculated using non-linear regression in GraphPad Prism 8.0.
  • the virus-antibody mixture was transferred onto a monolayer of Vero-E6 cells grown overnight. The cells were incubated with the mixture for 70 hrs. CPE were visually scored for each well in a blinded fashion by two independent observers. The results were then converted into percentage neutralization at a given mAb concentration, and the averages ⁇ SEM were plotted using a five-parameter dose-response curve in GraphPad Prism 8.0.
  • Epitope Mapping by ELISA [0992] 50 ng/well of S trimer, 50 ng/well of RBD, and 100 ng/well of NTD were coated on ELISA plates at 4°C overnight.
  • the ELISA plates were then blocked with 300 ⁇ L of blocking buffer (1% BSA and 10% bovine calf serum (BCS) (Sigma) in PBS at 37°C for 2 hrs. Afterwards, supernatants from the antibody transfection or purified antibodies were serially diluted using dilution buffer (1% BSA and 20% BCS in PBS), incubated at 37°C for 1 hr. Next, 100 ⁇ L of 10,000-fold diluted Peroxidase AffiniPure goat anti-human IgG (H+L) antibody (Jackson ImmunoResearch) were added into each well and incubated for 1 hr at 37°C. The plates were washed between each step with PBST (0.5% Tween-20 in PBS).
  • PBST 0.5% Tween-20 in PBS
  • TMB substrate (Sigma) was added and incubated before the reaction was stopped using 1M sulfuric acid. Absorbance was measured at 450 nm.
  • purified mAbs were biotin-labeled using One-Step Antibody Biotinylation Kit (Miltenyi Biotec) following manufacturer recommendations and purified using 40K MWCO Desalting Column (ThermoFisher Scientific).50 ⁇ L of serially diluted competitor antibodies were added into S trimer-precoated ELISA plates, followed by 50 ⁇ L of biotinylated antibodies at a concentration that achieves an OD450 reading of 1.5 in the absence of competitor antibodies.
  • a potent neutralizing human antibody reveals the N-terminal domain of the Spike protein of SARS-CoV-2 as a site of vulnerability. bioRxiv, 2020.2005.2008.083964 doi:10.1101/2020.05.08.083964 (2020).
  • 25. Wang, P. et al. SARS-CoV-2 Neutralizing Antibody Responses Are More Robust in Patients with Severe Disease. bioRxiv, 2020.2006.2013.150250, doi:10.1101/2020.06.13.150250 (2020). 26.
  • FIGS.32A-B show monoclonal antibody 2-15mut.
  • FIG.32A shows virus neutralization with the 2-15mut antibody.
  • FIG.32B shows potency of the 2-15mut antibody.
  • the 2-15mut antibody displays an IC 50 concentration of less than 0.00064 ⁇ g/ml and an IC 90 concertation of 0.011 ⁇ g/ml.
  • FIGS 33A-B show select mutants of the 4-8 monoclonal antibody.
  • FIG.33A shows neutralization with antibodies 4-8 (39/51) and 4-8(39/51/57).
  • FIG.33B shows potency of antibodies 4-8 (39/51) and 4-8(39/51/57).
  • the 4-8(39/51) antibody displays an IC50 concentration of 0.002 ⁇ g/ml and an IC90 concertation of 0.108 ⁇ g/ml.
  • the 4-8(39/51/57) antibody displays an IC 50 concentration of 0.003 ⁇ g/ml and an IC 90 concertation of 0.014 ⁇ g/ml.
  • FIG.34 shows a summary of IC50 and IC90 values of selected monoclonal antibody mutants.
  • SARS-CoV-2 is phylogenetically closely related to SARS-CoV, which caused the 2002–2003 human epidemic. SARS-CoV and SARS-CoV-2 share 76% amino acid identity in their Spike proteins, raising the possibility of conserved immunogenic surfaces on these antigens. Many human monoclonal antibodies have now been shown to target the SARS- CoV-2 Spike protein, but cross-neutralizing antibodies are relatively uncommon in individuals with COVID-19.
