WO2021226440A1 - Elastase-substrate, peptide linker immunoconjugates, and uses thereof - Google Patents
Elastase-substrate, peptide linker immunoconjugates, and uses thereof Download PDFInfo
- Publication number
- WO2021226440A1 WO2021226440A1 PCT/US2021/031264 US2021031264W WO2021226440A1 WO 2021226440 A1 WO2021226440 A1 WO 2021226440A1 US 2021031264 W US2021031264 W US 2021031264W WO 2021226440 A1 WO2021226440 A1 WO 2021226440A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- alkyldiyl
- seq
- immunoconjugate
- och
- espep
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 0 C**NC(C(*)NC(C(*)NC(C(*)NC)=O)=O)=O Chemical compound C**NC(C(*)NC(C(*)NC(C(*)NC)=O)=O)=O 0.000 description 4
- DXULRLCMZUZRAD-UHFFFAOYSA-N CC(CCCCOC(c1ccccc1)=O)(C(NCC(NC1C(CC2(CC2)C(NCC(Nc2ccc(COC(C)=O)cc2)=O)=O)CCCC1)=O)=O)NC Chemical compound CC(CCCCOC(c1ccccc1)=O)(C(NCC(NC1C(CC2(CC2)C(NCC(Nc2ccc(COC(C)=O)cc2)=O)=O)CCCC1)=O)=O)NC DXULRLCMZUZRAD-UHFFFAOYSA-N 0.000 description 1
- AEQXATLRRQUYQN-ZJAJMQJQSA-N CC[n]1nc(C)cc1C(/N=C(\Nc1cc(C(N)=O)c2)/N(C/C=C/CN(c(c(N3)cc(C(N)=O)c4)c4OCCCN(CC4)CCN4C(OCc(cc4)ccc4NC([C@H](C(C)C)NC(C[C@H](CCC4)N4C([C@H](C)NC(CCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCNC(CN(C(C=C4)=O)C4=O)=O)=O)=O)=O)=O)=O)/C3=N/C(c3cc(C)n[n]3CC)=O)c1c2OC)=O Chemical compound CC[n]1nc(C)cc1C(/N=C(\Nc1cc(C(N)=O)c2)/N(C/C=C/CN(c(c(N3)cc(C(N)=O)c4)c4OCCCN(CC4)CCN4C(OCc(cc4)ccc4NC([C@H](C(C)C)NC(C[C@H](CCC4)N4C([C@H](C)NC(CCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCNC(CN(C(C=C4)=O)C4=O)=O)=O)=O)=O)=O)=O)/C3=N/C(c3cc(C)n[n]3CC)=O)c1c2OC)=O AEQXATLRRQUYQN-ZJAJMQJQSA-N 0.000 description 1
- XDXIYKUABSYWCY-CMDGGOBGSA-N CC[n]1nc(C)cc1C(/N=C(\Nc1cc(C(N)=O)c2)/N(C/C=C/CN(c(c(OCCCN3CCNCC3)cc(C(N)=O)c3)c3N3)/C3=N/C(c3cc(C)n[n]3CC)=O)c1c2OC)=O Chemical compound CC[n]1nc(C)cc1C(/N=C(\Nc1cc(C(N)=O)c2)/N(C/C=C/CN(c(c(OCCCN3CCNCC3)cc(C(N)=O)c3)c3N3)/C3=N/C(c3cc(C)n[n]3CC)=O)c1c2OC)=O XDXIYKUABSYWCY-CMDGGOBGSA-N 0.000 description 1
- FIFHDRPYIYDHQQ-UHFFFAOYSA-N OC(C=C1)N(CC(NCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCC(O)=O)=O)C1=O Chemical compound OC(C=C1)N(CC(NCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCC(O)=O)=O)C1=O FIFHDRPYIYDHQQ-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/65—Peptidic linkers, binders or spacers, e.g. peptidic enzyme-labile linkers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6889—Conjugates wherein the antibody being the modifying agent and wherein the linker, binder or spacer confers particular properties to the conjugates, e.g. peptidic enzyme-labile linkers or acid-labile linkers, providing for an acid-labile immuno conjugate wherein the drug may be released from its antibody conjugated part in an acidic, e.g. tumoural or environment
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
Definitions
- the invention relates generally to an immunoconjugate comprising an antibody covalently attached to one or more immunostimulatory moieties by an elastase-substrate, peptide linker.
- BACKGROUND OF THE INVENTION New compositions and methods for the delivery of antibodies and immunostimulatory adjuvants are needed in order to reach inaccessible tumors and/or to expand treatment options for cancer patients and other subjects.
- Human neutrophil elastase (HNE) is a serine protease with destructive proteolytic activity.
- Elastase is stored in azurophilic granules of neutrophils and released into the extracellular space upon infections or inflammation stimuli.
- Elastase is also produced in cells of myeloid-lineage including myeloid-derived suppressor cells (MDSC), a heterogenous group of immune cells from myeloid lineage originating from bone marrow stem cells and within the tumor microenvironment.
- MDSC myeloid-derived suppressor cells
- High levels of elastase have been reported in primary tumors and metastasis, where it promotes oncogenic signaling and inhibits tumor suppressors (Starcher, J. Invest. Derm. (1996), 107:159-163). Circulating and infiltrating neutrophils and granulocytic MDSCs correlate with tumor progression and patient survival (Lerman, I. (2018) Steroids 133: 96–101).
- Peptide motifs to which elastase binds and cleaves include X- Ala-Ala-Pro-Val (SEQ ID NO: 637) or X-Ala-Ala-Pro-Nva where X is a peptide amino capping group and Nva is norvaline (SEQ ID NO: 638) (US 2002/0193311; US 6855689; WO 2000/069472).
- a tumor-targeting, peptidomimetic integrin ligand cyclo(DKP-RGD) was conjugated to the anticancer drug paclitaxel through a Asn-Pro-Val (NPV) tripeptide linker.
- the Asn-Pro-Val (NPV) tripeptide linker is a substrate of neutrophil-secreted elastase.
- In vitro linker cleavage assays and cell antiproliferative experiments demonstrated the efficacy of this tumor-targeting conjugate (Dias, A.R.M et al (2019) Chem. Eur. J.25:1696-1700).
- ADCs antibody-drug conjugates
- proteases such as neutrophil elastase are speculated to play a significant role in both the pharmacokinetics (PK)-exposure and toxicity of several ADCs that have been evaluated in the clinic (Flygare, J.A. et al (2013) Chem Biol Drug Des., 81:113–121.
- PK pharmacokinetics
- ADC pharmacokinetics
- a pool of 102 unnatural amino acids were incorporated into the S1–S4 binding pockets of human neutrophil elastase as tetrapeptides in a combinatorial library approach to optimize substrate catalytic cleavage efficiency (Kasperkiewicz, P. et al. (2014) Proc. Nat. Acad. Sci. 111:2518-2523).
- An aspect of the invention is an immunoconjugate comprising a cell-binding agent covalently attached to one or more immunostimulatory moieties by an elastase-substrate, peptide linker.
- Another aspect of the invention is an immunostimulant-elastase substrate, peptide linker compound capable of conjugation with a cell-binding agent.
- Another aspect of the invention is a pharmaceutical composition comprising a therapeutically effective amount of the immunoconjugate.
- Another aspect of the invention is a method of treatment comprising administering a therapeutically-effective dose of the immunoconjugate to a patient with cancer or an immune- related disorder.
- Another aspect of the invention is the use of the immunoconjugate in therapy.
- Figures 1A-D show heavy chain and light chain CDRs of PD-L1 Type A binding agents 1-42.
- Figures 2A-D show first (HFW1), second (HFW2), third (HFW3), and fourth (HFW4) heavy chain framework region polypeptides of PD-L1 Type A binding agents 1-42.
- Figures 3A-D show first (LFW1), second (LFW2), third (LFW3), and fourth (LFW4) light chain framework region polypeptides of PD-L1 Type A binding agents 1-42.
- Figures 4 A-D show heavy chain variable region (VH) of PD-L1 Type A binding agents 1-42.
- VH heavy chain variable region
- Figures 4 E-G show light chain variable region (VL) of PD-L1 Type A binding agents 1- 42.
- Figures 5A-B show heavy chain and light chain CDRs of PD-L1 Type B binding agents 1-21.
- Figures 6A-B show first (HFW1), second (HFW2), third (HFW3), and fourth (HFW4) heavy chain framework region polypeptides of PD-L1 Type B binding agents 1-21.
- Figures 7A-B show first (LFW1), second (LFW2), third (LFW3), and fourth (LFW4) light chain framework region polypeptides of PD-L1 Type B binding agents 1-21.
- Figures 8A-B show heavy chain variable region (VH) of PD-L1 Type B binding agents 1-21.
- Figures 8C-D show light chain variable region (VL) of PD-L1 Type B binding agents 1- 21.
- Figure 9 shows a graph of potency in a co-culture of a RAW 264.7 murine macrophage cell line and HCC1954 HER2 expressing tumor cells by a comparison of an elastase cleavable linker (Ala-Pro-Val) immunoconjugate ISAC-1 and a cathepsin B cleavable linker (Val-Cit) immunoconjugate ISAC-2.
- ISAC-1 has increased potency relative to the cathepsin B cleavable peptide (Val-Cit) ISAC-2 in RAWS only.
- Val-Cit linker unit of ISAC-2 is a known cathepsin B substrate. Cells are cultured overnight at a 10:1 effector to target ratio, and mouse TNFa is measured by ELISA as a readout of a proinflammatory response.
- ELISA effector to target ratio
- immunoconjugate refers to an antibody construct that is covalently bonded to an immunostimulatory moiety via a linker.
- immunostimulatory refers to a moiety, substance or adjuvant capable of eliciting an immune response in a subject exposed to the immunostimulatory moiety or the immunostimulatory compound after in vivo cleavage of the linker.
- adjuvant moiety refers to an adjuvant that is covalently bonded to a cell-binding agent, such as an antibody construct, through an elastase-substrate, peptide linker, as described herein.
- the adjuvant moiety can elicit the immune response while bonded to the antibody construct or after cleavage (e.g., enzymatic cleavage) from the antibody construct following administration of an immunoconjugate to the subject.
- Immunoconjugates allow targeted delivery of an active adjuvant moiety while the target antigen is bound.
- pattern-recognition receptor refers to germline-encoded host sensors which detect molecules typical for pathogens and modulate function of the innate immune system (Mahla, RS et al (2013) Frontiers in Immunology 4:248; Kumar, H et al (2011) Intl. Rev. of Immun.30:16-34; Schroder K et al (2010) Cell 140(6):821-832).
- PRRs are proteins expressed mainly by cells of the innate immune system such as dendritic cells, macrophages, monocytes, neutrophils and epithelial cells, to identify pathogen-associated molecular patterns (PAMPs) associated with microbial pathogens, and damage-associated molecular patterns (DAMPs) associated with components of host cells released during cell damage or death.
- PAMPs pathogen-associated molecular patterns
- DAMPs damage-associated molecular patterns
- PRRs are also called primitive pattern recognition receptors because they evolved before other parts of the immune system, particularly before adaptive immunity. PRRs also mediate the initiation of antigen-specific adaptive immune response and release of inflammatory cytokines.
- PRRs include but are not limited to: Toll-like receptors (TLRs), STING-like receptors, RIG-I-like receptors (RLRs), NOD-like receptors (NLRs), C-type lectin-like receptors (CLRs), and DNA sensors.
- Adjuvant refers to an immunostimulatory substance capable of eliciting an immune response in a subject exposed to the adjuvant.
- the phrase “adjuvant moiety” refers to an adjuvant that is covalently bonded to an antibody construct, e.g., through a linker, as described herein.
- the adjuvant moiety can elicit the immune response while bonded to the antibody construct or after cleavage (e.g., enzymatic cleavage) from the antibody construct following administration of an immunoconjugate to the subject.
- cleavage e.g., enzymatic cleavage
- the terms “Toll-like receptor” and “TLR” refer to any member of a family of highly- conserved mammalian proteins which recognizes pathogen-associated molecular patterns and acts as key signaling elements in innate immunity. TLR polypeptides share a characteristic structure that includes an extracellular domain that has leucine-rich repeats, a transmembrane domain, and an intracellular domain that is involved in TLR signaling.
- Toll-like receptor 7 and “TLR7” refer to nucleic acids or polypeptides sharing at least about 70%, about 80%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, or more sequence identity to a publicly-available TLR7 sequence, e.g., GenBank accession number AAZ99026 for human TLR7 polypeptide, or GenBank accession number AAK62676 for murine TLR7 polypeptide.
- Toll-like receptor 8 and “TLR8” refer to nucleic acids or polypeptides sharing at least about 70%, about 80%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, or more sequence identity to a publicly-available TLR7 sequence, e.g., GenBank accession number AAZ95441 for human TLR8 polypeptide, or GenBank accession number AAK62677 for murine TLR8 polypeptide.
- a “TLR agonist” is a substance that binds, directly or indirectly, to a TLR (e.g., TLR7 and/or TLR8) to induce TLR signaling.
- TLR signaling can indicate that an agonist stimulates or activates a TLR.
- Signaling differences can be manifested, for example, as changes in the expression of target genes, in the phosphorylation of signal transduction components, in the intracellular localization of downstream elements such as nuclear factor- ⁇ B (NF- ⁇ B), in the association of certain components (such as IL-1 receptor associated kinase (IRAK)) with other proteins or intracellular structures, or in the biochemical activity of components such as kinases (such as mitogen-activated protein kinase (MAPK)).
- a “cell-binding agent” refers to a polypeptide that binds to a cell through at least one binding site.
- Cell-binding agents include antibodies or a fragment of an antibody, peptides and peptidomimetics. Examples of cell-binding agents also include lymphokines, hormones, growth factors, nutrient-transport molecules, or any other cell binding molecule or substance. Conjugates of cell binding agents allow targeted delivery of an active moiety to an effect cell while the antigen is bound to the antibody.
- Antibody refers to a polypeptide comprising an antigen binding region (including the complementarity determining region (CDRs)) from an immunoglobulin gene or fragments thereof.
- antibody specifically encompasses monoclonal antibodies (including full length monoclonal antibodies), polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments that exhibit the desired biological activity.
- An exemplary immunoglobulin (antibody) structural unit comprises a tetramer. Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one “light” (about 25 kDa) and one “heavy” chain (about 50-70 kDa) connected by disulfide bonds. Each chain is composed of structural domains, which are referred to as immunoglobulin domains.
- variable domains or regions on the light and heavy chains V L and V H , respectively
- constant domains or regions on the light and heavy chains CL and CH, respectively.
- the N-terminus of each chain defines a variable region of about 100 to 110 or more amino acids, referred to as the paratope, primarily responsible for antigen recognition, i.e., the antigen binding domain.
- Light chains are classified as either kappa or lambda.
- Heavy chains are classified as gamma, mu, alpha, delta, or epsilon, which in turn define the immunoglobulin classes, IgG, IgM, IgA, IgD and IgE, respectively.
- IgG antibodies are large molecules of about 150 kDa composed of four peptide chains.
- IgG antibodies contain two identical class ⁇ heavy chains of about 50 kDa and two identical light chains of about 25 kDa, thus a tetrameric quaternary structure. The two heavy chains are linked to each other and to a light chain each by disulfide bonds. The resulting tetramer has two identical halves, which together form the Y-like shape. Each end of the fork contains an identical antigen binding domain.
- IgG subclasses IgG1, IgG2, IgG3, and IgG4 in humans, named in order of their abundance in serum (i.e., IgG1 is the most abundant).
- Antibody construct refers to an antibody or a fusion protein comprising (i) an antigen binding domain and (ii) an Fc domain.
- the binding agent is an antigen-binding antibody “fragment,” which is a construct that comprises at least an antigen-binding region of an antibody, alone or with other components that together constitute the antigen-binding construct.
- fragments are known in the art, including, for instance, (i) a Fab fragment, which is a monovalent fragment consisting of the VL, VH, CL, and CH1 domains, (ii) a F(ab’) 2 fragment, which is a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region, (iii) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (iv) a Fab’ fragment, which results from breaking the disulfide bridge of an F(ab’) 2 fragment using mild reducing conditions, (v) a disulfide-stabilized Fv fragment (dsFv), and (vi) a single chain Fv (scFv), which is a monovalent molecule consisting of the two domains of the Fv fragment (i.e., VL and VH) joined by a synthetic linker which enables the two domains to be synthesized as a
- the antibody or antibody fragments can be part of a larger construct, for example, a conjugate or fusion construct of the antibody fragment to additional regions.
- the antibody fragment can be fused to an Fc region as described herein.
- the antibody fragment e.g., a Fab or scFv
- the antibody fragment can be part of a chimeric antigen receptor or chimeric T-cell receptor, for instance, by fusing to a transmembrane domain (optionally with an intervening linker or “stalk” (e.g., hinge region)) and optional intercellular signaling domain.
- the antibody fragment can be fused to the gamma and/or delta chains of a t-cell receptor, so as to provide a T-cell receptor like construct that binds PD-L1.
- the antibody fragment is part of a bispecific T-cell engager (BiTEs) comprising a CD1 or CD3 binding domain and linker.
- BiTEs bispecific T-cell engager
- Epitope means any antigenic determinant or epitopic determinant of an antigen to which an antigen binding domain binds (i.e., at the paratope of the antigen binding domain).
- Antigenic determinants usually consist of chemically active surface groupings of molecules, such as amino acids or sugar side chains, and usually have specific three dimensional structural characteristics, as well as specific charge characteristics.
- Fc receptor refers to a receptor that binds to the Fc region of an antibody.
- Fc ⁇ R which binds to IgG
- Fc ⁇ R which binds to IgA
- Fc ⁇ R which binds to IgE.
- the Fc ⁇ R family includes several members, such as Fc ⁇ I (CD64), Fc ⁇ RIIA (CD32A), Fc ⁇ RIIB (CD32B), Fc ⁇ RIIIA (CD16A), and Fc ⁇ RIIIB (CD16B).
- the Fc ⁇ (Fc gamma) receptors differ in their affinity for IgG and also have different affinities for the IgG subclasses (e.g., IgG1, IgG2, IgG3, and IgG4).
- Nucleic acid or amino acid sequence “identity,” as referenced herein, can be determined by comparing a nucleic acid or amino acid sequence of interest to a reference nucleic acid or amino acid sequence. The percent identity is the number of nucleotides or amino acid residues that are the same (i.e., that are identical) as between the optimally aligned sequence of interest and the reference sequence divided by the length of the longest sequence (i.e., the length of either the sequence of interest or the reference sequence, whichever is longer).
- Alignment of sequences and calculation of percent identity can be performed using available software programs. Examples of such programs include CLUSTAL-W, T-Coffee, and ALIGN (for alignment of nucleic acid and amino acid sequences), BLAST programs (e.g., BLAST 2.1, BL2SEQ, BLASTp, BLASTn, and the like) and FASTA programs (e.g., FASTA3x, FASTM, and SSEARCH) (for sequence alignment and sequence similarity searches). Sequence alignment algorithms also are disclosed in, for example, Altschul et al., J. Molecular Biol., 215(3): 403-410 (1990), Beigert et al., Proc. Natl. Acad. Sci.
- Percent (%) identity of sequences can be also calculated, for example, as 100 x [(identical positions)/min(TGA, TGB)], where TGA and TGB are the sum of the number of residues and internal gap positions in peptide sequences A and B in the alignment that minimizes TG A and TG B . See, e.g., Russell et al., J. Mol Biol., 244: 332-350 (1994).
- the binding agent comprises Ig heavy and light chain variable region polypeptides that together form the antigen binding site.
- Each of the heavy and light chain variable regions are polypeptides comprising three complementarity determining regions (CDR1, CDR2, and CDR3) connected by framework regions.
- the binding agent can be any of a variety of types of binding agents known in the art that comprise Ig heavy and light chains.
- the binding agent can be an antibody, an antigen-binding antibody “fragment,” or a T-cell receptor.
- “Biosimilar” refers to an approved antibody construct that has active properties similar to, for example, a PD-L1-targeting antibody construct previously approved such as atezolizumab (TECENTRIQTM, Genentech, Inc.), durvalumab (IMFINZITM, AstraZeneca), and avelumab (BAVENCIOTM, EMD Serono, Pfizer); a HER2-targeting antibody construct previously approved such as trastuzumab (HERCEPTINTM, Genentech, Inc.), and pertuzumab (PERJETATM, Genentech, Inc.); or a CEA-targeting antibody such as labetuzumab (CEA- CIDE TM , MN-14, hMN14, Immunomedics)
- Biobetter refers to an approved antibody construct that is an improvement of a previously approved antibody construct, such as atezolizumab, durvalumab, avelumab, trastuzumab, pertuzumab, labetuzumab, or sacituzumab.
- the biobetter can have one or more modifications (e.g., an altered glycan profile, or a unique epitope) over the previously approved antibody construct.
- Amino acid refers to any monomeric unit that can be incorporated into a peptide, polypeptide, or protein.
- Amino acids include naturally-occurring ⁇ -amino acids and their stereoisomers, as well as unnatural (non-naturally occurring) amino acids and their stereoisomers.
- “Stereoisomers” of a given amino acid refer to isomers having the same molecular formula and intramolecular bonds but different three-dimensional arrangements of bonds and atoms (e.g., an L-amino acid and the corresponding D-amino acid).
- the amino acids can be glycosylated (e.g., N-linked glycans, O-linked glycans, phosphoglycans, C-linked glycans, or glypication) or deglycosylated.
- Amino acids may be referred to herein by either the commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission.
- Naturally-occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, ⁇ -carboxyglutamate, and O-phosphoserine.
- Naturally-occurring ⁇ -amino acids include, without limitation, alanine (Ala), cysteine (Cys), aspartic acid (Asp), glutamic acid (Glu), phenylalanine (Phe), glycine (Gly), histidine (His), isoleucine (Ile), arginine (Arg), lysine (Lys), leucine (Leu), methionine (Met), asparagine (Asn), proline (Pro), glutamine (Gln), serine (Ser), threonine (Thr), valine (Val), tryptophan (Trp), tyrosine (Tyr), and combinations thereof.
- Stereoisomers of naturally- occurring ⁇ -amino acids include, without limitation, D-alanine (D-Ala), D-cysteine (D-Cys), D-aspartic acid (D-Asp), D-glutamic acid (D-Glu), D-phenylalanine (D-Phe), D-histidine (D-His), D-isoleucine (D-Ile), D-arginine (D-Arg), D-lysine (D-Lys), D-leucine (D-Leu), D-methionine (D-Met), D-asparagine (D-Asn), D-proline (D-Pro), D-glutamine (D-Gln), D-serine (D-Ser), D-threonine (D-Thr), D-valine (D-Val), D-tryptophan (D-Trp), D-tyrosine (D-Tyr), and combinations thereof.