  • SARS-like viruses including some zoonotic sarbecoviruses in bats or pangolins which could infect human cells, and therefore, have the potential to cause next pandemics.
  • Our invention claims to isolate and characterize a monoclonal antibody that could not only neutralize SARS-CoV-2 and SARS-CoV but also neutralize sarbecoviruses in bats and pangolins.
  • Such cross-neutralizing antibodies are extremely valuable to understand how to confer broader protection against human SARS-like viruses that include the extensive reservoir of zoonotic sarbecoviruses in bats, pangolins, etc.
  • the SARS-CoV-2 specific antibody 2-4 only binds only to SARS-CoV-2 spike but not to SARS-CoV spike (FIGS.37C-D).
  • Antibody 2-36 also neutralized SARS-CoV, but with a lower potency, IC500.386 ⁇ g/ml (FIG.38B).
  • the control antibody CR3022 neutralizes SARS-CoV but very weakly on SARS-CoV-2; and antibody 2-4 only neutralizes SARS-CoV-2 (FIGS. 38A-B).
  • SARS-CoV-related lineage e.g., WIV1, SHC014, LYRa11, Rs7327, Rs4231, Rs4084
  • 3 in the SARS-CoV-2-related lineage e.g., RaTG13, GDPangolin
  • the 2-36 epitope on the spike is highly conserved among SARS-CoV-2, SARS-CoV, and other SARS-related coronaviruses (FIG.40D), which could explain why 2-36 showed such broad neutralizing properties.
  • antibody 2-36 can serve as the starting point for engineering a more potent antibody against diverse bat coronaviruses with human pandemic potential. Such an antibody could be further developed and placed in the national stockpile for pandemic preparedness.
  • Example 13 monoclonal antibody number 2-36 is a monoclonal antibody that neutralizes SARS-CoV-2 variants, SARS-CoV, and other beta-coronaviruses. To screen monoclonal antibodies with cross- neutralizing activity against other beta-coronaviruses, more than 200 mAbs isolated from COVID-19 convalescent patients (Liu et al. Nature 2020) were tested on SARS-CoV pseudovirus.
  • Monoclonal antibody 2-36 not only neutralizes SARS-CoV-2 pseudovirus at IC50 ⁇ 0.04 ⁇ g/ml and authentic virus at IC50 ⁇ 0.1 ⁇ g/mL, but also shows neutralizing activity against SARS-CoV, although with lower potency (IC50 ⁇ 0.2 ⁇ g/mL on pseudovirus and IC50 ⁇ 7.5 ⁇ g/mL on authentic virus).
  • Monoclonal antibody 2-36 can block SARS-CoV-2 spike trimer binding to ACE2.
  • Conservation analysis on the receptor-binding domain (RBD) among SARS-CoV-2, SARS-CoV, and some bat and pangolin coronavirus strains show that the 2-36 binding site is highly conserved.
  • Antibody 2-36 was tested on different SARS-CoV- 2 variants of concern/interest (including B.1.1.7, B.1.351, P.1, B.1.526, R.1, B.1.429) and many single mutations with high circulating frequency. The results show that antibody 2-36 can neutralize all these variants/mutations without any significant loss of activities. Moreover, besides SARS-CoV-2 and SARS-CoV, antibody 2-36 also neutralizes some bat and pangolin coronaviruses which can use human ACE2 as a receptor to enter host cells. These coronaviruses include but are not limited to RaTG13, WIV1, SHC014, GDPangolin, and GXPangolin viruses.
  • FIGS.90A-D show virus neutralization with monoclonal antibody 2-36.
  • FIG. 90A shows screening of transfection supernatant for neutralization activity against SARS- CoV-2 pseudovirus.
  • FIG.90B shows screening of transfection supernatant for neutralization activity against SARS-CoV pseudovirus.