- D-Ala D-c
- Naturally-occurring amino acids include those formed in proteins by post-translational modification, such as citrulline (Cit).
- Unnatural (non-naturally occurring) amino acids include, without limitation, amino acid analogs, amino acid mimetics, synthetic amino acids, N-substituted glycines, and N-methyl amino acids in either the L- or D-configuration that function in a manner similar to the naturally- occurring amino acids.
- amino acid analogs can be unnatural amino acids that have the same basic chemical structure as naturally-occurring amino acids (i.e., a carbon that is bonded to a hydrogen, a carboxyl group, an amino group) but have modified side-chain groups or modified peptide backbones, e.g., homoserine, norleucine, methionine sulfoxide, and methionine methyl sulfonium.
- Amino acid mimetics refer to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions in a manner similar to a naturally-occurring amino acid.
- Linker refers to a functional group that covalently bonds two or more moieties in a compound or material.
- the linking moiety can serve to covalently bond an adjuvant moiety to an antibody construct in an immunoconjugate.
- Linking moiety refers to a functional group that covalently bonds two or more moieties in a compound or material.
- the linking moiety can serve to covalently bond an adjuvant moiety to an antibody in an immunoconjugate.
- Useful bonds for connecting linking moieties to proteins and other materials include, but are not limited to, amides, amines, esters, carbamates, ureas, thioethers, thiocarbamates, thiocarbonates, and thioureas.
- Divalent refers to a chemical moiety that contains two points of attachment for linking two functional groups; polyvalent linking moieties can have additional points of attachment for linking further functional groups.
- Divalent radicals may be denoted with the suffix “diyl”.
- divalent linking moieties include divalent polymer moieties such as divalent poly(ethylene glycol), divalent cycloalkyl, divalent heterocycloalkyl, divalent aryl, and divalent heteroaryl group.
- a “divalent cycloalkyl, heterocycloalkyl, aryl, or heteroaryl group” refers to a cycloalkyl, heterocycloalkyl, aryl, or heteroaryl group having two points of attachment for covalently linking two moieties in a molecule or material. Cycloalkyl, heterocycloalkyl, aryl, or heteroaryl groups can be substituted or unsubstituted. Cycloalkyl, heterocycloalkyl, aryl, or heteroaryl groups can be substituted with one or more groups selected from halo, hydroxy, amino, alkylamino, amido, acyl, nitro, cyano, and alkoxy.
- a wavy line (“ ”) represents a point of attachment of the specified chemical moiety. If the specified chemical moiety has two wavy lines (“ ”) present, it will be understood that the chemical moiety can be used bilaterally, i.e., as read from left to right or from right to left. In some embodiments, a specified moiety having two wavy lines (“ ”) present is considered to be used as read from left to right.
- Alkyl refers to a straight (linear) or branched, saturated, aliphatic radical having the number of carbon atoms indicated. Alkyl can include any number of carbons, for example from one to twelve.
- alkyl groups include, but are not limited to, methyl (Me, -CH 3 ), ethyl (Et, -CH 2 CH 3 ), 1-propyl (n-Pr, n-propyl, -CH 2 CH 2 CH 3 ), 2-propyl (i-Pr, i-propyl, -CH(CH 3 ) 2 ), 1- butyl (n-Bu, n-butyl, -CH 2 CH 2 CH 2 CH 3 ), 2-methyl-1-propyl (i-Bu, i-butyl, -CH 2 CH(CH 3 ) 2 ), 2- butyl (s-Bu, s-butyl, -CH(CH 3 )CH 2 CH 3 ), 2-methyl-2-propyl (t-Bu, t-butyl, -C(CH 3 ) 3 ), 1-pentyl (n-pentyl, -CH 2 CH 2 CH 2 CH 3 ), 2-pentyl (-CH(CH(CH 2
- alkyldiyl refers to a divalent alkyl radical. Examples of alkyldiyl groups include, but are not limited to, methylene (-CH 2 -), ethylene (-CH 2 CH 2 -), propylene (- CH 2 CH 2 CH 2 -), and the like. An alkyldiyl group may also be referred to as an “alkylene” group.
- Alkynyl refers to a straight (linear) or branched, unsaturated, aliphatic radical having the number of carbon atoms indicated and at least one carbon-carbon triple bond, sp. Alkynyl can include from two to about 12 or more carbons atoms.
- C 2 -C 6 alkynyl includes, but is not limited to ethynyl (-C ⁇ CH), propynyl (propargyl, -CH 2 C ⁇ CH), butynyl, pentynyl, hexynyl, and isomers thereof
- Alkynyl groups can be substituted or unsubstituted.
- alkynylene or “alkynyldiyl” refer to a divalent alkynyl radical.
- the terms “carbocycle”, “carbocyclyl”, “carbocyclic ring” and “cycloalkyl” refer to a saturated or partially unsaturated, monocyclic, fused bicyclic, or bridged polycyclic ring assembly containing from 3 to 12 ring atoms, or the number of atoms indicated.
- Saturated monocyclic carbocyclic rings include, for example, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, and cyclooctyl.
- Saturated bicyclic and polycyclic carbocyclic rings include, for example, norbornane, [2.2.2] bicyclooctane, decahydronaphthalene and adamantane.
- Carbocyclic groups can also be partially unsaturated, having one or more double or triple bonds in the ring.
- carbocyclic groups that are partially unsaturated include, but are not limited to, cyclobutene, cyclopentene, cyclohexene, cyclohexadiene (1,3- and 1,4-isomers), cycloheptene, cycloheptadiene, cyclooctene, cyclooctadiene (1,3-, 1,4- and 1,5-isomers), norbornene, and norbornadiene.
- cycloalkyldiyl refers to a divalent cycloalkyl radical.
- Aryl refers to a monovalent aromatic hydrocarbon radical of 6-20 carbon atoms (C 6 ⁇ C 20 ) derived by the removal of one hydrogen atom from a single carbon atom of a parent aromatic ring system.
- Aryl groups can be monocyclic, fused to form bicyclic or tricyclic groups, or linked by a bond to form a biaryl group.
- Representative aryl groups include phenyl, naphthyl and biphenyl.
- Other aryl groups include benzyl, having a methylene linking group.
- Some aryl groups have from 6 to 12 ring members, such as phenyl, naphthyl or biphenyl.
- aryl groups have from 6 to 10 ring members, such as phenyl or naphthyl.
- arylene or “aryldiyl” mean a divalent aromatic hydrocarbon radical of 6-20 carbon atoms (C 6 ⁇ C 20 ) derived by the removal of two hydrogen atom from a two carbon atoms of a parent aromatic ring system.
- Some aryldiyl groups are represented in the exemplary structures as “Ar”.
- Aryldiyl includes bicyclic radicals comprising an aromatic ring fused to a saturated, partially unsaturated ring, or aromatic carbocyclic ring.
- Typical aryldiyl groups include, but are not limited to, radicals derived from benzene (phenyldiyl), substituted benzenes, naphthalene, anthracene, biphenylene, indenylene, indanylene, 1,2-dihydronaphthalene, 1,2,3,4- tetrahydronaphthyl, and the like.
- Aryldiyl groups are also referred to as “arylene”, and are optionally substituted with one or more substituents described herein.
- heterocycle refers to a saturated or a partially unsaturated (i.e., having one or more double and/or triple bonds within the ring) carbocyclic radical of 3 to about 20 ring atoms in which at least one ring atom is a heteroatom selected from nitrogen, oxygen, phosphorus and sulfur, the remaining ring atoms being C, where one or more ring atoms is optionally substituted independently with one or more substituents described below.
- a heterocycle may be a monocycle having 3 to 7 ring members (2 to 6 carbon atoms and 1 to 4 heteroatoms selected from N, O, P, and S) or a bicycle having 7 to 10 ring members (4 to 9 carbon atoms and 1 to 6 heteroatoms selected from N, O, P, and S), for example: a bicyclo [4,5], [5,5], [5,6], or [6,6] system.
- Heterocycles are described in Paquette, Leo A.; “Principles of Modern Heterocyclic Chemistry” (W.A.
- Heterocyclyl also includes radicals where heterocycle radicals are fused with a saturated, partially unsaturated ring, or aromatic carbocyclic or heterocyclic ring.
- heterocyclic rings include, but are not limited to, morpholin-4-yl, piperidin-1-yl, piperazinyl, piperazin-4-yl-2-one, piperazin-4-yl-3-one, pyrrolidin-1-yl, thiomorpholin-4-yl, S- dioxothiomorpholin-4-yl, azocan-1-yl, azetidin-1-yl, octahydropyrido[1,2-a]pyrazin-2-yl, [1,4]diazepan-1-yl, pyrrolidinyl, tetrahydrofuranyl, dihydrofuranyl, tetrahydrothienyl, tetrahydropyranyl, dihydropyranyl, tetrahydrothiopyranyl, piperidino, morpholino, thiomorpholino, thioxanyl, piperazinyl, homopiperazinyl, aze
- Spiro heterocyclyl moieties are also included within the scope of this definition.
- spiro heterocyclyl moieties include azaspiro[2.5]octanyl and azaspiro[2.4]heptanyl.
- the heterocycle groups herein are optionally substituted independently with one or more substituents described herein.
- heterocyclyldiyl refers to a divalent, saturated or a partially unsaturated (i.e., having one or more double and/or triple bonds within the ring) carbocyclic radical of 3 to about 20 ring atoms in which at least one ring atom is a heteroatom selected from nitrogen, oxygen, phosphorus and sulfur, the remaining ring atoms being C, where one or more ring atoms is optionally substituted independently with one or more substituents as described.
- heterocyclyldiyls examples include morpholinyldiyl, piperidinyldiyl, piperazinyldiyl, pyrrolidinyldiyl, dioxanyldiyl, thiomorpholinyldiyl, and S- dioxothiomorpholinyldiyl.
- heteroaryl refers to a monovalent aromatic radical of 5-, 6-, or 7-membered rings, and includes fused ring systems (at least one of which is aromatic) of 5-20 atoms, containing one or more heteroatoms independently selected from nitrogen, oxygen, and sulfur.
- heteroaryl groups are pyridinyl (including, for example, 2-hydroxypyridinyl), imidazolyl, imidazopyridinyl, pyrimidinyl (including, for example, 4-hydroxypyrimidinyl), pyrazolyl, triazolyl, pyrazinyl, tetrazolyl, furyl, thienyl, isoxazolyl, thiazolyl, oxadiazolyl, oxazolyl, isothiazolyl, pyrrolyl, quinolinyl, isoquinolinyl, tetrahydroisoquinolinyl, indolyl, benzimidazolyl, benzofuranyl, cinnolinyl, indazolyl, indolizinyl, phthalazinyl, pyridazinyl, triazinyl, isoindolyl, pteridinyl, purinyl, oxadiazol
- Heteroaryl groups are optionally substituted independently with one or more substituents described herein.
- heteroaryldiyl refers to a divalent aromatic radical of 5-, 6-, or 7-membered rings, and includes fused ring systems (at least one of which is aromatic) of 5-20 atoms, containing one or more heteroatoms independently selected from nitrogen, oxygen, and sulfur.
- Examples of 5-membered and 6-membered heteroaryldiyls include pyridyldiyl, imidazolyldiyl, pyrimidinyldiyl, pyrazolyldiyl, triazolyldiyl, pyrazinyldiyl, tetrazolyldiyl, furyldiyl, thienyldiyl, isoxazolyldiyldiyl, thiazolyldiyl, oxadiazolyldiyl, oxazolyldiyl, isothiazolyldiyl, and pyrrolyldiyl.
- the heterocycle or heteroaryl groups may be carbon (carbon-linked), or nitrogen (nitrogen-linked) bonded where such is possible.
- carbon bonded heterocycles or heteroaryls are bonded at position 2, 3, 4, 5, or 6 of a pyridine, position 3, 4, 5, or 6 of a pyridazine, position 2, 4, 5, or 6 of a pyrimidine, position 2, 3, 5, or 6 of a pyrazine, position 2, 3, 4, or 5 of a furan, tetrahydrofuran, thiofuran, thiophene, pyrrole or tetrahydropyrrole, position 2, 4, or 5 of an oxazole, imidazole or thiazole, position 3, 4, or 5 of an isoxazole, pyrazole, or isothiazole, position 2 or 3 of an aziridine, position 2, 3, or 4 of an azetidine, position 2, 3, 4, 5, 6, 7, or 8 of a quinoline or position 1, 3, 4, 5, 6,
- nitrogen bonded heterocycles or heteroaryls are bonded at position 1 of an aziridine, azetidine, pyrrole, pyrrolidine, 2-pyrroline, 3-pyrroline, imidazole, imidazolidine, 2-imidazoline, 3-imidazoline, pyrazole, pyrazoline, 2-pyrazoline, 3- pyrazoline, piperidine, piperazine, indole, indoline, 1H-indazole, position 2 of a isoindole, or isoindoline, position 4 of a morpholine, and position 9 of a carbazole, or ⁇ -carboline.
- halo and halogen refer to a fluorine, chlorine, bromine, or iodine atom.
- quaternary ammonium salt refers to a tertiary amine that has been quaternized with an alkyl substituent (e.g., a C 1 -C4 alkyl such as methyl, ethyl, propyl, or butyl).
- treat refers to any indicia of success in the treatment or amelioration of an injury, pathology, condition (e.g., cancer), or symptom (e.g., cognitive impairment), including any objective or subjective parameter such as abatement; remission; diminishing of symptoms or making the symptom, injury, pathology, or condition more tolerable to the patient; reduction in the rate of symptom progression; decreasing the frequency or duration of the symptom or condition; or, in some situations, preventing the onset of the symptom.
- the treatment or amelioration of symptoms can be based on any objective or subjective parameter, including, for example, the result of a physical examination.
- cancer refers to cells which exhibit autonomous, unregulated growth, such that the cells exhibit an aberrant growth phenotype characterized by a significant loss of control over cell proliferation.
- Cells of interest for detection, analysis, and/or treatment in the context of the invention include cancer cells (e.g., cancer cells from an individual with cancer), malignant cancer cells, pre-metastatic cancer cells, metastatic cancer cells, and non-metastatic cancer cells. Cancers of virtually every tissue are known.
- cancer burden refers to the quantum of cancer cells or cancer volume in a subject. Reducing cancer burden accordingly refers to reducing the number of cancer cells or the cancer cell volume in a subject.
- cancer cell refers to any cell that is a cancer cell (e.g., from any of the cancers for which an individual can be treated, e.g., isolated from an individual having cancer) or is derived from a cancer cell, e.g., clone of a cancer cell.
- a cancer cell can be from an established cancer cell line, can be a primary cell isolated from an individual with cancer, can be a progeny cell from a primary cell isolated from an individual with cancer, and the like.
- the term can also refer to a portion of a cancer cell, such as a sub-cellular portion, a cell membrane portion, or a cell lysate of a cancer cell.
- cancers are known to those of skill in the art, including solid tumors such as carcinomas, sarcomas, glioblastomas, melanomas, lymphomas, and myelomas, and circulating cancers such as leukemias.
- solid tumors such as carcinomas, sarcomas, glioblastomas, melanomas, lymphomas, and myelomas
- circulating cancers such as leukemias.
- cancer includes any form of cancer, including but not limited to, solid tumor cancers (e.g., skin, lung, prostate, breast, gastric, bladder, colon, ovarian, pancreas, kidney, liver, glioblastoma, medulloblastoma, leiomyosarcoma, head & neck squamous cell carcinomas, melanomas, and neuroendocrine) and liquid cancers (e.g., hematological cancers); carcinomas; soft tissue tumors; sarcomas; teratomas; melanomas; leukemias; lymphomas; and brain cancers, including minimal residual disease, and including both primary and metastatic tumors.
- solid tumor cancers e.g., skin, lung, prostate, breast, gastric, bladder, colon, ovarian
- pancreas kidney, liver, glioblastoma, medulloblastoma, leiomyosarcoma, head & neck squamous cell carcinomas, melan
- PD-L1 expression refers to a cell that has a PD-L1 receptor on the cell’s surface.
- PD-L1 overexpression refers to a cell that has more PD-L1 receptors as compared to corresponding non-cancer cell.
- HER2 refers to the protein human epidermal growth factor receptor 2.
- HER2 expression refers to a cell that has a HER2 receptor on the cell’s surface. For example, a cell may have from about 20,000 to about 50,000 HER2 receptors on the cell’s surface.
- HER2 overexpression refers to a cell that has more than about 50,000 HER2 receptors.
- a cell 2 5, 10, 100, 1,000, 10,000, 100,000, or 1,000,000 times the number of HER2 receptors as compared to corresponding non-cancer cell (e.g., about 1 or 2 million HER2 receptors). It is estimated that HER2 is overexpressed in about 25% to about 30% of breast cancers.
- the “pathology” of cancer includes all phenomena that compromise the well-being of the patient.
- cancer recurrence refers to further growth of neoplastic or cancerous cells after diagnosis of cancer. Particularly, recurrence may occur when further cancerous cell growth occurs in the cancerous tissue.
- Tumor spread similarly, occurs when the cells of a tumor disseminate into local or distant tissues and organs, therefore, tumor spread encompasses tumor metastasis.
- Tuor invasion occurs when the tumor growth spread out locally to compromise the function of involved tissues by compression, destruction, or prevention of normal organ function.
- metastasis refers to the growth of a cancerous tumor in an organ or body part, which is not directly connected to the organ of the original cancerous tumor. Metastasis will be understood to include micrometastasis, which is the presence of an undetectable amount of cancerous cells in an organ or body part that is not directly connected to the organ of the original cancerous tumor.
- Metastasis can also be defined as several steps of a process, such as the departure of cancer cells from an original tumor site, and migration and/or invasion of cancer cells to other parts of the body.
- effective amount and “therapeutically effective amount” refer to a dose or amount of a substance such as an immunoconjugate that produces therapeutic effects for which it is administered.
- the therapeutically effective amount of the immunoconjugate may reduce the number of cancer cells; reduce the tumor size; inhibit (i.e., slow to some extent and preferably stop) cancer cell infiltration into peripheral organs; inhibit (i.e., slow to some extent and preferably stop) tumor metastasis; inhibit, to some extent, tumor growth; and/or relieve to some extent one or more of the symptoms associated with the cancer.
- the immunoconjugate may prevent growth and/or kill existing cancer cells, it may be cytostatic and/or cytotoxic.
- efficacy can, for example, be measured by assessing the time to disease progression (TTP) and/or determining the response rate (RR)
- TTP time to disease progression
- RR response rate
- Recipient “individual,” “subject,” “host,” and “patient” are used interchangeably and refer to any mammalian subject for whom diagnosis, treatment, or therapy is desired (e.g., humans).
- “Mammal” for purposes of treatment refers to any animal classified as a mammal, including humans, domestic and farm animals, and zoo, sports, or pet animals, such as dogs, horses, cats, cows, sheep, goats, pigs, camels, etc. In certain embodiments, the mammal is human.
- the phrase “synergistic adjuvant” or “synergistic combination” in the context of this invention includes the combination of two immune modulators such as a receptor agonist, cytokine, and adjuvant polypeptide, that in combination elicit a synergistic effect on immunity relative to either administered alone.
- the immunoconjugates disclosed herein comprise synergistic combinations of the claimed adjuvant and antibody construct. These synergistic combinations upon administration elicit a greater effect on immunity, e.g., relative to when the antibody construct or adjuvant is administered in the absence of the other moiety.
- a decreased amount of the immunoconjugate may be administered (as measured by the total number of antibody constructs or the total number of adjuvants administered as part of the immunoconjugate) compared to when either the antibody construct or adjuvant is administered alone.
- administering refers to parenteral, intravenous, intraperitoneal, intramuscular, intratumoral, intralesional, intranasal, or subcutaneous administration, oral administration, administration as a suppository, topical contact, intrathecal administration, or the implantation of a slow-release device, e.g., a mini-osmotic pump, to the subject.
- the immunoconjugate of the invention comprises an antibody. Included in the scope of the embodiments of the invention are functional variants of the antibody constructs or antigen binding domain described herein.
- the term “functional variant” as used herein refers to an antibody construct having an antigen binding domain with substantial or significant sequence identity or similarity to a parent antibody construct or antigen binding domain, which functional variant retains the biological activity of the antibody construct or antigen binding domain of which it is a variant.
- Functional variants encompass, for example, those variants of the antibody constructs or antigen binding domain described herein (the parent antibody construct or antigen binding domain) that retain the ability to recognize target cells expressing PD-L1, HER2 or CEA to a similar extent, the same extent, or to a higher extent, as the parent antibody construct or antigen binding domain.
- the functional variant can, for instance, be at least about 30%, about 50%, about 75%, about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99% or more identical in amino acid sequence to the antibody construct or antigen binding domain.
- a functional variant can, for example, comprise the amino acid sequence of the parent antibody construct or antigen binding domain with at least one conservative amino acid substitution.
- the functional variants can comprise the amino acid sequence of the parent antibody construct or antigen binding domain with at least one non- conservative amino acid substitution.
- the non-conservative amino acid substitution may enhance the biological activity of the functional variant, such that the biological activity of the functional variant is increased as compared to the parent antibody construct or antigen binding domain.
- the antibodies comprising the immunoconjugates of the invention include Fc engineered variants.
- the mutations in the Fc region that result in modulated binding to one or more Fc receptors can include one or more of the following mutations: SD (S239D), SDIE (S239D/I332E), SE (S267E), SELF (S267E/L328F), SDIE (S239D/I332E), SDIEAL (S239D/I332E/A330L), GA (G236A), ALIE (A330L/I332E), GASDALIE (G236A/S239D/A330L/I332E), V9 (G237D/P238D/P271G/A330R), and V11 (G237D/P238D/H268D/P271G/A330R), and/or one or more mutations at the following amino acids: E345R, E233, G237, P238, H268, P271, L328 and A330.
- the antibodies comprising the immunoconjugates of the invention include glycan variants, such as afucosylation.
- the Fc region of the binding agents are modified to have an altered glycosylation pattern of the Fc region compared to the native non-modified Fc region.
- Amino acid substitutions of the inventive antibody constructs or antigen binding domains are preferably conservative amino acid substitutions.
- Conservative amino acid substitutions are known in the art, and include amino acid substitutions in which one amino acid having certain physical and/or chemical properties is exchanged for another amino acid that has the same or similar chemical or physical properties.
- the conservative amino acid substitution can be an acidic/negatively charged polar amino acid substituted for another acidic/negatively charged polar amino acid (e.g., Asp or Glu), an amino acid with a nonpolar side chain substituted for another amino acid with a nonpolar side chain (e.g., Ala, Gly, Val, Ile, Leu, Met, Phe, Pro, Trp, Cys, Val, etc.), a basic/positively charged polar amino acid substituted for another basic/positively charged polar amino acid (e.g., Lys, His, Arg, etc.), an uncharged amino acid with a polar side chain substituted for another uncharged amino acid with a polar side chain (e.g., Asn, Gln, Ser, Thr, Tyr, etc.), an amino acid with a
- the antibody construct or antigen binding domain can consist essentially of the specified amino acid sequence or sequences described herein, such that other components, e.g., other amino acids, do not materially change the biological activity of the antibody construct or antigen binding domain functional variant.
- the antibodies in the immunoconjugates contain a modified Fc region, wherein the modification modulates the binding of the Fc region to one or more Fc receptors.
- the antibodies in the immunoconjugates contain one or more modifications (e.g., amino acid insertion, deletion, and/or substitution) in the Fc region that results in modulated binding (e.g., increased binding or decreased binding) to one or more Fc receptors (e.g., Fc ⁇ RI (CD64), Fc ⁇ RIIA (CD32A), Fc ⁇ RIIB (CD32B), Fc ⁇ RIIIA (CD16a), and/or Fc ⁇ RIIIB (CD16b)) as compared to the native antibody lacking the mutation in the Fc region.
- modifications e.g., amino acid insertion, deletion, and/or substitution
- Fc receptors e.g., Fc ⁇ RI (CD64), Fc ⁇ RIIA (CD32A), Fc ⁇ RIIB (CD32B), Fc ⁇ RIIIA (CD16a), and/or Fc ⁇ RIIIB (CD16b)
- the antibodies in the immunoconjugates contain one or more modifications (e.g., amino acid insertion, deletion, and/or substitution) in the Fc region that reduce the binding of the Fc region of the antibody to Fc ⁇ RIIB. In some embodiments, the antibodies in the immunoconjugates contain one or more modifications (e.g., amino acid insertion, deletion, and/or substitution) in the Fc region of the antibody that reduce the binding of the antibody to Fc ⁇ RIIB while maintaining the same binding or having increased binding to Fc ⁇ RI (CD64), Fc ⁇ RIIA (CD32A), and/or FcR ⁇ IIIA (CD16a) as compared to the native antibody lacking the mutation in the Fc region.
- modifications e.g., amino acid insertion, deletion, and/or substitution
- the antibodies in the immunoconjugates contain one of more modifications in the Fc region that increase the binding of the Fc region of the antibody to Fc ⁇ RIIB.
- the modulated binding is provided by mutations in the Fc region of the antibody relative to the native Fc region of the antibody.
- the mutations can be in a CH 2 domain, a CH 3 domain, or a combination thereof.
- a “native Fc region” is synonymous with a “wild-type Fc region” and comprises an amino acid sequence that is identical to the amino acid sequence of an Fc region found in nature or identical to the amino acid sequence of the Fc region found in the native antibody (e.g., cetuximab).
- Native sequence human Fc regions include a native sequence human IgG1 Fc region, native sequence human IgG2 Fc region, native sequence human IgG3 Fc region, and native sequence human IgG4 Fc region, as well as naturally occurring variants thereof.
- Native sequence Fc includes the various allotypes of Fcs (Jefferis et al., (2009) mAbs, 1(4):332-338).
- the mutations in the Fc region that result in modulated binding to one or more Fc receptors can include one or more of the following mutations: SD (S239D), SDIE (S239D/I332E), SE (S267E), SELF (S267E/L328F), SDIE (S239D/I332E), SDIEAL (S239D/I332E/A330L), GA (G236A), ALIE (A330L/I332E), GASDALIE (G236A/S239D/A330L/I332E), V9 (G237D/P238D/P271G/A330R), and V11 (G237D/P238D/H268D/P271G/A330R), and/or one or more mutations at the following amino acids: E233, G237, P238, H268, P271, L328 and A330.
- Fc region modifications for modulating Fc receptor binding are described in, for example, US 2016/0145350 and US 7416726 and US 5624821, which are hereby incorporated by reference in their entireties.
- the Fc region of the antibodies of the immunoconjugates are modified to have an altered glycosylation pattern of the Fc region compared to the native non-modified Fc region.
- Human immunoglobulin is glycosylated at the Asn297 residue in the C ⁇ 2 domain of each heavy chain.
- This N-linked oligosaccharide is composed of a core heptasaccharide, N-acetylglucosamine4Mannose3 (GlcNAc4Man3).
- heptasaccharide Removal of the heptasaccharide with endoglycosidase or PNGase F is known to lead to conformational changes in the antibody Fc region, which can significantly reduce antibody-binding affinity to activating Fc ⁇ R and lead to decreased effector function.
- the core heptasaccharide is often decorated with galactose, bisecting GlcNAc, fucose, or sialic acid, which differentially impacts Fc binding to activating and inhibitory Fc ⁇ R.
- the modification to alter the glycosylation pattern is a mutation. For example, a substitution at Asn297. In some embodiments, Asn297 is mutated to glutamine (N297Q).
- the antibodies of the immunoconjugates are modified to contain an engineered Fab region with a non-naturally occurring glycosylation pattern.
- hybridomas can be genetically engineered to secrete afucosylated mAb, desialylated mAb or deglycosylated Fc with specific mutations that enable increased FcR ⁇ IIIa binding and effector function.
- the antibodies of the immunoconjugates are engineered to be afucosylated.
- the antibody construct further comprises an Fc domain.
- the antibody construct is an antibody.
- the antibody construct is a fusion protein.
- the antigen binding domain can be a single-chain variable region fragment (scFv).
- scFv single-chain variable region fragment
- dsFv disulfide-stabilized variable region fragments
- the antibody construct or antigen binding domain may comprise one or more variable regions (e.g., two variable regions) of an antigen binding domain of an anti-PD-L1 antibody, an anti-HER2 antibody, or an anti-CEA antibody, each variable region comprising a CDR1, a CDR2, and a CDR3.
- the antibodies in the immunoconjugates contain a modified Fc region, wherein the modification modulates the binding of the Fc region to one or more Fc receptors.
- the entire Fc region of an antibody in the immunoconjugates is exchanged with a different Fc region, so that the Fab region of the antibody is conjugated to a non-native Fc region.
- the Fab region of cetuximab which normally comprises an IgG1 Fc region
- the Fab region of nivolumab which normally comprises an IgG4 Fc region
- the Fc modified antibody with a non-native Fc domain also comprises one or more amino acid modification, such as the S228P mutation within the IgG4 Fc, that modulate the stability of the Fc domain described.
- the Fc modified antibody with a non-native Fc domain also comprises one or more amino acid modifications described herein that modulate Fc binding to FcR.
- the modifications that modulate the binding of the Fc region to FcR do not alter the binding of the Fab region of the antibody to its antigen when compared to the native non-modified antibody.
- the modifications that modulate the binding of the Fc region to FcR also increase the binding of the Fab region of the antibody to its antigen when compared to the native non-modified antibody.
- the immunoconjugates of the invention comprise an antibody construct that comprises an antigen binding domain that specifically recognizes and binds PD-L1.
- the immunoconjugates of the invention comprise an antibody construct that comprises an antigen binding domain that specifically recognizes and binds PD-L1.
- Programmed Death-Ligand 1 (PD-L1, cluster of differentiation 274, CD274, B7- homolog 1, or B7-H1) belongs to the B7 protein superfamily, and is a ligand of programmed cell death protein 1 (PD-1, PDCD1, cluster of differentiation 279, or CD279).
- PD-L1 can also interact with B7.1 (CD80) and such interaction is believed to inhibit T cell priming.
- the PD- L1/PD-1 axis plays a large role in suppressing the adaptive immune response.
- PD-L1/PD-1 also contributes to preventing autoimmunity and therefore agonistic agents against PD-L1 or agents that deliver immune inhibitory payloads may help treatment of autoimmune disorders.
- PD-L1-binding agents including agents that bind PD-L1 with high affinity and effectively prevent PD-L1/PD-1 signaling and agents that can deliver therapeutic payloads to PD-L1 expressing cells.
- new PD-L1-binding agents to treat autoimmune disorders and infections.
- a method is provided of delivering an aminobenzazepine derivative payload to a cell expressing PD-L1 comprising administering to the cell, or mammal comprising the cell, an immunoconjugate comprising an anti-PD-L1 antibody covalently attached to a linker which is covalently attached to one or more aminobenzazepine moieties. Also provided is a method for enhancing or reducing or inhibiting an immune response in a mammal, and a method for treating a disease, disorder, or condition in a mammal that is responsive to PD-L1 inhibition, which methods comprise administering a PD-L1 immunoconjugate thereof, to the mammal.
- the invention provides a PD-L1 binding agent comprising an immunoglobulin heavy chain variable region polypeptide and an immunoglobulin light chain variable region polypeptide.
- the PD-L1 binding agent specifically binds PD-L1.
- the binding specificity of the agent allows for targeting PD-L1 expressing cells, for instance, to deliver therapeutic payloads to such cells.
- the PD-L1 binding agent (Type A or Type B) binds to human PD- L1, for example, a protein comprising SEQ ID NO: 307.
- binding agents that bind to any PD-L1 homolog or paralog also are encompassed.
- the PD-L1 protein comprises at least about 70%, about 75%, about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or more sequence identity to SEQ ID NO: 307.
- the binding agent binds human PD-L1 and cynomolgus PD-L1; or human, cynomolgus and mouse PD-L1.
- the PD-L1 binding agent binds PD-L1 without substantially inhibiting or preventing PD-L1 from binding to its receptor, PD-1.
- the PD-L1 binding agent can completely or partially block (inhibit or prevent) binding of PD-L1 to its receptor, PD-1, such that the antibody can be used to inhibit PD-L1/PD- 1 signaling (e.g., for therapeutic purposes).
- the antibody or antigen-binding antibody fragment can be monospecific for PD-L1, or can be bispecific or multi-specific.
- the binding domains can be different targeting different epitopes of the same antigen or targeting different antigens. Methods of constructing multivalent binding constructs are known in the art. Bispecific and multispecific antibodies are known in the art.
- a diabody, triabody, or tetrabody can be provided, which is a dimer, trimer, or tetramer of polypeptide chains each comprising a VH connected to a VL by a peptide linker that is too short to allow pairing between the VH and VL on the same polypeptide chain, thereby driving the pairing between the complementary domains on different V H -V L polypeptide chains to generate a multimeric molecule having two, three, or four functional antigen binding sites.
- bis-scFv fragments which are small scFv fragments with two different variable domains can be generated to produce bispecific bis-scFv fragments capable of binding two different epitopes.
- the PD-L1-binding agent also can be an antibody conjugate.
- the PD-L1- binding agent can be a conjugate of (1) an antibody, an alternative scaffold, or fragments thereof, and (2) a protein or non-protein moiety.
- the PD-L1 binding agent can be conjugated to a peptide, a fluorescent molecule, chemotherapeutic or other cytotoxic payload, immune-activating or immune-suppressive agent.
- the PD-L1-binding agent can be, or can be obtained from, a human antibody, a non- human antibody, a humanized antibody, or a chimeric antibody, or corresponding antibody fragments.
- a “chimeric” antibody is an antibody or fragment thereof typically comprising human constant regions and non-human variable regions.
- a “humanized” antibody is a monoclonal antibody typically comprising a human antibody scaffold but with non-human origin amino acids or sequences in at least one CDR (e.g., 1, 2, 3, 4, 5, or all six CDRs).
- the PD-L1 binding agents (Type A) comprise an immunoglobulin heavy chain variable region of any one of SEQ ID NOs: 223-264, or at least the CDRs thereof; and an immunoglobulin light chain variable region of any one of SEQ ID NOs: 265-306 or at least the CDRs thereof.
- the PD-L1 binding agents (Type A) comprise an immunoglobulin heavy chain variable region polypeptide with an amino acid sequence that is at least 90% identical to any one of SEQ ID NOs: 223-264, and an immunoglobulin light chain variable region polypeptide with an amino acid sequence that is at least 90% identical to any one of SEQ ID NOs: 265-306.
- the immunoglobulin heavy chain variable region polypeptide comprises a complementarity determining region 1 (HCDR1) comprising any one of SEQ ID NOs: 1-23, a complementarity determining region 2 (HCDR2) comprising any one of SEQ ID NOs: 24-57, and a complementarity determining region 3 (HCDR3) comprising any one of SEQ ID NOs: 58-95; and/or the immunoglobulin light chain variable region polypeptide comprises a complementarity determining region 1 (LCDR1) comprising any one of SEQ ID NOs: 96-128, a complementarity determining region 2 (LCDR2) comprising any one of SEQ ID NOs: 129-151, and a complementarity determining region 3 (LCDR3) comprising any one of SEQ ID NOs: 152-155.
- HCDR1 complementarity determining region 1
- HCDR2 complementarity determining region 2
- HCDR3 complementarity determining region 3
- nucleic acids encoding the PD-L1 binding agents, or the individual heavy and light chains thereof; vectors and cells comprising the nucleic acids; and compositions comprising the binding agents or nucleic acids.
- the PD-L1 binding agents (Type A) provided herein cause cellular internalization of PD-L1 or the PD-L1/PD-L1 binding agent complex upon binding to PD-L1 on the cell surface. Without wishing to be bound by any particular theory or mechanism of action, it is believed that the PD-L1 binding agents according to this embodiment cause PD-L1 internalization upon binding, and remain bound to PD-L1 during internalization resulting in internalization of the binding agent along with PD-L1.
- Cellular internalization of PD-L1 and bound PD-L1 binding agent can be determined by any suitable method, such as assaying for persistence on the cell surface and/or detection of internalized antibodies.
- the PD-L1 binding agent internalizes strongly enough that at least about 25% (e.g., at least about 35%, at least about 50%, at least about 75%, or at least about 90%) of the PD-L1 binding agent that binds PD-L1 on the cell surface is internalized (e.g., using a surface persistence assay, about 75% or less, about 65% or less, about 50% or less, about 75% or less or about 10% or less of PD-L1 binding agent molecules bound to PD-L1 on the cell surface at the beginning of the assay remain bound at the end of the assay).
- the PD-L1 binding agent comprises an immunoglobulin heavy chain variable region of any one of SEQ ID NOs: 223-264, a sequence that is at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% identical to SEQ ID NOs: 223-264, or at least the CDRs thereof; and/or an immunoglobulin light chain variable region of any one of SEQ ID NOs: 265-306, a sequence that is at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% identical to SEQ ID NOs: 265-306, or at least the CDRs thereof.
- the PD-L1 binding agent can comprise: (1) an immunoglobulin heavy chain variable region of SEQ ID NO: 223, or at least the CDRs thereof, and/or an immunoglobulin light chain variable region of SEQ ID NO: 265, or at least the CDRs thereof; (2) an immunoglobulin heavy chain variable region of SEQ ID NO: 224, or at least the CDRs thereof, and/or an immunoglobulin light chain variable region of SEQ ID NO: 266, or at least the CDRs thereof; (3) an immunoglobulin heavy chain variable region of SEQ ID NO: 225, or at least the CDRs thereof, and/or an immunoglobulin light chain variable region of SEQ ID NO: 267, or at least the CDRs thereof; (4) an immunoglobulin heavy chain variable region of SEQ ID NO: 226, or at least the CDRs thereof, and/or an immunoglobulin light chain variable region of SEQ ID NO: 268, or at least the CDRs thereof; (5) an immunoglobulin heavy chain variable region of SEQ ID
- the CDRs of a given heavy or light chain Ig sequence can be determined in accordance with any of the various known Ig numbering schemes (e.g., Kabat, Chothia, Martin (Enhanced Chothia), IGMT, AbM).
- the PD-L1 binding agent (Type A) comprises one or more of the following CDRs: a HCDR1 comprising or consisting of any one of SEQ ID NOs: 1-23 or a sequence that is at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% identical to SEQ ID NOs: 1-23; a HCDR2 comprising or consisting of any one of SEQ ID NOs: 24-57 or a sequence that is at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%
- the binding agent (Type A) comprises an immunoglobulin heavy chain polypeptide and an immunoglobulin light chain polypeptide, wherein: (1) the immunoglobulin heavy chain polypeptide comprises a HCDR1 comprising or consisting of SEQ ID NO: 1, a HCDR2 comprising or consisting of SEQ ID NO: 24, and a HCDR3 comprising or consisting of SEQ ID NO: 58; and/or the immunoglobulin light chain polypeptide comprises a LCDR1 comprising or consisting of SEQ ID NO: 96, a LCDR2 comprising or consisting of SEQ ID NO: 129, and a LCDR3 comprising or consisting of SEQ ID NO: 152; (2) the immunoglobulin heavy chain polypeptide comprises a HCDR1 comprising or consisting of SEQ ID NO: 2, a HCDR2 comprising or consisting of SEQ ID NO: 25, and a HCDR3 comprising or consisting of SEQ ID NO: 59; and/or the immunoglobulin heavy chain poly
- PD-L1-binding agents – Type B Provided herein are PD-L1 binding agents (Type B) comprising an immunoglobulin heavy chain variable region polypeptide and an immunoglobulin light chain variable region polypeptide.
- the PD-L1 binding agents (Type B) comprise an immunoglobulin heavy chain variable region of any one of SEQ ID NOs: 430-450, or at least the CDRs thereof; and an immunoglobulin light chain variable region of any one of SEQ ID NOs: 451-471, or at least the CDRs thereof.
- the PD-L1 binding agents comprise an immunoglobulin heavy chain variable region polypeptide with an amino acid sequence that is at least 90% identical to any one of SEQ ID NOs: 430-450, and an immunoglobulin light chain variable region polypeptide with an amino acid sequence that is at least 90% identical to any one of SEQ ID NOs: 451-471.
- the immunoglobulin heavy chain variable region polypeptide comprises a complementarity determining region 1 (HCDR1) comprising any one of SEQ ID NOs: 308-321, a complementarity determining region 2 (HCDR2) comprising any one of SEQ ID NOs: 322- 338, and a complementarity determining region 3 (HCDR3) comprising any one of SEQ ID NOs: 339-359; and/or the immunoglobulin light chain variable region polypeptide comprises a complementarity determining region 1 (LCDR1) comprising any one of SEQ ID NOs: 360-374, a complementarity determining region 2 (LCDR2) comprising any one of SEQ ID NOs: 375- 386, and a complementarity determining region 3 (LCDR3) comprising any one of SEQ ID NOs: 387-398.
- HCDR1 complementarity determining region 1
- HCDR2 complementarity determining region 2
- HCDR3 complementarity determining region 3
- the PD-L1 binding agent (Type B) comprises an immunoglobulin heavy chain variable region of any one of SEQ ID NOs: 430-450, a sequence that is at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% identical to SEQ ID NOs: 430-450, or at least the CDRs thereof; and/or an immunoglobulin light chain variable region of any one of SEQ ID NOs: 451-471, a sequence that is at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least
- the PD-L1 binding agent can comprise: (1) an immunoglobulin heavy chain variable region of SEQ ID NO: 429, or at least the CDRs thereof, and/or an immunoglobulin light chain variable region of SEQ ID NO: 450, or at least the CDRs thereof; (2) an immunoglobulin heavy chain variable region of SEQ ID NO: 430, or at least the CDRs thereof, and/or an immunoglobulin light chain variable region of SEQ ID NO: 451, or at least the CDRs thereof; (3) an immunoglobulin heavy chain variable region of SEQ ID NO: 431, or at least the CDRs thereof, and/or an immunoglobulin light chain variable region of SEQ ID NO: 452, or at least the CDRs thereof; (4) an immunoglobulin heavy chain variable region of SEQ ID NO: 432, or at least the CDRs thereof, and/or an immunoglobulin light chain variable region of SEQ ID NO: 453, or at least the CDRs thereof; (5) an immunoglobulin heavy chain variable region of SEQ
- the CDRs of a given heavy or light chain Ig sequence can be determined in accordance with any of the various known Ig numbering schemes (e.g., Kabat, Chothia, Martin (Enhanced Chothia), IGMT, AbM).
- the PD-L1 binding agent comprises one or more of the following CDRs: a HCDR1 comprising or consisting of any one of SEQ ID NOs: 308-321 or a sequence that is at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% identical to SEQ ID NOs: 308-321; a HCDR2 comprising or consisting of any one of SEQ ID NOs: 322-338 or a sequence that is at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about
- the binding agent comprises an immunoglobulin heavy chain polypeptide and an immunoglobulin light chain polypeptide, wherein: (1) the immunoglobulin heavy chain polypeptide comprises a HCDR1 comprising or consisting of SEQ ID NO: 308, a HCDR2 comprising or consisting of SEQ ID NO: 322, and a HCDR3 comprising or consisting of SEQ ID NO: 339; and/or the immunoglobulin light chain polypeptide comprises a LCDR1 comprising or consisting of SEQ ID NO: 360, a LCDR2 comprising or consisting of SEQ ID NO: 375, and a LCDR3 comprising or consisting of SEQ ID NO: 387; (2) the immunoglobulin heavy chain polypeptide comprises a HCDR1 comprising or consisting of SEQ ID NO: 309, a HCDR2 comprising or consisting of SEQ ID NO: 323, and a HCDR3 comprising or consisting of SEQ ID NO: 340; and/or the immunoglobulin heavy chain poly
- the binding agent comprises an immunoglobulin heavy chain polypeptide and an immunoglobulin light chain polypeptide, wherein the immunoglobulin heavy chain polypeptide comprises a first framework region, a second framework region, a third framework region, and/or a fourth framework region; and/or the immunoglobulin light chain polypeptide comprises a first framework region, a second framework region, a third framework region, and/or a fourth framework region; and/or the immunoglobulin heavy chain polypeptide and light chain polypeptide comprises any combination of the framework regions listed in Figures 6A-B and/or Figures 7A-B (Type B), respectively.
- the immunoconjugates of the invention comprise an antibody construct that comprises an antigen binding domain that specifically recognizes and binds HER2.
- immunoconjugates of the invention comprise anti-HER2 antibodies.
- an anti-HER2 antibody of an immunoconjugate of the invention comprises a humanized anti-HER2 antibody, e.g., huMAb4D5-1, huMAb4D5- 2, huMAb4D5-3, huMAb4D5-4, huMAb4D5-5, huMAb4D5-6, huMAb4D5-7 and huMAb4D5- 8, as described in Table 3 of US 5821337, which is specifically incorporated by reference herein.
- Those antibodies contain human framework regions with the complementarity- determining regions of a murine antibody (4D5) that binds to HER2.
- the humanized antibody huMAb4D5-8 is also referred to as trastuzumab, commercially available under the tradename HERCEPTINTM (Genentech, Inc.).
- the antibody construct or antigen binding domain comprises the CDR regions of trastuzumab.
- the anti-HER2 antibody further comprises the framework regions of the trastuzumab.
- the anti-HER2 antibody further comprises one or both variable regions of trastuzumab.
- an anti-HER2 antibody of an immunoconjugate of the invention comprises a humanized anti-HER2 antibody, e.g., humanized 2C4, as described in US 7862817.