  • FIG.90C shows 2-36 neutralization IC50 ( ⁇ g/mL) against SARS-CoV-2 pseudovirus (PV) and live virus (LV).
  • FIG.90D shows 2-36 neutralization IC50 ( ⁇ g/mL) against SARS-CoV pseudovirus (PV) and live virus (LV).
  • FIGS.91A-B show binding of monoclonal antibody 2-36 to SARS-CoV-2 (FIG. 91A) and SARS-CoV (FIG.91B) spike as determined by ELISA.
  • FIGS.92A-H show binding affinity for monoclonal antibodies 2-36 and 2-4 to SARS-CoV-2 and SARS-CoV viruses as measured by SPR.
  • FIG.92A shows 2-36 binding affinity to SARS-CoV-2 spike protein.
  • FIG.92B shows 2-4 binding affinity to SARS-CoV-2 spike protein.
  • FIG.92C shows 2-36 binding affinity to SARS-CoV spike protein.
  • FIG.92D shows 2-4 binding affinity to SARS-CoV spike protein.
  • FIG.92E shows 2-36 binding affinity to SARS-CoV-2 receptor binding domain (RBD).
  • FIG.92F shows 2-4 binding affinity to SARS-CoV-2 RBD.
  • FIG.92G shows 2-36 binding affinity to SARS-CoV RBD.
  • FIG.92H shows 2-4 binding affinity to SARS-CoV RBD.
  • FIGS.93A-B show binding to SARS-CoV-2 spike protein.
  • FIG.93A shows that binding of monoclonal antibody 2-36 to SARS-CoV-2 spike is inhibited by CR3022.
  • FIG. 93B shows that monoclonal antibody 2-36 inhibits hACE2 binding to SARS-CoV-2 spike protein.
  • FIG.94 shows conservation analysis on the RBD among SARS CoV-2, SARS CoV-1, Bat CoVs, and Human CoVs virus strains. The analysis shows that the 2-36 binding site is highly conserved; with regions of high conservation in grey and low conservation in red. The 2-36 binding site is outlined in blue.
  • FIGS.95A-D show that monoclonal antibody 2-36 neutralizes SARS-CoV-2 variants and SARS-like coronaviruses using hACE2.
  • FIG.95A shows neutralization against live variants.
  • FIG.95B shows neutralization against pseudovariants.
  • FIG.95C shows evolution tree of viruses.
  • FIG.95D shows antibody potency against viruses.
  • FIGS.96A-D shows that monoclonal antibody 2-36 neutralizes SARS-like coronaviruses using hACE2.
  • FIG.96A shows virus neutralization with 2-36 antibody.
  • FIG. 96B shows virus neutralization with S309 antibody.
  • FIG.96C shows virus neutralization with COVA1-16 antibody.
  • FIG.96D shows virus neutralization with CR3022 antibody.
  • FIGS.97A-D show in vitro selection of 2-36 antibody escape mutations.
  • FIG.97A-D show in vitro selection of 2-36 antibody escape mutations.
  • 97A shows evolution of escape mutations during in vitro passage of SARS-CoV-2 USA/WA1 in Vero E6 cells in the presence of 2-36.
  • FIG.97B shows 2-36 neutralization activity tested against virus passages.
  • FIG.97C shows spike protein with selected mutation localized.
  • FIG.97D shows that the selected escape mutations were introduced into pseudoviruses and then 2-36 neutralization activity was tested against these viruses.
  • Examples for bispecific antibodies [1027] As described herein, bispecific antibodies bearing either the 1400 arm or the A32 arm indicate that those arms of the bispecific antibody are not specific to and do not bind the spike protein of the SARS-CoV-2 virus. These antibodies provide an “irrelevant” control to demonstrate the need for avidity by “both” arms of bispecific antibodies being controlled for.
  • IgG controls.1400 is a neutralizing monoclonal antibody against the human immunodeficiency virus (HIV).
  • A32 is a non-neutralizing monoclonal antibody against HIV.