- An exemplary humanized 2C4 antibody is pertuzumab (CAS Reg. No.380610- 27-5), PERJETATM (Genentech, Inc.).
- Pertuzumab is a HER dimerization inhibitor (HDI) and functions to inhibit the ability of HER2 to form active heterodimers or homodimers with other HER receptors (such as EGFR/HER1, HER2, HER3 and HER4). See, for example, Harari and Yarden, Oncogene 19:6102-14 (2000); Yarden and Sliwkowski. Nat Rev Mol Cell Biol 2:127- 37 (2001); Sliwkowski Nat Struct Biol 10:158-9 (2003); Cho et al. Nature 421:756-60 (2003); and Malik et al. Pro Am Soc Cancer Res 44:176-7 (2003).
- PERJETATM is approved for the treatment of breast cancer.
- the antibody construct or antigen binding domain comprises the CDR regions of pertuzumab.
- the anti-HER2 antibody further comprises the framework regions of the pertuzumab.
- the anti-HER2 antibody further comprises one or both variable regions of pertuzumab.
- the immunoconjugates of the invention comprise an antibody construct that comprises an antigen binding domain that specifically recognizes and binds Caprin-1 (Ellis JA, Luzio JP (1995) J Biol Chem.270(35):20717–23; Wang B, et al (2005) J Immunol.175 (7):4274–82; Solomon S, et al (2007) Mol Cell Biol.27(6):2324–42).
- Caprin-1 is also known as GPIAP1, GPIP137, GRIP137, M11S1, RNG105, p137GPI, and cell cycle associated protein 1.
- Cytoplasmic activation/proliferation-associated protein-1 (caprin-1) is an RNA-binding protein that participates in the regulation of cell cycle control-associated genes. Caprin-1 selectively binds to c-Myc and cyclin D2 mRNAs, which accelerates cell progression through the G 1 phase into the S phase, enhances cell viability and promotes cell growth, indicating that it may serve an important role in tumorigenesis (Wang B, et al (2005) J Immunol.175:4274– 4282). Caprin-1 acts alone or in combination with other RNA-binding proteins, such as RasGAP SH3-domain-binding protein 1 and fragile X mental retardation protein.
- caprin-1 In the tumorigenesis process, caprin-1 primarily functions by activating cell proliferation and upregulating the expression of immune checkpoint proteins. Through the formation of stress granules, caprin-1 is also involved in the process by which tumor cells adapt to adverse conditions, which contributes to radiation and chemotherapy resistance. Given its role in various clinical malignancies, caprin-1 holds the potential to be used as a biomarker and a target for the development of novel therapeutics (Yang, Z-S, et al (2019) Oncology Letters 18:15-21).
- the immunoconjugates of the invention comprise an antibody construct that comprises an antigen binding domain that specifically recognizes and binds CEA.
- CEA carcinoembryonic antigen
- CEA-CIDE TM Immunomedics, CAS Reg. No.219649-07-7
- MN-14 and hMN14 is a humanized IgG1 monoclonal antibody and has been studied for the treatment of colorectal cancer (Blumenthal, R. et al (2005) Cancer Immunology Immunotherapy 54(4):315-327).
- Labetuzumab conjugated to a camptothecin analog targets carcinoembryonic antigen- related cell adhesion mol.5 (CEACAM5) and is being studied in patients with relapsed or refractory metastatic colorectal cancer (Sharkey, R. et al, (2016), Molecular Cancer Therapeutics 17(1):196-203; Cardillo, T. et al (2016) Molecular Cancer Therapeutics 17(1):150-160).
- the CEA-targeting antibody construct or antigen binding domain comprises the Variable light chain (VL kappa) of hMN-14/labetuzumab SEQ ID NO.472 (US 6676924).
- VL kappa Variable light chain of hMN-14/labetuzumab SEQ ID NO.472 (US 6676924).
- the CEA-targeting antibody construct or antigen binding domain comprises the light chain CDR (complementarity determining region) or light chain framework (LFR) sequences of hMN-14/labetuzumab SEQ ID NO.473-479 (US 6676924).
- the CEA-targeting antibody construct or antigen binding domain comprises the Variable heavy chain (VH) of hMN-14/labetuzumab SEQ ID NO. 480 (US 6676924).
- the CEA-targeting antibody construct or antigen binding domain comprises the heavy chain CDR (complementarity determining region) or heavy chain framework (HFR) sequences of hMN-14/labetuzumab SEQ ID NO.481-487 (US 6676924).
- the CEA-targeting antibody construct or antigen binding domain comprises the Variable light chain (VL kappa) of hPR1A3 SEQ ID NO.488 (US 8642742).
- VL kappa Variable light chain
- the CEA-targeting antibody construct or antigen binding domain comprises the light chain CDR (complementarity determining region) or light chain framework (LFR) sequences of hPR1A3 SEQ ID NO.489-495 (US 8642742).
- the CEA-targeting antibody construct or antigen binding domain comprises the heavy chain CDR (complementarity determining region) or heavy chain framework (HFR) sequences of hPR1A3 SEQ ID NO.496-502 (US 8642742).
- the CEA-targeting antibody construct or antigen binding domain comprises the Variable light chain (VL kappa) of hMFE-23 SEQ ID NO.503 (US 723288).
- the CEA-targeting antibody construct or antigen binding domain comprises the light chain CDR (complementarity determining region) or light chain framework (LFR) sequences of hMFE-23 SEQ ID NO.504-510 (US 723288).
- the CEA-targeting antibody construct or antigen binding domain comprises the Variable heavy chain (VH) of hMFE-23 SEQ ID NO.511 (US 723288).
- the CEA-targeting antibody construct or antigen binding domain comprises the heavy chain CDR (complementarity determining region) or heavy chain framework (HFR) sequences of hMFE-23 SEQ ID NO.512-518 (US 723288).
- the CEA-targeting antibody construct or antigen binding domain comprises the Variable light chain (VL kappa) of SM3E SEQ ID NO.519 (US 723288).
- VL kappa Variable light chain
- the CEA-targeting antibody construct or antigen binding domain comprises the light chain CDR (complementarity determining region) or light chain framework (LFR) sequences of SM3E SEQ ID NO.520-526 (US 723288).
- the CEA-targeting antibody construct or antigen binding domain comprises the Variable heavy chain (VH) of SM3E SEQ ID NO.527 (US 723288).
- VH Variable heavy chain
- the CEA-targeting antibody construct or antigen binding domain comprises the heavy chain CDR (complementarity determining region) or heavy chain framework (HFR) sequences of SM3E SEQ ID NO.528-534 (US 723288).
- the CEA-targeting antibody construct or antigen binding domain comprises the light chain CDR (complementarity determining region) or light chain framework (LFR) sequences of NP-4/arcitumomab SEQ ID NO.535-541.
- the CEA-targeting antibody construct or antigen binding domain comprises the Variable heavy chain (VH) of NP-4/arcitumomab SEQ ID NO. 542.
- the CEA-targeting antibody construct or antigen binding domain comprises the heavy chain CDR (complementarity determining region) or heavy chain framework (HFR) sequences of NP-4 SEQ ID NO.543-549.
- the CEA-targeting antibody construct or antigen binding domain comprises the Variable light chain (VL kappa) of M5A/hT84.66 SEQ ID NO.
- the CEA-targeting antibody construct or antigen binding domain comprises the light chain CDR (complementarity determining region) or light chain framework (LFR) sequences of M5A/hT84.66 SEQ ID NO.551-557 (US 7776330).
- the CEA-targeting antibody construct or antigen binding domain comprises the Variable heavy chain (VH) of M5A/hT84.66 SEQ ID NO.558 (US 7776330).
- VH Variable heavy chain
- M5A/hT84.66 SEQ ID NO.558 (US 7776330).
- the CEA-targeting antibody construct or antigen binding domain comprises the heavy chain CDR (complementarity determining region) or heavy chain framework (HFR) sequences of M5A/hT84.66 SEQ ID NO.559-565 (US 7776330).
- the CEA-targeting antibody construct or antigen binding domain comprises the Variable light chain (VL kappa) of hAb2-3 SEQ ID NO.566 (US 9617345).
- the CEA-targeting antibody construct or antigen binding domain comprises the light chain CDR (complementarity determining region) or light chain framework (LFR) sequences of hAb2-3 SEQ ID NO.567-573 (US 9617345).
- the CEA-targeting antibody construct or antigen binding domain comprises the Variable heavy chain (VH) of SEQ ID NO.574 (US 9617345).
- the CEA-targeting antibody construct or antigen binding domain comprises the heavy chain CDR (complementarity determining region) or heavy chain framework (HFR) sequences of hAb2-3 SEQ ID NO.575-581.
- the CEA-targeting antibody construct or antigen binding domain comprises the Variable light chain (VL kappa) of A240VL-B9VH/AMG-211 SEQ ID NO.582 (US 9982063).
- VL kappa Variable light chain
- QAVLTQPASLSASPGASASLTCTLRRGINVGAYSIYWYQQKPGSPPQYLLRYKSDSDKQQGSGVSSRFSA SKDASANAGILLISGLQSEDEADYYCMIWHSGASAVFGGGTKLTVL SEQ ID NO.
- the CEA-targeting antibody construct or antigen binding domain comprises the light chain CDR (complementarity determining region) or light chain framework (LFR) sequences of A240VL-B9VH/AMG-211 SEQ ID NO.583-589 (US 9982063).
- the CEA-targeting antibody construct or antigen binding domain comprises the Variable heavy chain (VH) of B9VH SEQ ID NO.590 (US 9982063).
- the CEA-targeting antibody construct or antigen binding domain comprises the heavy chain CDR (complementarity determining region) or heavy chain framework (HFR) sequences of SEQ ID NO.591-597 (US 9982063).
- the CEA-targeting antibody construct or antigen binding domain comprises the Variable heavy chain (VH) of E12VH SEQ ID NO.598 (US 9982063).
- the CEA-targeting antibody construct or antigen binding domain comprises the heavy chain CDR (complementarity determining region) or heavy chain framework (HFR) sequences of SEQ ID NO.599-605 (US 9982063).
- the immunoconjugates of the invention comprise an antibody construct that comprises an antigen binding domain that specifically recognizes and binds Trop2.
- Tumor-associated calcium signal transducer 2 is a transmembrane glycoprotein encoded by the TACSTD2 gene (Linnenbach AJ, et al (1993) Mol Cell Biol.13(3): 1507–15; Calabrese G, et al (2001) Cytogenet Cell Genet.92(1–2): 164–5).
- Trop2 is an intracellular calcium signal transducer that is differentially expressed in many cancers and signals cells for self-renewal, proliferation, invasion, and survival. Trop2 is considered a stem cell marker and is expressed in many normal tissues, though in contrast, it is overexpressed in many cancers (Ohmachi T, et al., (2006) Clin.
- Trop2 Overexpression of Trop2 is of prognostic significance. Several ligands have been proposed that interact with Trop2. Trop2 signals the cells via different pathways and it is transcriptionally regulated by a complex network of several transcription factors.
- Human Trop2 (TACSTD2: tumor-associated calcium signal transducer 2, GA733-1, EGP-1, M1S1; hereinafter, referred to as hTrop2) is a single-pass transmembrane type 1 cell membrane protein consisting of 323 amino acid residues. While the presence of a cell membrane protein involved in immune resistance, which is common to human trophoblasts and cancer cells (Faulk W P, et al., Proc. Natl. Acad.
- an antigen molecule recognized by a monoclonal antibody against a cell membrane protein in a human choriocarcinoma cell line was identified and designated as Trop2 as one of the molecules expressed in human trophoblasts (Lipinski M, et al., Proc. Natl. Acad. Sci.78(8), 5147-5150 (1981)).
- This molecule was also designated as tumor antigen GA733-1 recognized by a mouse monoclonal antibody GA733 (Linnenbach A J, et al., Proc. Natl. Acad.
- hTrop2 The DNA sequence and amino acid sequence of hTrop2 are available on a public database and can be referred to, for example, under Accession Nos. NM_002353 and NP_002344 (NCBI). In response to such information suggesting the association with cancer, a plurality of anti-hTrop2 antibodies have been established so far and studied for their antitumor effects.
- an unconjugated antibody that exhibits in itself antitumor activity in nude mouse xenograft models WO 2008/144891; WO 2011/145744; WO 2011/155579; WO 2013/077458
- an antibody that exhibits antitumor activity as ADC with a cytotoxic drug WO 2003/074566; WO 2011/068845; WO 2013/068946; US 7999083.
- the strength or coverage of their activity is still insufficient, and there are unsatisfied medical needs for hTrop2 as a therapeutic target.
- Trop2 expression in cancer cells has been correlated with drug resistance.
- the Trop2 antibody in sacituzumab govitecan is conjugated to SN-38, the active metabolite of irinotecan (US 2016/0297890; WO 2015/098099).
- the Trop2-targeting antibody construct or antigen binding domain comprises the light chain CDR (complementarity determining region) sequences of hRS7 (humanized RS7), SEQ ID NO.607-609 (US 7238785, incorporated by reference herein).
- the Trop2-targeting antibody construct or antigen binding domain comprises the heavy chain CDR (complementarity determining region) sequences of hRS7 (humanized RS7), SEQ ID NO.610-612 (US 7238785; US 9797907; US 9382329; WO 2020/142659, each incorporated by reference herein).
- the Trop2-targeting antibody construct or antigen binding domain comprises the light chain CDR (complementarity determining region) sequences of AR47A6.4.2, SEQ ID NO.607-609 (US 7420040, incorporated by reference herein).
- the Trop2-targeting antibody construct or antigen binding domain comprises the heavy chain CDR (complementarity determining region) sequences of AR47A6.4.2, SEQ ID NO.610, 613, 614 (US 7420040, incorporated by reference herein).
- CDR-H3 GGYGSSYWYFDV 614 In an embodiment of the invention, the Trop2-targeting antibody construct or antigen binding domain comprises the light chain CDR (complementarity determining region) sequences of humanized KM4097, SEQ ID NO.615-617 (US 2012/0237518, incorporated by reference herein).
- the Trop2-targeting antibody construct or antigen binding domain comprises the heavy chain CDR (complementarity determining region) sequences of humanized KM4097, SEQ ID NO.618-620 (US 2012/0237518, incorporated by reference herein).
- the Trop2-targeting antibody construct or antigen binding domain comprises the light chain CDR (complementarity determining region) sequences of hTINA1-H1L1, SEQ ID NO.608, 609, 621 (US 10,227,417, incorporated by reference herein).
- the Trop2-targeting antibody construct or antigen binding domain comprises the heavy chain CDR (complementarity determining region) sequences of hTINA1-H1L1, SEQ ID NO.622-624 (US 10,227,417, incorporated by reference herein).
- the Trop2-targeting antibody construct or antigen binding domain comprises the light chain CDR (complementarity determining region) sequences of hTINA1-H1L1, SEQ ID NO.625-627 (US 8871908, incorporated by reference herein).
- the Trop2-targeting antibody construct or antigen binding domain comprises the heavy chain CDR (complementarity determining region) sequences of hTINA1-H1L1, SEQ ID NO.628-633 (US 8871908, incorporated by reference herein).
- the Trop2-targeting antibody construct or antigen binding domain comprises the light chain CDR (complementarity determining region) sequences SEQ ID NO.626, 627, 634 of hTINA1-H1L1, (US 8871908, incorporated by reference herein).
- the Trop2-targeting antibody construct or antigen binding domain comprises the heavy chain CDR (complementarity determining region) sequences SEQ ID NO.628-630, 633, 635, 636 of hTINA1-H1L1, (US 8871908, incorporated by reference herein).
- the antibody construct further comprises an Fc domain.
- the antibody construct is an antibody.
- the antibody construct is a fusion protein.
- the antigen binding domain can be a single-chain variable region fragment (scFv).
- a single-chain variable region fragment which is a truncated Fab fragment including the variable (V) domain of an antibody heavy chain linked to a V domain of a light antibody chain via a synthetic peptide, can be generated using routine recombinant DNA technology techniques.
- disulfide-stabilized variable region fragments can be prepared by recombinant DNA technology.
- the antibody construct or antigen binding domain may comprise one or more variable regions (e.g., two variable regions) of an antigen binding domain of an anti-Trop2 antibody, each variable region comprising a CDR1, a CDR2, and a CDR3.
- the Fc region is modified by inclusion of a transforming growth factor beta 1 (TGF ⁇ 1) receptor, or a fragment thereof, that is capable of binding TGF ⁇ 1.
- TGF ⁇ 1 TGF ⁇ 1
- the receptor can be TGF ⁇ receptor II (TGF ⁇ RII).
- TGF ⁇ receptor is a human TGF ⁇ receptor.
- the IgG has a C-terminal fusion to a TGF ⁇ RII extracellular domain, ECD (US 9676863).
- An “Fc linker” may be used to attach the IgG to the TGF ⁇ RII extracellular domain.
- the Fc linker may be a short, flexible peptide that allows for the proper three-dimensional folding of the molecule while maintaining the binding- specificity to the targets.
- the N-terminus of the TGF ⁇ receptor is fused to the Fc of the antibody construct (with or without an Fc linker).
- the C- terminus of the antibody construct heavy chain is fused to the TGF ⁇ receptor (with or without an Fc linker).
- the C-terminal lysine residue of the antibody construct heavy chain is mutated to alanine.
- the antibodies in the immunoconjugates are glycosylated.
- the antibodies in the immunoconjugates is a cysteine-engineered antibody which provides for site-specific conjugation of an adjuvant, label, or drug moiety to the antibody through cysteine substitutions at sites where the engineered cysteines are available for conjugation but do not perturb immunoglobulin folding and assembly or alter antigen binding and effector functions (Junutula, et al., 2008b Nature Biotech., 26(8):925-932; Dornan et al. (2009) Blood 114(13):2721-2729; US 7521541; US 7723485; US 2012/0121615; WO 2009/052249).
- cyste engineered antibody or “cysteine engineered antibody variant” is an antibody in which one or more residues of an antibody are substituted with cysteine residues.
- Cysteine-engineered antibodies can be conjugated to the thienoazepine adjuvant moiety as a thienoazepine-linker compound with uniform stoichiometry (e.g., up to two thienoazepine moieties per antibody in an antibody that has a single engineered cysteine site).
- cysteine-engineered antibodies used to prepare the immunoconjugates of Table 3 have a cysteine residue introduced at the 149-lysine site of the light chain (LC K149C).
- the cysteine-engineered antibodies have a cysteine residue introduced at the 118-alanine site (EU numbering) of the heavy chain (HC A118C). This site is alternatively numbered 121 by Sequential numbering or 114 by Kabat numbering.
- the cysteine-engineered antibodies have a cysteine residue introduced in the light chain at G64C or R142C according to Kabat numbering, or in the heavy chain at D101C, V184C or T205C according to Kabat numbering.
- IMMUNOSTIMULATORY COMPOUNDS The immunoconjugate of the invention comprises an immunostimulatory moiety.
- the active immunostimulatory compound can interact with and/or modulate a receptor to elicit an immune response.
- receptors include, but are not limited to: (1) various toll-like receptors, TLR (Javaid, N. et al (2019) Pharmaceutics 11(9), 441); (2) STING, STING1 (Ramanjulu, J.M. et al (2018 ) Nature 564:439–443; Barber, G.N. (2015) Nature Rev Immunol 15:760–770; US 2019/0300513; ); (3) NOD2 (Negroni, A. et al (2016) J.
- PRRs include but are not limited to: Toll-like receptors (TLRs), STING-like receptors, RIG-I-like receptors (RLRs), NOD-like receptors (NLRs), C-type lectin-like receptors (CLRs), and DNA sensors.
- the immunostimulatory moiety is a TLR agonist.
- TLRs are type-I transmembrane proteins that are responsible for the initiation of innate immune responses in vertebrates. TLRs recognize a variety of pathogen-associated molecular patterns from bacteria, viruses, and fungi and act as a first line of defense against invading pathogens. TLRs elicit overlapping yet distinct biological responses due to differences in cellular expression and in the signaling pathways that they initiate.
- TLRs Once engaged (e.g., by a natural stimulus or a synthetic TLR agonist), TLRs initiate a signal transduction cascade leading to activation of nuclear factor- ⁇ B (NF- ⁇ B) via the adapter protein myeloid differentiation primary response gene 88 (MyD88) and recruitment of the IL-1 receptor associated kinase (IRAK). Phosphorylation of IRAK then leads to recruitment of TNF-receptor associated factor 6 (TRAF6), which results in the phosphorylation of the NF- ⁇ B inhibitor I- ⁇ B. As a result, NF- ⁇ B enters the cell nucleus and initiates transcription of genes whose promoters contain NF- ⁇ B binding sites, such as cytokines.
- NF- ⁇ B nuclear factor- ⁇ B
- MyD88 adapter protein myeloid differentiation primary response gene 88
- IRAK IL-1 receptor associated kinase
- TNF-receptor associated factor 6 TNF-receptor associated factor 6
- TNF-receptor associated factor 6 TNF-receptor associated factor 6
- MyD88 dependent pathway also activates several IRF family members, including IRF5 and IRF7 whereas the TRIF dependent pathway also activates the NF- ⁇ B pathway.
- the TLR agonist described herein is a TLR7 and/or TLR8 agonist. TLR7 and TLR8 are both expressed in monocytes and dendritic cells.
- TLR7 is also expressed in plasmacytoid dendritic cells (pDCs) and B cells.
- TLR8 is expressed mostly in cells of myeloid origin, i.e., monocytes, granulocytes, and myeloid dendritic cells.
- TLR7 and TLR8 are capable of detecting the presence of “foreign” single-stranded RNA within a cell, as a means to respond to viral invasion.
- Treatment of TLR8-expressing cells, with TLR8 agonists can result in production of high levels of IL-12, IFN- ⁇ , IL-1, TNF- ⁇ , IL-6, and other inflammatory cytokines.
- TLR7-expressing cells such as pDCs
- TLR7 agonists can result in production of high levels of IFN- ⁇ and other inflammatory cytokines.
- TLR7/TLR8 engagement and resulting cytokine production can activate dendritic cells and other antigen-presenting cells, driving diverse innate and acquired immune response mechanisms leading to tumor destruction.
- Exemplary TLR 7/8 agonists include an amino-imidazoquinoline of formulas a-d: a; an aminoquinoline of formula b: an amino-benzazepine of formula c: an amino-thienoazepine of formula d: amino-pyrazoloazepines of formulas e and f:
- An exemplary amino-benzazepine immunostimulatory TLR moiety has the structure: where the wavy line indicates the site of attachment to the elastase-substrate, peptide linker, L. ELASTASE-SUBSTRATE, PEPTIDE LINKERS
- the invention includes a linking unit, i.e. L or linker, between the cell-binding agent and the immunostimulatory moiety.