  • Y A32 (HIV neutralization antibody). Because they do not neutralize SARS-CoV-2 or any variant strains, they are utilized herein to construct bispecific antibodies with one arm against SARS-CoV-2 and the other arm without any activity against SARS-CoV-2. These control antibodies, therefore, allow one to accurately attribute the contribution of each arm to the activity of the bispecific antibodies.
  • FIG.42 shows that the 2-17/1-57 bispecific antibody against SARS-CoV-2 does not enhance potency compared to respective single arm counterpart.
  • Ab X and Ab Y are single arm irrelevant controls.
  • X PGDM1400 (HIV neutralization Ab).
  • Y A32 (HIV neutralization Ab).
  • the IC50 of the 2-17/1-57 bispecific antibody is 0.023 ⁇ g/mL.
  • the IC90 of the 2-17/1-57 bispecific antibody is 0.167 ⁇ g/mL.
  • the IC 50 of the Ab X/1-57 control is 0.014 ⁇ g/mL.
  • the IC90 of the Ab X/1-57 control is 0.424 ⁇ g/mL.
  • FIG.43 shows potent neutralization of bispecific antibody 2-17/2-7 against SARS-CoV-2 compared to respective single arm counterpart.
  • Ab X and Ab Y are single arm irrelevant controls.
  • X PGDM1400 (HIV neutralization Ab).
  • Y A32 (HIV neutralization Ab).
  • the IC 50 of the 2-17/2-7 bispecific antibody is 0.008 ⁇ g/mL.
  • the IC 90 of the 2-17/2-7 bispecific antibody is 0.025 ⁇ g/mL.
  • the IC 50 of the Ab X/2-7 control is 0.028 ⁇ g/mL.
  • the IC90 of the Ab X/2-7 control is 0.162 ⁇ g/mL.
  • the IC50 of the 2-17/Ab Y control is 1.451 ⁇ g/mL.
  • the IC90 of the 2-17/Ab Y bispecific antibody is 3.572 ⁇ g/mL.
  • FIG.44 shows potent neutralization of bispecific antibody 2-17/2-15 against SARS-CoV-2 compared to respective single arm counterpart.
  • Ab X and Ab Y are single arm irrelevant controls.
  • X PGDM1400 (HIV neutralization Ab).
  • Y A32 (HIV neutralization Ab).
  • the IC 50 of the 2-17/2-15 bispecific antibody is 0.006 ⁇ g/mL.
  • the IC 90 of the 2-17/2-15 bispecific antibody is 0.085 ⁇ g/mL.
  • the IC 50 of the Ab X/2-15 control is 0.043 ⁇ g/mL.
  • the IC90 of the Ab X/2-15 bispecific antibody is 0.232 ⁇ g/mL.
  • the IC50 of the 2-17/Ab Y control is 1.451 ⁇ g/mL.
  • the IC 90 of the 2-17/Ab Y control is 3.572 ⁇ g/mL.
  • FIG.45 shows potent neutralization of bispecific antibody 2-17/2-30 against SARS-CoV-2 compared to respective single arm counterpart. Ab X and Ab Y are single arm irrelevant controls.
  • the IC 50 of the 2-17/2-30 bispecific antibody is 0.065 ⁇ g/mL.
  • the IC 90 of the 2-17/2-30 bispecific antibody is 0.598 ⁇ g/mL.
  • the IC50 of the Ab X/2-30 control is 0.349 ⁇ g/mL.
  • the IC90 of the Ab X/2-30 control is 4.939 ⁇ g/mL.
  • the IC50 of the 2-17/Ab Y control is 1.451 ⁇ g/mL.
  • the IC 90 of the 2-17/Ab Y control is 3.572 ⁇ g/mL.
  • FIG.46 shows potent neutralization of bispecific antibody 2-17/4-20 against SARS-CoV-2 compared to respective single arm counterpart.
  • Ab X and Ab Y are single arm irrelevant controls.
  • X PGDM1400 (HIV neutralization Ab).
  • Y A32 (HIV neutralization Ab).
  • the IC50 of the 2-17/4-20 bispecific antibody is 0.030 ⁇ g/mL.
  • the IC90 of the 2-17/4-20 bispecific antibody is 0.164 ⁇ g/mL.
  • the IC 50 of the Ab X/4-20 control is 0.084 ⁇ g/mL.
  • the IC 90 of the Ab X/4-20 control is 3.066 ⁇ g/mL.
  • the IC 50 of the 2-17/Ab Y control is 1.451 ⁇ g/mL.
  • FIG.47 shows potent neutralization of bispecific antibody 5-24/1-57 against SARS-CoV-2 compared to respective single arm counterpart.
  • Ab X and Ab Y are single arm irrelevant controls.
  • X PGDM1400 (HIV neutralization Ab).
  • Y A32 (HIV neutralization Ab).
  • the IC50 of the 5-24/1-57 bispecific antibody is 0.004 ⁇ g/mL.
  • the IC90 of the 5-24/1-57 bispecific antibody is 0.046 ⁇ g/mL.
  • the IC 50 of the Ab X/1-57 control is 0.014 ⁇ g/mL.
  • the IC 90 of the Ab X/1-57 control is 0.424 ⁇ g/mL.
  • the IC 50 of the 5-24/Ab Y control is 0.137 ⁇ g/mL.
  • the IC90 of the 5-24/Ab Y control is 2.320 ⁇ g/mL.
  • FIG.48 shows potent neutralization of bispecific antibody 5-24/2-15 against SARS-CoV-2 compared to respective single arm counterpart.
  • Ab X and Ab Y are single arm irrelevant controls.
  • X PGDM1400 (HIV neutralization Ab).
  • Y A32 (HIV neutralization Ab).
  • the IC50 of the 5-24/2-15 bispecific antibody is 0.004 ⁇ g/mL.
  • the IC90 of the 5-24/2-15 bispecific antibody is 0.033 ⁇ g/mL.
  • the IC 50 of the Ab X/2-15 control is 0.043 ⁇ g/mL.
  • the IC90 of the ab X/2-15 control is 0.232 ⁇ g/mL.
  • the IC50 of the 5-24/Ab Y control is 0.137 ⁇ g/mL.
  • the IC90 of the 5-24/Ab Y control is 2.320 ⁇ g/mL.
  • FIG.49 shows bispecific antibody 5-24/4-20 against SARS-CoV-2 does not enhance potency (IC50) compared to respective single arm counterpart.
  • Ab X and Ab Y are single arm irrelevant controls.
  • X PGDM1400 (HIV neutralization Ab).
  • FIG.50 shows potent neutralization of bispecific antibody 1-20/1-68 against SARS-CoV-2 compared to respective single arm counterpart.
  • Ab X and Ab Y are single arm irrelevant controls.
  • X PGDM1400 (HIV neutralization Ab).
  • Y A32 (HIV neutralization Ab).
  • the IC 50 of the 1-20/1-68 bispecific antibody is 0.010 ⁇ g/mL.
  • the IC 90 of the 1-20/1-68 bispecific antibody is 0.157 ⁇ g/mL.
  • the IC50 of the 1-20/Ab Y control is 0.078 ⁇ g/mL.
  • the IC90 of the 1-20/Ab Y control is 1.241 ⁇ g/mL.
  • the IC50 of the Ab X/1-68 control is 0.035 ⁇ g/mL.
  • the IC 90 of the Ab X/1-68 control is 0.332 ⁇ g/mL.
  • FIG.51 shows potent neutralization of bispecific antibody 1-20/2-17 against SARS-CoV-2 compared to respective single arm counterpart.
  • Ab X and Ab Y are single arm irrelevant controls.
  • X PGDM1400 (HIV neutralization Ab).
  • Y A32 (HIV neutralization Ab).
  • the IC 50 of the 1-20/2-17 bispecific antibody is 0.025 ⁇ g/mL.
  • the IC 90 of the 1-20/2-17 bispecific antibody is 0.213 ⁇ g/mL.
  • the IC50 of the 1-20/Ab Y control is 0.078 ⁇ g/mL.
  • the IC90 of the 1-20/Ab Y control is 1.241 ⁇ g/mL.
  • FIG.52 shows potent neutralization of bispecific antibody 1-20/4-18 against SARS-CoV-2 compared to respective single arm counterpart.
  • Ab X and Ab Y are single arm irrelevant controls.
  • X PGDM1400 (HIV neutralization Ab).
  • Y A32 (HIV neutralization Ab).
  • the IC 50 of the 1-20/4-18 bispecific antibody is 0.009 ⁇ g/mL.
  • the IC 90 of the 1-20/4-18 bispecific antibody is 0.043 ⁇ g/mL.
  • the IC50 of the 1-20/Ab Y control is 0.078 ⁇ g/mL.
  • the IC 90 of the 1-20/Ab Y control is 1.241 ⁇ g/mL.
  • the IC 50 of the Ab X/4-18 control is 0.049 ⁇ g/mL.
  • the IC 90 of the Ab X/4-18 control is 3.463 ⁇ g/mL.
  • FIG.53 shows potent neutralization of bispecific antibody 1-20/5-24 against SARS-CoV-2 compared to respective single arm counterpart.
  • Ab X and Ab Y are single arm irrelevant controls.
  • X PGDM1400 (HIV neutralization Ab).
  • Y A32 (HIV neutralization Ab).
  • the IC50 of the 1-20/5-24 bispecific antibody is 0.009 ⁇ g/mL.