- the linker is a peptide radical based on a linear sequence of specific amino acid residues which can be selectively cleaved by a tumor-associated elastase enzyme or an enzyme with elastase-like activity.
- the peptide radical may be about two to about twelve amino acids. Cleavage of a bond within the elastase-substrate, peptide linker by elastase releases an active form of the immunostimulatory moiety. This leads to an increase in the tissue specificity of the conjugates according to the invention and thus to an additional decrease of toxicity of the conjugates according to the invention in other tissue types.
- the linker provides sufficient stability of the immunoconjugate in biological media, e.g. culture medium or serum and, at the same time, the desired intracellular action within tumor tissue as a result of its specific enzymatic or hydrolytic cleavability with release of the immunostimulatory moiety, i.e. “payload”.
- the enzymatic activity of elastase can catalyze cleavage of a covalent bond of the immunoconjugate under physiological conditions.
- the enzymatic activity being the expression product of cells associated with tumor tissue.
- the enzymatic activity on the cleavage site of the targeting peptide converts the immunoconjugate to an active immunostimulatory drug free of targeting peptide and linking group.
- the cleavage site may be specifically recognized by elastase.
- Elastase may catalyze the cleavage of a specific peptidic bond between the C-terminal amino acid residue of the specific peptide and the immunostimulatory moiety of the immunoconjugate.
- EsPEP is a tripeptide and has the formulas: or EsPEP is a tetrapeptide and has the formulas: where AA1, AA2 and AA3 are independently selected from a natural or unnatural amino acid side chain, or one or more of AA 1 , AA 2 , AA 3 , AA 4 , and an adjacent nitrogen atom form a 5-membered ring proline amino acid, and the wavy line indicates a point of attachment.
- Cyc is selected from C 6 - C 20 aryldiyl and C 1 -C 20 heteroaryldiyl, optionally substituted with one or more groups selected from F, Cl, NO 2 , ⁇ OH, ⁇ OCH 3 , and a glucuronic acid having the structure:
- EsPEP is a tripeptide wherein AA 1 is methyl, AA 2 forms proline, and AA3 is isopropyl.
- EsPEP is a tetrapeptide wherein AA 1 is selected from the group consisting of Abu, Ala, and Val; AA2 is selected from the group consisting of Nle(O-Bzl), Oic and Pro; AA3 is selected from the group consisting of Ala and Met(O) 2 ; and AA 4 is selected from the group consisting of Oic, Arg(NO 2 ), Bpa, and Nle(O-Bzl).
- EsPEP is comprised of amino acid residues of amino acids selected from the group consisting of: Ala D-Ala Met(O 2 ) .
- EsPEP is selected from the group consisting of Ala-Pro- Val, Asn-Pro-Val, Ala-Ala-Val, Ala-Ala-Pro-Ala (SEQ ID NO: 639), Ala-Ala-Pro-Val (SEQ ID NO: 640), and Ala-Ala-Pro-Nva (SEQ ID NO: 641).
- EsPEP has the formula: .
- EsPEP has the formula: .
- the immunoconjugates of the invention are prepared by conjugation of a cell-binding agent with an immunostimulant-elastase substrate, peptide linker compound.
- Immunostimulant- elastase substrate, peptide linker compounds comprise an immunostimulatory moiety covalently attached to a linker unit.
- the linker units comprise an elastase-substrate, peptide unit and functional groups and subunits which affect stability, permeability, solubility, and other pharmacokinetic, safety, and efficacy properties of the immunoconjugates.
- the linker unit includes a reactive functional group which reacts, i.e.
- conjugates with a reactive functional group of the antibody.
- a nucleophilic group such as a lysine side chain amino of the antibody reacts with an electrophilic reactive functional group of the immunostimulant- elastase substrate, peptide linker compound to form the immunoconjugate.
- a cysteine thiol of the cell-binding agent e.g. an antibody, reacts with a maleimide or bromoacetamide group of the immunostimulant-elastase substrate, peptide linker compound to form the immunoconjugate.
- Electrophilic reactive functional groups suitable for the immunostimulant-elastase substrate, peptide linker compounds include, but are not limited to, N-hydroxysuccinimidyl (NHS) esters and N-hydroxysulfosuccinimidyl (sulfo-NHS) esters (amine reactive); carbodiimides (amine and carboxyl reactive); hydroxymethyl phosphines (amine reactive); maleimides (thiol reactive); halogenated acetamides such as N-iodoacetamides (thiol reactive); aryl azides (primary amine reactive); fluorinated aryl azides (reactive via carbon-hydrogen (C- H) insertion); pentafluorophenyl (PFP) esters (amine reactive); tetrafluorophenyl (TFP) esters (amine reactive); tetrafluorophenyl, sulfonate (sulfo-TFP) esters, imidoesters (
- linkers may be labile in the blood stream, thereby releasing unacceptable amounts of the adjuvant/drug prior to internalization in a target cell (Khot, A. et al (2015) Bioanalysis 7(13):1633–1648).
- Other linkers may provide stability in the bloodstream, but intracellular release effectiveness may be negatively impacted.
- Linkers that provide for desired intracellular release typically have poor stability in the bloodstream.
- bloodstream stability and intracellular release are typically inversely related.
- the amount of adjuvant/drug moiety loaded on the antibody i.e. drug loading
- the amount of aggregate that is formed in the conjugation reaction i.e. the amount of aggregate that is formed in the conjugation reaction
- the yield of final purified conjugate that can be obtained are interrelated.
- aggregate formation is generally positively correlated to the number of equivalents of adjuvant/drug moiety and derivatives thereof conjugated to the antibody.
- formed aggregates must be removed for therapeutic applications.
- drug loading-mediated aggregate formation decreases immunoconjugate yield and can render process scale-up difficult.
- Exemplary embodiments of immunostimulant-elastase substrate, peptide linker compounds are selected from formulas IIa-f:
- R 1 , R 2 , R 3 , R 4 , and R 5 are independently selected from the group consisting of H, C 1 -C 12 alkyl, C 2 -C 6 alkenyl, C 2 -C 6 alkynyl, C 3 -C 12 carbocyclyl, C 6 -C 20 aryl, C 2 -C 9 heterocyclyl, and C 1 -C 20 heteroaryl, where alkyl, alkenyl, alkynyl, carbocyclyl, aryl, heterocyclyl, and heteroaryl are independently and optionally substituted with one or more groups selected from: ⁇ (C 1 -C 12 alkyldiyl) ⁇ N(R 6 ) ⁇ *; ⁇ (C 1 -C 12 alkyldiyl) ⁇ N(R 6 ) 2 ; ⁇ (C 1 -C 12 alkyldiyl) ⁇ OR 6 ; ⁇ (C 3 -C 12 carbocyclyl); ⁇ (C 3
- An exemplary embodiment of an immunostimulant-elastase substrate, peptide linker compound has the formula: ; where TFP is 2,3,5,6-tetrafluorophenoxy.
- An exemplary embodiment of an immunostimulant-elastase substrate, peptide linker compound includes wherein PEG has the formula: ⁇ (CH 2 CH 2 O) 25 ⁇ (CH 2 ) 2 ⁇ or ⁇ (CH 2 CH 2 O) 10 ⁇ (CH 2 ) 2 ⁇ .
- Exemplary embodiments of immunostimulant-elastase substrate, peptide linker compounds comprise a structure selected from IIe-h:
- immunostimulant-elastase substrate, peptide linker compounds comprise a structure selected from IIi-l: where the wavy line indicates the attachment through L to the antibody.
- the invention includes all reasonable combinations, and permutations of the features, of the Formula II embodiments.
- An exemplary embodiment of the immunostimulant-elastase substrate, peptide linker compound of Formula II is selected from Tables 1a and 1b. Each compound was synthesized and purified by the methods in the Examples provided herein, characterized by mass spectrometry, and shown to have the mass indicated.
- Table 1a Immunostimulant-elastase substrate, peptide linker compound of Formula II and intermediates thereof
- immunoconjugates comprise a cell-binding agent covalently attached to one or more immunostimulatory moieties by an elastase-substrate, peptide linker, having the Formula I:
- Targeting properties of the cell-binding agent may drive the immunoconjugate accumulation at a tumor site, where the proinflammatory stimuli result in the recruitment of tumor-infiltrating leukocytes, such as neutrophils. The activation of the latter promotes the release of elastase, which triggers the payload release in the tumor microenvironment.
- This mode of activation may possess potential therapeutic benefits, since the free payload would diffuse in the tumor mass, and act against a large variety of cells (e.g., antigen-negative cancer cells, endothelial and other cancer-associated host cells) leading to a localized damage (Li, F. et al (2016) Cancer Res.76:2710-2719).
- Lipophilic immunostimulatory moieties may be most suited for this strategy, as the membrane permeability may facilitate biological activity by the so-called “bystander effect.”
- the invention includes an immunoconjugates comprising a cell-binding agent covalently attached to one or more immunostimulatory moieties by an elastase-substrate, peptide linker.
- the immunoconjugate includes wherein the cell-binding agent is an antibody.
- the antibody may be an antibody construct that has an antigen binding domain that binds PD-L1.
- the antibody may be selected from the group consisting of atezolizumab, durvalumab, and avelumab, or a biosimilar or a biobetter thereof.
- the antibody may be an antibody construct that has an antigen binding domain that binds HER2.
- the antibody may be selected from the group consisting of trastuzumab and pertuzumab, or a biosimilar or a biobetter thereof.
- the antibody may be an antibody construct that has an antigen binding domain that binds CEA.
- the antibody may be labetuzumab, or a biosimilar or a biobetter thereof.
- An exemplary embodiment of the immunoconjugate includes wherein the one or more immunostimulatory moieties is a pattern-recognition receptor.
- An exemplary embodiment of the immunoconjugate includes wherein the one or more immunostimulatory moieties interact with or modulate a receptor selected from the group consisting of TLR, STING, NOD2, RIG-1, and NLRP3.
- An exemplary embodiment of the immunoconjugate has Formula I: I or a pharmaceutically acceptable salt thereof, wherein: Ab is the antibody; L is the linker comprising an elastase-substrate, peptide linker unit; Ims is the immunostimulatory moiety; and p is an integer from 1 to 8.
- An exemplary embodiment of the immunoconjugate includes wherein Ims is selected from formulas Ia-f: Ia; wherein R 1 , R 2 , R 3 , R 4 , and R 5 are independently selected from the group consisting of H, C 1 -C 12 alkyl, C 2 -C 6 alkenyl, C 2 -C 6 alkynyl, C 3 -C 12 carbocyclyl, C 6 -C 20 aryl, C 2 -C 9 heterocyclyl, and C 1 -C 20 heteroaryl, where alkyl, alkenyl, alkynyl, carbocyclyl, aryl, heterocyclyl, and heteroaryl are independently and optionally substituted with one or more groups selected from: ⁇ (C 1 -C 12 alkyldiyl) ⁇ N(R 6 ) ⁇ *; ⁇ (C 1 -C 12 alkyldiyl) ⁇ N(R 6 ) 2 ; ⁇ (C 1 -C 12 alkyld
- An exemplary embodiment of the immunoconjugate includes wherein Ims has formula wherein X a and X b are independently selected from a five-membered heteroaryl; R 1 is selected from the group consisting of F, Cl, Br, I, ⁇ CN, ⁇ OH, and ⁇ O ⁇ (C 1 -C 6 alkyldiyl).
- R 3 is selected from C 1 -C 6 alkyldiyl, ⁇ (C 1 -C 3 alkyldiyl) ⁇ O ⁇ (C 1 -C 3 alkyldiyl) ⁇ , C 2 -C 6 alkenyldiyl and C 2 -C 6 alkynyldiyl, optionally substituted with one or more groups selected from F, Cl, ⁇ OH, ⁇ OCH 3 , ⁇ OCH 2 CH 3 , ⁇ OCH 2 CH 2 OCH 3 , ⁇ OCH 2 CH 2 OH, ⁇ OCH 2 CH 2 N(CH 3 ) 2 ;
- R 4 is selected from the group consisting of: ⁇ (C 1 -C 12 alkyldiyl) ⁇ N(R 5 ) ⁇ *; ⁇ (C 1 -C 12 alkyldiyl) ⁇ (C 2 -C 20
- An exemplary embodiment of formula Ig includes wherein wherein X a and X b are independently selected from the group consisting of imidazolyl, pyrazolyl, triazolyl, tetrazolyl, furyl, thienyl, isoxazolyl, thiazolyl, oxadiazolyl, oxazolyl, isothiazolyl, pyrrolyl, oxadiazolyl, and thiadiazolyl.
- An exemplary embodiment of formula Ig includes wherein wherein X a and X b are each pyrazolyl, substituted with one or more C 1 -C 12 alkyl groups.
- An exemplary embodiment of formula Ig includes wherein wherein R 1 is selected from the group consisting of ⁇ OCH 3 , ⁇ OCH 2 CH 3 , ⁇ OCH 2 CH 2 OCH 3 , ⁇ OCH 2 CH 2 OH, and ⁇ OCH 2 CH 2 N(CH 3 ) 2
- R 1 is ⁇ OCH 3
- R 1 is F
- An exemplary embodiment of formula Ig includes wherein R 3 is C 2 -C 4 alkenyldiyl, substituted with one or more groups selected from F, ⁇ OH, and ⁇ OCH 3 .
- An exemplary embodiment of formula Ig includes wherein R 4 is ⁇ O ⁇ (C 1 -C 12 alkyldiyl) ⁇ (C 2 -C 20 heterocyclyldiyl) ⁇ *.
- An exemplary embodiment of formula Ig includes wherein C 1 -C 12 alkyldiyl is propyldiyl and C 2 -C 20 heterocyclyldiyl is piperidiyl.
- An exemplary embodiment of the immunoconjugate includes wherein y is selected from 2, 3, and 4.
- An exemplary embodiment of the immunoconjugate includes wherein AA 1 is methyl, AA 2 forms proline, and AA 3 is isopropyl.
- An exemplary embodiment of the immunoconjugate includes wherein EsPEP has the formula: .
- An exemplary embodiment of the immunoconjugate includes wherein EsPEP is selected from the formulas: .
- An exemplary embodiment of the immunoconjugate includes wherein PEG is: ⁇ (CH 2 CH 2 O) 25 ⁇ (CH 2 ) 2 ⁇ .
- An exemplary embodiment of the immunoconjugate has the formula: .
- An exemplary embodiment of the immunoconjugate includes wherein Ims has formula IIc: IIc.
- Exemplary embodiments of the immunoconjugate includes wherein Ims have the structures: where the wavy line indicates the site of attachment to the linker.
- EsPEP is a tetrapeptide having the formula: where AA 1 , AA 2 , AA 3 and AA 4 are independently selected from a natural or unnatural amino acid, and the wavy line indicates a point of attachment; Cyc is selected from C 6 -C 20 aryldiyl and C 1 -C 20 heteroaryldiyl, optionally substituted with one or more groups selected from F, Cl, NO 2 , ⁇ OH, ⁇ OCH 3 , and a glucuronic acid having the structure: ; R 7 is selected from the group consisting of ⁇ CH(R 8 )O ⁇ , ⁇ CH 2 ⁇ , ⁇ CH 2 N(R 8 ) ⁇ , and ⁇ CH(R 8
- An exemplary embodiment of the immunoconjugate includes wherein AA1 is selected from the group consisting of Abu, Ala, and Val; AA 2 is selected from the group consisting of Nle(O-Bzl), Oic and Pro; AA 3 is selected from the group consisting of Ala and Met(O) 2 ; and AA4 is selected from the group consisting of Oic, Arg(NO 2 ), Bpa, and Nle(O-Bzl).
- An exemplary embodiment of the immunoconjugate includes wherein EsPEP has the formula: .
- An exemplary embodiment of the immunoconjugate includes wherein EsPEP has the formula:
- An exemplary embodiment of the immunoconjugate includes a structure selected from IIe-h: ' where the wavy line indicates the attachment through L to the antibody.
- An exemplary embodiment of the immunoconjugate includes a structure selected from IIi-l: where the wavy line indicates the attachment through L to the antibody.
- An exemplary embodiment of the immunoconjugate includes wherein R 2 and R 3 are each C 1 -C 8 alkyl.
- An exemplary embodiment of the immunoconjugate includes wherein R 2 and R 3 are each ⁇ CH 2 CH 2 CH 3 .
- An exemplary embodiment of the immunoconjugate includes wherein X 2 and X 3 are each a bond, and R 2 or R 3 is ⁇ O ⁇ (C 1 -C 12 alkyl).
- An exemplary embodiment of the immunoconjugate includes wherein R 2 or R 3 is ⁇ OCH 2 CH 3 .
- An exemplary embodiment of the immunoconjugate includes wherein the elastase- substrate, peptide linker is cleaved by elastase.
- Exemplary embodiments of the immunoconjugate have the structures:
- Drug loading is represented by p, the number of immunostimulatory moieties per antibody in an immunoconjugate of Formula I.
- Drug (immunostimulant) loading may range from 1 to about 8 drug moieties (D) per antibody.
- Immunoconjugates of Formula I include mixtures or collections of antibodies conjugated with a range of drug moieties, from 1 to about 8.
- the number of drug moieties that can be conjugated to an antibody is limited by the number of reactive or available amino acid side chain residues such as lysine and cysteine.
- free cysteine residues are introduced into the antibody amino acid sequence by the methods described herein.
- p may be 1, 2, 3, 4, 5, 6, 7, or 8, and ranges thereof, such as from 1 to 8 or from 2 to 5.
- Exemplary immunoconjugates of Formula I include, but are not limited to, antibodies that have 1, 2, 3, or 4 engineered cysteine amino acids (Lyon, R. et al. (2012) Methods in Enzym.502:123-138).
- one or more free cysteine residues are already present in an antibody forming intrachain disulfide bonds, without the use of engineering, in which case the existing free cysteine residues may be used to conjugate the antibody to a drug.
- an antibody is exposed to reducing conditions prior to conjugation of the antibody in order to generate one or more free cysteine residues.
- p may be limited by the number of attachment sites on the antibody.
- an antibody may have only one or a limited number of cysteine thiol groups, or may have only one or a limited number of sufficiently reactive thiol groups, to which the drug may be attached.
- one or more lysine amino groups in the antibody may be available and reactive for conjugation with an immunostimulant-linker compound of Formula II.
- higher drug loading e.g.
- the average drug loading for an immunoconjugate ranges from 1 to about 8; from about 2 to about 6; or from about 3 to about 5.
- an antibody is subjected to denaturing conditions to reveal reactive nucleophilic groups such as lysine or cysteine.
- the loading (drug/antibody ratio) of an immunoconjugate may be controlled in different ways, and for example, by: (i) limiting the molar excess of the immunostimulant-linker intermediate compound relative to antibody, (ii) limiting the conjugation reaction time or temperature, and (iii) partial or limiting reductive denaturing conditions for optimized antibody reactivity. Where more than one nucleophilic group of the antibody reacts with a drug, then the resulting product is a mixture of immunoconjugate compounds with a distribution of one or more drug moieties attached to an antibody. The average number of drugs per antibody may be calculated from the mixture by a dual ELISA antibody assay, which is specific for antibody and specific for the drug.
- Individual immunoconjugate molecules may be identified in the mixture by mass spectroscopy and separated by HPLC, e.g. hydrophobic interaction chromatography (see, e.g., McDonagh et al. (2006) Prot. Engr. Design & Selection 19(7):299-307; Hamblett et al. (2004) Clin. Cancer Res.10:7063-7070; Hamblett, K.J., et al. “Effect of drug loading on the pharmacology, pharmacokinetics, and toxicity of an anti-CD30 antibody-drug conjugate,” Abstract No.624, American Association for Cancer Research, 2004 Annual Meeting, March 27- 31, 2004, Proceedings of the AACR, Volume 45, March 2004; Alley, S.C., et al.
- a homogeneous immunoconjugate with a single loading value may be isolated from the conjugation mixture by electrophoresis or chromatography.
- BIOLOGICAL ACTIVITY OF IMMUNOCONJUGATES Figure 9 shows a graph measuring potency as measured by TNFa production in a co- culture experiment with RAW 264.7 murine macrophage cells and HCC1954 HER2 expressing tumor cells.
- This experiment compared an elastase cleavable linker (Ala-Pro-Val) immunoconjugate ISAC-1, and a cathepsin B cleavable linker (Val-Cit) immunoconjugate ISAC-2.
- the antibody of ISAC-1 and ISAC-2 is anti-HER2 trastuzumab.
- the Val-Cit linker unit of ISAC-2 is a known cathepsin B substrate. Cells were cultured overnight at a 10:1 effector (macrophage) to target ( HCC1954 tumor cell) ratio, and mouse TNFa was measured by ELISA as a readout of a proinflammatory response.
- the RAW 264.7 murine macrophage cell line was cultured according to vendor protocols (Invivogen) and Example 203.
- PHARMACEUTICAL COMPOSITIONS OF IMMUNOCONJUGATES The invention provides a composition, e.g., a pharmaceutically or pharmacologically acceptable composition or formulation, comprising a plurality of immunoconjugates as described herein and optionally a carrier therefor, e.g., a pharmaceutically or pharmacologically acceptable carrier.
- the immunoconjugates can be the same or different in the composition, i.e., the composition can comprise immunoconjugates that have the same number of immunostimulants linked to the same positions on the antibody construct and/or immunoconjugates that have the same number of immunostimulants linked to different positions on the antibody construct, that have different numbers of immunostimulants linked to the same positions on the antibody construct, or that have different numbers of immunostimulants linked to different positions on the antibody construct.
- a pharmaceutical composition comprises a therapeutically effective amount of the immunoconjugate and one or more pharmaceutically acceptable diluent, vehicle, carrier or excipient.
- a composition comprising the immunoconjugate compounds comprises a mixture of the immunoconjugate compounds, wherein the average drug (immunostimulatory moieties) loading per antibody in the mixture of immunoconjugate compounds is about 2 to about 5.
- a composition of immunoconjugates of the invention can have an average adjuvant to antibody construct ratio (DAR) of about 0.4 to about 10.
- DAR adjuvant to antibody construct ratio
- the adjuvant to antibody construct (e.g., antibody) ratio can be assessed by any suitable means, many of which are known in the art.
- the average number of adjuvant moieties per antibody (DAR) in preparations of immunoconjugates from conjugation reactions may be characterized by conventional means such as mass spectrometry, ELISA assay, and HPLC.
- the quantitative distribution of immunoconjugates in a composition in terms of p may also be determined. In some instances, separation, purification, and characterization of homogeneous immunoconjugates where p is a certain value from immunoconjugates with other drug loadings may be achieved by means such as reverse phase HPLC or electrophoresis.
- the composition further comprises one or more pharmaceutically or pharmacologically acceptable excipients.
- the immunoconjugates of the invention can be formulated for parenteral administration, such as IV administration or administration into a body cavity or lumen of an organ.
- the immunoconjugates can be injected intra-tumorally.
- Compositions for injection will commonly comprise a solution of the immunoconjugate dissolved in a pharmaceutically acceptable carrier.
- acceptable vehicles and solvents that can be employed are water and an isotonic solution of one or more salts such as sodium chloride, e.g., Ringer's solution.
- sterile fixed oils can conventionally be employed as a solvent or suspending medium.
- any bland fixed oil can be employed, including synthetic monoglycerides or diglycerides.
- fatty acids such as oleic acid can likewise be used in the preparation of injectables.
- These compositions desirably are sterile and generally free of undesirable matter.
- These compositions can be sterilized by conventional, well known sterilization techniques.
- the compositions can contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions such as pH adjusting and buffering agents, toxicity adjusting agents, e.g., sodium acetate, sodium chloride, potassium chloride, calcium chloride, sodium lactate and the like.
- the composition can contain any suitable concentration of the immunoconjugate.
- the concentration of the immunoconjugate in the composition can vary widely, and will be selected primarily based on fluid volumes, viscosities, body weight, and the like, in accordance with the particular mode of administration selected and the patient's needs. In certain embodiments, the concentration of an immunoconjugate in a solution formulation for injection will range from about 0.1% (w/w) to about 10% (w/w).
- METHOD OF TREATING CANCER WITH IMMUNOCONJUGATES The invention provides a method for treating cancer. The method includes administering a therapeutically effective amount of an immunoconjugate as described herein (e.g., as a composition as described herein) to a subject in need thereof, e.g., a subject that has cancer and is in need of treatment for the cancer.
- the method includes administering a therapeutically effective amount of an immunoconjugate (IC).
- the immunoconjugate compounds of the invention include those with immunostimulatory activity.
- the immunoconjugates of the invention selectively deliver an effective dose of an immunostimulatory drug to tumor tissue, whereby greater selectivity (i.e., a lower efficacious dose) may be achieved while increasing the therapeutic index (“therapeutic window”) relative to the unconjugated immunostimulatory drug.
- the invention provides a pharmaceutical composition for use in therapy.
- the invention provides a method of treatment comprising administering a therapeutically-effective dose of the immunoconjugate to a patient with an immune-related disorder.
- the elastase-substrate, peptide linker of the immunoconjugate may be cleaved by elastase. It is contemplated that the immunoconjugate of the present invention may be used to treat various hyperproliferative diseases or disorders, e.g. characterized by the overexpression of a tumor antigen. Exemplary hyperproliferative disorders include benign or malignant solid tumors and hematological disorders such as leukemia and lymphoid malignancies.
- an immunoconjugate for use as a medicament is provided. In certain embodiments, the invention provides an immunoconjugate for use in a method of treating an individual comprising administering to the individual an effective amount of the immunoconjugate.
- the method further comprises administering to the individual an effective amount of at least one additional therapeutic agent, e.g., as described herein.
- the invention provides for the use of an immunoconjugate in the manufacture or preparation of a medicament.
- the medicament is for treatment of cancer, the method comprising administering to an individual having cancer an effective amount of the medicament.
- the method further comprises administering to the individual an effective amount of at least one additional therapeutic agent, e.g., as described herein.
- Carcinomas are malignancies that originate in the epithelial tissues. Epithelial cells cover the external surface of the body, line the internal cavities, and form the lining of glandular tissues.
- carcinomas include, but are not limited to, adenocarcinoma (cancer that begins in glandular (secretory) cells such as cancers of the breast, pancreas, lung, prostate, stomach, gastroesophageal junction, and colon) adrenocortical carcinoma; hepatocellular carcinoma; renal cell carcinoma; ovarian carcinoma; carcinoma in situ; ductal carcinoma; carcinoma of the breast; basal cell carcinoma; squamous cell carcinoma; transitional cell carcinoma; colon carcinoma; nasopharyngeal carcinoma; multilocular cystic renal cell carcinoma; oat cell carcinoma; large cell lung carcinoma; small cell lung carcinoma; non-small cell lung carcinoma; and the like.
- adenocarcinoma cancer that begins in glandular (secretory) cells such as cancers of the breast, pancreas, lung, prostate, stomach, gastroesophageal junction, and colon
- adrenocortical carcinoma hepatocellular carcinoma
- renal cell carcinoma ovarian carcinoma
- carcinoma in situ duct
- Carcinomas may be found in prostrate, pancreas, colon, brain (usually as secondary metastases), lung, breast, and skin.
- methods for treating non-small cell lung carcinoma include administering an immunoconjugate containing an antibody construct that is capable of binding PD-L1 (e.g., atezolizumab, durvalumab, avelumab, biosimilars thereof, or biobetters thereof).
- methods for treating breast cancer include administering an immunoconjugate containing an antibody construct that is capable of binding PD-L1 (e.g., atezolizumab, durvalumab, avelumab, biosimilars thereof, or biobetters thereof).
- methods for treating triple-negative breast cancer include administering an immunoconjugate containing an antibody construct that is capable of binding PD-L1 (e.g., atezolizumab, durvalumab, avelumab, biosimilars thereof, or biobetters thereof).
- an immunoconjugate containing an antibody construct that is capable of binding PD-L1 e.g., atezolizumab, durvalumab, avelumab, biosimilars thereof, or biobetters thereof.
- Soft tissue tumors are a highly diverse group of rare tumors that are derived from connective tissue.
- soft tissue tumors include, but are not limited to, alveolar soft part sarcoma; angiomatoid fibrous histiocytoma; chondromyoxid fibroma; skeletal chondrosarcoma; extraskeletal myxoid chondrosarcoma; clear cell sarcoma; desmoplastic small round-cell tumor; dermatofibrosarcoma protuberans; endometrial stromal tumor; Ewing’s sarcoma; fibromatosis (Desmoid); fibrosarcoma, infantile; gastrointestinal stromal tumor; bone giant cell tumor; tenosynovial giant cell tumor; inflammatory myofibroblastic tumor; uterine leiomyoma; leiomyosarcoma; lipoblastoma; typical lipoma; spindle cell or pleomorphic lipoma; atypical lipoma; chondroid lipoma; well-differentiated liposarcoma;
- a sarcoma is a rare type of cancer that arises in cells of mesenchymal origin, e.g., in bone or in the soft tissues of the body, including cartilage, fat, muscle, blood vessels, fibrous tissue, or other connective or supportive tissue.
- Different types of sarcoma are based on where the cancer forms. For example, osteosarcoma forms in bone, liposarcoma forms in fat, and rhabdomyosarcoma forms in muscle.
- sarcomas include, but are not limited to, askin's tumor; sarcoma botryoides; chondrosarcoma; ewing's sarcoma; malignant hemangioendothelioma; malignant schwannoma; osteosarcoma; and soft tissue sarcomas (e.g., alveolar soft part sarcoma; angiosarcoma; cystosarcoma phyllodesdermatofibrosarcoma protuberans (DFSP); desmoid tumor; desmoplastic small round cell tumor; epithelioid sarcoma; extraskeletal chondrosarcoma; extraskeletal osteosarcoma; fibrosarcoma; gastrointestinal stromal tumor (GIST); hemangiopericytoma; hemangiosarcoma (more commonly referred to as “angiosarcoma”); kaposi’s sarcoma; leiomyosarcoma; lipos
- a teratoma is a type of germ cell tumor that may contain several different types of tissue (e.g., can include tissues derived from any and/or all of the three germ layers: endoderm, mesoderm, and ectoderm), including, for example, hair, muscle, and bone. Teratomas occur most often in the ovaries in women, the testicles in men, and the tailbone in children.
- Melanoma is a form of cancer that begins in melanocytes (cells that make the pigment melanin). Melanoma may begin in a mole (skin melanoma), but can also begin in other pigmented tissues, such as in the eye or in the intestines.
- Merkel cell carcinoma is a rare type of skin cancer that usually appears as a flesh-colored or bluish-red nodule on the face, head or neck. Merkel cell carcinoma is also called neuroendocrine carcinoma of the skin.
- methods for treating Merkel cell carcinoma include administering an immunoconjugate containing an antibody construct that is capable of binding PD-L1 (e.g., atezolizumab, durvalumab, avelumab, biosimilars thereof, or biobetters thereof).
- the Merkel cell carcinoma has metastasized when administration occurs.
- Leukemias are cancers that start in blood-forming tissue, such as the bone marrow, and cause large numbers of abnormal blood cells to be produced and enter the bloodstream.
- leukemias can originate in bone marrow-derived cells that normally mature in the bloodstream.
- Leukemias are named for how quickly the disease develops and progresses (e.g., acute versus chronic) and for the type of white blood cell that is affected (e.g., myeloid versus lymphoid).
- Myeloid leukemias are also called myelogenous or myeloblastic leukemias.
- Lymphoid leukemias are also called lymphoblastic or lymphocytic leukemia. Lymphoid leukemia cells may collect in the lymph nodes, which can become swollen.
- lymphomas are cancers that begin in cells of the immune system.
- lymphomas can originate in bone marrow-derived cells that normally mature in the lymphatic system.
- lymphomas There are two basic categories of lymphomas.
- One category of lymphoma is Hodgkin lymphoma (HL), which is marked by the presence of a type of cell called the Reed-Sternberg cell.
- HL Hodgkin lymphoma
- Hodgkin lymphomas examples include nodular sclerosis classical Hodgkin lymphoma (CHL), mixed cellularity CHL, lymphocyte- depletion CHL, lymphocyte-rich CHL, and nodular lymphocyte predominant HL.
- CHL classical Hodgkin lymphoma
- NHL non-Hodgkin lymphomas
- Non-Hodgkin lymphomas can be further divided into cancers that have an indolent (slow-growing) course and those that have an aggressive (fast-growing) course.
- NHL non-Hodgkin lymphomas
- non-Hodgkin lymphomas include, but are not limited to, AIDS-related Lymphomas, anaplastic large-cell lymphoma, angioimmunoblastic lymphoma, blastic NK-cell lymphoma, Burkitt’s lymphoma, Burkitt-like lymphoma (small non-cleaved cell lymphoma), chronic lymphocytic leukemia/small lymphocytic lymphoma, cutaneous T-Cell lymphoma, diffuse large B-Cell lymphoma, enteropathy-type T-Cell lymphoma, follicular lymphoma, hepatosplenic gamma- delta T-Cell lymphomas, T-Cell leukemias, lymphoblastic lymphoma, mantle cell lymphoma, marginal zone lymphoma, nasal T-Cell lymphoma, pediatric lymphoma, peripheral T-Cell lymphomas, primary central nervous system lymphoma, transformed lymphomas,
- Brain cancers include any cancer of the brain tissues.
- Examples of brain cancers include, but are not limited to, gliomas (e.g., glioblastomas, astrocytomas, oligodendrogliomas, ependymomas, and the like), meningiomas, pituitary adenomas, and vestibular schwannomas, primitive neuroectodermal tumors (medulloblastomas).
- Immunoconjugates of the invention can be used either alone or in combination with other agents in a therapy. For instance, an immunoconjugate may be co-administered with at least one additional therapeutic agent, such as a chemotherapeutic agent.
- Such combination therapies encompass combined administration (where two or more therapeutic agents are included in the same or separate formulations), and separate administration, in which case, administration of the immunoconjugate can occur prior to, simultaneously, and/or following, administration of the additional therapeutic agent and/or adjuvant.
- Immunoconjugates can also be used in combination with radiation therapy.
- the immunoconjugates of the invention (and any additional therapeutic agent) can be administered by any suitable means, including parenteral, intrapulmonary, and intranasal, and, if desired for local treatment, intralesional administration.
- Parenteral infusions include intramuscular, intravenous, intraarterial, intraperitoneal, or subcutaneous administration. Dosing can be by any suitable route, e.g.
- Atezolizumab, durvalumab, avelumab, biosimilars thereof, and biobetters thereof are known to be useful in the treatment of cancer, particularly breast cancer, especially triple negative (test negative for estrogen receptors, progesterone receptors, and excess HER2 protein) breast cancer, bladder cancer, and Merkel cell carcinoma.
- the immunoconjugate described herein can be used to treat the same types of cancers as atezolizumab, durvalumab, avelumab, biosimilars thereof, and biobetters thereof, particularly breast cancer, especially triple negative (test negative for estrogen receptors, progesterone receptors, and excess HER2 protein) breast cancer, bladder cancer, and Merkel cell carcinoma.
- the immunoconjugate is administered to a subject in need thereof in any therapeutically effective amount using any suitable dosing regimen, such as the dosing regimens utilized for atezolizumab, durvalumab, avelumab, biosimilars thereof, and biobetters thereof.
- the methods can include administering the immunoconjugate to provide a dose of from about 100 ng/kg to about 50 mg/kg to the subject.
- the immunoconjugate dose can range from about 5 mg/kg to about 50 mg/kg, from about 10 ⁇ g/kg to about 5 mg/kg, or from about 100 ⁇ g/kg to about 1 mg/kg.
- the immunoconjugate dose can be about 100, 200, 300, 400, or 500 ⁇ g/kg.
- the immunoconjugate dose can be about 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 mg/kg.
- the immunoconjugate dose can also be outside of these ranges, depending on the particular conjugate as well as the type and severity of the cancer being treated.
- Frequency of administration can range from a single dose to multiple doses per week, or more frequently.
- the immunoconjugate is administered from about once per month to about five times per week.
- the immunoconjugate is administered once per week.
- the invention provides a method for preventing cancer.
- the method comprises administering a therapeutically effective amount of an immunoconjugate (e.g., as a composition as described above) to a subject.
- the subject is susceptible to a certain cancer to be prevented.
- the methods can include administering the immunoconjugate to provide a dose of from about 100 ng/kg to about 50 mg/kg to the subject.
- the immunoconjugate dose can range from about 5 mg/kg to about 50 mg/kg, from about 10 ⁇ g/kg to about 5 mg/kg, or from about 100 ⁇ g/kg to about 1 mg/kg.
- the immunoconjugate dose can be about 100, 200, 300, 400, or 500 ⁇ g/kg.
- the immunoconjugate dose can be about 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 mg/kg.
- the immunoconjugate dose can also be outside of these ranges, depending on the particular conjugate as well as the type and severity of the cancer being treated. Frequency of administration can range from a single dose to multiple doses per week, or more frequently. In some embodiments, the immunoconjugate is administered from about once per month to about five times per week.
- the immunoconjugate is administered once per week.
- Some embodiments of the invention provide methods for treating cancer as described above, wherein the cancer is breast cancer.
- Breast cancer can originate from different areas in the breast, and a number of different types of breast cancer have been characterized.
- the immunoconjugates of the invention can be used for treating ductal carcinoma in situ; invasive ductal carcinoma (e.g., tubular carcinoma; medullary carcinoma; mucinous carcinoma; papillary carcinoma; or cribriform carcinoma of the breast); lobular carcinoma in situ; invasive lobular carcinoma; inflammatory breast cancer; and other forms of breast cancer such as triple negative (test negative for estrogen receptors, progesterone receptors, and excess HER2 protein) breast cancer.
- triple negative test negative for estrogen receptors, progesterone receptors, and excess HER2 protein
- methods for treating breast cancer include administering an immunoconjugate containing an antibody construct that is capable of binding HER2 (e.g. trastuzumab, pertuzumab, biosimilars, or biobetters thereof ) and PD-L1 (e.g., atezolizumab, durvalumab, avelumab, biosimilars, or biobetters thereof).
- methods for treating colon cancer lung cancer, renal cancer, pancreatic cancer, gastric cancer, and esophageal cancer include administering an immunoconjugate containing an antibody construct that is capable of binding CEA, or tumors over-expressing CEA (e.g. labetuzumab, biosimilars, or biobetters thereof).
- the cancer is susceptible to a pro-inflammatory response induced by TLR7 and/or TLR8.
- EXAMPLES Preparation of immunostimulatory compounds and intermediates Example 1 Synthesis of 2,3,5,6-tetrafluorophenyl (R)-1-((S)-2-(((S)-1-((4-(((((1-((3- (2-amino-4-(dipropylcarbamoyl)-3H-benzo[b]azepin-8-yl)phenyl)sulfonyl)azetidin-3- yl)methyl)carbamoyl)oxy)methyl)phenyl)amino)-3-methyl-1-oxobutan-2- yl)carbamoyl)pyrrolidin-1-yl)-2-methyl-1,4-dioxo- 7,10,13,16,19,22,25,28,31,34,37,40,43,46,49,52,55,58
- the mixture was filtered and purified by prep-HPLC (column: Nano-micro Kromasil C 1 8100*30mm 8um; mobile phase: [water (0.1%TFA)-ACN]; B%: 35%-60%, 10 min) to afford II-1m (70 mg, 60.96 umol, 31.07% yield) as white solid.
- II-1n (0.021 g, 0.01 mmol, 65%).
- LC/MS [M+2H] 1064.57 (calculated); LC/MS [M+2H] 1064.70 (observed).
- II-1 Acid, II-1n (0.021 g, 0.0097 mmol, 1 eq.) and 2,3,5,6- tetrafluorophenol, TFP (0.0032 g, 0.019 mmol, 2 eq.) were dissolved in 1 ml dimethylformamide, DMF.
- the mixture was filtered and purified by prep-HPLC (column: Nano-micro Kromasil C 1 8 100*30mm 8um;mobile phase: [water(0.1%TFA)-ACN];B%: 35%-60%,10min) to give II-2b (58 mg, 45.90 umol, 28.68% yield) as white solid.
- II-2c (0.015 g, 0.0066 mmol, 28%). LC/MS [M+2H] 1122.10 (calculated); LC/MS [M+2H] 1122.40 (observed).
- Acid II-2c (0.015 g, 0.0066 mmol, 1 eq.) and TFP (0.0022 g, 0.013 mmol, 2 eq.) were dissolved in 1 ml DMF.
- II-3c (0.016 g, 0.01 mmol, 33%).
- Preparation of II-3 Acid II-3a (0.0156 g, 0.0103 mmol, 1 eq.) and TFP (0.004 g, 0.024 mmol, 2.3 eq.) were dissolved in 1 ml ACN. Collidine (0.0068 ml, 0.051 mmol, 5 eq.) was added, followed by EDC-HCl (0.0045 g, 0.023 mmol, 2.23 eq.).
- II-5d (0.37 g, 360 umol, 99% yield) as yellow oil.
- acetyl chloride 22.9 mg, 292 umol, 20.8 uL, 1.0 eq
- the mixture was stirred at 20 °C for 1 hr under N 2 atmosphere.
- the reaction mixture was filtered and purified by prep-HPLC (column: Phenomenex Synergi C 1 8 150*25*10um; mobile phase: [water (0.1%TFA)-ACN]; B%: 35%-45%, 7 min) to give II-6 (58.3 mg, 51.08 umol, 29.40% yield) as white solid.
- No.25952-53-8 (10.2 g, 53.44 mmol, 1.2 eq), and it was stirred at 20°C for 12 h. The mixture was washed by saturated aqueous solution of NaHCO 3 (70 mL x 3). The organic layer was dried over Na 2 SO 4 and concentrated to give 7b (17.5 g, 40.28 mmol, 90.60% yield) as a white solid.
- No.16357-59-8 (8.50 g, 34.36 mmol, 1.5 eq) and then stirred at 20 °C for 12 h. The mixture was concentrated in vacuum to give a residue and the residue was purified by flash silica gel chromatography (Silica Flash Column, Eluent of 0-40% Ethyl acetate/MeOH @ 65 mL/min) to give 7d (13 g, 24.0 mmol, 52.38% yield) as yellow solid.
- No.148893-10-1 (4.82 g, 12.68 mmol, 1.5 eq) and DIPEA (3.28 g, 25.36 mmol, 4.42 mL, 3 eq) at 0°C.
- the mixture was stirred at this temperature for 5min, and then 7e (2.7 g, 8.45 mmol, 1 eq) was added at 0 °C and then the resulting mixture was stirred at 0°C for 25 min.
- the reaction mixture was quenched by addition of H 2 O (150 mL) and then extracted with EtOAc (70 mL x 3). The combined organic layers were washed with brine (50 mL x 3), dried over Na2SO4, filtered and concentrated under reduced pressure.
- the reaction mixture was concentrated under reduced pressure to remove CH 3 CN.
- the residue was extracted with MTBE (10 mL x 3) and discarded.
- the water phase was concentrated under reduced pressure to give a residue.
- the residue was purified by prep-HPLC (TFA condition; column: Phenomenex Luna c18250mm x 100mm x 10um;mobile phase: [water(0.1%TFA)-ACN];B%: 0%-25%,24min) to give 7j (1.6 g, 2.40 mmol, 38.6% yield) as a light yellow oil.
- Example 201 Preparation of Immunoconjugates (IC)
- an antibody is buffer exchanged into a conjugation buffer containing 100 mM boric acid, 50 mM sodium chloride, 1 mM ethylenediaminetetraacetic acid at pH 8.3, using G-25 SEPHADEX TM desalting columns (Sigma-Aldrich, St. Louis, MO).
- the eluates are then each adjusted to 6 mg/ml using the buffer and then sterile filtered.
- the antibody at 6 mg/ml is pre-warmed to 30 °C and rapidly mixed with 2-20 (e.g., 7-10) molar equivalents of immunostimulant-elastase substrate, peptide linker compound.
- the reaction is allowed to proceed for 16 hours at 30 °C and Immunoconjugate A is separated from reactants by running over two successive G-25 desalting columns equilibrated in phosphate buffered saline (PBS) at pH 7.2 to provide the Immunoconjugate (IC) of Table 3.
- PBS phosphate buffered saline
- Adjuvant-antibody ratio is determined by liquid chromatography mass spectrometry analysis using a C4 reverse phase column on an ACQUITY TM UPLC H-class (Waters Corporation, Milford, Massachusetts) connected to a XEVO TM G2-XS TOF mass spectrometer (Waters Corporation).
- the antibody may dissolved in a physiological buffer system known in the art that will not adversely impact the stability or antigen-binding specificity of the antibody. Phosphate buffered saline may be used.
- the immunostimulant-elastase substrate, peptide linker compound is dissolved in a solvent system comprising at least one polar aprotic solvent as described elsewhere herein.
- immunostimulant-elastase substrate, peptide linker intermediate is dissolved to a concentration of about 5 mM, 10 mM, about 20 mM, about 30 mM, about 40 mM or about 50 mM, and ranges thereof such as from about 50 mM to about 50mM or from about 10 mM to about 30 mM in pH 8 Tris buffer (e.g., 50 mM Tris).
- the immunostimulant-elastase substrate, peptide linker intermediate is dissolved in DMSO or acetonitrile, or in DMSO.
- an equivalent excess of immunostimulant-elastase substrate, peptide linker intermediate solution is diluted and combined with chilled antibody solution (e.g. from about 1 °C to about 10 °C).