Landscapes

  • Life Sciences & Earth Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Virology (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Molecular Biology (AREA)
  • Immunology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Oncology (AREA)
  • Communicable Diseases (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Epidemiology (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Peptides Or Proteins (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • AIDS & HIV (AREA)
  • Pulmonology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
PCT/US2021/033512 2020-05-20 2021-05-20 Potent neutralizing antibodies against sars-cov-2, generation and uses thereof Ceased WO2021236997A2 (en)

Priority Applications (12)

Application Number Priority Date Filing Date Title
IL298263A IL298263A (en) 2020-05-20 2021-05-20 Strong neutralizing antibodies against sars-cov-2, their production and uses
JP2022570668A JP2023526469A (ja) 2020-05-20 2021-05-20 SARS-CoV-2に対する強力な中和抗体、その生成および使用
CA3184184A CA3184184A1 (en) 2020-05-20 2021-05-20 Potent neutralizing antibodies against sars-cov-2, generation and uses thereof
EP21807600.8A EP4153625A4 (en) 2020-05-20 2021-05-20 STRONG NEUTRALISING ANTIBODIES AGAINST SARS-COV-2, THEIR PRODUCTION AND USE
CN202180059673.2A CN116829177A (zh) 2020-05-20 2021-05-20 抗SARS-CoV-2的有效中和抗体及其生成和用途
PH1/2022/500025A PH12022500025A1 (en) 2020-05-20 2021-05-20 Potent neutralizing antibodies against sars-cov-2, generation and uses thereof
US17/999,387 US20230203134A1 (en) 2020-05-20 2021-05-20 Potent neutralizing antibodies against sars-cov-2, generation and uses thereof
MX2022014420A MX2022014420A (es) 2020-05-20 2021-05-20 Potentes anticuerpos neutralizantes contra el sars-cov-2, generacion y usos de los mismos.
KR1020227044068A KR20230024904A (ko) 2020-05-20 2021-05-20 Sars-cov-2에 대한 강력한 중화 항체, 그의 생성 및 용도
AU2021277373A AU2021277373A1 (en) 2020-05-20 2021-05-20 Potent neutralizing antibodies against SARS-CoV-2, generation and uses thereof
BR112022023467A BR112022023467A2 (pt) 2020-05-20 2021-05-20 Potentes anticorpos neutralizantes contra sars-cov-2, geração e usos dos mesmos
CONC2022/0018192A CO2022018192A2 (es) 2020-05-20 2022-12-15 Potentes anticuerpos neutralizantes contra el sars-cov-2, generación y usos de los mismos

Applications Claiming Priority (16)

Application Number Priority Date Filing Date Title
US202063027935P 2020-05-20 2020-05-20
US63/027,935 2020-05-20
US202063032518P 2020-05-29 2020-05-29
US63/032,518 2020-05-29
US202063039977P 2020-06-16 2020-06-16
US63/039,977 2020-06-16
US202063060116P 2020-08-02 2020-08-02
US63/060,116 2020-08-02
US202063063106P 2020-08-07 2020-08-07
US63/063,106 2020-08-07
US202063117908P 2020-11-24 2020-11-24
US63/117,908 2020-11-24
US202063123767P 2020-12-10 2020-12-10
US63/123,767 2020-12-10
US202163165729P 2021-03-24 2021-03-24
US63/165,729 2021-03-24

Publications (2)

Publication Number Publication Date
WO2021236997A2 true WO2021236997A2 (en) 2021-11-25
WO2021236997A3 WO2021236997A3 (en) 2022-09-29

Family

ID=78707603

Family Applications (4)

Application Number Title Priority Date Filing Date
PCT/US2021/033512 Ceased WO2021236997A2 (en) 2020-05-20 2021-05-20 Potent neutralizing antibodies against sars-cov-2, generation and uses thereof
PCT/US2021/033513 Ceased WO2021236998A2 (en) 2020-05-20 2021-05-20 Potent neutralizing antibodies against sars-cov-2, generation and uses thereof
PCT/US2021/033511 Ceased WO2021236996A2 (en) 2020-05-20 2021-05-20 Potent neutralizing antibodies against sars-cov-2, generation and uses thereof
PCT/US2021/033510 Ceased WO2021236995A2 (en) 2020-05-20 2021-05-20 Potent neutralizing antibodies against sars-cov-2, generation and uses thereof

Family Applications After (3)

Application Number Title Priority Date Filing Date
PCT/US2021/033513 Ceased WO2021236998A2 (en) 2020-05-20 2021-05-20 Potent neutralizing antibodies against sars-cov-2, generation and uses thereof
PCT/US2021/033511 Ceased WO2021236996A2 (en) 2020-05-20 2021-05-20 Potent neutralizing antibodies against sars-cov-2, generation and uses thereof
PCT/US2021/033510 Ceased WO2021236995A2 (en) 2020-05-20 2021-05-20 Potent neutralizing antibodies against sars-cov-2, generation and uses thereof

Country Status (13)