- the immunostimulant-elastase substrate, peptide linker intermediate solution may suitably be diluted with at least one polar aprotic solvent and at least one polar protic solvent, examples of which include water, methanol, ethanol, n-propanol, and acetic acid.
- the thienoazepine-linker intermediate is dissolved in DMSO and diluted with acetonitrile and water prior to admixture with the antibody solution.
- the molar equivalents of immunostimulant- elastase substrate, peptide linker intermediate to antibody may be about 1.5:1, about 3:1, about 5:1, about 10:1 about 15:1 or about 20:1, and ranges thereof, such as from about 1.5:1 to about 20:1 from about 1.5:1 to about 15:1, from about 1.5:1 to about 10:1, from about 3:1 to about 15:1, from about 3:1 to about 10:1, from about 5:1 to about 15:1 or from about 5:1 to about 10:1.
- the reaction may suitably be monitored for completion by methods known in the art, such as LC-MS, and the reaction is typically complete in from about 1 hour to about 24 hours.
- the immunoconjugates may be purified and separated from unconjugated reactants and/or conjugate aggregates by purification methods known in the art such as, for example and not limited to, size exclusion chromatography, hydrophobic interaction chromatography, ion exchange chromatography, chromatofocusing, ⁇ Ltrafiltration, centrifugal ⁇ Ltrafiltration, and combinations thereof. For instance, purification may be preceded by diluting the immunoconjugate, such in 20 mM sodium succinate, pH 5.
- HEK Reporter Assay HEK293 reporter cells expressing human TLR7 or human TLR8 were purchased from Invivogen and vendor protocols were followed for cellular propagation and experimentation. Briefly, cells were grown to 80-85% confluence at 5% CO 2 in DMEM supplemented with 10% FBS, Zeocin, and Blasticidin. Cells were then seeded in 96-well flat plates at 4x10 4 cells/well with substrate containing HEK detection medium and immunostimulatory molecules.
- Example 203 Assessment of Immunoconjugate Activity In Vitro The RAW 264.7 murine macrophage cell line was cultured according to vendor protocols (Invivogen). RAW 264.7 cells were co-cultured with the human HER2-expressing tumor cell line, HCC1954, and then stimulated with a range of concentrations of trastuzumab- based ISACs, ISAC 1 and ISAC 2 ( Figure 9). Stimulated cells were cultured for 18 hours and then assessed for cellular activation based on production of proinflammatory cytokine TNFa. Cell-free supernatant was collected and analyzed by ELISA.
- Immunoconjugates of the invention are effective at eliciting myeloid activation, and therefore are useful for the treatment of cancer.
- Isolation of Human Antigen Presenting Cells Human myeloid antigen presenting cells (APCs) were negatively selected from human peripheral blood obtained from healthy blood donors (Stanford Blood Center, Palo Alto, California) by density gradient centrifugation using a ROSETTESEP TM Human Monocyte Enrichment Cocktail (Stem Cell Technologies, Vancouver, Canada) containing monoclonal antibodies against CD14, CD16, CD40, CD86, CD123, and HLA-DR.
- Immature APCs were subsequently purified to >90% purity via negative selection using an EASYSEP TM Human Monocyte Enrichment Kit (Stem Cell Technologies) without CD16 depletion containing monoclonal antibodies against CD14, CD16, CD40, CD86, CD123, and HLA-DR.
- Myeloid APC Activation Assay 2 x 10 5 APCs were incubated in 96-well plates (Corning, Corning, NY) containing Gibco Iscove’s modified Dulbecco’s medium, IMDM (Lonza) supplemented with 10% FBS, 100 U/mL penicillin, 100 ⁇ g/mL (micrograms per milliliter) streptomycin, 2 mM L-glutamine, sodium pyruvate, non-essential amino acids, and where indicated, various concentrations of unconjugated (naked) PD-L1 or HER2 antibodies and immunoconjugates of the invention (as prepared according to the Example above).
- Trastuzumab and avelumab were used as the antibody constructs.
- Cell-free supernatants were analyzed after 18 hours via ELISA to measure TNF ⁇ secretion as a readout of a proinflammatory response.
- Myeloid cell types for use in screening assays Conventional myeloid cell types include Monocytes, M-CSF M ⁇ (M0), GM/IL4 DC, ex vivo cDC for TLR7/8 stimulation assays in a Cytokine read out to exclude inactive agonists.
- Polarized myeloid cells include Monocytes differentiated toward immunosuppressive state such as M2a M ⁇ (IL4/IL13), M2c M ⁇ (IL10/TGFb) and tumor-educated monocytes (TEM) – differentiation w/ tumor-conditioned media (786.O, MDA-MB-231, HCC1954) GM/IL6 “MDSC” in a cytokine read out to exclude agonists with limited activity across assays.
- Tumor-associated myeloid cells include Myeloid cells present in dissociated tumor cell suspensions (Discovery Life Sciences) in an assay for discovery of agonists.
- Other useful cell lines for screening may include murine cell lines such as the RAW 264.7 described above, bone marrow derived monocytes, bone marrow derived dendritic cells or macrophages, splenic dendritic cells, TAMs (tumor associated macrophages), and myeloid- derived suppressor cells (MDSCs) in the murine setting.
- murine cell lines such as the RAW 264.7 described above, bone marrow derived monocytes, bone marrow derived dendritic cells or macrophages, splenic dendritic cells, TAMs (tumor associated macrophages), and myeloid- derived suppressor cells (MDSCs) in the murine setting.
- All references, including publications, patent applications, and patents, cited herein are hereby incorporated by reference to the same extent as if each reference were individually and specifically indicated to be incorporated by reference and were set forth in its entirety herein.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Medicinal Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Chemical & Material Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Epidemiology (AREA)
- Immunology (AREA)
- Cell Biology (AREA)
- Organic Chemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Peptides Or Proteins (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicinal Preparation (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Priority Applications (5)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2022566686A JP2023524271A (ja) | 2020-05-08 | 2021-05-07 | エラスターゼ-基質ペプチドリンカーイムノコンジュゲート、及びそれらの使用 |
| CA3176626A CA3176626A1 (en) | 2020-05-08 | 2021-05-07 | Elastase-substrate, peptide linker immunoconjugates, and uses thereof |
| US17/923,541 US20230293716A1 (en) | 2020-05-08 | 2021-05-07 | Elastase-substrate, peptide linker immunoconjugates, and uses thereof |
| EP21728751.5A EP4146282A1 (en) | 2020-05-08 | 2021-05-07 | Elastase-substrate, peptide linker immunoconjugates, and uses thereof |
| CN202180046241.8A CN115996756A (zh) | 2020-05-08 | 2021-05-07 | 弹性蛋白酶底物肽连接子免疫缀合物及其用途 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202063022069P | 2020-05-08 | 2020-05-08 | |
| US63/022,069 | 2020-05-08 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2021226440A1 true WO2021226440A1 (en) | 2021-11-11 |
Family
ID=76181275
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2021/031264 Ceased WO2021226440A1 (en) | 2020-05-08 | 2021-05-07 | Elastase-substrate, peptide linker immunoconjugates, and uses thereof |
Country Status (6)
| Country | Link |
|---|---|
| US (1) | US20230293716A1 (https=) |
| EP (1) | EP4146282A1 (https=) |
| JP (1) | JP2023524271A (https=) |
| CN (1) | CN115996756A (https=) |
| CA (1) | CA3176626A1 (https=) |
| WO (1) | WO2021226440A1 (https=) |
Cited By (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2022125904A1 (en) * | 2020-12-11 | 2022-06-16 | Bolt Biotherapeutics, Inc. | Anti-her2 immunoconjugates, and uses thereof |
| WO2022125908A1 (en) * | 2020-12-11 | 2022-06-16 | Bolt Biotherapeutics, Inc. | Anti-pd-l1 immunoconjugates, and uses thereof |
| WO2022125915A1 (en) * | 2020-12-11 | 2022-06-16 | Bolt Biotherapeutics, Inc. | Anti-her2 immunoconjugates, and uses thereof |
| US11400164B2 (en) | 2019-03-15 | 2022-08-02 | Bolt Biotherapeutics, Inc. | Immunoconjugates targeting HER2 |
| WO2022125891A3 (en) * | 2020-12-11 | 2022-10-13 | Bolt Biotherapeutics, Inc. | Anti-cea immunoconjugates, and uses thereof |
| US11547761B1 (en) | 2016-07-07 | 2023-01-10 | The Board Of Trustees Of The Leland Stanford Junior University | Antibody adjuvant conjugates |
| WO2023076599A1 (en) * | 2021-10-29 | 2023-05-04 | Bolt Biotherapeutics, Inc. | Tlr agonist immunoconjugates with cysteine-mutant antibodies, and uses thereof |
| WO2023154302A1 (en) * | 2022-02-09 | 2023-08-17 | Bolt Biotherapeutics, Inc. | Macromolecule-supported 8-sulfonyl-benzazepine compounds and their uses |
| WO2023154318A1 (en) * | 2022-02-09 | 2023-08-17 | Bolt Biotherapeutics, Inc. | Anti-tr0p2, aminobenzazepine immunoconjugates, and uses thereof |
| WO2023154307A1 (en) * | 2022-02-09 | 2023-08-17 | Bolt Biotherapeutics, Inc. | Antibody-conjugated 8-sulfonyl-benzazepine compounds and their uses |
| EP4259208A1 (en) * | 2020-12-11 | 2023-10-18 | Bolt Biotherapeutics, Inc. | Immunoconjugates comprising an anti-cea antibody linked by conjugation to one or more 8-het-2- aminobenzazepine derivatives useful in treating cancer |
| WO2024174863A1 (zh) * | 2023-02-22 | 2024-08-29 | 深圳众格生物科技有限公司 | Sting激动剂及其制备方法和医药用途 |
| WO2025252682A1 (en) * | 2024-06-03 | 2025-12-11 | Elasmogen Ltd | Self immolative compounds and conjugates comprising an immunomodulatory agent |
| WO2026078593A1 (en) | 2024-10-08 | 2026-04-16 | Sun Pharma Advanced Research Company Limited | Sting agonists and antibody drug conjugates thereof |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CA3128081A1 (en) | 2019-02-12 | 2020-08-20 | Ambrx, Inc. | Compositions containing, methods and uses of antibody-tlr agonist conjugates |
| IL300316A (en) * | 2020-08-13 | 2023-04-01 | Bolt Biotherapeutics Inc | Immune conjugates of pyrazolozapines and their uses |
Citations (60)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US723288A (en) | 1901-10-26 | 1903-03-24 | Harry South Lewis | Cipher-key for cryptographic codes. |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| US5677171A (en) | 1988-01-12 | 1997-10-14 | Genentech, Inc. | Monoclonal antibodies directed to the HER2 receptor |
| US5821337A (en) | 1991-06-14 | 1998-10-13 | Genentech, Inc. | Immunoglobulin variants |
| US6054297A (en) | 1991-06-14 | 2000-04-25 | Genentech, Inc. | Humanized antibodies and methods for making them |
| WO2000069472A2 (en) | 1999-05-14 | 2000-11-23 | Boehringer Ingelheim Pharmaceuticals, Inc. | Enzyme-activated anti-tumor prodrug compounds |
| US6339142B1 (en) | 1998-05-06 | 2002-01-15 | Genentech, Inc. | Protein purification |
| US20020193311A1 (en) | 2001-03-08 | 2002-12-19 | Hans-Georg Lerchen | Novel cytostatic conjugates with integrin ligands |
| WO2003074566A2 (en) | 2002-03-01 | 2003-09-12 | Immunomedics, Inc. | Rs7 antibodies |
| US6676924B2 (en) | 1994-10-05 | 2004-01-13 | Immunomedics, Inc. | CDR-grafted type III anti-CEA humanized mouse monoclonal antibodies |
| US6800738B1 (en) | 1991-06-14 | 2004-10-05 | Genentech, Inc. | Method for making humanized antibodies |
| US20070014795A1 (en) | 2004-12-30 | 2007-01-18 | Dhodapkar Madhav V | Compositions and methods for enhanced dendritic cell maturation and function |
| US7416726B2 (en) | 2000-04-13 | 2008-08-26 | The Rockefeller University | Enhancement of antibody-mediated immune responses |
| US7420040B2 (en) | 2006-02-24 | 2008-09-02 | Arius Research Inc. | Cytotoxicity mediation of cells evidencing surface expression of TROP-2 |
| US20080286819A1 (en) | 2005-11-07 | 2008-11-20 | Ravetch Jeffrey V | Reagents, Methods and Systems for Selecting a Cytotoxic Antibody or Variant Thereof |
| WO2008144891A1 (en) | 2007-05-30 | 2008-12-04 | F. Hoffmann-La Roche Ag | Humanized and chimeric anti-trop-2 antibodies that mediate cancer cell cytotoxicity |
| US7521541B2 (en) | 2004-09-23 | 2009-04-21 | Genetech Inc. | Cysteine engineered antibodies and conjugates |
| WO2009052249A1 (en) | 2007-10-19 | 2009-04-23 | Genentech, Inc. | Cysteine engineered anti-tenb2 antibodies and antibody drug conjugates |
| US7723485B2 (en) | 2007-05-08 | 2010-05-25 | Genentech, Inc. | Cysteine engineered anti-MUC16 antibodies and antibody drug conjugates |
| US7776330B2 (en) | 2004-03-11 | 2010-08-17 | City Of Hope | Humanized anti-CEA T84.66 antibody and uses thereof |
| US7862817B2 (en) | 1999-06-25 | 2011-01-04 | Genentech, Inc. | Humanized anti-ErbB2 antibodies and treatment with anti-ErbB2 antibodies |
| WO2011068845A1 (en) | 2009-12-02 | 2011-06-09 | Immunomedics, Inc. | Combining radioimmunotherapy and antibody-drug conjugates for improved cancer therapy |
| WO2011096519A1 (ja) | 2010-02-04 | 2011-08-11 | 東レ株式会社 | 癌の治療及び/又は予防用医薬組成物 |
| US7999083B2 (en) | 2002-12-13 | 2011-08-16 | Immunomedics, Inc. | Immunoconjugates with an intracellularly-cleavable linkage |
| WO2011145744A1 (ja) | 2010-05-17 | 2011-11-24 | 株式会社リブテック | in vivoで抗腫瘍活性を有する抗ヒトTROP-2抗体 |
| WO2011155579A1 (ja) | 2010-06-10 | 2011-12-15 | 北海道公立大学法人札幌医科大学 | 抗Trop-2抗体 |
| US20120121615A1 (en) | 2010-11-17 | 2012-05-17 | Flygare John A | Alaninyl maytansinol antibody conjugates |
| WO2013018889A1 (ja) | 2011-08-04 | 2013-02-07 | 東レ株式会社 | 癌の治療及び/又は予防用医薬組成物 |
| WO2013018883A1 (ja) | 2011-08-04 | 2013-02-07 | 東レ株式会社 | 癌の治療及び/又は予防用医薬組成物 |
| WO2013018892A1 (ja) | 2011-08-04 | 2013-02-07 | 東レ株式会社 | 癌の治療及び/又は予防用医薬組成物 |
| WO2013018891A1 (ja) | 2011-08-04 | 2013-02-07 | 東レ株式会社 | 癌の治療及び/又は予防用医薬組成物 |
| WO2013068946A2 (en) | 2011-11-11 | 2013-05-16 | Rinat Neuroscience Corp. | Antibodies specific for trop-2 and their uses |
| WO2013077458A1 (ja) | 2011-11-22 | 2013-05-30 | 株式会社リブテック | in vivoで抗腫瘍活性を有する抗ヒトTROP-2抗体 |
| WO2013125640A1 (ja) | 2012-02-21 | 2013-08-29 | 東レ株式会社 | 癌の治療及び/又は予防用医薬組成物 |
| WO2013125654A1 (ja) | 2012-02-21 | 2013-08-29 | 東レ株式会社 | 癌の治療及び/又は予防用医薬組成物 |
| WO2013125630A1 (ja) | 2012-02-21 | 2013-08-29 | 東レ株式会社 | 癌の治療及び/又は予防用医薬組成物 |
| WO2013125636A1 (ja) | 2012-02-21 | 2013-08-29 | 東レ株式会社 | 癌の治療及び/又は予防用医薬組成物 |
| WO2014014086A1 (ja) | 2012-07-19 | 2014-01-23 | 東レ株式会社 | 癌の検出方法 |
| WO2014014082A1 (ja) | 2012-07-19 | 2014-01-23 | 東レ株式会社 | 癌の検出方法 |
| US8642742B2 (en) | 2011-03-02 | 2014-02-04 | Roche Glycart Ag | Anti-CEA antibodies |
| WO2015020212A1 (ja) | 2013-08-09 | 2015-02-12 | 東レ株式会社 | 癌の治療及び/又は予防用医薬組成物 |
| WO2015098099A1 (ja) | 2013-12-25 | 2015-07-02 | 第一三共株式会社 | 抗trop2抗体-薬物コンジュゲート |
| WO2015172099A1 (en) | 2014-05-09 | 2015-11-12 | Kineta, Inc. | Anti-viral compounds, pharmaceutical compositions, and methods of use thereof |
| US20160145350A1 (en) | 2014-11-21 | 2016-05-26 | Bristol-Myers Squibb Company | Antibodies against cd73 and uses thereof |
| US9382329B2 (en) | 2012-08-14 | 2016-07-05 | Ibc Pharmaceuticals, Inc. | Disease therapy by inducing immune response to Trop-2 expressing cells |
| US9617345B2 (en) | 2012-11-20 | 2017-04-11 | Sanofi | Anti-CEACAM5 antibodies and uses thereof |
| US9676863B2 (en) | 2014-02-10 | 2017-06-13 | Merck Patent Gmbh | Targeted TGFβ inhibitors |
| WO2017156152A1 (en) | 2016-03-08 | 2017-09-14 | Bioxcel Corporation | Immunomodulation therapies for cancer |
| US9797907B2 (en) | 2015-04-22 | 2017-10-24 | Immunomedics, Inc. | Isolation, detection, diagnosis and/or characterization of circulating Trop-2-positive cancer cells |
| WO2018079740A1 (ja) | 2016-10-28 | 2018-05-03 | 東レ株式会社 | 癌の治療及び/又は予防用医薬組成物 |
| US9982063B2 (en) | 2005-12-21 | 2018-05-29 | Amgen Research (Munich) Gmbh | Pharmaceutical compositions with resistance to soluble CEA |
| WO2019069275A1 (en) * | 2017-10-05 | 2019-04-11 | Glaxosmithkline Intellectual Property Development Limited | STING AGONIST ADMINISTRATION METHODS |
| WO2019084060A1 (en) * | 2017-10-24 | 2019-05-02 | Silverback Therapeutics, Inc. | CONJUGATES AND METHODS OF USE FOR THE SELECTIVE DELIVERY OF IMMUNOMODULATORY AGENTS |
| US20190300513A1 (en) | 2018-04-03 | 2019-10-03 | Merck Sharp & Dohme Corp. | Sting agonist compounds |
| WO2019222676A1 (en) * | 2018-05-17 | 2019-11-21 | Bolt Biotherapeutics, Inc. | Immunoconjugates |
| WO2020142659A2 (en) | 2019-01-04 | 2020-07-09 | Trio Pharmaceuticals, Inc. | Multi-specific protein molecules and uses thereof |
| WO2020252294A1 (en) * | 2019-06-13 | 2020-12-17 | Bolt Biotherapeutics, Inc. | Aminobenzazepine compounds, immunoconjugates, and uses thereof |
| WO2021046112A1 (en) * | 2019-09-03 | 2021-03-11 | Bolt Biotherapeutics, Inc. | Aminoquinoline compounds, immunoconjugates, and uses thereof |
| WO2021067242A1 (en) * | 2019-09-30 | 2021-04-08 | Bolt Biotherapeutics, Inc. | Amide-linked, aminobenzazepine immunoconjugates, and uses thereof |
| WO2021081407A1 (en) * | 2019-10-25 | 2021-04-29 | Bolt Biotherapeutics, Inc. | Thienoazepine immunoconjugates, and uses thereof |
-
2021
- 2021-05-07 US US17/923,541 patent/US20230293716A1/en active Pending
- 2021-05-07 JP JP2022566686A patent/JP2023524271A/ja not_active Withdrawn
- 2021-05-07 EP EP21728751.5A patent/EP4146282A1/en not_active Withdrawn
- 2021-05-07 CN CN202180046241.8A patent/CN115996756A/zh active Pending
- 2021-05-07 WO PCT/US2021/031264 patent/WO2021226440A1/en not_active Ceased
- 2021-05-07 CA CA3176626A patent/CA3176626A1/en active Pending
Patent Citations (72)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US723288A (en) | 1901-10-26 | 1903-03-24 | Harry South Lewis | Cipher-key for cryptographic codes. |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| US5677171A (en) | 1988-01-12 | 1997-10-14 | Genentech, Inc. | Monoclonal antibodies directed to the HER2 receptor |