Country Link
US (3) US20230203134A1 (https=)
EP (1) EP4153625A4 (https=)
JP (1) JP2023526469A (https=)
KR (1) KR20230024904A (https=)
AU (1) AU2021277373A1 (https=)
BR (1) BR112022023467A2 (https=)
CA (1) CA3184184A1 (https=)
CL (1) CL2022003215A1 (https=)
CO (1) CO2022018192A2 (https=)
IL (1) IL298263A (https=)
MX (1) MX2022014420A (https=)
PH (1) PH12022500025A1 (https=)
WO (4) WO2021236997A2 (https=)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12216120B2 (en) 2020-03-26 2025-02-04 Vanderbilt University Human monoclonal antibodies to severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP4153625A4 (en) * 2020-05-20 2024-09-25 The Trustees Of Columbia University In The City Of New York STRONG NEUTRALISING ANTIBODIES AGAINST SARS-COV-2, THEIR PRODUCTION AND USE
WO2024089277A2 (en) * 2022-10-27 2024-05-02 Oxford University Innovation Limited Antibodies

Family Cites Families (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP1778283A2 (en) * 2004-06-30 2007-05-02 ID Biomedical Corporation of Quebec Vaccine compositions for treating coronavirus infection
WO2006124269A2 (en) * 2005-05-16 2006-11-23 Amgen Fremont Inc. Human monoclonal antibodies that bind to very late antigen-1 for the treatment of inflammation and other disorders
CA2662350A1 (en) * 2006-09-05 2008-03-13 Medarex, Inc. Antibodies to bone morphogenic proteins and receptors therefor and methods for their use
US7982016B2 (en) * 2007-09-10 2011-07-19 Amgen Inc. Antigen binding proteins capable of binding thymic stromal lymphopoietin
EP2242768A4 (en) * 2008-01-17 2012-03-14 Humabs Llc CROSS-NEUTRALIZATION OF HUMAN MONOCLONAL ANTIBODIES AGAINST SARS-COV AND METHODS FOR THEIR APPLICATION
CN108610416B (zh) * 2008-10-13 2022-01-14 生物医学研究所 登革热病毒中和抗体及其用途
CA2742969A1 (en) * 2008-11-07 2010-05-14 Fabrus Llc Anti-dll4 antibodies and uses thereof
CA2932405A1 (en) * 2013-12-02 2015-06-11 Aaron Diamond Aids Research Center Improved hiv-1-neutralizing antibody potency and breadth via cell receptor anchoring using bispecific antibodies with native architecture
WO2016138160A1 (en) * 2015-02-24 2016-09-01 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Middle east respiratory syndrome coronavirus immunogens, antibodies, and their use
WO2016187220A2 (en) * 2015-05-18 2016-11-24 Five Prime Therapeutics, Inc. Anti-ror1 antibodies
EP3356415B1 (en) * 2015-09-29 2024-05-01 Amgen Inc. Asgr inhibitors for reduzing cholesterol levels
CR20180365A (es) * 2015-12-16 2018-09-28 Amgen Inc PROTEÍNAS DE UNIÓN AL ANTÍGENO BISPECÍFICO DE ANTI-TL1A/ANTI-TNF-a Y SUS USOS
TWI848953B (zh) * 2018-06-09 2024-07-21 德商百靈佳殷格翰國際股份有限公司 針對癌症治療之多特異性結合蛋白
CN113056483B (zh) * 2018-07-09 2025-08-01 戊瑞治疗有限公司 结合到ilt4的抗体
EP4153625A4 (en) * 2020-05-20 2024-09-25 The Trustees Of Columbia University In The City Of New York STRONG NEUTRALISING ANTIBODIES AGAINST SARS-COV-2, THEIR PRODUCTION AND USE

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12216120B2 (en) 2020-03-26 2025-02-04 Vanderbilt University Human monoclonal antibodies to severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)

Also Published As

Publication number Publication date
US20230203134A1 (en) 2023-06-29
AU2021277373A1 (en) 2023-01-05
WO2021236998A3 (en) 2021-12-16
CL2022003215A1 (es) 2023-07-07
CA3184184A1 (en) 2021-11-25
US20240002476A1 (en) 2024-01-04
BR112022023467A2 (pt) 2023-03-28
WO2021236995A3 (en) 2022-09-15
WO2021236998A2 (en) 2021-11-25
JP2023526469A (ja) 2023-06-21
EP4153625A4 (en) 2024-09-25
WO2021236997A3 (en) 2022-09-29
WO2021236996A3 (en) 2022-11-17
KR20230024904A (ko) 2023-02-21
MX2022014420A (es) 2023-03-21
IL298263A (en) 2023-01-01
WO2021236996A2 (en) 2021-11-25
CO2022018192A2 (es) 2023-03-17
WO2021236995A2 (en) 2021-11-25
PH12022500025A1 (en) 2024-03-25
EP4153625A2 (en) 2023-03-29
WO2021236998A9 (en) 2022-03-31
US20230203138A1 (en) 2023-06-29

Similar Documents

Publication Publication Date Title
JP7684379B2 (ja) 抗sars-cov-2-スパイク糖タンパク質抗体および抗原結合断片
JP6979875B2 (ja) チクングニヤウイルスの抗体媒介性中和
US20230348572A1 (en) Single domain antibodies binding to sars-cov-2 spike protein
WO2021236997A2 (en) Potent neutralizing antibodies against sars-cov-2, generation and uses thereof
Liu et al. Potent Neutralizing Monoclonal Antibodies Directed to Multiple Epitopes on the SARS-CoV-2 Spike
US20240101645A1 (en) Monoclonal antibodies against coronaviruses and uses thereof
EP4206224A1 (en) Human antibody or antigen-binding fragment thereof against coronavirus spike protein
EP4585687A1 (en) Human antibody against coronavirus variants or antigen-binding fragment thereof
CN115087667B (zh) 特异性结合SARS-CoV-2的抗原结合蛋白
US20220213176A1 (en) Antibodies against sars-cov-2 spike protein
CN116829177A (zh) 抗SARS-CoV-2的有效中和抗体及其生成和用途
EP3180024B1 (en) Anti-ospa antibodies and methods of use
US20240287161A1 (en) Antibody against coronavirus
WO2024168061A2 (en) Antibody molecules binding to sars-cov-2
WO2025083216A1 (en) Antibodies specific for the spike protein of sars cov-2 coronavirus
WO2024089277A2 (en) Antibodies
WO2023025813A1 (en) Neutralizing antibodies directed to sars-cov-2 spike protein
CN117343168A (zh) 冠状病毒结合分子及医药用途
EP4255487A1 (en) Polypeptides for detection and treatment of coronavirus infection

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21807600

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 2022570668

Country of ref document: JP

Kind code of ref document: A

Ref document number: 3184184

Country of ref document: CA

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112022023467

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: NC2022/0018192

Country of ref document: CO

WWE Wipo information: entry into national phase

Ref document number: DZP2022001039

Country of ref document: DZ

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021807600

Country of ref document: EP

Effective date: 20221220

ENP Entry into the national phase

Ref document number: 2021277373

Country of ref document: AU

Date of ref document: 20210520

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 202180059673.2

Country of ref document: CN

REG Reference to national code

Ref country code: BR

Ref legal event code: B01E

Ref document number: 112022023467

Country of ref document: BR

Free format text: EXIGENCIA:1 - FAVOR EFETUAR, EM ATE 60 (SESSENTA) DIAS, O PAGAMENTO DE GRU CODIGO DE SERVICO 260 PARA A REGULARIZACAO DO PEDIDO, CONFORME ART 2O 1O DA RESOLUCAO 189/2017 E NOTA DE ESCLARECIMENTO PUBLICADA NA RPI 2421 DE 30/05/2017, UMA VEZ QUE A PETICAO NO 870230001673 DE 06/01/2023 APRESENTA DOCUMENTOS REFERENTES A 2 SERVICOS DIVERSOS (TRADUCAO DOS DOCUMENTOS APRESENTADOS NO DEPOSITO E MODIFICACAO NO TITULO DO PEDIDO) TENDO SIDO PAGA SOMENTE 1 RETRIBUICAO. DEVERA SER PAGA MAIS 1 (UMA) GRU CODIGO DE SERVICO 260 E A GRU CODIGO DE SERVICO 207 REFERENTE A RESPOSTA DESTA EXIGENCIA. 2 ? APRESENTE NOVA VIA DE DESENHOS, UMA VEZ QUE NO CONTEUDO APRESENTADO NA PETICAO 870230001673 DE 06/01/2023 A PA

WWP Wipo information: published in national office

Ref document number: NC2022/0018192

Country of ref document: CO

ENP Entry into the national phase

Ref document number: 112022023467

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20221118

WWW Wipo information: withdrawn in national office

Ref document number: 2021807600

Country of ref document: EP

WWW Wipo information: withdrawn in national office

Ref document number: 794789

Country of ref document: NZ