| US6165464A (en) | 1988-01-12 | 2000-12-26 | Genetech, Inc. | Monoclonal antibodies directed to the HER2 receptor |
| US5821337A (en) | 1991-06-14 | 1998-10-13 | Genentech, Inc. | Immunoglobulin variants |
| US6054297A (en) | 1991-06-14 | 2000-04-25 | Genentech, Inc. | Humanized antibodies and methods for making them |
| US6407213B1 (en) | 1991-06-14 | 2002-06-18 | Genentech, Inc. | Method for making humanized antibodies |
| US6800738B1 (en) | 1991-06-14 | 2004-10-05 | Genentech, Inc. | Method for making humanized antibodies |
| US6719971B1 (en) | 1991-06-14 | 2004-04-13 | Genentech, Inc. | Method for making humanized antibodies |
| US6639055B1 (en) | 1991-06-14 | 2003-10-28 | Genentech, Inc. | Method for making humanized antibodies |
| US6676924B2 (en) | 1994-10-05 | 2004-01-13 | Immunomedics, Inc. | CDR-grafted type III anti-CEA humanized mouse monoclonal antibodies |
| US6339142B1 (en) | 1998-05-06 | 2002-01-15 | Genentech, Inc. | Protein purification |
| US7074404B2 (en) | 1998-05-06 | 2006-07-11 | Genentech, Inc. | Protein purification |
| WO2000069472A2 (en) | 1999-05-14 | 2000-11-23 | Boehringer Ingelheim Pharmaceuticals, Inc. | Enzyme-activated anti-tumor prodrug compounds |
| US6855689B2 (en) | 1999-05-14 | 2005-02-15 | Boehringer Ingelheim Pharmaceuticals, Inc. | Enzyme-activated anti-tumor prodrug compounds |
| US20020147138A1 (en) * | 1999-05-14 | 2002-10-10 | Boehringer Ingelheim Pharmaceuticals, Inc. | Enzyme-activated anti-tumor prodrug compounds |
| US7862817B2 (en) | 1999-06-25 | 2011-01-04 | Genentech, Inc. | Humanized anti-ErbB2 antibodies and treatment with anti-ErbB2 antibodies |
| US7416726B2 (en) | 2000-04-13 | 2008-08-26 | The Rockefeller University | Enhancement of antibody-mediated immune responses |
| US20020193311A1 (en) | 2001-03-08 | 2002-12-19 | Hans-Georg Lerchen | Novel cytostatic conjugates with integrin ligands |
| WO2003074566A2 (en) | 2002-03-01 | 2003-09-12 | Immunomedics, Inc. | Rs7 antibodies |
| US7238785B2 (en) | 2002-03-01 | 2007-07-03 | Immunomedics, Inc. | RS7 antibodies |
| US7999083B2 (en) | 2002-12-13 | 2011-08-16 | Immunomedics, Inc. | Immunoconjugates with an intracellularly-cleavable linkage |
| US7776330B2 (en) | 2004-03-11 | 2010-08-17 | City Of Hope | Humanized anti-CEA T84.66 antibody and uses thereof |
| US7521541B2 (en) | 2004-09-23 | 2009-04-21 | Genetech Inc. | Cysteine engineered antibodies and conjugates |
| US20070014795A1 (en) | 2004-12-30 | 2007-01-18 | Dhodapkar Madhav V | Compositions and methods for enhanced dendritic cell maturation and function |
| US20080286819A1 (en) | 2005-11-07 | 2008-11-20 | Ravetch Jeffrey V | Reagents, Methods and Systems for Selecting a Cytotoxic Antibody or Variant Thereof |
| US9982063B2 (en) | 2005-12-21 | 2018-05-29 | Amgen Research (Munich) Gmbh | Pharmaceutical compositions with resistance to soluble CEA |
| US7420040B2 (en) | 2006-02-24 | 2008-09-02 | Arius Research Inc. | Cytotoxicity mediation of cells evidencing surface expression of TROP-2 |
| US7723485B2 (en) | 2007-05-08 | 2010-05-25 | Genentech, Inc. | Cysteine engineered anti-MUC16 antibodies and antibody drug conjugates |
| WO2008144891A1 (en) | 2007-05-30 | 2008-12-04 | F. Hoffmann-La Roche Ag | Humanized and chimeric anti-trop-2 antibodies that mediate cancer cell cytotoxicity |
| WO2009052249A1 (en) | 2007-10-19 | 2009-04-23 | Genentech, Inc. | Cysteine engineered anti-tenb2 antibodies and antibody drug conjugates |
| WO2011068845A1 (en) | 2009-12-02 | 2011-06-09 | Immunomedics, Inc. | Combining radioimmunotherapy and antibody-drug conjugates for improved cancer therapy |
| WO2011096519A1 (ja) | 2010-02-04 | 2011-08-11 | 東レ株式会社 | 癌の治療及び/又は予防用医薬組成物 |
| WO2011145744A1 (ja) | 2010-05-17 | 2011-11-24 | 株式会社リブテック | in vivoで抗腫瘍活性を有する抗ヒトTROP-2抗体 |
| WO2011155579A1 (ja) | 2010-06-10 | 2011-12-15 | 北海道公立大学法人札幌医科大学 | 抗Trop-2抗体 |
| US20120237518A1 (en) | 2010-06-10 | 2012-09-20 | Kyowa Hakko Kirin Co., Ltd | Anti-trop-2 antibody |
| US20120121615A1 (en) | 2010-11-17 | 2012-05-17 | Flygare John A | Alaninyl maytansinol antibody conjugates |
| US8642742B2 (en) | 2011-03-02 | 2014-02-04 | Roche Glycart Ag | Anti-CEA antibodies |
| WO2013018889A1 (ja) | 2011-08-04 | 2013-02-07 | 東レ株式会社 | 癌の治療及び/又は予防用医薬組成物 |
| WO2013018892A1 (ja) | 2011-08-04 | 2013-02-07 | 東レ株式会社 | 癌の治療及び/又は予防用医薬組成物 |
| WO2013018891A1 (ja) | 2011-08-04 | 2013-02-07 | 東レ株式会社 | 癌の治療及び/又は予防用医薬組成物 |
| WO2013018883A1 (ja) | 2011-08-04 | 2013-02-07 | 東レ株式会社 | 癌の治療及び/又は予防用医薬組成物 |
| WO2013068946A2 (en) | 2011-11-11 | 2013-05-16 | Rinat Neuroscience Corp. | Antibodies specific for trop-2 and their uses |
| US8871908B2 (en) | 2011-11-11 | 2014-10-28 | Rinat Neuroscience Corp. | Antibodies specific for Trop-2 and their uses |
| WO2013077458A1 (ja) | 2011-11-22 | 2013-05-30 | 株式会社リブテック | in vivoで抗腫瘍活性を有する抗ヒトTROP-2抗体 |
| WO2013125640A1 (ja) | 2012-02-21 | 2013-08-29 | 東レ株式会社 | 癌の治療及び/又は予防用医薬組成物 |
| WO2013125636A1 (ja) | 2012-02-21 | 2013-08-29 | 東レ株式会社 | 癌の治療及び/又は予防用医薬組成物 |
| WO2013125630A1 (ja) | 2012-02-21 | 2013-08-29 | 東レ株式会社 | 癌の治療及び/又は予防用医薬組成物 |
| WO2013125654A1 (ja) | 2012-02-21 | 2013-08-29 | 東レ株式会社 | 癌の治療及び/又は予防用医薬組成物 |
| WO2014014086A1 (ja) | 2012-07-19 | 2014-01-23 | 東レ株式会社 | 癌の検出方法 |
| WO2014014082A1 (ja) | 2012-07-19 | 2014-01-23 | 東レ株式会社 | 癌の検出方法 |
| US9382329B2 (en) | 2012-08-14 | 2016-07-05 | Ibc Pharmaceuticals, Inc. | Disease therapy by inducing immune response to Trop-2 expressing cells |
| US9617345B2 (en) | 2012-11-20 | 2017-04-11 | Sanofi | Anti-CEACAM5 antibodies and uses thereof |
| WO2015020212A1 (ja) | 2013-08-09 | 2015-02-12 | 東レ株式会社 | 癌の治療及び/又は予防用医薬組成物 |
| US20160297890A1 (en) | 2013-12-25 | 2016-10-13 | Daiichi Sankyo Company, Limited | Anti-trop2 antibody-drug conjugate |
| WO2015098099A1 (ja) | 2013-12-25 | 2015-07-02 | 第一三共株式会社 | 抗trop2抗体-薬物コンジュゲート |
| US10227417B2 (en) | 2013-12-25 | 2019-03-12 | Daiichi Sankyo Company, Limited | Anti-TROP2 antibody-drug conjugate |
| US9676863B2 (en) | 2014-02-10 | 2017-06-13 | Merck Patent Gmbh | Targeted TGFβ inhibitors |
| WO2015172099A1 (en) | 2014-05-09 | 2015-11-12 | Kineta, Inc. | Anti-viral compounds, pharmaceutical compositions, and methods of use thereof |
| US20160145350A1 (en) | 2014-11-21 | 2016-05-26 | Bristol-Myers Squibb Company | Antibodies against cd73 and uses thereof |
| US9797907B2 (en) | 2015-04-22 | 2017-10-24 | Immunomedics, Inc. | Isolation, detection, diagnosis and/or characterization of circulating Trop-2-positive cancer cells |
| WO2017156152A1 (en) | 2016-03-08 | 2017-09-14 | Bioxcel Corporation | Immunomodulation therapies for cancer |
| WO2018079740A1 (ja) | 2016-10-28 | 2018-05-03 | 東レ株式会社 | 癌の治療及び/又は予防用医薬組成物 |
| WO2019069275A1 (en) * | 2017-10-05 | 2019-04-11 | Glaxosmithkline Intellectual Property Development Limited | STING AGONIST ADMINISTRATION METHODS |
| WO2019084060A1 (en) * | 2017-10-24 | 2019-05-02 | Silverback Therapeutics, Inc. | CONJUGATES AND METHODS OF USE FOR THE SELECTIVE DELIVERY OF IMMUNOMODULATORY AGENTS |
| US20190300513A1 (en) | 2018-04-03 | 2019-10-03 | Merck Sharp & Dohme Corp. | Sting agonist compounds |
| WO2019222676A1 (en) * | 2018-05-17 | 2019-11-21 | Bolt Biotherapeutics, Inc. | Immunoconjugates |
| WO2020142659A2 (en) | 2019-01-04 | 2020-07-09 | Trio Pharmaceuticals, Inc. | Multi-specific protein molecules and uses thereof |
| WO2020252294A1 (en) * | 2019-06-13 | 2020-12-17 | Bolt Biotherapeutics, Inc. | Aminobenzazepine compounds, immunoconjugates, and uses thereof |
| WO2021046112A1 (en) * | 2019-09-03 | 2021-03-11 | Bolt Biotherapeutics, Inc. | Aminoquinoline compounds, immunoconjugates, and uses thereof |
| WO2021067242A1 (en) * | 2019-09-30 | 2021-04-08 | Bolt Biotherapeutics, Inc. | Amide-linked, aminobenzazepine immunoconjugates, and uses thereof |
| WO2021081407A1 (en) * | 2019-10-25 | 2021-04-29 | Bolt Biotherapeutics, Inc. | Thienoazepine immunoconjugates, and uses thereof |
Non-Patent Citations (69)
| Title |
|---|
| "GenBank", Database accession no. AAK62677 |
| "The Chemistry of Heterocyclic Compounds, A series of Monographs", 1950, JOHN WILEY & SONS |
| ALLEY, S.C. ET AL.: "2004 Annual Meeting, March 27-31, 2004, Proceedings of the AACR", vol. 45, March 2004, AMERICAN ASSOCIATION FOR CANCER RESEARCH, article "Controlling the location of drug attachment in antibody-drug conjugates" |
| ALTSCHUL ET AL., J. MOLECULAR BIOL., vol. 215, no. 3, 1990, pages 403 - 410 |
| ALTSCHUL ET AL., NUCLEIC ACIDS RES., vol. 25, no. 17, 1997, pages 3389 - 3402 |
| ANDRÉ RAPOSO MOREIRA DIAS ET AL: "Neutrophil Elastase Promotes Linker Cleavage and Paclitaxel Release from an Integrin-Targeted Conjugate", CHEMISTRY - A EUROPEAN JOURNAL, vol. 25, no. 7, 1 February 2019 (2019-02-01), pages 1696 - 1700, XP055657811, ISSN: 0947-6539, DOI: 10.1002/chem.201805447 * |
| BARBER, G.N., NATURE REV IMMUNOL, vol. 15, 2015, pages 760 - 770 |
| BEIGERT ET AL., PROC. NATL. ACAD. SCI. USA, vol. 106, no. 10, 2009, pages 3770 - 3775 |
| BLUMENTHAL, R. ET AL., CANCER IMMUNOLOGY IMMUNOTHERAPY, vol. 54, no. 4, 2005, pages 315 - 327 |
| CALABRESE G ET AL., CYTOGENET CELL GENET, vol. 92, no. 1-2, 2001, pages 164 - 5 |
| CARDILLO, T. ET AL., MOLECULAR CANCER THERAPEUTICS, vol. 17, no. 1, 2018, pages 150 - 160 |
| CHO ET AL., NATURE, vol. 421, 2003, pages 756 - 60 |
| COULOMBE, F. ET AL., J. EXP. MED., vol. 206, no. 8, 2009, pages 1709 - 1716 |
| COUSSENS ET AL., SCIENCE, vol. 230, 1985, pages 1132 - 9 |
| DIAS, A.R.M ET AL., CHEM. EUR. J., vol. 25, 2019, pages 1696 - 1700 |
| DORNAN ET AL., BLOOD, vol. 114, no. 13, 2009, pages 2721 - 2729 |
| ELION, D.L. ET AL., ONCOTARGET, vol. 9, no. 48, 2018, pages 29007 - 29017 |
| ELLIS JALUZIO JP, JBIOL CHEM., vol. 270, no. 35, 1995, pages 20717 - 23 |
| FAULK W P ET AL., PROC. NATL. ACAD. SCI., vol. 75, no. 4, 1978, pages 1947 - 1951 |
| FLYGARE, J.A. ET AL., CHEM BIOL DRUGDES., vol. 81, 2013, pages 113 - 121 |
| FONG D ET AL., BR. J. CANCER, vol. 99, no. 8, 2008, pages 1290 - 1295 |
| FONG D ET AL., MOD. PATHOL., vol. 21, no. 2, 2008, pages 186 - 191 |
| FORNARO M ET AL., INT. J. CANCER, vol. 62, no. 5, 1995, pages 610 - 618 |
| GUSFIELD: "Algorithms on Strings, Trees and Sequences", 1997, CAMBRIDGE UNIVERSITY PRESS |
| HAMBLETT ET AL., CLIN. CANCER RES., vol. 10, 2004, pages 7063 - 7070 |
| HAMBLETT, K.J. ET AL.: "Annual Meeting, March 27-31, 2004, Proceedings of the AACR", vol. 45, March 2004, AMERICAN ASSOCIATION FOR CANCER RESEARCH, article "Effect of drug loading on the pharmacology, pharmacokinetics, and toxicity of an anti-CD30 antibody-drug conjugate" |
| HANAHAN D. ET AL., CELL, vol. 144, 2011, pages 646 - 674 |
| HERMANSON: "Bioconjugate Techniques", 2008, ACADEMIC PRESS |
| J. AM. CHEM. SOC., vol. 82, no. 5566, 1960 |
| JAVAID, N. ET AL., PHARMACEUTICS, vol. 11, no. 9, 2019, pages 441 |
| JEFFERIS ET AL., MABS, vol. 1, no. 4, 2009, pages 332 - 338 |
| JUNUTULA ET AL., NATURE BIOTECH.,, vol. 26, no. 8, 2008, pages 925 - 932 |
| KASPERKIEWICZ, P. ET AL., PROC. NAT. ACAD. SCI., vol. 111, pages 2518 - 2523 |
| KHOT, A. ET AL., BIOANALYSIS, vol. 7, no. 13, 2015, pages 1633 - 1648 |
| KOHLWAY, A., EMBO REP, vol. 14, 2013, pages 772 - 779 |
| KUMAR, H ET AL., INTL. REV. OF IMMUN., vol. 30, 2011, pages 16 - 34 |
| LERMAN, I., STEROIDS, vol. 133, 2018, pages 96 - 101 |
| LI, F. ET AL., CANCER RES., vol. 76, 2016, pages 2710 - 2719 |
| LIEBERMAN, PHARMACEUTICAL DOSAGE FORMS, vol. 1-3, 1992 |
| LINNENBACH A J ET AL., PROC. NATL. ACAD. SCI., vol. 86, no. 1, 1989, pages 27 - 31 |
| LINNENBACH AJ ET AL., MOL CELL BIOL, vol. 13, no. 3, 1993, pages 1507 - 15 |
| LIPINSKI M ET AL., PROC. NATL. ACAD. SCI., vol. 78, no. 8, 1981, pages 5147 - 5150 |
| LLOYD, THE ART, SCIENCE AND TECHNOLOGY OF PHARMACEUTICAL COMPOUNDING, 1999 |
| LYON, R. ET AL., METHODS IN ENZYM., vol. 502, 2012, pages 123 - 138 |
| MAHLA, RS ET AL., FRONTIERS IN IMMUNOLOGY, vol. 4, no. 248, 2013 |
| MALIK ET AL., PRO AM SOC CANCER RES, vol. 44, 2003, pages 176 - 7 |
| MANGAN, M. ET AL., NATURE REVIEWS DRUG DISCOVERY, vol. 17, 2018, pages 588 - 606 |
| MCDONAGH ET AL., PROT. ENGR. DESIGN & SELECTION, vol. 19, no. 7, 2006, pages 299 - 307 |
| MUHLMANN G ET AL., J. CLIN. PATHOL., vol. 62, no. 2, 2009, pages 152 - 158 |
| NEGRONI, A. ET AL., J. INFLAMM. RES., vol. 11, 2018, pages 49 - 60 |
| NING S ET AL., NEUROL. SCI., vol. 34, no. 10, 2013, pages 1745 - 1750 |
| OHMACHI T ET AL., CLIN. CANCER RES., vol. 12, no. 10, 2006, pages 3057 - 3063 |
| PAQUETTE, LEO A.: "Principles of Modern Heterocyclic Chemistry", 1968, W.A. BENJAMIN |
| PICKAR: "Dosage Calculations", 1999, MCGRAW-HILL, article "Goodman & Gilman's The Pharmacological Basis of Therapeutics" |
| POREBA M ET AL., PLOS ONE, vol. 7, no. 2, 2012, pages e31938 |
| RAMANJULU, J.M. ET AL., NATURE, vol. 564, 2018, pages 439 - 443 |
| RUSSELL ET AL., J. MOLBIOL., vol. 244, 1994, pages 332 - 350 |
| SCHRODER K ET AL., CELL, vol. 140, no. 6, 2010, pages 821 - 832 |
| SLAMON ET AL., NEW ENGL. J. MED., vol. 344, 2001, pages 783 - 792 |
| SLAMON ET AL., SCIENCE, vol. 244, 1989, pages 707 - 12 |
| SLIWKOWSKI, NAT STRUCT BIOL, vol. 10, 2003, pages 158 - 9 |
| SODING, BIOINFORMATICS, vol. 21, no. 7, 2005, pages 951 - 960 |
| SOLOMON S ET AL., MOL CELL BIOL., vol. 27, no. 6, 2007, pages 2324 - 42 |
| STARCHER, J., INVEST. DERM., vol. 107, 1996, pages 159 - 163 |
| WANG B ET AL., J IMMUNOL., vol. 175, no. 7, 2005, pages 4274 - 4282 |
| YANG, Z-S ET AL., ONCOLOGY LETTERS, vol. 18, 2019, pages 15 - 21 |
| YARDEN, ONCOGENE, vol. 19, 2000, pages 6102 - 14 |
| YARDENSLIWKOWSKI., NAT REV MOL CELL BIOL, vol. 2, 2001, pages 127 - 37 |
| ZERVOUDI E ET AL., BIOCHEM, vol. Y435, no. 2, 2011, pages 411 - 420 |
Cited By (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11547761B1 (en) | 2016-07-07 | 2023-01-10 | The Board Of Trustees Of The Leland Stanford Junior University | Antibody adjuvant conjugates |
| US11400164B2 (en) | 2019-03-15 | 2022-08-02 | Bolt Biotherapeutics, Inc. | Immunoconjugates targeting HER2 |
| EP4259208A1 (en) * | 2020-12-11 | 2023-10-18 | Bolt Biotherapeutics, Inc. | Immunoconjugates comprising an anti-cea antibody linked by conjugation to one or more 8-het-2- aminobenzazepine derivatives useful in treating cancer |
| WO2022125908A1 (en) * | 2020-12-11 | 2022-06-16 | Bolt Biotherapeutics, Inc. | Anti-pd-l1 immunoconjugates, and uses thereof |
| WO2022125915A1 (en) * | 2020-12-11 | 2022-06-16 | Bolt Biotherapeutics, Inc. | Anti-her2 immunoconjugates, and uses thereof |
| WO2022125891A3 (en) * | 2020-12-11 | 2022-10-13 | Bolt Biotherapeutics, Inc. | Anti-cea immunoconjugates, and uses thereof |
| WO2022125904A1 (en) * | 2020-12-11 | 2022-06-16 | Bolt Biotherapeutics, Inc. | Anti-her2 immunoconjugates, and uses thereof |
| WO2023076599A1 (en) * | 2021-10-29 | 2023-05-04 | Bolt Biotherapeutics, Inc. | Tlr agonist immunoconjugates with cysteine-mutant antibodies, and uses thereof |
| WO2023154318A1 (en) * | 2022-02-09 | 2023-08-17 | Bolt Biotherapeutics, Inc. | Anti-tr0p2, aminobenzazepine immunoconjugates, and uses thereof |
| WO2023154307A1 (en) * | 2022-02-09 | 2023-08-17 | Bolt Biotherapeutics, Inc. | Antibody-conjugated 8-sulfonyl-benzazepine compounds and their uses |
| WO2023154302A1 (en) * | 2022-02-09 | 2023-08-17 | Bolt Biotherapeutics, Inc. | Macromolecule-supported 8-sulfonyl-benzazepine compounds and their uses |
| WO2024174863A1 (zh) * | 2023-02-22 | 2024-08-29 | 深圳众格生物科技有限公司 | Sting激动剂及其制备方法和医药用途 |
| WO2025252682A1 (en) * | 2024-06-03 | 2025-12-11 | Elasmogen Ltd | Self immolative compounds and conjugates comprising an immunomodulatory agent |
| WO2026078593A1 (en) | 2024-10-08 | 2026-04-16 | Sun Pharma Advanced Research Company Limited | Sting agonists and antibody drug conjugates thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2023524271A (ja) | 2023-06-09 |
| CN115996756A (zh) | 2023-04-21 |
| CA3176626A1 (en) | 2021-11-11 |
| US20230293716A1 (en) | 2023-09-21 |
| EP4146282A1 (en) | 2023-03-15 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20230293716A1 (en) | Elastase-substrate, peptide linker immunoconjugates, and uses thereof | |
| EP4048315B1 (en) | Thienoazepine immunoconjugates, and uses thereof | |
| US20220347310A1 (en) | Amide-linked, aminobenzazepine immunoconjugates, and uses thereof | |
| WO2024137619A1 (en) | Anti-claudin, bis-benzimid azole sting agonist immunoconjugates, and uses thereof | |
| EP4025254A1 (en) | Aminoquinoline compounds, immunoconjugates, and uses thereof | |
| WO2022204536A1 (en) | 2-amino-4-carboxamide-benzazepine immunoconjugates, and uses thereof | |
| EP4259212A1 (en) | Anti-her2 immunoconjugates, and uses thereof | |
| WO2023154318A1 (en) | Anti-tr0p2, aminobenzazepine immunoconjugates, and uses thereof | |
| WO2022125915A1 (en) | Anti-her2 immunoconjugates, and uses thereof | |
| EP4259210A2 (en) | Anti-cea immunoconjugates, and uses thereof | |
| EP4259209A1 (en) | Anti-pd-l1 immunoconjugates, and uses thereof | |
| US20250127914A1 (en) | Antibody-conjugated 8-sulfonyl-benzazepine compounds and their uses | |
| KR20230163450A (ko) | 2-아미노-4-카복사마이드-벤즈아제핀 면역접합체 및 이의 용도 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 21728751 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3176626 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2022566686 Country of ref document: JP Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2021728751 Country of ref document: EP Effective date: 20221208 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |