WO2021216972A1 - Anti-cd3 antibodies and uses thereof - Google Patents

Anti-cd3 antibodies and uses thereof Download PDF

Info

Publication number
WO2021216972A1
WO2021216972A1 PCT/US2021/028798 US2021028798W WO2021216972A1 WO 2021216972 A1 WO2021216972 A1 WO 2021216972A1 US 2021028798 W US2021028798 W US 2021028798W WO 2021216972 A1 WO2021216972 A1 WO 2021216972A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
antibody
immunoglobulin
binding fragment
antigen binding
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2021/028798
Other languages
English (en)
French (fr)
Inventor
Nai-Kong V. Cheung
Sayed Shahabuddin HOSEINI
Hong Xu
Brian SANTICH
Mahiuddin Ahmed
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Memorial Sloan Kettering Cancer Center
Original Assignee
Memorial Sloan Kettering Cancer Center
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Memorial Sloan Kettering Cancer Center filed Critical Memorial Sloan Kettering Cancer Center
Priority to EP21792369.7A priority Critical patent/EP4139347A4/en
Priority to JP2022564276A priority patent/JP7791836B2/ja
Priority to CA3176391A priority patent/CA3176391A1/en
Priority to CN202180043797.1A priority patent/CN115803340A/zh
Priority to US17/920,539 priority patent/US20230212289A1/en
Publication of WO2021216972A1 publication Critical patent/WO2021216972A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2809Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/303Liver or Pancreas
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/575Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/54Medicinal preparations containing antigens or antibodies characterised by the route of administration
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/35Valency
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/40Immunoglobulins specific features characterized by post-translational modification
    • C07K2317/41Glycosylation, sialylation, or fucosylation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/524CH2 domain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94Stability, e.g. half-life, pH, temperature or enzyme-resistance

Definitions

  • the present technology relates generally to the preparation of immunoglobulin- related compositions (e.g ., antibodies or antigen binding fragments thereof) that specifically bind CD3 protein and uses of the same.
  • the present technology relates to the preparation of CD3 binding antibodies and their use in detecting and treating cancer or CD3 -associated pathologies.
  • autoimmune diseases arises when the immune system of the patient reacts against its own normal tissues.
  • the autoimmune diseases commonly involve both B cells and T cells.
  • T cells play important roles in various autoimmune diseases including those mediated primarily via autoimmune antibodies or immune complexes, there are diseases that are primarily T cell mediated including sympathetic ophthalmia, multiple sclerosis, and type-1 diabetes mellitus.
  • the treatment of autoimmune diseases is mainly based on immunosuppression with either corticosteroids or T cell activation pathway antagonists.
  • AHCT Allergenic hematopoietic cell transplantation
  • corticosteroids have several adverse metabolic systemic effects, such as dampening the whole immune system including the innate and adaptive immunity and increasing the risk of opportunistic infections (Jacobsohn and Vogelsang, supra (2007), Hatzimichael and Tuthill, supra (2010)).
  • some patients are resistant to corticosteroid treatment.
  • the survival rate of patients with grade IV GVHD is only 5%, thus necessitating the development of more effective and safer treatment options for these patients (Cahn et al ., Blood 106(4): 1495-1500 (2005)).
  • the present disclosure provides an antibody or antigen binding fragment thereof comprising a heavy chain immunoglobulin variable domain (VH) and a light chain immunoglobulin variable domain (VL), wherein (a) the VH comprises a VH- CDR1 sequence of GYTFTRYT (SEQ ID NO: 2), a VH-CDR2 sequence of INPSRGYT (SEQ ID NO: 3), and a VH-CDR3 sequence of ARYYDDHYSLDY (SEQ ID NO: 6), ARYYDDHYSCDY (SEQ ID NO: 134), ARYYDDHCSLDY (SEQ ID NO: 135), or ARY YDDHY SLC Y (SEQ ID NO: 136); and/or; (b) the VL comprises a VL-CDR1 sequence of SSVSY (SEQ ID NO: 12), a VL-CDR2 sequence of DT (SEQ ID NO: 13), and a VL- CDR3 sequence of QQWSSNPFT
  • the present disclosure provides an antibody or antigen binding fragment thereof comprising a heavy chain immunoglobulin variable domain (VH) and a light chain immunoglobulin variable domain (VL), wherein: (a) the VH comprises an amino acid sequence selected from any one of SEQ ID NOs: 5, 7, 8, 9, 10, or 43-61; and/or (b) the VL comprises an amino acid sequence selected from any one of SEQ ID NOs: 15-20 or 62- 91.
  • VH heavy chain immunoglobulin variable domain
  • VL light chain immunoglobulin variable domain
  • the antibody may further comprise an Fc domain of an isotype selected from the group consisting of IgGl, IgG2, IgG3, IgG4, IgAl, IgA2, IgM, IgD, and IgE.
  • the antibody comprises an IgGl constant region comprising one or more amino acid substitutions selected from the group consisting of N297A and K322A.
  • the antibody comprises an IgG4 constant region comprising a S228P mutation.
  • the antigen binding fragment is selected from the group consisting of Fab, F(ab’)2, Fab’, scFv, and F v.
  • the antibody is a monoclonal antibody, a chimeric antibody, a humanized antibody, a bispecific antibody, or a multi-specific antibody.
  • the antibody or antigen binding fragment binds to the extracellular domain of a CD3 polypeptide.
  • the extracellular domain comprises a CD3e subunit including a linear stretch of sequence on the F-G loop.
  • the CD3e subunit may comprise three discontinuous regions: residues 79e- 85e (the F-G loop), residue 34e (the first residue of the BC strand), and residues 46e and 48e (the C’-D loop).
  • the present disclosure provides an antibody comprising a heavy chain (HC) amino acid sequence comprising SEQ ID NO: 23, SEQ ID NO: 96, SEQ ID NO: 100, SEQ ID NO: 104, SEQ ID NO: 108, SEQ ID NO: 112, SEQ ID NO: 116, SEQ ID NO: 126, SEQ ID NO: 132, SEQ ID NO: 137, SEQ ID NO: 139, or a variant thereof having one or more conservative amino acid substitutions, and/or a light chain (LC) amino acid sequence comprising SEQ ID NO: 21, SEQ ID NO: 92, SEQ ID NO: 94, SEQ ID NO: 98, SEQ ID NO: 102, SEQ ID NO: 106, SEQ ID NO: 110, SEQ ID NO: 114, SEQ ID NO: 122, SEQ ID NO: 124, SEQ ID NO: 128, SEQ ID NO: 130, or a variant thereof having one or more conservative amino acid substitutions.
  • HC heavy chain
  • the antibody comprises a HC amino acid sequence and a LC amino acid sequence selected from the group consisting of: SEQ ID NO: 23 and SEQ ID NO: 21, SEQ ID NO: 23 and SEQ ID NO: 92, SEQ ID NO: 96 and SEQ ID NO: 94, SEQ ID NO: 100 and SEQ ID NO: 98, SEQ ID NO: 104 and SEQ ID NO: 102, SEQ ID NO: 108 and SEQ ID NO: 106, SEQ ID NO:
  • the antibody comprises a first LC amino acid sequence, a second LC amino acid sequence, a first HC amino acid sequence, and a second HC amino acid sequence selected from the group consisting of SEQ ID NO: 122, SEQ ID NO: 124, SEQ ID NO: 126, and SEQ ID NO: 137; and SEQ ID NO: 128, SEQ ID NO: 130, SEQ ID NO: 132, and SEQ ID NO: 139, respectively.
  • the present disclosure provides an antibody comprising (a) a light chain immunoglobulin variable domain sequence that is at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the light chain immunoglobulin variable domain sequence of any one of SEQ ID NOs: 15-20 or 62-91; and/or (b) a heavy chain immunoglobulin variable domain sequence that is at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the heavy chain immunoglobulin variable domain sequence of any one of SEQ ID NOs: 5, 7, 8, 9, 10, or 43-61.
  • the present disclosure provides an antibody comprising (a) a LC sequence that is at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the LC sequence present in SEQ ID NO: 21, SEQ ID NO: 92, SEQ ID NO: 94, SEQ ID NO: 98, SEQ ID NO: 102, SEQ ID NO: 106, SEQ ID NO: 110, SEQ ID NO: 114, SEQ ID NO: 122, SEQ ID NO: 124, SEQ ID NO: 128, or SEQ ID NO: 130; and/or (b) a LC sequence that is at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the LC sequence present in SEQ ID NO: 21, SEQ ID NO: 92, SEQ ID NO: 94, SEQ ID NO: 98, SEQ ID NO: 102, SEQ ID NO: 106, SEQ ID NO: 110, SEQ ID NO: 114, SEQ ID NO:
  • HC sequence that is at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the HC sequence present in SEQ ID NO: 23, SEQ ID NO: 96, SEQ ID NO: 100, SEQ ID NO: 104, SEQ ID NO: 108, SEQ ID NO: 112, SEQ ID NO: 116, SEQ ID NO: 126,
  • SEQ ID NO: 132 SEQ ID NO: 137, or SEQ ID NO: 139.
  • the antibody is a monoclonal antibody, a chimeric antibody, a humanized antibody, a bispecific antibody, or a multi-specific antibody. Additionally or alternatively, in some embodiments, the antibody comprises an IgGl constant region comprising one or more amino acid substitutions selected from the group consisting of N297A and K322A. In certain embodiments, the antibody of the present technology comprises an IgG4 constant region comprising a S228P mutation. In any of the above embodiments, the antibody binds to the extracellular domain of a CD3 polypeptide. In certain embodiments, the extracellular domain comprises a CD3e subunit including a linear stretch of sequence on the F-G loop. In some embodiments, the CD3e subunit may comprise three discontinuous regions: residues 79e-85e (the F-G loop), residue 34e (the first residue of the BC strand), and residues 46e and 48e (the C’-D loop).
  • the antibody of the present technology lacks a-l,6-fucose modifications.
  • the present disclosure provides a multi-specific antigen binding fragment comprising a first polypeptide chain, wherein: the first polypeptide chain comprises in the N-terminal to C-terminal direction: (i) a heavy chain variable domain of a first immunoglobulin that is capable of specifically binding to a first epitope; (ii) a flexible peptide linker comprising the amino acid sequence (GGGGS (iii) a light chain variable domain of the first immunoglobulin; (iv) a flexible peptide linker comprising the amino acid sequence (GGGGS (v) a heavy chain variable domain of a second immunoglobulin that is capable of specifically binding to a second epitope; (vi) a flexible peptide linker comprising the amino acid sequence (GGGGS (vii) a light chain variable domain of the second immunoglobulin; (viii) a flexible peptide linker sequence comprising the amino acid sequence TPLGDTTHT; and (ix) a self-assembly
  • the present disclosure provides a multi-specific antigen binding fragment comprising a first polypeptide chain, wherein: the first polypeptide chain comprises in the N-terminal to C-terminal direction: (i) a light chain variable domain of a first immunoglobulin that is capable of specifically binding to a first epitope; (ii) a flexible peptide linker comprising the amino acid sequence (GGGGS (iii) a heavy chain variable domain of the first immunoglobulin; (iv) a flexible peptide linker comprising the amino acid sequence (GGGGS (v) a heavy chain variable domain of a second immunoglobulin that is capable of specifically binding to a second epitope; (vi) a flexible peptide linker comprising the amino acid sequence (GGGGS (vii) a light chain variable domain of the second immunoglobulin; (viii) a flexible peptide linker sequence comprising the amino acid sequence TPLGDTTHT; and (ix) a self-assembly
  • the SADA polypeptide comprises a tetramerization, pentamerization, or hexamerization domain.
  • the SADA polypeptide comprises a tetramerization domain of any one of p53, p63, p73, hnRNPC, SNA-23, Stefin B, KCNQ4, and CBFA2T1.
  • the present disclosure provides a multi-specific antibody comprising a first polypeptide chain, a second polypeptide chain, a third polypeptide chain and a fourth polypeptide chain, wherein the first and second polypeptide chains are covalently bonded to one another, the second and third polypeptide chains are covalently bonded to one another, and the third and fourth polypeptide chain are covalently bonded to one another, and wherein: (a) each of the first polypeptide chain and the fourth polypeptide chain comprises in the N-terminal to C-terminal direction: (i) a light chain variable domain of a first immunoglobulin that is capable of specifically binding to a first epitope; (ii) a light chain constant domain of the first immunoglobulin; (iii) a flexible peptide linker comprising the amino acid sequence (GGGGS)3; and (iv) a light chain variable domain of a second immunoglobulin that is linked to a complementary heavy chain variable domain of the second immunoglob
  • the present disclosure provides a recombinant nucleic acid sequence encoding any of the antibodies or antigen binding fragments described herein.
  • the recombinant nucleic acid sequence is selected from the group consisting of: SEQ ID NOs: 22, 24, 93, 95, 97, 99, 101, 103, 105, 107, 109, 111, 113, 115, 117, 123, 125, 127, 129, 131, 133, 138, and 140.
  • the present disclosure provides a host cell or vector comprising any of the recombinant nucleic acid sequences disclosed herein.
  • the present disclosure provides a composition comprising an antibody or antigen binding fragment of the present technology and a pharmaceutically- acceptable carrier, wherein the antibody or antigen binding fragment is optionally conjugated to an agent selected from the group consisting of isotopes, dyes, chromagens, contrast agents, drugs, toxins, cytokines, enzymes, enzyme inhibitors, hormones, hormone antagonists, growth factors, radionuclides, metals, liposomes, nanoparticles, RNA, DNA or any combination thereof.
  • the multi-specific antibody or antigen binding fragment of the present technology binds to T cells, B-cells, myeloid cells, plasma cells, or mast-cells. Additionally or alternatively, in some embodiments, the multi-specific antibody or antigen binding fragment binds to CD3, GPA33, HER2/neu,
  • CD 138 EGFR, EGP-1, EGP-2, VEGF, P1GF, insulin-like growth factor (ILGF), tenascin, platelet-derived growth factor, IL-6, CD20, CD 19, PSMA, CD33, CD 123, MET, DLL4, Ang-2, HER3, IGF-1R, CD30, TAG-72, SPEAP, CD45, Ll-CAM, Lewis Y (Le y ) antigen, E-cadherin, V-cadherin, GPC3, EpCAM, CD4, CD8, CD21, CD23, CD46, CD80, HLA- DR, CD74, CD22, CD14, CD15, CD16, CD123, TCR gamma/delta, NKp46, KIR, CD56, DLL3, PD-1, PD-L1, CD28, CD 137, CD99, GloboH, CD24, STEAPl, B7H3, Poly sialic Acid, 0X40, OX40-ligand,
  • the small molecule DOTA hapten may be selected from the group consisting of DOTA, DOTA-Bn, DOTA-desferrioxamine, DOTA- Phe-Lys(HSG)-D-Tyr-Lys(HSG)-NH2, Ac-Lys(HSG)D-Tyr-Lys(HSG)-Lys(Tscg-Cys)- NH 2 , DOTA-D-Asp-D-Lys(HSG)-D-Asp-D-Lys(HSG)-NH2; DOTA-D-Glu-D-Lys(HSG)- D-Glu-D-Lys(HSG)-NH 2 , DOTA-D-Tyr-D-Lys(HSG)-D-Glu-D-Lys(HSG)-NH2, DOTA- D-Ala-D-Lys(HSG)-D-Glu-D-Lys(HSG)-NH2, DOTA-
  • the present disclosure provides a method for treating a CD3- associated autoimmune disease in a subject in need thereof, comprising administering to the subject an effective amount of an antibody comprising a HC amino acid sequence and a LC amino acid sequence selected from the group consisting of SEQ ID NO: 23 and SEQ ID NO: 21, SEQ ID NO: 23 and SEQ ID NO: 92, SEQ ID NO: 96 and SEQ ID NO: 94, SEQ ID NO: 100 and SEQ ID NO: 98, SEQ ID NO: 104 and SEQ ID NO: 102, SEQ ID NO: 108 and SEQ ID NO: 106, SEQ ID NO: 112 and SEQ ID NO: 110, and SEQ ID NO: 116 and SEQ ID NO: 114, respectively, wherein the antibody specifically binds to CD3.
  • an antibody comprising a HC amino acid sequence and a LC amino acid sequence selected from the group consisting of SEQ ID NO: 23 and SEQ ID NO: 21, SEQ ID NO: 23 and SEQ ID NO: 92
  • CD 3 -associated autoimmune disease examples include, but are not limited to, multiple sclerosis (MS), rheumatoid arthritis (RA), systemic lupus erythematosus, Celiac disease, Sympathetic ophthalmia, Type 1 diabetes, and graft-versus-host disease.
  • MS multiple sclerosis
  • RA rheumatoid arthritis
  • Celiac disease Celiac disease
  • Sympathetic ophthalmia Type 1 diabetes
  • graft-versus-host disease examples include, but are not limited to, multiple sclerosis (MS), rheumatoid arthritis (RA), systemic lupus erythematosus, Celiac disease, Sympathetic ophthalmia, Type 1 diabetes, and graft-versus-host disease.
  • the present disclosure provides a method for treating cancer in a subject in need thereof, comprising administering to the subject an effective amount of an antibody comprising a HC amino acid sequence and a LC amino acid sequence selected from the group consisting of SEQ ID NO: 23 and SEQ ID NO: 21, SEQ ID NO: 23 and SEQ ID NO: 92, SEQ ID NO: 96 and SEQ ID NO: 94, SEQ ID NO: 100 and SEQ ID NO: 98, SEQ ID NO: 104 and SEQ ID NO: 102, SEQ ID NO: 108 and SEQ ID NO: 106, SEQ ID NO: 112 and SEQ ID NO: 110, and SEQ ID NO: 116 and SEQ ID NO:
  • cancer examples include, but are not limited to, precursor T acute lymphoblastic leukemia/lymphoma, anaplastic large-cell lymphoma, lymphomatoid papulosis type A, Mycosis fungoides, pagetoid reticulosis, granulomatous slack skin, Sezary disease, adult T-cell leukemia/lymphoma, cutaneous large T cell lymphoma, pleomorphic T-cell lymphoma, lymphomatoid papulosis type B, secondary cutaneous CD30+ large-cell lymphoma, hepatosplenic T-cell lymphoma, angioimmunoblastic T-cell lymphoma, enteropathy- associated T-cell lymphoma, peripheral T-cell lymphoma not otherwise specified, subcutaneous T-cell lymphoma, large granular lymphocytic leukemia, and acute biphenotypic leukemia.
  • precursor T acute lymphoblastic leukemia/lymphoma ana
  • cancers include, but are not limited to, adrenal cancers, bladder cancers, blood cancers, bone cancers, brain cancers, breast cancers, carcinoma, cervical cancers, colon cancers, colorectal cancers, corpus uterine cancers, ear, nose and throat (ENT) cancers, endometrial cancers, esophageal cancers, gastrointestinal cancers, head and neck cancers, Hodgkin's disease, intestinal cancers, kidney cancers, larynx cancers, acute and chronic leukemias, liver cancers, lymph node cancers, lymphomas, lung cancers, melanomas, mesothelioma, myelomas, nasopharynx cancers, neuroblastomas, non-Hodgkin's lymphoma, oral cancers, ovarian cancers, pancreatic cancers, penile cancers, pharynx cancers, prostate cancers, rectal cancers, sarcoma, seminomas, skin cancers, stomach cancers,
  • the antibody or antigen binding fragment is administered to the subject separately, sequentially or simultaneously with an additional therapeutic agent.
  • additional therapeutic agents include one or more of alkylating agents, platinum agents, taxanes, vinca agents, anti-estrogen drugs, aromatase inhibitors, ovarian suppression agents, VEGF/VEGFR inhibitors, EGF/EGFR inhibitors, PARP inhibitors, cytostatic alkaloids, cytotoxic antibiotics, antimetabolites, endocrine/hormonal agents, bisphosphonate therapy agents.
  • additional therapeutic agents include non-steroidal anti-inflammatory drugs (NSAIDs), selective COX-2 inhibitors, glucocorticoids, and conventional disease modifying anti-rheumatic drugs (cDMARDs).
  • the present disclosure provides a method for detecting tumors in a subject in need thereof comprising (a) administering to the subject an effective amount of a complex comprising a radiolabeled DOTA hapten and a multi-specific antibody or antigen binding fragment of the present technology that binds to the radiolabeled DOTA hapten, a tumor antigen, and a CD3 antigen, wherein the complex is configured to localize to a tumor expressing the tumor antigen recognized by the multi-specific antibody or antigen binding fragment of the complex; and (b) detecting the presence of tumors in the subject by detecting radioactive levels emitted by the complex that are higher than a reference value.
  • the subject is human.
  • the present disclosure provides a method for detecting cancer in a subject in vivo comprising (a) administering to the subject an effective amount of an antibody or antigen binding fragment of the present technology, wherein the antibody or antigen binding fragment is configured to localize to a cancer cell expressing CD3, and is labeled with a radioisotope; and (b) detecting the presence of a tumor in the subject by detecting radioactive levels emitted by the antibody or antigen binding fragment that are higher than a reference value.
  • the subject is diagnosed with or is suspected of having cancer. Radioactive levels emitted by the antibody or antigen binding fragment may be detected using positron emission tomography or single photon emission computed tomography.
  • the method further comprises administering to the subject an effective amount of an immunoconjugate comprising an antibody or antigen binding fragment of the present technology conjugated to a radionuclide.
  • the radionuclide is an alpha particle-emitting isotope, a beta particle-emitting isotope, an Auger-emitter, or any combination thereof.
  • beta particle-emitting isotopes include 86 Y, 90 Y, 89 Sr, 165 Dy, 186 Re, 188 Re, 177 Lu, and 67 Cu.
  • nonspecific FcR-dependent binding in normal tissues is eliminated or reduced ( e.g ., via N297A mutation in Fc region, which results in aglycosylation).
  • kits for the detection and/or treatment of CD3- associated pathologies comprising at least one immunoglobulin-related composition of the present technology (e.g., any antibody or antigen binding fragment described herein), or a functional variant (e.g., substitutional variant) thereof and instructions for use.
  • the immunoglobulin-related composition is coupled to one or more detectable labels.
  • the one or more detectable labels comprise a radioactive label, a fluorescent label, or a chromogenic label.
  • the kit further comprises a secondary antibody that specifically binds to an anti-CD3 immunoglobulin-related composition described herein.
  • the secondary antibody is coupled to at least one detectable label selected from the group consisting of a radioactive label, a fluorescent label, or a chromogenic label.
  • the present disclosure provides a method for selecting a subject for pretargeted radioimmunotherapy comprising (a) administering to the subject an effective amount of a complex comprising a radiolabeled DOTA hapten and a multi-specific antibody or antigen binding fragment of the present technology that binds to the radiolabeled DOTA hapten, a tumor antigen, and a CD3 antigen, wherein the complex is configured to localize to a tumor expressing the tumor antigen recognized by the multi-specific antibody or antigen binding fragment of the complex; (b) detecting radioactive levels emitted by the complex; and (c) selecting the subject for pretargeted radioimmunotherapy when the radioactive levels emitted by the complex are higher than a reference value.
  • the subject is human.
  • the present disclosure provides a method for increasing tumor sensitivity to radiation therapy in a subject diagnosed with cancer comprising administering to the subject an effective amount of a complex comprising a radiolabeled-DOTA hapten and a multi-specific antibody or antigen binding fragment of the present technology that recognizes and binds to the radiolabeled-DOTA hapten, a CD3 antigen and a tumor antigen, wherein the complex is configured to localize to a tumor expressing the tumor antigen recognized by the multi-specific antibody or antigen binding fragment of the complex.
  • the present disclosure provides a method for treating cancer in a subject in need thereof comprising administering to the subject an effective amount of a complex comprising a radiolabeled-DOTA hapten and a multi-specific antibody or antigen binding fragment of the present technology that recognizes and binds to the radiolabeled- DOTA hapten, a CD3 antigen and a tumor antigen, wherein the complex is configured to localize to a tumor expressing the tumor antigen recognized by the multi-specific antibody or antigen binding fragment of the complex.
  • the complex is administered intravenously, intramuscularly, intraarterially, intrathecally, intracapsularly, intraorbitally, intradermally, intraperitoneally, transtracheally, subcutaneously, intracerebroventricularly, orally, intratumorally, or intranasally.
  • the subject is human.
  • the radiolabeled-DOTA hapten comprises 213 Bi, 211 At, 225 Ac, 152 Dy, 212 Bi, 223 Ra, 219 Rn, 215 Po, 211 Bi, 221 Fr, 217 At, 255 Fm, 86 Y,
  • Also disclosed herein is a method for selecting a subject for pretargeted radioimmunotherapy comprising (a) administering to the subject an effective amount of the multi-specific antibody or antigen binding fragment of the present technology that binds to a radiolabeled DOTA hapten, a tumor antigen, and a CD3 antigen, wherein the multi specific antibody is configured to localize to a tumor expressing the tumor antigen recognized by the multi-specific antibody or antigen binding fragment; (b) administering an effective amount of a radiolabeled-DOTA hapten to the subject, wherein the radiolabeled- DOTA hapten is configured to bind to the multi-specific antibody or antigen binding fragment; (c) detecting radioactive levels emitted by the multi-specific antibody; and (d) selecting the subject for pretargeted radioimmunotherapy when the radioactive levels emitted by the multi-specific antibody are higher than a reference value.
  • the present disclosure provides a method for increasing tumor sensitivity to radiation therapy in a subject diagnosed with cancer comprising (a) administering to the subject an effective amount of the multi-specific antibody or antigen binding fragment of the present technology that binds to a radiolabeled DOTA hapten, a tumor antigen, and a CD3 antigen, wherein the multi-specific antibody is configured to localize to a tumor expressing the tumor antigen recognized by the multi-specific antibody or antigen binding fragment; and (b) administering an effective amount of a radiolabeled-DOTA hapten to the subject, wherein the radiolabeled-DOTA hapten is configured to bind to the multi-specific antibody or antigen binding fragment.
  • the present disclosure provides a method for treating cancer in a subject in need thereof comprising (a) administering to the subject an effective amount of the multi-specific antibody or antigen binding fragment of the present technology that binds to a radiolabeled DOTA hapten, a tumor antigen, and a CD3 antigen, wherein the multi-specific antibody is configured to localize to a tumor expressing the tumor antigen recognized by the multi-specific antibody or antigen binding fragment; and (b) administering an effective amount of a radiolabeled-DOTA hapten to the subject, wherein the radiolabeled-DOTA hapten is configured to bind to the multi-specific antibody or antigen binding fragment.
  • the methods of the present technology further comprise administering an effective amount of a clearing agent to the subject prior to administration of the radiolabeled-DOTA hapten.
  • the radiolabeled-DOTA hapten comprises 213 Bi, 211 At, 225 Ac, 152 Dy, 212 Bi, 223 Ra, 219 Rn, 215 Po, 211 Bi, 221 Fr, 217 At, 255 Fm, 86 Y, 90 Y, 89 Sr, 165 Dy, 186 Re, 188 Re, 177 Lu, 67 Cu, m In, 67 Ga, 51 Cr, 58 Co, 99m Tc, 103m Rh, 195m Pt, 119 Sb, 161 Ho, 189m Os, 192 Ir, 201 T1, 203 Pb, 68 Ga, 227 Th, or 64 Cu, and optionally comprises an alpha particle-emitting isotope, a beta particle- emitting isotope, or an Auger-emitter.
  • the subject is human.
  • the multi-specific antibody or antigen binding fragment binds to CD3, GPA33, HER2/neu, GD2, MAGE-1, MAGE-3, BAGE, GAGE-1, GAGE-2, MUM-1, CDK4, N-acetylglucosaminyltransf erase, pl5, gp75, beta-catenin, ErbB2, cancer antigen 125 (CA-125), carcinoembryonic antigen (CEA), RAGE, MART (melanoma antigen), MUC-1, MUC-2, MUC-3, MUC-4, MUC-5ac, MUC-16, MUC-17, tyrosinase, Pmel 17 (gplOO), GnT-V intron V sequence (N- acetylglucoaminyltransferase V intron V sequence), Prostate cancer psm, PRAME (melanoma antigen), b-catenin, EBNA (Epstein-
  • EBNA 1-6 PRAME, MART, tyronsinase, MAGEA1-A6, pmel 17, LMP2, or WT1).
  • Figure 1A shows a schematic of the modular tetravalent IgG-scFv format comprising an IgG molecule with two binding sites covalently linked to two scFvs providing two additional binding domains.
  • Figure IB shows an exemplary analysis of biochemical purity of the BC276 (hOKT3 L2H2) BsAb of the present disclosure.
  • the top panel shows a size-exclusion chromatography-high-performance liquid chromatography (SEC-HPLC) profile. Protein in the eluent was detected based on the absorbance of ultraviolet light having a wavelength of 280 nm. The relative amount of protein in the SEC-HPLC peaks from the chromatogram is displayed in the bottom panel.
  • SEC-HPLC size-exclusion chromatography-high-performance liquid chromatography
  • Figure 2 shows the stability of the humanized OKT3 IgG antibody BC276 (hOKT3 L2H2) at 40 °C.
  • the antibody was incubated at 40 °C, and aliquots of the same were withdrawn at specified times to assess purity using HPLC.
  • a line graph which plots the stability values as a function of incubation time at 40 °C is shown.
  • FIGS 3A-3B show that BC276 induces potent T cell fratricide in vitro.
  • T cells were cultured with 350pM BC276 in the presence of interleukin-2 to support T cell proliferation.
  • a CD19 x CD3-specific IgG-L-scFv BsAb, and the humanized OKT3 IgG were used as controls.
  • Figure 3A shows the number of CD4 T cell populations at several indicated time points.
  • Figure 3B shows the number of CD8 T cell populations at several indicated time points.
  • FIGs 4A-4B show that the BC276 BsAb induces profound T cell depletion in mice.
  • NSG mice were injected with 30 million PBMCs (a mix of PBMCs from 3 different donors, 10 million cells from each donor) intraperitoneally. Treatment with injections of 1 pg of BC276 BsAb was initiated on day 8. Control mice were injected with no antibody (No Ab) or with an anti-CD3 x GD2-BsAb (BC119), which were used as negative controls.
  • Figure 4A shows the flow cytometry profiles of peripheral blood stained with an anti human CD45 antibody at indicated time points.
  • Figure 4B (left panels) displays line graphs showing quantitation of CD45+ cells per ml of peripheral blood at the indicated time points.
  • Figure 4B (right panels) display graphs showing quantitation of CD45+ cells per ml of peripheral blood on either day 15 (top panel) and day 22 (bottom panel).
  • Figures 5A-5B show the dosage effects of BC276 BsAb on T cell depletion in mice.
  • NSG mice were injected with 30 million PBMCs (a mix of PBMCs from 3 different donors, 10 million cells from each donor) intraperitoneally.
  • Treatment with injections of 1 pg or 0.1 pg of BC276 BsAb or an anti-CD3 x GD2-BsAb (BC119, the negative control) was initiated on day 8.
  • Figure 5A shows the flow cytometry profiles of peripheral blood stained with an anti-human CD45 antibody on day 15.
  • Figure 5B shows graphs showing quantitation of CD45+ cells per ml of peripheral blood on day 15.
  • Figures 6A-6C demonstrate that both CD4 and CD8 T cells were depleted in vivo upon treatment with BC276 BsAb.
  • NSG mice were injected with 30 million PBMCs (a mix of PBMCs from 3 different donors, 10 million cells from each donor) intraperitoneally.
  • Treatment with injections of 1 pg or 0.1 pg of BC276 BsAb or an anti-CD3 x GD2-BsAb (BC119, the negative control) was initiated on day 8.
  • Figure 6A shows the quantitation of CD45+ cells per ml of peripheral blood at the indicated time points.
  • Figure 6B shows the quantitation of CD4+ cells per ml of peripheral blood at the indicated time points.
  • Figure 6C shows the quantitation of CD8+ cells per ml of peripheral blood at the indicated time points.
  • CD3BC refers to the BC276 BsAb.
  • FIG. 7 demonstrates that depletion of T cells is not associated with clinical side effects.
  • NSG mice were injected with 30 million PBMCs (a mix of PBMCs from 3 different donors 10 million from each donor) intraperitoneally.
  • Treatment with injections of 1 gg or 0.1 gg of BC276 or an anti-CD3-, and GD2-BsAb (BC119, the negative control) was started on day 8.
  • Figures 8A-8B show development of graft-versus-host-disease (GVHD) in BC276-treated mice. NSG mice from the experiments described in Figures 6A-7 were used in the experiment. Antibody injections were discontinued, and a second dose of effector cells (22 million activated T cells per mouse) was injected to the mice. Then antibody injections were resumed as shown.
  • Figure 8A shows the line graph showing quantitation of CD4+ cells per ml of peripheral blood at the indicated time points.
  • Figure 8B shows the line graph showing quantitation of CD8+ cells per ml of peripheral blood at the indicated time points.
  • Figure 9 shows the graph of GVHD scores in the mice treated with the indicated doses of BC276 or an anti-CD3-, and GD2-BsAb (BC119, the negative control) antibodies compared to mice receiving no antibody.
  • the mice from the experiments described in Figures 8A-8B were randomized in 5 groups and the following treatments were carried out: (1) 30 gg BC276, (2) 10 gg BC276, (3) 3 gg BC276, (4) 10 gg BC119 (CD3xGD2 BsAb), and 5) no antibody (No Ab).
  • GVHD scores were measured at indicated time points and plotted.
  • Figure 10 shows a line graph showing body weights of animals treated with the indicated doses of BC276 or an anti-CD3-, and GD2-BsAb (BC119, the negative control) antibodies compared to mice receiving no antibody. Mice from the experiment described in Figure 9 were weighed at the indicated time points and their weights were plotted.
  • Figure 11 shows a line graph showing body weights of animals treated with the indicated doses of BC276 or an anti-CD3-, and GD2-BsAb (BC119, the negative control) antibodies compared to mice receiving no antibody. Mice from the experiment described in Figure 10 were weighed at the indicated time points and their weights were plotted.
  • Figure 12A shows the amino acid sequences of the murine and humanized OKT3 heavy chain variable domains (SEQ ID NOs: 1, 5, 7-10, and 43-61 respectively).
  • OKT3 VH (SEQ ID NO: 1) is the murine OKT3 heavy chain variable domain sequence.
  • OKT3 VH-1, OKT3 VH-2, OKT3 VH-3, OKT3 VH-4, VH-1 H105, VH-2 H105, VH-3 HI 05, VH-4 HI 05, VH-1 H44, VH-2 H44, VH-3 H44, VH-4 H44, VH-1 H100B, VH-2 H100B, VH-3 H100B, VH-4 H100B, VH-1 HI 00, VH-2 HI 00, VH-3 HI 00, VH-4 HI 00, VH-1 H101, VH-2 H101, VH-3 H101, and VH-4 H101 are variants of the humanized 0KT3 heavy chain variable domain.
  • the VH CDRl sequence is GYTFTRYT (SEQ ID NO: 2), the VH CDR2 sequence is INPSRGYT (SEQ ID NO: 3), the VH CDR3 sequences are ARYYDDHY CLD Y (SEQ ID NO: 4), ARY YDDHY SLD Y (SEQ ID NO: 6), ARYYDDHYSCDY (SEQ ID NO: 134), ARYYDDHCSLDY (SEQ ID NO: 135), or ARYYDDHY SLC Y (SEQ ID NO: 136).
  • the VH CDR 1-3 sequences are underlined.
  • the CDR sequences of the VH of humanized anti-CD3 antibody are determined using the IMGT definition.
  • Figure 12B shows the amino acid sequences of the murine and humanized OKT3 light chain variable domains (SEQ ID NOs: 11, 15-20 and 62-91 respectively).
  • OKT3 VL (SEQ ID NO: 11) is the murine OKT3 light chain variable domain sequence.
  • the VL CDRl sequence is SSVSY (SEQ ID NO: 12), the VL CDR2 sequence is DT (SEQ ID NO: 13), and the VL CDR3 sequence is QQWSSNPFT (SEQ ID NO: 14).
  • the VL CDR 1-3 sequences are underlined.
  • the CDR sequences of the VL of humanized anti-CD3 antibody are determined using the IMGT definition.
  • Figure 13A shows the amino acid and nucleotide sequences of the light chain (SEQ ID NOs: 21-22) of the humanized OKT3 x CD3 BsAb, BC276 (hOKT3 H2L2DS).
  • Figure 13B shows the amino acid and nucleotide sequences of the heavy chain (SEQ ID NOs: 23-24) of the humanized OKT3 x CD3 BsAbs, BC276 (hOKT3 H2L2DS) or BC276.1 (hOKT3 H2L2) respectively.
  • Figure 13C shows the amino acid and nucleotide sequences of the light chain (SEQ ID NOs: 92-93) of the humanized OKT3 x CD3 BsAb, BC276.1 (hOKT3 H2L2).
  • the signal peptide is underlined, the variable domains of the humanized anti-CD3 BsAb are indicated in italicized font, and linker sequences are shown in italicized, underlined boldface font.
  • Figure 14A shows the amino acid and nucleotide sequences of the light chain (SEQ ID NOs: 94-95) of the humanized anti-GD2/anti CD3 h3F8 x hOKT3 BsAb.
  • Figure 14B shows the amino acid and nucleotide sequences of the heavy chain (SEQ ID NOs: 96- 97) of the humanized h3F8 x hOKT3 BsAb.
  • the signal peptide is underlined, the variable domains of the h3F8 x hOKT3 BsAb are indicated in italicized font, and linker sequences are shown in underlined boldface font.
  • Figure 15A shows the amino acid and nucleotide sequences of the light chain (SEQ ID NOs: 98-99) of the humanized anti-CD33/anti CD3 hM195 x hOKT3 BsAb.
  • Figure 15B shows the amino acid and nucleotide sequences of the heavy chain (SEQ ID NOs: 100-101) of the humanized hM195 x hOKT3 BsAb.
  • the signal peptide is underlined, the variable domains of the hM195 x hOKT3 BsAb are indicated in italicized font, and linker sequences are shown in underlined boldface font.
  • Figure 16A shows the amino acid and nucleotide sequences of the light chain (SEQ ID NOs: 102-103) of the humanized anti-glypican-3/anti CD3 hGPC3 x hOKT3 BsAb.
  • Figure 16B shows the amino acid and nucleotide sequences of the heavy chain (SEQ ID NOs: 104-105) of the humanized hGPC3 x hOKT3 BsAb.
  • the signal peptide is underlined, the variable domains of the hGPC3 x hOKT3 BsAb are indicated in italicized font, and linker sequences are shown in underlined boldface font.
  • Figure 17A shows the amino acid and nucleotide sequences of the light chain (SEQ ID NOs: 106-107) of the humanized anti-CD 19/anti CD3 hFMC63 x hOKT3 BsAb.
  • Figure 17B shows the amino acid and nucleotide sequences of the heavy chain (SEQ ID NOs: 108-109) of the humanized hFMC63 x hOKT3 BsAb.
  • the signal peptide is underlined, the variable domains of the hFMC63 x hOKT3 BsAb are indicated in italicized font, and linker sequences are shown in underlined boldface font.
  • Figure 18A shows the amino acid and nucleotide sequences of the light chain (SEQ ID NOs: 110-111) of the humanized hSTEAPl x hOKT3 BsAb.
  • Figure 18B shows the amino acid and nucleotide sequences of the heavy chain (SEQ ID NOs: 112-113) of the humanized hSTEAPl x hOKT3 BsAb.
  • the signal peptide is underlined, the variable domains of the hSTEAPl x hOKT3 BsAb are indicated in italicized font, and linker sequences are shown in underlined boldface font.
  • Figure 19A shows the amino acid and nucleotide sequences of the light chain (SEQ ID NOs: 114-115) of the humanized anti-CD33/anti CD3 hHIM34 x hOKT3 BsAb.
  • Figure 19B shows the amino acid and nucleotide sequences of the heavy chain (SEQ ID NOs: 116-117) of the humanized hHIM34 x hOKT3 BsAb.
  • the signal peptide is underlined, the variable domains of the hHIM34 x hOKT3 BsAb are indicated in italicized font, and linker sequences are shown in underlined boldface font.
  • Figures 20A-20D show the amino acid sequences of humanized 3F8 x OKT3 BsAb, humanized STEAPl x OKT3 BsAb, humanized HER2 x OKT3 BsAb, and humanized FMC63 x OKT3 BsAb in the single-chain bispecific tandem fragment variable (scBsTaFv) format (SEQ ID NO: 118-121), respectively.
  • the signal peptide is underlined, the variable domains of the scBsTaFvs are italicized, linker sequences are indicated in boldface font, p53 tetramerization domains are italicized and underlined, and histidine 6 tags are indicated in bold and underlined font.
  • Figure 21A shows the amino acid and nucleotide sequences of the light chain (SEQ ID NOs: 122-123) of the humanized h3F8 x hC825 Ab.
  • Figure 21B shows the amino acid and nucleotide sequences of the light chain (SEQ ID NOs: 124-125) of the humanized h3F8 x hOKT3 Ab.
  • Figure 21C shows the amino acid and nucleotide sequences of the heavy chain K (SEQ ID NOs: 126-127) of the humanized h3F8 Ab.
  • Figure 21D shows the amino acid and nucleotide sequences of the heavy chain F (SEQ ID NOs: 137-138) of the humanized h3F8 Ab.
  • the signal peptide is underlined, the variable domains of the heavy and light chains are indicated in italicized font, and linker sequences are shown in underlined boldface font.
  • Figure 22A shows the amino acid and nucleotide sequences of the light chain (SEQ ID NOs: 128-129) of the humanized hSTEAPl x hC825 Ab.
  • Figure 22B shows the amino acid and nucleotide sequences of the light chain (SEQ ID NOs: 130-131) of the humanized hSTEAPl x hOKT3 Ab.
  • Figure 22C shows the amino acid and nucleotide sequences of the heavy chain K (SEQ ID NOs: 132-133) of the humanized hSTEAPl Ab.
  • Figure 22D shows the amino acid and nucleotide sequences of the heavy chain F (SEQ ID NOs: 139-140) of the humanized hSTEAPl Ab.
  • the signal peptide is underlined, the variable domains of the heavy and light chains are indicated in italicized font, and linker sequences are shown in underlined boldface font.
  • Figure 23A shows the potency of an anti-GD2 anti-CD3 bispecific antibody (comprising SEQ ID NO: 94 and SEQ ID NO: 96) against a GD2-expressing neuroblastoma cell line (IMR32).
  • Figure 23B shows the potency of an anti-GPC3 anti-CD3 bispecific antibody (comprising SEQ ID NO: 102 and SEQ ID NO: 104) against a GPC3 -expressing liver cancer cell line (HEPG2).
  • Figure 24A shows that the CEM-NKR T cell line, which lacks CD3 expression, was not responsive to treatment with the BC276 BsAb.
  • Figure 24B shows that HUT78 T cells, which express high levels of CD3, were killed in an antibody dependent T cell mediated cytotoxicity (ADTC) assay when treated with the BC276 BsAb, while the control antibody HER2-BsAb directed at HER2 showed no cytotoxicity.
  • Figure 24C shows that JURKAT T cells, which express high levels of CD3, were killed in an antibody dependent T cell mediated cytotoxicity (ADTC) assay when treated with the BC276 BsAb, while the control antibody HER2-BsAb directed at HER2 showed no cytotoxicity.
  • ADTC antibody dependent T cell mediated cytotoxicity
  • FIG 24D shows that 8402 T cells, which express high levels of CD3, were killed in an antibody dependent T cell mediated cytotoxicity (ADTC) assay when treated with the BC276 BsAb, while the control antibody HER2-BsAb directed at HER2 showed no cytotoxicity.
  • Figure 24E shows that the MOLT4 T cell line, which lacks CD3 expression, was not responsive to treatment with the BC276 BsAb.
  • ADTC antibody dependent T cell mediated cytotoxicity
  • Figure 25 demonstrates that signs of distress, such as reduced activity, hunched posture, or ruffled fur, were not observed in animals treated with BC276 BsAb.
  • NSG mice were injected intraperitoneally with 30 million PBMCs (a mix of PBMCs from 3 different donors, 10 million cells from each donor) on day 0. The mice were treated with vehicle only control (no antibody), or with 1 pg or 0.1 pg BC276 BsAb, or 1 pg or 0.1 pg BC119 BsAb starting on day 8. The mice were evaluated for clinical signs of distress (i.e., reduced activity, hunched posture, or ruffled fur).
  • FIG. 26 shows 5 GPC3 c CD3 bispecific antibodies (BsAbs) that share the same Fab which binds to Glypican-3 antigen. Each bispecific antibody expresses distinct anti-CD3 scfv attached to the constant light chain. Doted circles indicate the anti-CD3 scFv. BsAb 1-5 express anti-CD3 scFv clone huOKT3, CD3 H2L2, CD3 H2L5,
  • CD3 H4L2 and CD3 H4L5 respectively.
  • Figure 27 shows the amino acid sequences of the anti-CD3 scFv region for each of the 5 GPC3 c CD3 bispecific antibodies (BsAbs) (SEQ ID NOs: 141-145) shown in
  • Figure 28 shows the distinct binding affinities of the 5 GPC3 x CD3 BsAbs described in Figure 26 to ex vivo expanded human T cells using Flow-cytometry.
  • Human T cells activated by anti-CD3/CD28 beads for 21 days were harvested and incubated with BsAb (1 x 10 6 T cells for each sample) followed by secondary goat-anti human IgG PE.
  • Baseline value (geometric MFI, gMFI) was obtained from T cells incubated with only goat- anti human IgG PE without BsAb. Normalized gMFI values were calculated by deducting gMFI of each sample from baseline value.
  • BsAb #3 shows the highest binding affinity to human T cells followed by BsAb #1, #2, #5 and #4.
  • Figure 29 shows that the binding affinities of the exemplified BsAbs to human recombinant CD35/e are not drastically different as demonstrated using SPR.
  • Binding affinity of BsAb to human CD3 antigen as indicated by the KD value shows that BsAb #1, #2, #3 and #5 bind with similar affinities and BsAb #4 showed 1 log lower binding affinity.
  • FIGS 30-31 show that the exemplified BsAbs differentially induce surface expression of T cell activation marker CD69 and CD25, respectively.
  • Human T cells activated by anti-CD3/CD28 beads for 21 days were harvested and cocultured with HepG2 cells in a 10:1 ratio (100,000 T cells and 10,000 HepG2) for 3 days at 37°C. After 3 days, cells were harvested and stained for hCD3, hCD4, hCD8, hCD69 and hCD25. Cells were pre-stained with fixable live-dead dye (NIR) prior cell surface staining. Singlet, NIR- and hCD3+ cells were pre-gated and analyzed for CD8 T cells expression for hCD69 or hCD25.
  • NIR fixable live-dead dye
  • BsAb #1, #2, #3 and #5 induced a similar proportion of CD69+ T cells, while BsAb #4 weakly activated CD8 T cell expression of CD69.
  • BsAb #4 weakly activated CD8 T cell expression of CD69.
  • a similar trend was observed for CD25 expression on CD8 T cells whereby BsAb #4 weakly induced CD25 expression compared to BsAb #1, #2, #3 and #5.
  • FIGs 32A-32B show that the exemplified BsAbs induce robust T cell proliferation.
  • Human T cells activated by anti-CD3/CD28 beads for 14 days were harvested and labelled with CellTraceTM Violet Cell Proliferation Kit (InvitrogenTM). T cells were cocultured with HepG2 cells in 10:1 ratio (100,000 T cells and 10,000 HepG2). After 96 hours, cells were harvested and stained for hCD3, hCD4, hCD8. Cells were pre-stained with fixable live-dead dye (NIR) prior cell surface staining.
  • Figure 32A top.
  • BsAb #1, #2, #3 and #5 drove robust CD8 T cell proliferation and more than 70% of CD8 T cells underwent active division with as little as 6.4ng/ml BsAb concentration.
  • BsAb #4 not only weakly induced CD8 T cell activation, there was very little dividing CD8 T cells (15%) at 6.4ng/ml BsAb concentration.
  • Figure 32A bottom Increasing concentration of BsAb in the T and HepG2 coculture assay did not lead to reduced CD8 T cell viability. Similar CD8 T cell viability (10-20%) was observed among all BsAbs.
  • Figure 32B The results suggest that the production of BsAbs.
  • CD8 T cells Singlet, NIR- and hCD3+ cells were pre-gated and analyzed for the intensity of CellTrace violet (Excitation/Emission 405/450) on the CD8 T cells.
  • Undivided CD8 T cells harbor highest intensity of CellTrace dye, whereas each cell division leads to dilution and lower intensity of the dye.
  • FIG 33 shows BsAb-engaged T-cell mediated killing of HepG2 hepatocellular carcinoma cell line.
  • Human T cells activated by anti-CD3/CD28 beads for 14 days were harvested and cocultured with HepG2 cells in 10:1 ratio (50,000 T cells to 5,000 HepG2). Prior incubation with T cells, HepG2 cells were labelled with Cr 51 for 1 hour at 37C.
  • Human T cells and HepG2 cells coculture in the presence of respective BsAb were kept in incubator (37C, 5% C02) for 4 hours before spinning down at 800xg lOmins. Supernatants were transferred to microtubes and read in scintillation counter.
  • BsAb #3 and #1 show similar EC50 followed by #2 and #5.
  • BsAb 4 showed lowest EC50.
  • BsAb #6, where Fab is CD33 targeting was included as negative control (HepG2 is a CD33-negative cancer).
  • FIGS 34A-34B show human T cell engraftment in HepG2 xenograft mice.
  • Human T cells transduced by luciferase lentivirus, were expanded in the presence of anti- CD3/CD28 beads for 8 days.
  • Each HepG2 xenograft mouse was administered 2xl0 7 T-luc cells.
  • Bioluminescence of T-luc cells in the treated mice were acquired using IVIS instrument (Perkin Elmer) on day 1, 4, 7, and 10 after T-luc cells administration. Luciferin (0.3mg in lOOul PBS/mouse i.v) was injected 5 mins before imaging.
  • the present disclosure generally provides immunoglobulin-related compositions (e.g ., antibodies or antigen binding fragments thereof), which can specifically bind to CD3 polypeptides.
  • the immunoglobulin-related compositions of the present technology are useful in methods for detecting or treating CD3 -associated pathologies in a subject in need thereof. Accordingly, the various aspects of the present methods relate to the preparation, characterization, and manipulation of anti-CD3 antibodies.
  • the immunoglobulin-related compositions of the present technology are useful alone or in combination with additional therapeutic agents for treating cancer or autoimmune diseases.
  • the immunoglobulin-related composition is a monoclonal antibody, a humanized antibody, a chimeric antibody, a bispecific antibody, or a multi-specific antibody.
  • the term “about” in reference to a number is generally taken to include numbers that fall within a range of 1%, 5%, or 10% in either direction (greater than or less than) of the number unless otherwise stated or otherwise evident from the context (except where such number would be less than 0% or exceed 100% of a possible value).
  • the “administration” of an agent or drug to a subject includes any route of introducing or delivering to a subject a compound to perform its intended function. Administration can be carried out by any suitable route, including but not limited to, orally, intranasally, parenterally (intravenously, intramuscularly, intraperitoneally, or subcutaneously), rectally, intrathecally, intratumorally or topically. Administration includes self-administration and the administration by another.
  • an adjuvant refers to one or more substances that cause stimulation of the immune system.
  • an adjuvant is used to enhance an immune response to one or more vaccine antigens or antibodies.
  • An adjuvant may be administered to a subject before, in combination with, or after administration of the vaccine.
  • chemical compounds used as adjuvants include aluminum compounds, oils, block polymers, immune stimulating complexes, vitamins and minerals (e.g ., vitamin E, vitamin A, selenium, and vitamin B 12), Quil A (saponins), bacterial and fungal cell wall components (e.g., lipopolysaccarides, lipoproteins, and glycoproteins), hormones, cytokines, and co stimulatory factors.
  • antibody collectively refers to immunoglobulins or immunoglobulin-like molecules including by way of example and without limitation, IgA, IgD, IgE, IgG and IgM, combinations thereof, and similar molecules produced during an immune response in any vertebrate, for example, in mammals such as humans, goats, rabbits and mice, as well as non-mammalian species, such as shark immunoglobulins.
  • antibodies includes intact immunoglobulins and “antigen binding fragments” specifically bind to a molecule of interest (or a group of highly similar molecules of interest) to the substantial exclusion of binding to other molecules (for example, antibodies and antibody fragments that have a binding constant for the molecule of interest that is at least 10 3 M 1 greater, at least 10 4 M 1 greater or at least 10 5 M 1 greater than a binding constant for other molecules in a biological sample).
  • antibody also includes genetically engineered forms such as chimeric antibodies (for example, humanized murine antibodies), heteroconjugate antibodies (such as, bispecific antibodies). See also, Pierce Catalog and Handbook, 1994-1995 (Pierce Chemical Co., Rockford, Ill.); Kuby, J., Immunology , 3 rd Ed., W.H. Freeman & Co., New York, 1997.
  • antibody refers to a polypeptide ligand comprising at least a light chain immunoglobulin variable region or heavy chain immunoglobulin variable region which specifically recognizes and binds an epitope of an antigen.
  • Antibodies are composed of a heavy and a light chain, each of which has a variable region, termed the variable heavy (VH) region and the variable light (VL) region. Together, the VH region and the VL region are responsible for binding the antigen recognized by the antibody.
  • an immunoglobulin has heavy (H) chains and light (L) chains interconnected by disulfide bonds. There are two types of light chain, lambda (l) and kappa (K).
  • Each heavy and light chain contains a constant region and a variable region, (the regions are also known as “domains”). In combination, the heavy and the light chain variable regions specifically bind the antigen.
  • Light and heavy chain variable regions contain a “framework” region interrupted by three hypervariable regions, also called “complementarity-determining regions” or “CDRs”. The extent of the framework region and CDRs have been defined (see, Rabat et al., Sequences of Proteins of Immunological Interest , U.S. Department of Health and Human Services, 1991, which is hereby incorporated by reference).
  • the Kabat database is now maintained online.
  • the sequences of the framework regions of different light or heavy chains are relatively conserved within a species.
  • the framework region of an antibody that is the combined framework regions of the constituent light and heavy chains, largely adopt a b-sheet conformation and the CDRs form loops which connect, and in some cases form part of, the b-sheet structure.
  • framework regions act to form a scaffold that provides for positioning the CDRs in correct orientation by inter-chain, non-covalent interactions.
  • the CDRs are primarily responsible for binding to an epitope of an antigen.
  • the CDRs of each chain are typically referred to as CDR1, CDR2, and CDR3, numbered sequentially starting from the N-terminus, and are also typically identified by the chain in which the particular CDR is located.
  • a VH CDR3 is located in the variable domain of the heavy chain of the antibody in which it is found
  • a VL CDRl is the CDR1 from the variable domain of the light chain of the antibody in which it is found.
  • An antibody that binds CD3 protein will have a specific VH region and the VL region sequence, and thus specific CDR sequences.
  • Antibodies with different specificities i.e.
  • immunoglobulin-related compositions refers to antibodies (including monoclonal antibodies, polyclonal antibodies, humanized antibodies, chimeric antibodies, recombinant antibodies, multi-specific antibodies, bispecific antibodies, etc.,) as well as antibody fragments. An antibody or antigen binding fragment thereof specifically binds to an antigen.
  • antibody-related polypeptide means antigen-binding antibody fragments, including single-chain antibodies, that can comprise the variable region(s) alone, or in combination, with all or part of the following polypeptide elements: hinge region, CHi, CFh, and CFE domains of an antibody molecule. Also included in the technology are any combinations of variable region(s) and hinge region, CHi, CFh, and CFb domains.
  • Antibody-related molecules useful in the present methods e.g., but are not limited to, Fab, Fab' and F(ab')2, Fd, single-chain Fvs (scFv), single-chain antibodies, disulfide-linked Fvs (sdFv) and fragments comprising either a VL or VH domain.
  • Examples include: (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CHi domains; (ii) a F(ab')2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CHi domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a dAb fragment (Ward etal. , Nature 341: 544-546, 1989), which consists of a VH domain; and (vi) an isolated complementarity determining region (CDR).
  • CDR complementarity determining region
  • antibody fragments or “antigen binding fragments” can comprise a portion of a full length antibody, generally the antigen binding or variable region thereof.
  • antibody fragments or antigen binding fragments include Fab, Fab', F(ab')2, and Fv fragments; diabodies; linear antibodies; single-chain antibody molecules; and multi-specific antibodies formed from antibody fragments.
  • Bispecific antibody refers to an antibody that can bind simultaneously to two targets that have a distinct structure, e.g., two different target antigens, two different epitopes on the same target antigen, or a hapten and a target antigen or epitope on a target antigen.
  • a variety of different bispecific antibody structures are known in the art.
  • each antigen binding moiety in a bispecific antibody includes VH and/or VL regions; in some such embodiments, the VH and/or VL regions are those found in a particular monoclonal antibody.
  • the bispecific antibody contains two antigen binding moieties, each including VH and/or VL regions from different monoclonal antibodies.
  • the bispecific antibody contains two antigen binding moieties, wherein one of the two antigen binding moieties includes an immunoglobulin molecule having VH and/or VL regions that contain CDRs from a first monoclonal antibody, and the other antigen binding moiety includes an antibody fragment (e.g., Fab, F(ab'), F(ab')2, Fd, Fv, dAB, scFv, etc.) having VH and/or VL regions that contain CDRs from a second monoclonal antibody.
  • conjugated refers to the association of two molecules by any method known to those in the art. Suitable types of associations include chemical bonds and physical bonds. Chemical bonds include, for example, covalent bonds and coordinate bonds. Physical bonds include, for instance, hydrogen bonds, dipolar interactions, van der Waal forces, electrostatic interactions, hydrophobic interactions and aromatic stacking.
  • diabodies refers to small antibody fragments with two antigen-binding sites, which fragments comprise a heavy-chain variable domain (VH) connected to a light-chain variable domain (VL) in the same polypeptide chain (VH VL).
  • VH heavy-chain variable domain
  • VL light-chain variable domain
  • VH VL polypeptide chain
  • single-chain antibodies or “single-chain Fv (scFv)” refer to an antibody fusion molecule of the two domains of the Fv fragment, VL and VH.
  • Single-chain antibody molecules may comprise a polymer with a number of individual molecules, for example, dimer, trimer or other polymers.
  • the two domains of the F v fragment, VL and VH are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (known as single-chain F v (scF v )).
  • scF v single-chain Fv
  • Such single-chain antibodies can be prepared by recombinant techniques or enzymatic or chemical cleavage of intact antibodies.
  • any of the above-noted antibody fragments are obtained using conventional techniques known to those of skill in the art, and the fragments are screened for binding specificity and neutralization activity in the same manner as are intact antibodies.
  • an “antigen” refers to a molecule to which an antibody (or antigen binding fragment thereof) can selectively bind.
  • the target antigen may be a protein, carbohydrate, nucleic acid, lipid, hapten, or other naturally occurring or synthetic compound.
  • the target antigen may be a polypeptide (e.g., a CD3 polypeptide).
  • An antigen may also be administered to an animal to generate an immune response in the animal.
  • antigen binding fragment refers to a fragment of the whole immunoglobulin structure which possesses a part of a polypeptide responsible for binding to antigen.
  • antigen binding fragment useful in the present technology include scFv, (SCFV)2, SCFVFC, Fab, Fab' and F(ab')2, but are not limited thereto.
  • binding affinity is meant the strength of the total noncovalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen or antigenic peptide).
  • the affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (KD).
  • KD dissociation constant
  • Affinity can be measured by standard methods known in the art, including those described herein.
  • a low-affinity complex contains an antibody that generally tends to dissociate readily from the antigen, whereas a high-affinity complex contains an antibody that generally tends to remain bound to the antigen for a longer duration.
  • biological sample means sample material derived from living cells.
  • Biological samples may include tissues, cells, protein or membrane extracts of cells, and biological fluids (e.g ., ascites fluid or cerebrospinal fluid (CSF)) isolated from a subject, as well as tissues, cells and fluids present within a subject.
  • biological fluids e.g ., ascites fluid or cerebrospinal fluid (CSF)
  • Biological samples of the present technology include, but are not limited to, samples taken from breast tissue, renal tissue, the uterine cervix, the endometrium, the head or neck, the gallbladder, parotid tissue, the prostate, the brain, the pituitary gland, kidney tissue, muscle, the esophagus, the stomach, the small intestine, the colon, the liver, the spleen, the pancreas, thyroid tissue, heart tissue, lung tissue, the bladder, adipose tissue, lymph node tissue, the uterus, ovarian tissue, adrenal tissue, testis tissue, the tonsils, thymus, blood, hair, buccal, skin, serum, plasma, CSF, semen, prostate fluid, seminal fluid, urine, feces, sweat, saliva, sputum, mucus, bone marrow, lymph, and tears.
  • Bio samples can also be obtained from biopsies of internal organs or from cancers. Biological samples can be obtained from subjects for diagnosis or research or can be obtained from non-diseased individuals, as controls or for basic research. Samples may be obtained by standard methods including, e.g., venous puncture and surgical biopsy. In certain embodiments, the biological sample is a tissue sample obtained by needle biopsy.
  • CDR-grafted antibody means an antibody in which at least one CDR of an “acceptor” antibody is replaced by a CDR “graft” from a “donor” antibody possessing a desirable antigen specificity.
  • chimeric antibody means an antibody in which the Fc constant region of a monoclonal antibody from one species (e.g, a mouse Fc constant region) is replaced, using recombinant DNA techniques, with an Fc constant region from an antibody of another species (e.g, a human Fc constant region).
  • a monoclonal antibody from one species e.g, a mouse Fc constant region
  • another species e.g, a human Fc constant region
  • the term “consensus FR” means a framework (FR) antibody region in a consensus immunoglobulin sequence. The FR regions of an antibody do not contact the antigen.
  • control is an alternative sample used in an experiment for comparison purpose.
  • a control can be "positive” or “negative.”
  • a positive control a compound or composition known to exhibit the desired therapeutic effect
  • a negative control a subject or a sample that does not receive the therapy or receives a placebo
  • the term “effective amount” refers to a quantity sufficient to achieve a desired therapeutic and/or prophylactic effect, e.g. , an amount which results in the prevention of, or a decrease in a disease or condition described herein or one or more signs or symptoms associated with a disease or condition described herein.
  • the amount of a composition administered to the subject will vary depending on the composition, the degree, type, and severity of the disease and on the characteristics of the individual, such as general health, age, sex, body weight and tolerance to drugs. The skilled artisan will be able to determine appropriate dosages depending on these and other factors.
  • the compositions can also be administered in combination with one or more additional therapeutic compounds.
  • the therapeutic compositions may be administered to a subject having one or more signs or symptoms of a disease or condition described herein.
  • a "therapeutically effective amount" of a composition refers to composition levels in which the physiological effects of a disease or condition are ameliorated or eliminated.
  • a therapeutically effective amount can be given in one or more administrations.
  • effector cell means an immune cell which is involved in the effector phase of an immune response, as opposed to the cognitive and activation phases of an immune response.
  • exemplary immune cells include a cell of a myeloid or lymphoid origin, e.g., lymphocytes (e.g, B cells and T cells including cytolytic T cells (CTLs)), killer cells, natural killer cells, macrophages, monocytes, eosinophils, neutrophils, polymorphonuclear cells, granulocytes, mast cells, and basophils. Effector cells express specific Fc receptors and carry out specific immune functions.
  • An effector cell can induce antibody-dependent cell-mediated cytotoxicity (ADCC), e.g.
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • a neutrophil capable of inducing ADCC.
  • monocytes, macrophages, neutrophils, eosinophils, and lymphocytes which express FcaR are involved in specific killing of target cells and presenting antigens to other components of the immune system, or binding to cells that present antigens.
  • epitope means a protein determinant capable of specific binding to an antibody.
  • Epitopes usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three dimensional structural characteristics, as well as specific charge characteristics. Conformational and non-conformational epitopes are distinguished in that the binding to the former but not the latter is lost in the presence of denaturing solvents.
  • an “epitope” of the CD3 protein is a region of the protein to which the anti- CD3 antibodies of the present technology specifically bind.
  • the epitope is a conformational epitope or a non-conformational epitope.
  • a routine cross-blocking assay such as that described in Antibodies, A Laboratory Manual, Cold Spring Harbor Laboratory, Ed Harlow and David Lane (1988), can be performed. This assay can be used to determine if an anti- CD3 antibody binds the same site or epitope as an anti-CD3 antibody of the present technology.
  • epitope mapping can be performed by methods known in the art. For example, the antibody sequence can be mutagenized such as by alanine scanning, to identify contact residues.
  • peptides corresponding to different regions of CD3 protein can be used in competition assays with the test antibodies or with a test antibody and an antibody with a characterized or known epitope.
  • expression includes one or more of the following: transcription of the gene into precursor mRNA; splicing and other processing of the precursor mRNA to produce mature mRNA; mRNA stability; translation of the mature mRNA into protein (including codon usage and tRNA availability); and glycosylation and/or other modifications of the translation product, if required for proper expression and function.
  • gene means a segment of DNA that contains all the information for the regulated biosynthesis of an RNA product, including promoters, exons, introns, and other untranslated regions that control expression.
  • Homology refers to sequence similarity between two peptides or between two nucleic acid molecules. Homology can be determined by comparing a position in each sequence which may be aligned for purposes of comparison. When a position in the compared sequence is occupied by the same base or amino acid, then the molecules are homologous at that position. A degree of homology between sequences is a function of the number of matching or homologous positions shared by the sequences.
  • a polynucleotide or polynucleotide region has a certain percentage (for example, at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%) of “sequence identity” to another sequence means that, when aligned, that percentage of bases (or amino acids) are the same in comparing the two sequences.
  • This alignment and the percent homology or sequence identity can be determined using software programs known in the art. In some embodiments, default parameters are used for alignment.
  • One alignment program is BLAST, using default parameters.
  • Biologically equivalent polynucleotides are those having the specified percent homology and encoding a polypeptide having the same or similar biological activity. Two sequences are deemed “unrelated” or “non-homologous” if they share less than 40% identity, or less than 25% identity, with each other.
  • humanized forms of non-human (e.g ., murine) antibodies are chimeric antibodies which contain minimal sequence derived from non-human immunoglobulin.
  • humanized antibodies are human immunoglobulins in which hypervariable region residues of the recipient are replaced by hypervariable region residues from a non-human species (donor antibody) such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity.
  • donor antibody such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity.
  • donor antibody such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity.
  • Fv framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues.
  • humanized antibodies may comprise residues which are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance such as binding affinity.
  • the humanized antibody will comprise substantially all of at least one, and typically two, variable domains (e.g ., Fab, Fab', F(ab')2, or Fv), in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin consensus FR sequence although the FR regions may include one or more amino acid substitutions that improve binding affinity.
  • the number of these amino acid substitutions in the FR are typically no more than 6 in the H chain, and in the L chain, no more than 3.
  • the humanized antibody optionally may also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
  • Fc immunoglobulin constant region
  • hypervariable region refers to the amino acid residues of an antibody which are responsible for antigen-binding.
  • the hypervariable region generally comprises amino acid residues from a “complementarity determining region” or “CDR” (e.g, around about residues 24-34 (LI), 50-56 (L2) and 89-97 (L3) in the VL, and around about 31-35B (HI), 50-65 (H2) and 95-102 (H3) in the VH (Rabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD.
  • CDR complementarity determining region
  • residues from a “hypervariable loop” e.g, residues 26-32 (LI), 50-52 (L2) and 91-96 (L3) in the VL, and 26-32 (HI), 52A-55 (H2) and 96-101 (H3) in the VH (Chothia and Lesk J. Mol. Biol. 196:901-917 (1987)).
  • nucleic acids or polypeptide sequences refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same (i.e., about 60%, 65%, 70%, 75%, 80%, 85%,
  • identity exists over a region that is at least about 25 amino acids or nucleotides in length, or 50-100 amino acids or nucleotides in length.
  • the term “intact antibody” or “intact immunoglobulin” means an antibody that has at least two heavy (H) chain polypeptides and two light (L) chain polypeptides interconnected by disulfide bonds.
  • Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as HCVR or VH) and a heavy chain constant region.
  • the heavy chain constant region is comprised of three domains, CHi, CFb and CEE.
  • Each light chain is comprised of a light chain variable region (abbreviated herein as LCVR or VL) and a light chain constant region.
  • the light chain constant region is comprised of one domain, CL.
  • VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR).
  • CDR complementarity determining regions
  • FR framework regions
  • Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxyl-terminus in the following order: FRi, CDRi, FR2, CDR2, FR3, CDR3, FRL
  • the variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
  • the constant regions of the antibodies can mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g ., effector cells) and the first component (Clq) of the classical complement system.
  • the terms “individual”, “patient”, or “subject” can be an individual organism, a vertebrate, a mammal, or a human. In some embodiments, the individual, patient or subject is a human.
  • the term “monoclonal antibody” as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts.
  • a monoclonal antibody can be an antibody that is derived from a single clone, including any eukaryotic, prokaryotic, or phage clone, and not the method by which it is produced.
  • a monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope.
  • Monoclonal antibodies are highly specific, being directed against a single antigenic site.
  • each monoclonal antibody is directed against a single determinant on the antigen.
  • the modifier “monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
  • Monoclonal antibodies can be prepared using a wide variety of techniques known in the art including, e.g ., but not limited to, hybridoma, recombinant, and phage display technologies.
  • the monoclonal antibodies to be used in accordance with the present methods may be made by the hybridoma method first described by Kohler et ah, Nature 256:495 (1975), or may be made by recombinant DNA methods (See, e.g, U.S. Patent No. 4,816,567).
  • the “monoclonal antibodies” may also be isolated from phage antibody libraries using the techniques described in Clackson et al, Nature 352:624-628 (1991) and Marks etal, J. Mol. Biol. 222:581-597 (1991), for example.
  • the term “pharmaceutically-acceptable carrier” is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal compounds, isotonic and absorption delaying compounds, and the like, compatible with pharmaceutical administration.
  • Pharmaceutically-acceptable carriers and their formulations are known to one skilled in the art and are described, for example, in Remington's Pharmaceutical Sciences (20 th edition, ed. A. Gennaro, 2000, Lippincott, Williams & Wilkins, Philadelphia, Pa.).
  • polyclonal antibody means a preparation of antibodies derived from at least two (2) different antibody-producing cell lines. The use of this term includes preparations of at least two (2) antibodies that contain antibodies that specifically bind to different epitopes or regions of an antigen.
  • polynucleotide or “nucleic acid” means any RNA or DNA, which may be unmodified or modified RNA or DNA.
  • Polynucleotides include, without limitation, single- and double-stranded DNA, DNA that is a mixture of single- and double-stranded regions, single- and double-stranded RNA, RNA that is mixture of single- and double-stranded regions, and hybrid molecules comprising DNA and RNA that may be single-stranded or, more typically, double-stranded or a mixture of single- and double- stranded regions.
  • polynucleotide refers to triple-stranded regions comprising RNA or DNA or both RNA and DNA.
  • the term polynucleotide also includes DNAs or RNAs containing one or more modified bases and DNAs or RNAs with backbones modified for stability or for other reasons.
  • polypeptide As used herein, the terms “polypeptide,” “peptide” and “protein” are used interchangeably herein to mean a polymer comprising two or more amino acids joined to each other by peptide bonds or modified peptide bonds, i.e., peptide isosteres.
  • Polypeptide refers to both short chains, commonly referred to as peptides, glycopeptides or oligomers, and to longer chains, generally referred to as proteins.
  • Polypeptides may contain amino acids other than the 20 gene-encoded amino acids.
  • Polypeptides include amino acid sequences modified either by natural processes, such as post-translational processing, or by chemical modification techniques that are well known in the art. Such modifications are well described in basic texts and in more detailed monographs, as well as in a voluminous research literature.
  • the term “recombinant” when used with reference, e.g ., to a cell, or nucleic acid, protein, or vector, indicates that the cell, nucleic acid, protein or vector, has been modified by the introduction of a heterologous nucleic acid or protein or the alteration of a native nucleic acid or protein, or that the material is derived from a cell so modified.
  • recombinant cells express genes that are not found within the native (non-recombinant) form of the cell or express native genes that are otherwise abnormally expressed, under expressed or not expressed at all.
  • the term “separate” therapeutic use refers to an administration of at least two active ingredients at the same time or at substantially the same time by different routes.
  • sequential therapeutic use refers to administration of at least two active ingredients at different times, the administration route being identical or different. More particularly, sequential use refers to the whole administration of one of the active ingredients before administration of the other or others commences. It is thus possible to administer one of the active ingredients over several minutes, hours, or days before administering the other active ingredient or ingredients. There is no simultaneous treatment in this case.
  • “specifically binds” refers to a molecule (e.g., an antibody or antigen binding fragment thereof) which recognizes and binds another molecule (e.g., an antigen), but that does not substantially recognize and bind other molecules.
  • telomere binding can be exhibited, for example, by a molecule having a KD for the molecule to which it binds to of about 1CT 4 M, 1CT 5 M, 10 6 M, 10 7 M, 10 8 M, 10 9 M, 10 10 M, 10 U M, or 10 12 M.
  • telomere binding may also refer to binding where a molecule (e.g., an antibody or antigen binding fragment thereof) binds to a particular polypeptide (e.g., a CD3 polypeptide), or an epitope on a particular polypeptide, without substantially binding to any other polypeptide, or polypeptide epitope.
  • a molecule e.g., an antibody or antigen binding fragment thereof
  • a particular polypeptide e.g., a CD3 polypeptide
  • epitope on a particular polypeptide without substantially binding to any other polypeptide, or polypeptide epitope.
  • the term “simultaneous” therapeutic use refers to the administration of at least two active ingredients by the same route and at the same time or at substantially the same time.
  • the term “therapeutic agent” is intended to mean a compound that, when present in an effective amount, produces a desired therapeutic effect on a subject in need thereof.
  • Treating” or “treatment” as used herein covers the treatment of a disease or disorder described herein, in a subject, such as a human, and includes: (i) inhibiting a disease or disorder, i.e., arresting its development; (ii) relieving a disease or disorder, i.e., causing regression of the disorder; (iii) slowing progression of the disorder; and/or (iv) inhibiting, relieving, or slowing progression of one or more symptoms of the disease or disorder.
  • treatment means that the symptoms associated with the disease are, e.g., alleviated, reduced, cured, or placed in a state of remission.
  • the various modes of treatment of disorders as described herein are intended to mean “substantial,” which includes total but also less than total treatment, and wherein some biologically or medically relevant result is achieved.
  • the treatment may be a continuous prolonged treatment for a chronic disease or a single, or few time administrations for the treatment of an acute condition.
  • Amino acid sequence modification(s) of the anti-CD3 antibodies described herein are contemplated. For example, it may be desirable to improve the binding affinity and/or other biological properties of the antibody.
  • Amino acid sequence variants of an anti- CD3 antibody are prepared by introducing appropriate nucleotide changes into the antibody nucleic acid, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into and/or substitutions of, residues within the amino acid sequences of the antibody. Any combination of deletion, insertion, and substitution is made to obtain the antibody of interest, as long as the obtained antibody possesses the desired properties.
  • the modification also includes the change of the pattern of glycosylation of the protein.
  • the sites of greatest interest for substitutional mutagenesis include the hypervariable regions, but FR alterations are also contemplated. “Conservative substitutions” are shown in the Table below.
  • substitutional variant involves substituting one or more hypervariable region residues of a parent antibody.
  • a convenient way for generating such substitutional variants involves affinity maturation using phage display. Specifically, several hypervariable region sites (e.g ., 6-7 sites) are mutated to generate all possible amino acid substitutions at each site.
  • the antibody variants thus generated are displayed in a monovalent fashion from filamentous phage particles as fusions to the gene III product of Ml 3 packaged within each particle. The phage-displayed variants are then screened for their biological activity (e.g., binding affinity) as herein disclosed.
  • alanine scanning mutagenesis can be performed to identify hypervariable region residues contributing significantly to antigen binding.
  • the present technology describes methods and compositions for the generation and use of anti-CD3 immunoglobulin-related compositions (e.g., anti-CD3 antibodies or antigen binding fragments thereof).
  • the anti-CD3 immunoglobulin-related compositions of the present disclosure may be useful in the diagnosis, or treatment of CD3 -associated pathologies.
  • Anti-CD3 immunoglobulin-related compositions within the scope of the present technology include, e.g ., but are not limited to, monoclonal, chimeric, humanized, bispecific antibodies and diabodies that specifically bind the target polypeptide, a homolog, derivative or a fragment thereof.
  • the present disclosure also provides antigen binding fragments of any of the anti-CD3 antibodies disclosed herein, wherein the antigen binding fragment is selected from the group consisting of Fab, F(ab)'2, Fab’, scF v , and F v.
  • the present technology provides chimeric and re-humanized variants of Teplizumab, including multi-specific immunoglobulin-related compositions (e.g, bispecific antibody agents).
  • the CDR of the VH and VL of humanized CD3 antibody based on the IMGT annotation system are summarized below:
  • the present disclosure provides an antibody or antigen binding fragment thereof comprising a heavy chain immunoglobulin variable domain (VH) and a light chain immunoglobulin variable domain (VL), wherein (a) the VH comprises a VH- CDR1 sequence of GYTFTRYT (SEQ ID NO: 2), a VH-CDR2 sequence of INPSRGYT (SEQ ID NO: 3), and a VH-CDR3 sequence of ARYYDDHYSLDY (SEQ ID NO: 6), ARYYDDHYSCDY (SEQ ID NO: 134), ARYYDDHCSLDY (SEQ ID NO: 135), or ARY YDDHY SLC Y (SEQ ID NO: 136); and/or; (b) the VL comprises a VL-CDR1 sequence of SSVSY (SEQ ID NO: 12), a VL-CDR2 sequence of DT (SEQ ID NO: 13), and a VL- CDR3 sequence of QQWSSNPFT
  • the present disclosure provides an antibody or antigen binding fragment thereof comprising a heavy chain immunoglobulin variable domain (VH) and a light chain immunoglobulin variable domain (VL), wherein: (a) the VH comprises an amino acid sequence selected from any one of SEQ ID NOs: 5, 7, 8, 9, 10, or 43-61; and/or (b) the VL comprises an amino acid sequence selected from any one of SEQ ID NOs: 15-20 or 62- 91.
  • VH heavy chain immunoglobulin variable domain
  • VL light chain immunoglobulin variable domain
  • the antibody further comprises a Fc domain of any isotype, e.g ., but are not limited to, IgG (including IgGl, IgG2, IgG3, and IgG4), IgA (including IgAi and IgA2), IgD, IgE, or IgM, and IgY.
  • IgG including IgGl, IgG2, IgG3, and IgG4
  • IgA including IgAi and IgA2
  • IgD IgE
  • IgM IgM
  • IgY IgY.
  • constant region sequences include:
  • the immunoglobulin-related compositions of the present technology comprise a heavy chain constant region that is at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or is 100% identical to SEQ ID NOS: 25-32. Additionally or alternatively, in some embodiments, the immunoglobulin-related compositions of the present technology comprise a light chain constant region that is at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or is 100% identical to SEQ ID NO: 33.
  • the immunoglobulin-related compositions of the present technology bind to the extracellular domain of a CD3 polypeptide.
  • the epitope is a conformational epitope or non-conformational epitope.
  • the CD3 polypeptide has the amino acid sequence of SEQ ID NO: 42.
  • NCBI Ref NP 000724.1 Homo sapiens T-cell surface glycoprotein CD3 epsilon chain precursor (SEQ ID NO: 42)
  • the antibody or antigen binding fragment binds to the extracellular domain of a CD3 polypeptide.
  • the extracellular domain comprises a CD3e subunit including a linear stretch of sequence on the F-G loop.
  • the CD3e subunit may comprise three discontinuous regions: residues 79e-85e (the F-G loop), residue 34e (the first residue of the BC strand), and residues 46e and 48e (the C’-D loop).
  • the present disclosure provides an isolated immunoglobulin- related composition (e.g ., an antibody or antigen binding fragment thereof) comprising a heavy chain (HC) amino acid sequence comprising SEQ ID NO: 23, SEQ ID NO: 96, SEQ ID NO: 100, SEQ ID NO: 104, SEQ ID NO: 108, SEQ ID NO: 112, SEQ ID NO: 116, SEQ ID NO: 126, SEQ ID NO: 132, SEQ ID NO: 137, SEQ ID NO: 139, or a variant thereof having one or more conservative amino acid substitutions.
  • HC heavy chain
  • the immunoglobulin-related compositions of the present technology comprise a light chain (LC) amino acid sequence comprising SEQ ID NO: 21, SEQ ID NO: 92, SEQ ID NO: 94, SEQ ID NO: 98, SEQ ID NO: 102, SEQ ID NO: 106, SEQ ID NO:
  • LC light chain
  • the immunoglobulin-related compositions of the present technology comprise a HC amino acid sequence and a LC amino acid sequence selected from the group consisting of: SEQ ID NO: 23 and SEQ ID NO: 21, SEQ ID NO: 23 and SEQ ID NO: 92, SEQ ID NO: 96 and SEQ ID NO: 94, SEQ ID NO: 100 and SEQ ID NO: 98, SEQ ID NO: 104 and SEQ ID NO: 102, SEQ ID NO: 108 and SEQ ID NO: 106, SEQ ID NO: 112 and SEQ ID NO: 110, and SEQ ID NO: 116 and SEQ ID NO: 114, respectively.
  • the immunoglobulin-related compositions comprise a first LC amino acid sequence, a second LC amino acid sequence, a first HC amino acid sequence, and a second HC amino acid sequence selected from the group consisting of SEQ ID NO: 122, SEQ ID NO: 124, SEQ ID NO: 126, and SEQ ID NO: 137; and SEQ ID NO: 128, SEQ ID NO: 130, SEQ ID NO: 132, and SEQ ID NO: 139, respectively.
  • the HC and LC immunoglobulin variable domain sequences form an antigen binding site that binds to the extracellular domain of a CD3 polypeptide.
  • the extracellular domain comprises a CD3a subunit including a linear stretch of sequence on the F-G loop.
  • the CD3a subunit may comprise three discontinuous regions: residues 79e-85e (the F-G loop), residue 34e (the first residue of the BC strand), and residues 46e and 48e (the C’-D loop).
  • the epitope is a conformational epitope or a non-conformational epitope.
  • the HC and LC immunoglobulin variable domain sequences are components of the same polypeptide chain. In other embodiments, the HC and LC immunoglobulin variable domain sequences are components of different polypeptide chains. In certain embodiments, the antibody is a full-length antibody.
  • the immunoglobulin-related compositions of the present technology bind specifically to at least one CD3 polypeptide. In some embodiments, the immunoglobulin-related compositions of the present technology bind at least one CD3 polypeptide with a dissociation constant (KD) of about 10 _3 M, 10 _4 M, 10 _5 M, 10 _6 M, 10 _7 M, 10 _8 M, 10 _9 M, 10 _10 M, 10 _11 M, or 10 _12 M. In certain embodiments, the immunoglobulin-related compositions are monoclonal antibodies, chimeric antibodies, humanized antibodies, bispecific antibodies, or multi-specific antibodies. In some embodiments, the antibodies comprise a human antibody framework region.
  • the immunoglobulin-related composition includes one or more of the following characteristics: (a) a light chain immunoglobulin variable domain sequence that is at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the light chain immunoglobulin variable domain sequence of any one of SEQ ID NOs: 15-20 or 62-91; and/or (b) a heavy chain immunoglobulin variable domain sequence that is at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the heavy chain immunoglobulin variable domain sequence of any one of SEQ ID NOs: 5, 7, 8, 9, 10, or 43-61.
  • one or more amino acid residues in the immunoglobulin- related compositions provided herein are substituted with another amino acid. The substitution may be a “conservative substitution” as defined herein.
  • the present disclosure provides an immunoglobulin-related composition comprising an amino acid sequence that is at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to an amino acid sequence selected from SEQ ID NOs: 118-121.
  • the present disclosure provides an antibody comprising (a) a LC sequence that is at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the LC sequence present in SEQ ID NO: 21, SEQ ID NO: 92, SEQ ID NO: 94, SEQ ID NO: 98, SEQ ID NO: 102, SEQ ID NO: 106, SEQ ID NO: 110, SEQ ID NO: 114, SEQ ID NO: 122, SEQ ID NO: 124, SEQ ID NO: 128, SEQ ID NO: 130; and/or (b) a HC sequence that is at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the HC sequence present in SEQ ID NO: 23, SEQ ID NO: 96, SEQ ID NO: 100, SEQ ID NO: 104, SEQ ID NO: 108, SEQ ID NO: 112, SEQ ID NO: 116, SEQ ID NO: 126, S
  • the multi-specific antibodies of the present disclosure bind to CD3, GPA33, HER2/neu, GD2, MAGE-1, MAGE-3, BAGE, GAGE-1, GAGE-2, MUM-1, CDK4, N-acetylglucosaminyltransf erase, pl5, gp75, beta-catenin, ErbB2, cancer antigen 125 (CA-125), carcinoembryonic antigen (CEA), RAGE, MART (melanoma antigen), MUC-1, MUC-2, MUC-3, MUC-4, MUC-5ac, MUC-16, MUC-17, tyrosinase, Pmel 17 (gplOO), GnT-V intron V sequence (N- acetylglucoaminyltransferase V intron V sequence), Prostate cancer psm, PRAME (melanoma antigen), b-catenin, EBNA (Epstein-Barr Virus nuclear
  • the present disclosure provides a multi-specific antigen binding fragment comprising a first polypeptide chain, wherein: the first polypeptide chain comprises in the N-terminal to C-terminal direction: (i) a heavy chain variable domain of a first immunoglobulin that is capable of specifically binding to a first epitope; (ii) a flexible peptide linker comprising the amino acid sequence (GGGGS (iii) a light chain variable domain of the first immunoglobulin; (iv) a flexible peptide linker comprising the amino acid sequence (GGGGS (v) a heavy chain variable domain of a second immunoglobulin that is capable of specifically binding to a second epitope; (vi) a flexible peptide linker comprising the amino acid sequence (GGGGS (vii) a light chain variable domain of the second immunoglobulin; (viii) a flexible peptide linker sequence comprising the amino acid sequence TPLGDTTHT; and (ix) a self-assembly
  • the present disclosure provides a multi-specific antigen binding fragment comprising a first polypeptide chain, wherein: the first polypeptide chain comprises in the N-terminal to C-terminal direction: (i) a light chain variable domain of a first immunoglobulin that is capable of specifically binding to a first epitope; (ii) a flexible peptide linker comprising the amino acid sequence (GGGGS (iii) a heavy chain variable domain of the first immunoglobulin; (iv) a flexible peptide linker comprising the amino acid sequence (GGGGS (v) a heavy chain variable domain of a second immunoglobulin that is capable of specifically binding to a second epitope; (vi) a flexible peptide linker comprising the amino acid sequence (GGGGS (vii) a light chain variable domain of the second immunoglobulin; (viii) a flexible peptide linker sequence comprising the amino acid sequence TPLGDTTHT; and (ix) a self-assembly
  • the SADA polypeptide comprises a tetramerization, pentamerization, or hexamerization domain.
  • the SADA polypeptide comprises a tetramerization domain of any one of p53, p63, p73, hnRNPC, SNA-23, Stefin B, KCNQ4, and CBFA2T1.
  • the bispecific antigen binding fragment comprises an amino acid sequence selected from SEQ ID NOs: 118-121.
  • the present disclosure provides a multi-specific antibody comprising a first polypeptide chain, a second polypeptide chain, a third polypeptide chain and a fourth polypeptide chain, wherein the first and second polypeptide chains are covalently bonded to one another, the second and third polypeptide chains are covalently bonded to one another, and the third and fourth polypeptide chain are covalently bonded to one another, and wherein: (a) each of the first polypeptide chain and the fourth polypeptide chain comprises in the N-terminal to C-terminal direction: (i) a light chain variable domain of a first immunoglobulin that is capable of specifically binding to a first epitope; (ii) a light chain constant domain of the first immunoglobulin; (iii) a flexible peptide linker comprising the amino acid sequence (GGGGS)3; and (iv) a light chain variable domain of a second immunoglobulin that is linked to a complementary heavy chain variable domain of the second immunoglob
  • the immunoglobulin-related compositions contain an IgGl constant region comprising one or more amino acid substitutions selected from the group consisting of N297A and K322A. Additionally or alternatively, in some embodiments, the immunoglobulin-related compositions contain an IgG4 constant region comprising a S228P mutation.
  • the anti-CD3 immunoglobulin-related compositions described herein contain structural modifications to facilitate rapid binding and cell uptake and/or slow release.
  • the anti-CD3 immunoglobulin-related composition of the present technology e.g ., an antibody
  • a Fab fragment is used to facilitate rapid binding and cell uptake and/or slow release.
  • a F(ab)'2 fragment is used to facilitate rapid binding and cell uptake and/or slow release.
  • the present technology provides a nucleic acid sequence encoding any of the immunoglobulin-related compositions described herein. Also disclosed herein are recombinant nucleic acid sequences encoding any of the antibodies described herein. In some embodiments, the nucleic acid sequence is selected from the group consisting of SEQ ID NOs: 22, 24, 93, 95, 97, 99, 101, 103, 105, 107, 109, 111, 113, 115, 117, 123, 125, 127, 129, 131, 133, 138, and 140.
  • the present technology provides a host cell expressing any nucleic acid sequence encoding any of the immunoglobulin-related compositions described herein.
  • the immunoglobulin-related compositions of the present technology can be monospecific, bispecific, trispecific or of greater multi specificity.
  • Multi-specific antibodies can be specific for different epitopes of one or more CD3 polypeptides or can be specific for both the CD3 polypeptide(s) as well as for heterologous compositions, such as a heterologous polypeptide or solid support material. See, e.g., WO 93/17715; WO 92/08802; WO 91/00360; WO 92/05793; Tutt etal., J. Immunol. 147: 60-69 (1991); U.S. Pat. Nos.
  • the immunoglobulin-related compositions are chimeric. In certain embodiments, the immunoglobulin-related compositions are humanized.
  • the immunoglobulin-related compositions of the present technology can further be recombinantly fused to a heterologous polypeptide at the N- or C-terminus or chemically conjugated (including covalently and non-covalently conjugations) to polypeptides or other compositions.
  • the immunoglobulin-related compositions of the present technology can be recombinantly fused or conjugated to molecules useful as labels in detection assays and effector molecules such as heterologous polypeptides, drugs, or toxins. See, e.g, WO 92/08495; WO 91/14438; WO 89/12624; U.S. Pat. No. 5,314,995; and EP 0 396 387.
  • the antibody or antigen binding fragment may be optionally conjugated to an agent selected from the group consisting of isotopes, dyes, chromagens, contrast agents, drugs, toxins, cytokines, enzymes, enzyme inhibitors, hormones, hormone antagonists, growth factors, radionuclides, metals, liposomes, nanoparticles, RNA, DNA or any combination thereof.
  • an agent selected from the group consisting of isotopes, dyes, chromagens, contrast agents, drugs, toxins, cytokines, enzymes, enzyme inhibitors, hormones, hormone antagonists, growth factors, radionuclides, metals, liposomes, nanoparticles, RNA, DNA or any combination thereof.
  • an agent selected from the group consisting of isotopes, dyes, chromagens, contrast agents, drugs, toxins, cytokines, enzymes, enzyme inhibitors, hormones, hormone antagonists, growth factors, radionuclides, metals, liposomes, nanoparticles
  • the functional groups on the agent and immunoglobulin-related composition can associate directly.
  • a functional group e.g ., a sulfhydryl group
  • a functional group e.g., sulfhydryl group
  • an immunoglobulin-related composition to form a disulfide.
  • the functional groups can associate through a cross-linking agent (i.e., linker).
  • cross-linking agents are described below.
  • the cross-linker can be attached to either the agent or the immunoglobulin-related composition.
  • the number of agents or immunoglobulin-related compositions in a conjugate is also limited by the number of functional groups present on the other. For example, the maximum number of agents associated with a conjugate depends on the number of functional groups present on the immunoglobulin-related composition. Alternatively, the maximum number of immunoglobulin-related compositions associated with an agent depends on the number of functional groups present on the agent.
  • the conjugate comprises one immunoglobulin- related composition associated to one agent.
  • a conjugate comprises at least one agent chemically bonded (e.g, conjugated) to at least one immunoglobulin-related composition.
  • the agent can be chemically bonded to an immunoglobulin-related composition by any method known to those in the art.
  • a functional group on the agent may be directly attached to a functional group on the immunoglobulin-related composition.
  • suitable functional groups include, for example, amino, carboxyl, sulfhydryl, maleimide, isocyanate, isothiocyanate and hydroxyl.
  • the agent may also be chemically bonded to the immunoglobulin-related composition by means of cross-linking agents, such as dialdehydes, carbodiimides, dimaleimides, and the like.
  • Cross-linking agents can, for example, be obtained from Pierce Biotechnology, Inc., Rockford, Ill. The Pierce Biotechnology, Inc. web-site can provide assistance.
  • Additional cross-linking agents include the platinum cross-linking agents described in U.S. Pat. Nos. 5,580,990; 5,985,566; and 6,133,038 ofKreatech Biotechnology, B.V., Amsterdam, The Netherlands.
  • the functional group on the agent and immunoglobulin-related composition can be the same.
  • Homobifunctional cross-linkers are typically used to cross link identical functional groups. Examples of homobifunctional cross-linkers include EGS (i.e., ethylene glycol bis[succinimidylsuccinate]), DSS (i.e., disuccinimidyl suberate), DMA (.
  • DTSSP i.e., 3,3'- dithiobis[sulfosuccinimidylpropionate]
  • DPDPB i.e., l,4-di-[3'-(2'-pyridyldithio)- propionamidojbutane
  • BMH i.e., bis-maleimidohexane
  • the agent may be beneficial to cleave the agent from the immunoglobulin-related composition.
  • the web-site of Pierce Biotechnology, Inc. described above can also provide assistance to one skilled in the art in choosing suitable cross-linkers which can be cleaved by, for example, enzymes in the cell.
  • the agent can be separated from the immunoglobulin-related composition.
  • cleavable linkers examples include SMPT (i.e., 4-succinimidyloxycarbonyl-methyl-a-[2-pyridyldithio]toluene), Sulfo-LC- SPDP (i.e., sulfosuccinimidyl 6-(3-[2-pyridyldithio]-propionamido)hexanoate), LC-SPDP (i.e., succinimidyl 6-(3-[2-pyridyldithio]-propionamido)hexanoate), Sulfo-LC-SPDP (i.e., sulfosuccinimidyl 6-(3-[2-pyridyldithio]-propionamido)hexanoate), SPDP (i.e., N- succinimidyl 3-[2-pyridyldithio]-propionamidohexanoate), and AEDP
  • a conjugate comprises at least one agent physically bonded with at least one immunoglobulin-related composition.
  • Any method known to those in the art can be employed to physically bond the agents with the immunoglobulin-related compositions.
  • the immunoglobulin-related compositions and agents can be mixed together by any method known to those in the art. The order of mixing is not important.
  • agents can be physically mixed with immunoglobulin-related compositions by any method known to those in the art.
  • the immunoglobulin- related compositions and agents can be placed in a container and agitated, by for example, shaking the container, to mix the immunoglobulin-related compositions and agents.
  • the immunoglobulin-related compositions can be modified by any method known to those in the art.
  • the immunoglobulin-related composition may be modified by means of cross-linking agents or functional groups, as described above.
  • a target polypeptide is chosen to which an antibody of the present technology can be raised.
  • an antibody may be raised against the full-length CD3 protein, or to a portion of the extracellular domain of the CD3 protein.
  • Techniques for generating antibodies directed to such target polypeptides are well known to those skilled in the art. Examples of such techniques include, for example, but are not limited to, those involving display libraries, xeno or human mice, hybridomas, and the like.
  • Target polypeptides within the scope of the present technology include any polypeptide derived from CD3 protein containing the extracellular domain which is capable of eliciting an immune response.
  • the extracellular domain comprises a CD3e subunit including a linear stretch of sequence on the F-G loop.
  • the CD3e subunit may comprise three discontinuous regions: residues 79e-85e (the F-G loop), residue 34e (the first residue of the BC strand), and residues 46e and 48e (the C’-D loop).
  • Anti-CD3 antibodies that can be subjected to the techniques set forth herein include monoclonal and polyclonal antibodies, and antibody fragments such as Fab, Fab', F(ab')2, Fd, scFv, diabodies, antibody light chains, antibody heavy chains and/or antibody fragments. Methods useful for the high yield production of antibody Fv-containing polypeptides, e.g. , Fab' and F(ab')2 antibody fragments have been described. See U.S. Pat. No. 5,648,237.
  • an antibody is obtained from an originating species. More particularly, the nucleic acid or amino acid sequence of the variable portion of the light chain, heavy chain or both, of an originating species antibody having specificity for a target polypeptide antigen is obtained.
  • An originating species is any species which was useful to generate the antibody of the present technology or library of antibodies, e.g. , rat, mouse, rabbit, chicken, monkey, human, and the like.
  • Phage or phagemid display technologies are useful techniques to derive the antibodies of the present technology. Techniques for generating and cloning monoclonal antibodies are well known to those skilled in the art. Expression of sequences encoding antibodies of the present technology, can be carried out in E. coli.
  • nucleic acid coding sequences which encode substantially the same amino acid sequences as those of the naturally occurring proteins may be used in the practice of the present technology
  • nucleic acid sequences including all or portions of the nucleic acid sequences encoding the above polypeptides, which are altered by the substitution of different codons that encode a functionally equivalent amino acid residue within the sequence, thus producing a silent change.
  • nucleotide sequence of an immunoglobulin tolerates sequence homology variations of up to 25% as calculated by standard methods (“Current Methods in Sequence Comparison and Analysis ” Macromolecule Sequencing and Synthesis, Selected Methods and Applications, pp.
  • one or more amino acid residues within a polypeptide sequence can be substituted by another amino acid of a similar polarity which acts as a functional equivalent, resulting in a silent alteration.
  • Substitutes for an amino acid within the sequence may be selected from other members of the class to which the amino acid belongs.
  • the nonpolar (hydrophobic) amino acids include alanine, leucine, isoleucine, valine, proline, phenylalanine, tryptophan and methionine.
  • the polar neutral amino acids include glycine, serine, threonine, cysteine, tyrosine, asparagine, and glutamine.
  • the positively charged (basic) amino acids include arginine, lysine and histidine.
  • the negatively charged (acidic) amino acids include aspartic acid and glutamic acid.
  • proteins or fragments or derivatives thereof which are differentially modified during or after translation, e.g, by glycosylation, proteolytic cleavage, linkage to an antibody molecule or other cellular ligands, etc.
  • an immunoglobulin encoding nucleic acid sequence can be mutated in vitro or in vivo to create and/or destroy translation, initiation, and/or termination sequences or to create variations in coding regions and/or form new restriction endonuclease sites or destroy pre-existing ones, to facilitate further in vitro modification.
  • Any technique for mutagenesis known in the art can be used, including but not limited to in vitro site directed mutagenesis, ./. Biol. Chem. 253:6551, use of Tab linkers (Pharmacia), and the like.
  • Methods of generating antibodies or antibody fragments of the present technology typically include immunizing a subject (generally a non-human subject such as a mouse or rabbit) with a purified CD3 protein or fragment thereof or with a cell expressing the CD3 protein or fragment thereof.
  • An appropriate immunogenic preparation can contain, e.g. , a recombinantly-expressed CD3 protein or a chemically-synthesized CD3 peptide.
  • the extracellular domain of the CD3 protein, or a portion or fragment thereof can be used as an immunogen to generate an anti- CD3 antibody that binds to the CD3 protein, or a portion or fragment thereof using standard techniques for polyclonal and monoclonal antibody preparation.
  • the extracellular domain comprises a CD3e subunit including a linear stretch of sequence on the F-G loop.
  • the CD3e subunit may comprise three discontinuous regions: residues 79e-85e (the F-G loop), residue 34e (the first residue of the BC strand), and residues 46e and 48e (the C’-D loop).
  • residues 79e-85e the F-G loop
  • residue 34e the first residue of the BC strand
  • residues 46e and 48e the C’-D loop
  • a CD3 fragment comprises the extracellular domain of the CD3 protein, or a portion or fragment thereof (e.g, a CD3 polypeptide comprising a CD3a subunit that includes three discontinuous regions: residues 79e-85e (the F-G loop), residue 34e (the first residue of the BC strand), and residues 46e and 48e (the C’-D loop), such that an antibody raised against the peptide forms a specific immune complex with the CD3 protein.
  • the antigenic CD3 peptide comprises at least 10, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, or at least 100 amino acid residues. Longer antigenic peptides are sometimes desirable over shorter antigenic peptides, depending on use and according to methods well known to those skilled in the art. Multimers of a given epitope are sometimes more effective than a monomer.
  • the immunogenicity of the CD3 protein can be increased by fusion or conjugation to a carrier protein such as keyhole limpet hemocyanin (KLH) or ovalbumin (OVA).
  • KLH keyhole limpet hemocyanin
  • OVA ovalbumin
  • Many such carrier proteins are known in the art.
  • adjuvants used to increase the immunological response include, but are not limited to, Freund's (complete and incomplete), mineral gels (e.g, aluminum hydroxide), surface active substances (e.g ., lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, dinitrophenol, etc.), human adjuvants such as Bacille Calmette-Guerin and Corynebacterium parvum, or similar immunostimulatory compounds. These techniques are standard in the art.
  • immune responses may be described as either “primary” or “secondary” immune responses.
  • a primary immune response which is also described as a “protective” immune response, refers to an immune response produced in an individual as a result of some initial exposure (e.g., the initial “immunization”) to a particular antigen, e.g, CD3 protein.
  • the immunization can occur as a result of vaccinating the individual with a vaccine containing the antigen.
  • the vaccine can be a CD3 vaccine comprising one or more CD3 protein-derived antigens.
  • a primary immune response can become weakened or attenuated over time and can even disappear or at least become so attenuated that it cannot be detected.
  • the present technology also relates to a “secondary” immune response, which is also described here as a “memory immune response.”
  • the term secondary immune response refers to an immune response elicited in an individual after a primary immune response has already been produced.
  • a secondary immune response can be elicited, e.g, to enhance an existing immune response that has become weakened or attenuated, or to recreate a previous immune response that has either disappeared or can no longer be detected.
  • the secondary or memory immune response can be either a humoral (antibody) response or a cellular response.
  • a secondary or memory humoral response occurs upon stimulation of memory B cells that were generated at the first presentation of the antigen.
  • Delayed type hypersensitivity (DTH) reactions are a type of cellular secondary or memory immune response that are mediated by CD4 + T cells. A first exposure to an antigen primes the immune system and additional exposure(s) results in a DTH.
  • the anti-CD3 antibody can be prepared from the subject’s serum. If desired, the antibody molecules directed against the CD3 protein can be isolated from the mammal (e.g, from the blood) and further purified by well- known techniques, such as polypeptide A chromatography to obtain the IgG fraction.
  • the antibody is an anti-CD3 monoclonal antibody.
  • the anti-CD3 monoclonal antibody may be a human or a mouse anti-CD3 monoclonal antibody.
  • any technique that provides for the production of antibody molecules by continuous cell line culture can be utilized. Such techniques include, but are not limited to, the hybridoma technique (See, e.g. , Kohler & Milstein, 1975.
  • amplified sequences also can be fused to DNAs encoding other proteins - e.g, a bacteriophage coat, or a bacterial cell surface protein - for expression and display of the fusion polypeptides on phage or bacteria. Amplified sequences can then be expressed and further selected or isolated based, e.g, on the affinity of the expressed antibody or fragment thereof for an antigen or epitope present on the CD3 protein.
  • hybridomas expressing anti- CD3 monoclonal antibodies can be prepared by immunizing a subject and then isolating hybridomas from the subject’s spleen using routine methods.
  • a selected monoclonal antibody with the desired properties can be used as expressed by the hybridoma, it can be bound to a molecule such as polyethylene glycol (PEG) to alter its properties, or a cDNA encoding it can be isolated, sequenced and manipulated in various ways.
  • Synthetic dendromeric trees can be added to reactive amino acid side chains, e.g, lysine, to enhance the immunogenic properties of CD3 protein.
  • CPG-dinucleotide techniques can be used to enhance the immunogenic properties of the CD3 protein.
  • Other manipulations include substituting or deleting particular amino acyl residues that contribute to instability of the antibody during storage or after administration to a subject, and affinity maturation techniques to improve affinity of the antibody of the CD3 protein.
  • the antibody of the present technology is an anti-CD3 monoclonal antibody produced by a hybridoma which includes a B cell obtained from a transgenic non-human animal, e.g ., a transgenic mouse, having a genome comprising a human heavy chain transgene and a light chain transgene fused to an immortalized cell.
  • Hybridoma techniques include those known in the art and taught in Harlow et al., Antibodies: A Laboratory Manual Cold Spring Harbor Laboratory, Cold Spring Harbor, NY, 349 (1988); Hammerling et al, Monoclonal Antibodies And T-Cell Hybridomas, 563-681 (1981). Other methods for producing hybridomas and monoclonal antibodies are well known to those of skill in the art.
  • the antibodies of the present technology can be produced through the application of recombinant DNA and phage display technology.
  • anti-CD3 antibodies can be prepared using various phage display methods known in the art.
  • phage display methods functional antibody domains are displayed on the surface of a phage particle which carries polynucleotide sequences encoding them.
  • Phages with a desired binding property are selected from a repertoire or combinatorial antibody library (e.g, human or murine) by selecting directly with an antigen, typically an antigen bound or captured to a solid surface or bead.
  • Phages used in these methods are typically filamentous phage including fd and M13 with Fab, Fv or disulfide stabilized Fv antibody domains that are recombinantly fused to either the phage gene III or gene VIII protein.
  • methods can be adapted for the construction of Fab expression libraries (See, e.g, Huse, etal, Science 246: 1275-1281, 1989) to allow rapid and effective identification of monoclonal Fab fragments with the desired specificity for a CD3 polypeptide, e.g, a polypeptide or derivatives, fragments, analogs or homologs thereof.
  • Other examples of phage display methods that can be used to make the antibodies of the present technology include those disclosed in Huston et al, Proc.
  • Fab, Fab' and F(ab')2 fragments can also be employed using methods known in the art such as those disclosed in WO 92/22324; Mullinax et al, BioTechniques 12: 864-869, 1992; and Sawai et al., AJRI 34: 26-34, 1995; and Better et al., Science 240: 1041-1043, 1988.
  • hybrid antibodies or hybrid antibody fragments that are cloned into a display vector can be selected against the appropriate antigen in order to identify variants that maintain good binding activity, because the antibody or antibody fragment will be present on the surface of the phage or phagemid particle.
  • a display vector can be selected against the appropriate antigen in order to identify variants that maintain good binding activity, because the antibody or antibody fragment will be present on the surface of the phage or phagemid particle.
  • Barbas III et al. Phage Display, A Laboratory Manual (Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 2001).
  • other vector formats could be used for this process, such as cloning the antibody fragment library into a lytic phage vector (modified T7 or Lambda Zap systems) for selection and/or screening.
  • the antibodies of the present technology can be produced through the application of recombinant DNA technology.
  • Recombinant polynucleotide constructs encoding an anti- CD3 antibody of the present technology typically include an expression control sequence operably-linked to the coding sequences of anti-CD3 antibody chains, including naturally- associated or heterologous promoter regions.
  • another aspect of the technology includes vectors containing one or more nucleic acid sequences encoding an anti-CD3 antibody of the present technology.
  • the nucleic acid containing all or a portion of the nucleotide sequence encoding the anti-CD3 antibody is inserted into an appropriate cloning vector, or an expression vector (i.e., a vector that contains the necessary elements for the transcription and translation of the inserted polypeptide coding sequence) by recombinant DNA techniques well known in the art and as detailed below. Methods for producing diverse populations of vectors have been described by Lerner et al ., U.S. Pat. Nos.
  • expression vectors useful in recombinant DNA techniques are often in the form of plasmids.
  • plasmid and “vector” can be used interchangeably as the plasmid is the most commonly used form of vector.
  • the present technology is intended to include such other forms of expression vectors that are not technically plasmids, such as viral vectors ( e.g ., replication defective retroviruses, adenoviruses and adeno-associated viruses), which serve equivalent functions.
  • viral vectors e.g ., replication defective retroviruses, adenoviruses and adeno-associated viruses
  • Such viral vectors permit infection of a subject and expression of a construct in that subject.
  • the expression control sequences are eukaryotic promoter systems in vectors capable of transforming or transfecting eukaryotic host cells.
  • the host is maintained under conditions suitable for high level expression of the nucleotide sequences encoding the anti-CD3 antibody, and the collection and purification of the anti-CD3 antibody, e.g., cross-reacting anti-CD3 antibodies.
  • These expression vectors are typically replicable in the host organisms either as episomes or as an integral part of the host chromosomal DNA.
  • expression vectors contain selection markers, e.g., ampicillin-resistance or hygromycin-resi stance, to permit detection of those cells transformed with the desired DNA sequences.
  • Vectors can also encode signal peptide, e.g, pectate lyase, useful to direct the secretion of extracellular antibody fragments. See U.S.
  • the recombinant expression vectors of the present technology comprise a nucleic acid encoding a protein with CD3 binding properties in a form suitable for expression of the nucleic acid in a host cell, which means that the recombinant expression vectors include one or more regulatory sequences, selected on the basis of the host cells to be used for expression that is operably-linked to the nucleic acid sequence to be expressed.
  • “operably-linked” is intended to mean that the nucleotide sequence of interest is linked to the regulatory sequence(s) in a manner that allows for expression of the nucleotide sequence (e.g, in an in vitro transcription/translation system or in a host cell when the vector is introduced into the host cell).
  • regulatory sequence is intended to include promoters, enhancers and other expression control elements (e.g ., polyadenylation signals). Such regulatory sequences are described, e.g., in Goeddel, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990). Regulatory sequences include those that direct constitutive expression of a nucleotide sequence in many types of host cell and those that direct expression of the nucleotide sequence only in certain host cells (e.g., tissue- specific regulatory sequences).
  • Typical regulatory sequences useful as promoters of recombinant polypeptide expression include, e.g, but are not limited to, promoters of 3 -phosphogly cerate kinase and other glycolytic enzymes.
  • Inducible yeast promoters include, among others, promoters from alcohol dehydrogenase, isocytochrome C, and enzymes responsible for maltose and galactose utilization.
  • a polynucleotide encoding an anti-CD3 antibody of the present technology is operably-linked to an ara B pro oter and expressible in a host cell. See Ei.S. Pat. 5,028,530.
  • the expression vectors of the present technology can be introduced into host cells to thereby produce polypeptides or peptides, including fusion polypeptides, encoded by nucleic acids as described herein (e.g, anti-CD3 antibody, etc.).
  • Another aspect of the present technology pertains to anti-CD3 antibody expressing host cells, which contain a nucleic acid encoding one or more anti-CD3 antibodies.
  • the recombinant expression vectors of the present technology can be designed for expression of an anti-CD3 antibody in prokaryotic or eukaryotic cells.
  • an anti-CD3 antibody can be expressed in bacterial cells such as Escherichia coli, insect cells (using baculovirus expression vectors), fungal cells, e.g, yeast, yeast cells or mammalian cells. Suitable host cells are discussed further in Goeddel, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990).
  • the recombinant expression vector can be transcribed and translated in vitro, e.g, using T7 promoter regulatory sequences and T7 polymerase.
  • T7 promoter regulatory sequences and T7 polymerase Methods useful for the preparation and screening of polypeptides having a predetermined property, e.g, anti-CD3 antibody, via expression of stochastically generated polynucleotide sequences has been previously described. See U.S. Pat. Nos. 5,763,192; 5,723,323; 5,814,476; 5,817,483; 5,824,514; 5,976,862; 6,492,107; 6,569,641. [00185] Expression of polypeptides in prokaryotes is most often carried out in E.
  • Fusion vectors add a number of amino acids to a polypeptide encoded therein, usually to the amino terminus of the recombinant polypeptide.
  • Such fusion vectors typically serve three purposes: (i) to increase expression of recombinant polypeptide; (ii) to increase the solubility of the recombinant polypeptide; and (iii) to aid in the purification of the recombinant polypeptide by acting as a ligand in affinity purification.
  • a proteolytic cleavage site is introduced at the junction of the fusion moiety and the recombinant polypeptide to enable separation of the recombinant polypeptide from the fusion moiety subsequent to purification of the fusion polypeptide.
  • enzymes, and their cognate recognition sequences include Factor Xa, thrombin and enterokinase.
  • Typical fusion expression vectors include pGEX (Pharmacia Biotech Inc; Smith and Johnson, 1988.
  • GST glutathione S- transferase
  • maltose E binding polypeptide or polypeptide A, respectively, to the target recombinant polypeptide.
  • E. coli expression vectors examples include pTrc (Amrann et al, (1988) Gene 69: 301-315) and pET lid (Studier et al, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990) 60-89). Methods for targeted assembly of distinct active peptide or protein domains to yield multifunctional polypeptides via polypeptide fusion has been described by Pack etal. , U.S. Pat. Nos. 6,294,353; 6,692,935.
  • One strategy to maximize recombinant polypeptide expression, e.g ., an anti-CD3 antibody, in E. coli is to express the polypeptide in host bacteria with an impaired capacity to proteolytically cleave the recombinant polypeptide. See , e.g. , Gottesman, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990) 119-128. Another strategy is to alter the nucleic acid sequence of the nucleic acid to be inserted into an expression vector so that the individual codons for each amino acid are those preferentially utilized in the expression host, e.g. , E. coli (See, e.g, Wada, etal, 1992.
  • nucleic acid sequences of the present technology can be carried out by standard DNA synthesis techniques.
  • the anti-CD3 antibody expression vector is a yeast expression vector.
  • yeast Saccharomyces cerevisiae examples include pYepSecl (Baldari, etal. , 1987. EMBO J. 6: 229-234), pMFa (Kurjan and Herskowitz, Cell 30: 933-943, 1982), pJRY88 (Schultz etal., Gene 54: 113-123, 1987), pYES2 (Invitrogen Corporation, San Diego, Calif.), and picZ (Invitrogen Corp, San Diego, Calif.).
  • an anti-CD3 antibody can be expressed in insect cells using baculovirus expression vectors.
  • Baculovirus vectors available for expression of polypeptides, e.g., anti-CD3 antibody, in cultured insect cells include the pAc series (Smith, etal, Mol. Cell. Biol. 3: 2156-2165, 1983) and the pVL series (Lucklow and Summers, 1989. Virology 170: 31-39).
  • a nucleic acid encoding an anti-CD3 antibody of the present technology is expressed in mammalian cells using a mammalian expression vector.
  • mammalian expression vectors include, e.g, but are not limited to, pCDM8 (Seed, Nature 329: 840, 1987) and pMT2PC (Kaufman, etal, EMBO J. 6: 187-195, 1987).
  • the expression vector's control functions are often provided by viral regulatory elements.
  • commonly used promoters are derived from polyoma, adenovirus 2, cytomegalovirus, and simian virus 40.
  • the recombinant mammalian expression vector is capable of directing expression of the nucleic acid in a particular cell type (e.g, tissue- specific regulatory elements).
  • tissue-specific regulatory elements are known in the art.
  • suitable tissue-specific promoters include the albumin promoter (liver-specific; Pinkert, etal, Genes Dev. 1: 268-277, 1987), lymphoid-specific promoters (Calame and Eaton, Adv. Immunol. 43: 235-275, 1988), promoters of T cell receptors (Winoto and Baltimore, EMBO J. 8: 729-733, 1989) and immunoglobulins (Banerji, et al, 1983.
  • Neuron-specific promoters e.g, the neurofilament promoter; Byrne and Ruddle, Proc. Natl. Acad. Sci. USA 86: 5473-5477, 1989
  • pancreas-specific promoters Esdlund, etal, 1985. Science 230: 912- 916
  • mammary gland-specific promoters e.g, milk whey promoter; U.S. Pat. No. 4,873,316 and European Application Publication No. 264, 166).
  • promoters are also encompassed, e.g, the murine hox promoters (Kessel and Gruss, Science 249: 374-379, 1990) and the a-fetoprotein promoter (Campes and Tilghman, Genes Dev. 3: 537-546, 1989).
  • host cell and “recombinant host cell” are used interchangeably herein. It is understood that such terms refer not only to the particular subject cell but also to the progeny or potential progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term as used herein.
  • a host cell can be any prokaryotic or eukaryotic cell.
  • an anti-CD3 antibody can be expressed in bacterial cells such as E. coli , insect cells, yeast or mammalian cells.
  • Mammalian cells are a suitable host for expressing nucleotide segments encoding immunoglobulins or fragments thereof. See Winnacker, From Genes To Clones , (VCH Publishers, NY, 1987).
  • a number of suitable host cell lines capable of secreting intact heterologous proteins have been developed in the art, and include Chinese hamster ovary (CHO) cell lines, various COS cell lines, HeLa cells, L cells and myeloma cell lines. In some embodiments, the cells are non-human.
  • Expression vectors for these cells can include expression control sequences, such as an origin of replication, a promoter, an enhancer, and necessary processing information sites, such as ribosome binding sites, RNA splice sites, polyadenylation sites, and transcriptional terminator sequences. Queen et al ., Immunol.
  • Illustrative expression control sequences are promoters derived from endogenous genes, cytomegalovirus, SV40, adenovirus, bovine papillomavirus, and the like. Co et al., J Immunol. 148: 1149, 1992. Other suitable host cells are known to those skilled in the art.
  • Vector DNA can be introduced into prokaryotic or eukaryotic cells via conventional transformation or transfection techniques.
  • transformation and “transfection” are intended to refer to a variety of art-recognized techniques for introducing foreign nucleic acid (e.g ., DNA) into a host cell, including calcium phosphate or calcium chloride co-precipitation, DEAE-dextran-mediated transfection, lipofection, electroporation, biolistics or viral-based transfection.
  • Other methods used to transform mammalian cells include the use of polybrene, protoplast fusion, liposomes, electroporation, and microinjection ( See generally , Sambrook et al. , Molecular Cloning). Suitable methods for transforming or transfecting host cells can be found in Sambrook, etal. (MOLECULAR CLONING: A LABORATORY MANUAL. 2nd ed.,
  • the vectors containing the DNA segments of interest can be transferred into the host cell by well-known methods, depending on the type of cellular host.
  • a gene that encodes a selectable marker e.g. , resistance to antibiotics
  • a selectable marker e.g. , resistance to antibiotics
  • Various selectable markers include those that confer resistance to drugs, such as G418, hygromycin and methotrexate.
  • Nucleic acid encoding a selectable marker can be introduced into a host cell on the same vector as that encoding the anti-CD3 antibody or can be introduced on a separate vector. Cells stably transfected with the introduced nucleic acid can be identified by drug selection (e.g., cells that have incorporated the selectable marker gene will survive, while the other cells die).
  • a host cell that includes an anti-CD3 antibody of the present technology can be used to produce (i.e., express) recombinant anti-CD3 antibody.
  • the method comprises culturing the host cell (into which a recombinant expression vector encoding the anti-CD3 antibody has been introduced) in a suitable medium such that the anti-CD3 antibody is produced.
  • the method further comprises the step of isolating the anti-CD3 antibody from the medium or the host cell.
  • collections of the anti-CD3 antibody e.g, the anti-CD3 antibodies or the anti-CD3 antibody-related polypeptides are purified from culture media and host cells.
  • the anti-CD3 antibody can be purified according to standard procedures of the art, including HPLC purification, column chromatography, gel electrophoresis and the like.
  • the anti-CD3 antibody is produced in a host organism by the method of Boss et al, U.S. Pat. No. 4,816,397.
  • anti-CD3 antibody chains are expressed with signal sequences and are thus released to the culture media.
  • the anti-CD3 antibody chains can be released by treatment with mild detergent.
  • polynucleotides encoding anti-CD3 antibodies can be incorporated in transgenes for introduction into the genome of a transgenic animal and subsequent expression in the milk of the transgenic animal. See , e.g. , U.S. Pat. Nos. 5,741,957, 5,304,489, and 5,849,992.
  • Suitable transgenes include coding sequences for light and/or heavy chains in operable linkage with a promoter and enhancer from a mammary gland specific gene, such as casein or b-lactoglobulin.
  • transgenes can be microinjected into fertilized oocytes, or can be incorporated into the genome of embryonic stem cells, and the nuclei of such cells transferred into enucleated oocytes.
  • the anti-CD3 antibody of the present technology is a single-chain anti-CD3 antibody.
  • techniques can be adapted for the production of single-chain antibodies specific to a CD3 protein (See, e.g, U.S. Pat. No. 4,946,778). Examples of techniques which can be used to produce single-chain Fvs and antibodies of the present technology include those described in U.S. Pat. Nos. 4,946,778 and 5,258,498; Huston et al, Methods in Enzymology, 203: 46-88, 1991; Shu, L. etal, Proc. Natl. Acad Sci. USA, 90: 7995-7999, 1993; and Skerra et al, Science 240: 1038-1040, 1988.
  • the anti-CD3 antibody of the present technology is a chimeric anti-CD3 antibody.
  • the anti-CD3 antibody of the present technology is a humanized anti-CD3 antibody.
  • the donor and acceptor antibodies are monoclonal antibodies from different species.
  • the acceptor antibody is a human antibody (to minimize its antigenicity in a human), in which case the resulting CDR-grafted antibody is termed a “humanized” antibody.
  • Recombinant anti-CD3 antibodies such as chimeric and humanized monoclonal antibodies, comprising both human and non-human portions, can be made using standard recombinant DNA techniques, and are within the scope of the present technology.
  • chimeric and humanized monoclonal antibodies can be produced by recombinant DNA techniques known in the art. Such useful methods include, e.g ., but are not limited to, methods described in International Application No. PCT/US86/02269; U.S. Pat. No. 5,225,539; European Patent No. 184187; European Patent No. 171496; European Patent No. 173494; PCT International Publication No.
  • antibodies can be humanized using a variety of techniques including CDR-grafting (EP 0239400; WO 91/09967; U.S. Pat. No. 5,530,101; 5,585,089; 5,859,205; 6,248,516; EP460167), veneering or resurfacing (EP 0 592 106; EP 0 519 596; Padlan E. A., Molecular Immunology, 28: 489-498, 1991; Studnicka et al. , Protein Engineering 1 : 805-814, 1994; Roguska et al, PNAS 91: 969-973, 1994), and chain shuffling (U.S. Pat. No. 5,565,332).
  • a cDNA encoding a murine anti- CD3 monoclonal antibody is digested with a restriction enzyme selected specifically to remove the sequence encoding the Fc constant region, and the equivalent portion of a cDNA encoding a human Fc constant region is substituted
  • the present technology provides the construction of humanized anti-CD3 antibodies that are unlikely to induce a human anti-mouse antibody (hereinafter referred to as “HAMA”) response, while still having an effective antibody effector function.
  • HAMA human anti-mouse antibody
  • the terms “human” and “humanized”, in relation to antibodies, relate to any antibody which is expected to elicit a therapeutically tolerable weak immunogenic response in a human subject.
  • the present technology provides for a humanized anti-CD3 antibodies, heavy and light chain immunoglobulins.
  • the anti-CD3 antibody of the present technology is an anti-CD3 CDR antibody.
  • the donor and acceptor antibodies used to generate the anti-CD3 CDR antibody are monoclonal antibodies from different species; typically the acceptor antibody is a human antibody (to minimize its antigenicity in a human), in which case the resulting CDR-grafted antibody is termed a “humanized” antibody.
  • the graft may be of a single CDR (or even a portion of a single CDR) within a single VH or VL of the acceptor antibody, or can be of multiple CDRs (or portions thereof) within one or both of the VH and VL.
  • either or both the heavy and light chain variable regions are produced by grafting the CDRs from the originating species into the hybrid framework regions.
  • Assembly of hybrid antibodies or hybrid antibody fragments having hybrid variable chain regions with regard to either of the above aspects can be accomplished using conventional methods known to those skilled in the art.
  • DNA sequences encoding the hybrid variable domains described herein can be produced by oligonucleotide synthesis and/or PCR.
  • the nucleic acid encoding CDR regions can also be isolated from the originating species antibodies using suitable restriction enzymes and ligated into the target species framework by ligating with suitable ligation enzymes.
  • suitable restriction enzymes ligated into the target species framework by ligating with suitable ligation enzymes.
  • framework regions of the variable chains of the originating species antibody can be changed by site-directed mutagenesis.
  • hybrids are constructed from choices among multiple candidates corresponding to each framework region, there exist many combinations of sequences which are amenable to construction in accordance with the principles described herein. Accordingly, libraries of hybrids can be assembled having members with different combinations of individual framework regions. Such libraries can be electronic database collections of sequences or physical collections of hybrids.
  • This process typically does not alter the acceptor antibody’s FRs flanking the grafted CDRs.
  • one skilled in the art can sometimes improve antigen binding affinity of the resulting anti-CD3 CDR-grafted antibody by replacing certain residues of a given FR to make the FR more similar to the corresponding FR of the donor antibody. Suitable locations of the substitutions include amino acid residues adjacent to the CDR, or which are capable of interacting with a CDR (See, e.g., US 5,585,089, especially columns 12-16).
  • one skilled in the art can start with the donor FR and modify it to be more similar to the acceptor FR or a human consensus FR. Techniques for making these modifications are known in the art.
  • the resulting FR fits a human consensus FR for that position, or is at least 90% or more identical to such a consensus FR, doing so may not increase the antigenicity of the resulting modified anti-CD3 CDR-grafted antibody significantly compared to the same antibody with a fully human FR.
  • Bispecific Antibodies A bispecific antibody is an antibody that can bind simultaneously to two targets that have a distinct structure, e.g., two different target antigens, two different epitopes on the same target antigen, or a hapten and a target antigen or epitope on a target antigen.
  • BsAbs can be made, for example, by combining heavy chains and/or light chains that recognize different epitopes of the same or different antigen.
  • a bispecific binding agent binds one antigen (or epitope) on one of its two binding arms (one VH/VL pair), and binds a different antigen (or epitope) on its second arm (a different VH/VL pair).
  • a bispecific binding agent has two distinct antigen binding arms (in both specificity and CDR sequences), and is monovalent for each antigen to which it binds.
  • Multi-specific antibodies such as bispecific antibodies (BsAb) and bispecific antibody fragments (BsFab) have at least one arm that specifically binds to, for example, CD3 and at least one other arm that specifically binds to a second target antigen.
  • the second target antigen is an antigen or epitope of a B-cell, a T-cell, a myeloid cell, a plasma cell, or a mast-cell. Additionally or alternatively, in certain embodiments, the second target antigen is selected from the group consisting of CD3, CD4, CD8, CD20, CD 19, CD21, CD23, CD46, CD80, HLA-DR, CD74, CD22, CD14, CD15, CD16, CD123, TCR gamma/delta, NKp46 and KIR. In certain embodiments, the BsAbs are capable of binding to tumor cells that express CD3 antigen on the cell surface.
  • the BsAbs have been engineered to facilitate killing of tumor cells by directing (or recruiting) cytotoxic T cells to a tumor site.
  • Other exemplary BsAbs include those with a first antigen binding site specific for CD3 and a second antigen binding site specific for a small molecule hapten (e.g ., DTP A, IMP288, DOTA, DOTA-Bn, DOTA- desferrioxamine, other DOTA-chelates described herein, Biotin, fluorescein, or those disclosed in Goodwin, D A. et al, 1994, Cancer Res. 54(22):5937-5946).
  • a small molecule hapten e.g ., DTP A, IMP288, DOTA, DOTA-Bn, DOTA- desferrioxamine, other DOTA-chelates described herein, Biotin, fluorescein, or those disclosed in Goodwin, D A. et al, 1994, Cancer Res. 54(22):5937-5946).
  • bispecific fusion proteins can be produced using molecular engineering.
  • BsAbs have been constructed that either utilize the full immunoglobulin framework (e.g., IgG), single chain variable fragment (scFv), or combinations thereof.
  • the bispecific fusion protein is divalent, comprising, for example, a scFv with a single binding site for one antigen and a Fab fragment with a single binding site for a second antigen.
  • the bispecific fusion protein is divalent, comprising, for example, an scFv with a single binding site for one antigen and another scFv fragment with a single binding site for a second antigen.
  • the bispecific fusion protein is tetravalent, comprising, for example, an immunoglobulin (e.g., IgG) with two binding sites for one antigen and two identical scFvs for a second antigen.
  • BsAbs composed of two scFv units in tandem have been shown to be a clinically successful bispecific antibody format.
  • BsAbs comprise two single chain variable fragments (scFvs) in tandem have been designed such that an scFv that binds a tumor antigen (e.g., CD3) is linked with an scFv that engages T cells (e.g., by binding CD3).
  • BsAbs of the present technology comprise two single chain variable fragments (scFvs) in tandem have been designed such that an scFv that binds a tumor antigen (e.g., CD3) is linked with an scFv that engages a small molecule DOTA hapten.
  • scFvs single chain variable fragments
  • Recent methods for producing BsAbs include engineered recombinant monoclonal antibodies which have additional cysteine residues so that they crosslink more strongly than the more common immunoglobulin isotypes. See, e.g., FitzGerald et al., Protein Eng. 10(10): 1221-1225 (1997). Another approach is to engineer recombinant fusion proteins linking two or more different single-chain antibody or antibody fragment segments with the needed dual specificities. See, e.g., Coloma et al., Nature Biotech. 15:159-163 (1997). A variety of bispecific fusion proteins can be produced using molecular engineering.
  • a BsAb according to the present technology comprises an immunoglobulin, which immunoglobulin comprises a heavy chain and a light chain, and an scFv.
  • the scFv is linked to the C-terminal end of the heavy chain of any CD3 immunoglobulin disclosed herein.
  • scFvs are linked to the C-terminal end of the light chain of any CD3 immunoglobulin disclosed herein.
  • scFvs are linked to heavy or light chains via a linker sequence.
  • Appropriate linker sequences necessary for the in-frame connection of the heavy chain Fd to the scFv are introduced into the VL and Vkappa domains through PCR reactions.
  • the DNA fragment encoding the scFv is then ligated into a staging vector containing a DNA sequence encoding the CHI domain.
  • the resulting scFv-CHl construct is excised and ligated into a vector containing a DNA sequence encoding the VH region of a CD3 antibody.
  • the resulting vector can be used to transfect an appropriate host cell, such as a mammalian cell for the expression of the bispecific fusion protein.
  • a linker is at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40, 45, 50, 55, 60, 65, 70,
  • a linker is characterized in that it tends not to adopt a rigid three-dimensional structure, but rather provides flexibility to the polypeptide ( e.g ., first and/or second antigen binding sites).
  • a linker is employed in a BsAb described herein based on specific properties imparted to the BsAb such as, for example, an increase in stability.
  • a BsAb of the present technology comprises a G4S linker.
  • a BsAb of the present technology comprises a (G4S)n linker, wherein n is 1,
  • SADA Self assembly disassembly
  • CD3 antibodies of the present technology comprise one or more SADA domains.
  • SADA domains can be designed and/or tailored to achieve environmentally-dependent multimerization with beneficial kinetic, thermodynamic, and/or pharmacologic properties.
  • SADA domains may be part of a conjugate that permit effective delivery of a payload to a target site of interest while minimizing the risk off-target interactions.
  • the anti-CD3 antibodies of the present technolgy may comprise a SADA domain linked to one or more binding domains.
  • conjugates are characterized in that they multimerize to form a complex of a desired size under relevant conditions (e.g.
  • the conjugate in a solution in which the conjugate is present above a threshold concentration or pH and/or when present at a target site characterized by a relevant level or density of receptors for the payload), and disassemble to a smaller form under other conditions (e.g, absent the relevant environmental multimerization trigger).
  • a SADA conjugate may have improved characteristics compared to a conjugate without a SADA domain.
  • improved characteristics of a multimeric conjugate include: increased avidity /binding to a target, increased specificity for target cells or tissues, and/or extended initial serum half-life.
  • improved characteristics include that through dissociation to smaller states (e.g, dimeric or monomeric), a SADA conjugate exhibits reduced non-specific binding, decreased toxicity, and/or improved renal clearance.
  • a SADA conjugate comprises a SADA polypeptide having an amino acid sequence that shows at least 75% identity with that of a human homo-multimerizing polypeptide and is characterized by one or more multimerization dissociation constants (KD).
  • KD multimerization dissociation constants
  • a SADA conjugate is constructed and arranged so that it adopts a first multimerization state and one or more higher-order multimerization states.
  • a first multimerization state is less than about ⁇ 70 kDa in size.
  • a first multimerization state is an unmultimerized state (e.g, a monomer or a dimer).
  • a first multimerization state is a monomer.
  • a first multimerization state is a dimer.
  • a first multimerization state is a multimerized state (e.g., a trimer or a tetramer).
  • a higher-order multimerization states is a homo-tetramer or higher-order homo-multimer greater than 150 kDa in size.
  • a higher-order homo- multimerized conjugate is stable in aqueous solution when the conjugate is present at a concentration above the SADA polypeptide KD.
  • a SADA conjugate transitions from a higher-order multimerization state(s) to a first multimerization state under physiological conditions when the concentration of the conjugate is below the SADA polypeptide KD.
  • a SADA polypeptide is covalently linked to a binding domain via a linker. Any suitable linker known in the art can be used. In some embodiments, a SADA polypeptide is linked to a binding domain via a polypeptide linker.
  • a polypeptide linker is a Gly-Ser linker. In some embodiments, a polypeptide linker is or comprises a sequence of (GGGGS)n, where n represents the number of repeating GGGGS units and is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18,
  • a binding domain is directly fused to a SADA polypeptide.
  • a SADA domain is a human polypeptide or a fragment and/or derivative thereof. In some embodiments, a SADA domain is substantially non- immunogenic in a human. In some embodiments, a SADA polypeptide is stable as a multimer. In some embodiments, a SADA polypeptide lacks unpaired cysteine residues. In some embodiments, a SADA polypeptide does not have large exposed hydrophobic surfaces. In some embodiments, a SADA domain has or is predicted to have a structure comprising helical bundles that can associate in a parallel or anti-parallel orientation. In some embodiments, a SADA polypeptide is capable of reversible multimerization.
  • a SADA domain is a tetramerization domain, a heptamerization domain, a hexamerization domain or an octamerization domain.
  • a SADA domain is a tetramerization domain.
  • a SADA domain is composed of a multimerization domains which are each composed of helical bundles that associate in a parallel or anti- parallel orientation.
  • a SADA domain is selected from the group of one of the following human proteins: p53, p63, p73, heterogeneous nuclear Ribonucleoprotein C (hnRNPC), N-terminal domain of Synaptosomal-associated protein 23 (SNAP-23), Stefin B (Cystatin B), Potassium voltage-gated channel subfamily KQT member 4 (KCNQ4), or Cyclin-D-related protein (CBFA2T1).
  • suitable SADA domains are described in PCT/TJS2018/031235, which is hereby incorporated by reference in its entirety. Provided below are polypeptide sequences for exemplary SADA domains.
  • KCNQ4 tetramerizaiton domain amino acid sequence (611-640) DEISMMGRVVK VEKQ V Q SIEHKLDLLLGF Y (SEQ ID NO: 40)
  • CBFA2T1 tetramerizaiton domain amino acid sequence (462-521) TVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKD WEKHH (SEQ ID NO: 41)
  • a SADA polypeptide is or comprises a tetramerization domain of p53, p63, p73, heterogeneous nuclear Ribonucleoprotein C (hnRNPC), N- terminal domain of Synaptosomal-associated protein 23 (SNAP -23), Stefin B (Cystatin B), Potassium voltage-gated channel subfamily KQT member 4 (KCNQ4), or Cyclin-D-related protein (CBFA2T1).
  • a SADA polypeptide is or comprises a sequence that is at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to a sequence as set forth in any one of SEQ ID NOs: 34-41.
  • the anti-CD3 antibodies of the present technology comprise a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region (or the parental Fc region), such that said molecule has an altered affinity for an Fc receptor (e.g ., an FcyR), provided that said variant Fc region does not have a substitution at positions that make a direct contact with Fc receptor based on crystallographic and structural analysis of Fc-Fc receptor interactions such as those disclosed by Sondermann et al., Nature , 406:267-273 (2000).
  • an Fc receptor e.g ., an FcyR
  • positions within the Fc region that make a direct contact with an Fc receptor such as an FcyR include amino acids 234-239 (hinge region), amino acids 265-269 (B/C loop), amino acids 297-299 (C7E loop), and amino acids 327-332 (F/G) loop.
  • an anti-CD3 antibody of the present technology has an altered affinity for activating and/or inhibitory receptors, having a variant Fc region with one or more amino acid modifications, wherein said one or more amino acid modification is a N297 substitution with alanine, or a K322 substitution with alanine.
  • anti-CD3 antibodies of the present technology have an Fc region with variant glycosylation as compared to a parent Fc region.
  • variant glycosylation includes the absence of fucose; in some embodiments, variant glycosylation results from expression in GnTl -deficient CHO cells.
  • the antibodies of the present technology may have a modified glycosylation site relative to an appropriate reference antibody that binds to an antigen of interest (e.g., CD3), without altering the functionality of the antibody, e.g., binding activity to the antigen.
  • an antigen of interest e.g., CD3
  • glycosylation sites include any specific amino acid sequence in an antibody to which an oligosaccharide (i.e., carbohydrates containing two or more simple sugars linked together) will specifically and covalently attach.
  • Oligosaccharide side chains are typically linked to the backbone of an antibody via either N-or O-linkages.
  • N-linked glycosylation refers to the attachment of an oligosaccharide moiety to the side chain of an asparagine residue.
  • O-linked glycosylation refers to the attachment of an oligosaccharide moiety to a hydroxyamino acid, e.g., serine, threonine.
  • an Fc-gly coform hCD3-IgGln
  • hCD3-IgGln that lacks certain oligosaccharides including fucose and terminal N- acetylglucosamine may be produced in special CHO cells and exhibit enhanced ADCC effector function.
  • the carbohydrate content of an immunoglobulin-related composition disclosed herein is modified by adding or deleting a glycosylation site.
  • Methods for modifying the carbohydrate content of antibodies are well known in the art and are included within the present technology, see, e.g., U.S. Patent No. 6,218,149; EP 0359096B1; U.S. Patent Publication No. US 2002/0028486; International Patent Application Publication WO 03/035835; U.S. Patent Publication No. 2003/0115614; U.S. Patent No. 6,218,149; U.S. Patent No. 6,472,511; all of which are incorporated herein by reference in their entirety.
  • the carbohydrate content of an antibody is modified by deleting one or more endogenous carbohydrate moieties of the antibody.
  • the present technology includes deleting the glycosylation site of the Fc region of an antibody, by modifying position 297 from asparagine to alanine.
  • Engineered glycoforms may be useful for a variety of purposes, including but not limited to enhancing or reducing effector function.
  • Engineered glycoforms may be generated by any method known to one skilled in the art, for example by using engineered or variant expression strains, by co-expression with one or more enzymes, for example N- acetylglucosaminyltransferase III (GnTIII), by expressing a molecule comprising an Fc region in various organisms or cell lines from various organisms, or by modifying carbohydrate(s) after the molecule comprising Fc region has been expressed.
  • Methods for generating engineered glycoforms are known in the art, and include but are not limited to those described in Umana et al., 1999, Nat.
  • the anti-CD3 antibody of the present technology is a fusion protein.
  • the anti-CD3 antibodies of the present technology when fused to a second protein, can be used as an antigenic tag.
  • domains that can be fused to polypeptides include not only heterologous signal sequences, but also other heterologous functional regions.
  • the fusion does not necessarily need to be direct, but can occur through linker sequences.
  • fusion proteins of the present technology can also be engineered to improve characteristics of the anti-CD3 antibodies. For instance, a region of additional amino acids, particularly charged amino acids, can be added to the N-terminus of the anti-CD3 antibody to improve stability and persistence during purification from the host cell or subsequent handling and storage.
  • peptide moieties can be added to an anti-CD3 antibody to facilitate purification. Such regions can be removed prior to final preparation of the anti-CD3 antibody.
  • the addition of peptide moieties to facilitate handling of polypeptides are familiar and routine techniques in the art.
  • the anti-CD3 antibody of the present technology can be fused to marker sequences, such as a peptide which facilitates purification of the fused polypeptide.
  • the marker amino acid sequence is a hexa-histidine peptide, such as the tag provided in a pQE vector (QIAGEN, Inc., Chatsworth, Calif), among others, many of which are commercially available. As described in Gentz et al., Proc. Natl. Acad. Sci.
  • hexa-histidine provides for convenient purification of the fusion protein.
  • Another peptide tag useful for purification, the “HA” tag corresponds to an epitope derived from the influenza hemagglutinin protein. Wilson et ah, Cell 37: 767, 1984.
  • any of these above fusion proteins can be engineered using the polynucleotides or the polypeptides of the present technology. Also, in some embodiments, the fusion proteins described herein show an increased half-life in vivo.
  • Fusion proteins having disulfide-linked dimeric structures can be more efficient in binding and neutralizing other molecules compared to the monomeric secreted protein or protein fragment alone.
  • EP-A-0464 533 (Canadian counterpart 2045869) discloses fusion proteins comprising various portions of constant region of immunoglobulin molecules together with another human protein or a fragment thereof.
  • the Fc part in a fusion protein is beneficial in therapy and diagnosis, and thus can result in, e.g, improved pharmacokinetic properties. See EP-A 0232262.
  • deleting or modifying the Fc part after the fusion protein has been expressed, detected, and purified, may be desired.
  • the Fc portion can hinder therapy and diagnosis if the fusion protein is used as an antigen for immunizations.
  • human proteins such as hIL-5
  • Fc portions for the purpose of high-throughput screening assays to identify antagonists of hIL-5. Bennett et al, ./. Molecular Recognition 8: 52-58, 1995; Johanson et al. , J Biol. Chem., 270: 9459-9471, 1995.
  • the anti-CD3 antibody of the present technology is coupled with a label moiety, i.e., detectable group.
  • a label moiety i.e., detectable group.
  • the particular label or detectable group conjugated to the anti-CD3 antibody is not a critical aspect of the technology, so long as it does not significantly interfere with the specific binding of the anti-CD3 antibody of the present technology to the CD3 protein.
  • the detectable group can be any material having a detectable physical or chemical property.
  • detectable labels have been well-developed in the field of immunoassays and imaging. In general, almost any label useful in such methods can be applied to the present technology.
  • a label is any composition detectable by spectroscopic, photochemical, biochemical, immunochemical, electrical, optical or chemical means.
  • Labels useful in the practice of the present technology include magnetic beads (e.g, DynabeadsTM), fluorescent dyes (e.g, fluorescein isothiocyanate, Texas red, rhodamine, and the like), radiolabels (e.g, 3 H, 14 C, 35 S, 125 I, 121 I, 131 I, 112 In, 99 mTc), other imaging agents such as microbubbles (for ultrasound imaging), 18 F, U C, 15 0, 89 Zr (for Positron emission tomography), 99m TC, U1 ln (for Single photon emission tomography), enzymes (e.g, horse radish peroxidase, alkaline phosphatase and others commonly used in an ELISA), and calorimetric labels such as colloidal gold or colored glass or plastic (e.g, polystyrene, polypropylene, latex, and the like) beads.
  • fluorescent dyes e.g, fluorescein isothiocyanate, Texas red
  • Patents that describe the use of such labels include U.S. Pat. Nos. 3,817,837; 3,850,752; 3,939,350; 3,996,345; 4,277,437; 4,275,149; and 4,366,241, each incorporated herein by reference in their entirety and for all purposes. See also Handbook of Fluorescent Probes and Research Chemicals (6 th Ed., Molecular Probes, Inc., Eugene OR.).
  • the label can be coupled directly or indirectly to the desired component of an assay according to methods well known in the art. As indicated above, a wide variety of labels can be used, with the choice of label depending on factors such as required sensitivity, ease of conjugation with the compound, stability requirements, available instrumentation, and disposal provisions. [00237] Non-radioactive labels are often attached by indirect means. Generally, a ligand molecule (e.g ., biotin) is covalently bound to the molecule.
  • a ligand molecule e.g ., biotin
  • the ligand then binds to an anti-ligand (e.g., streptavidin) molecule which is either inherently detectable or covalently bound to a signal system, such as a detectable enzyme, a fluorescent compound, or a chemiluminescent compound.
  • a signal system such as a detectable enzyme, a fluorescent compound, or a chemiluminescent compound.
  • ligands and anti-ligands can be used.
  • a ligand has a natural anti-ligand, e.g, biotin, thyroxine, and cortisol, it can be used in conjunction with the labeled, naturally-occurring anti-ligands.
  • any haptenic or antigenic compound can be used in combination with an antibody, e.g, an anti-CD3 antibody.
  • the molecules can also be conjugated directly to signal generating compounds, e.g, by conjugation with an enzyme or fluorophore.
  • Enzymes of interest as labels will primarily be hydrolases, particularly phosphatases, esterases and glycosidases, or oxidoreductases, particularly peroxidases.
  • Fluorescent compounds useful as labeling moieties include, but are not limited to, e.g, fluorescein and its derivatives, rhodamine and its derivatives, dansyl, umbelliferone, and the like.
  • Chemiluminescent compounds useful as labeling moieties include, but are not limited to, e.g, luciferin, and 2,3- dihydrophthalazinediones, e.g, luminol.
  • Means of detecting labels are well known to those of skill in the art.
  • means for detection include a scintillation counter or photographic film as in autoradiography.
  • the label is a fluorescent label, it can be detected by exciting the fluorochrome with the appropriate wavelength of light and detecting the resulting fluorescence. The fluorescence can be detected visually, by means of photographic film, by the use of electronic detectors such as charge coupled devices (CCDs) or photomultipliers and the like.
  • CCDs charge coupled devices
  • enzymatic labels can be detected by providing the appropriate substrates for the enzyme and detecting the resulting reaction product.
  • simple colorimetric labels can be detected simply by observing the color associated with the label. Thus, in various dipstick assays, conjugated gold often appears pink, while various conjugated beads appear the color of the bead.
  • agglutination assays can be used to detect the presence of the target antibodies, e.g, the anti-CD3 antibodies.
  • antigen-coated particles are agglutinated by samples comprising the target antibodies.
  • none of the components need be labeled and the presence of the target antibody is detected by simple visual inspection.
  • Methods for identifying and/or screening the anti-CD3 antibodies of the present technology include any immunologically- mediated techniques known within the art.
  • cytotoxic T lymphocytes can be incubated with radioactively labeled target cells and the lysis of these target cells detected by the release of radioactivity;
  • helper T lymphocytes can be incubated with antigens and antigen presenting cells and the synthesis and secretion of cytokines measured by standard methods (Windhagen A et al., Immunity, 2: 373-80, 1995); (3) antigen presenting cells can be incubated with whole protein antigen and the presentation of that antigen on MHC detected by either T lymphocyte activation assays or biophysical methods (Harding et al. , Proc. Natl. Acad. Sci. , 86: 4230-4, 1989); (4) mast cells can be incubated with reagents that cross-link their Fc- epsilon receptors and histamine release measured by enzyme immunoassay (Siraganian et al. , TIPS, 4: 432-437, 1983); and (5) enzyme-linked immunosorbent assay (ELISA).
  • ELISA enzyme-linked immunosorbent assay
  • products of an immune response in either a model organism (e.g, mouse) or a human subject can also be detected by various methods that are well known to those of ordinary skill in the art.
  • a model organism e.g, mouse
  • a human subject can also be detected by various methods that are well known to those of ordinary skill in the art.
  • the production of antibodies in response to vaccination can be readily detected by standard methods currently used in clinical laboratories, e.g, an ELISA;
  • the migration of immune cells to sites of inflammation can be detected by scratching the surface of skin and placing a sterile container to capture the migrating cells over scratch site (Peters etal, Blood, 72: 1310-5, 1988);
  • the proliferation of peripheral blood mononuclear cells (PBMCs) in response to mitogens or mixed lymphocyte reaction can be measured using 3 H-thymidine;
  • the phagocytic capacity of granulocytes, macrophages, and other phagocytes in PBMCs can be measured by placing PBMCs
  • anti-CD3 antibodies of the present technology are selected using display of CD3 peptides on the surface of replicable genetic packages. See , e.g, U.S. Pat. Nos. 5,514,548; 5,837,500; 5,871,907; 5,885,793; 5,969,108; 6,225,447; 6,291,650;
  • EP 844306 Methods useful for producing/selecting a filamentous bacteriophage particle containing a phagemid genome encoding for a binding molecule with a desired specificity has been described. See, e.g, EP 774 511; US 5871907; US 5969108; US 6225447; US 6291650; US 6492160.
  • anti-CD3 antibodies of the present technology are selected using display of CD3 peptides on the surface of a yeast host cell. Methods useful for the isolation of scFv polypeptides by yeast surface display have been described by Kieke et al., Protein Eng. 1997 Nov; 10(11): 1303-10.
  • anti-CD3 antibodies of the present technology are selected using ribosome display.
  • Methods useful for identifying ligands in peptide libraries using ribosome display have been described by Mattheakis et al, Proc. Natl. Acad. Sci.
  • anti-CD3 antibodies of the present technology are selected using tRNA display of CD3 peptides. Methods useful for in vitro selection of ligands using tRNA display have been described by Merryman etal, Chem. Biol., 9: 741- 46, 2002.
  • anti-CD3 antibodies of the present technology are selected using RNA display.
  • Methods useful for selecting peptides and proteins using RNA display libraries have been described by Roberts et al. Proc. Natl. Acad. Sci. USA, 94: 12297-302, 1997; and Nemoto et al, FEBS Lett., 414: 405-8, 1997.
  • Methods useful for selecting peptides and proteins using unnatural RNA display libraries have been described by Frankel etal, Curr. Opin. Struct. Biol., 13: 506-12, 2003.
  • anti-CD3 antibodies of the present technology are expressed in the periplasm of gram negative bacteria and mixed with labeled CD3 protein. See WO 02/34886. In clones expressing recombinant polypeptides with affinity for CD3 protein, the concentration of the labeled CD3 protein bound to the anti-CD3 antibodies is increased and allows the cells to be isolated from the rest of the library as described in Harvey etal. , Proc. Natl. Acad. Sci. 22: 9193-982004 and U.S. Pat. Publication No. 2004/0058403.
  • anti-CD3 antibodies which are, e.g., but not limited to, anti-CD3 hybrid antibodies or fragments can be produced by using conventional techniques to construct an expression vector that encodes an antibody heavy chain in which the CDRs and, if necessary, a minimal portion of the variable region framework, that are required to retain original species antibody binding specificity (as engineered according to the techniques described herein) are derived from the originating species antibody and the remainder of the antibody is derived from a target species immunoglobulin which can be manipulated as described herein, thereby producing a vector for the expression of a hybrid antibody heavy chain.
  • a CD3 binding assay refers to an assay format wherein CD3 protein and an anti-CD3 antibody are mixed under conditions suitable for binding between the CD3 protein and the anti-CD3 antibody and assessing the amount of binding between the CD3 protein and the anti-CD3 antibody.
  • the amount of binding is compared with a suitable control, which can be the amount of binding in the absence of the CD3 protein, the amount of the binding in the presence of a non specific immunoglobulin composition, or both.
  • the amount of binding can be assessed by any suitable method.
  • Binding assay methods include, e.g, ELISA, radioimmunoassays, scintillation proximity assays, fluorescence energy transfer assays, liquid chromatography, membrane filtration assays, and the like.
  • Biophysical assays for the direct measurement of CD3 protein binding to anti-CD3 antibody are, e.g, nuclear magnetic resonance, fluorescence, fluorescence polarization, surface plasmon resonance (BIACORE chips) and the like. Specific binding is determined by standard assays known in the art, e.g, radioligand binding assays, ELISA, FRET, immunoprecipitation, SPR, NMR (2D-NMR), mass spectroscopy and the like.
  • the candidate anti-CD3 antibody is useful as an anti-CD3 antibody of the present technology.
  • Uses of the Anti-CD3 Antibodies of the Present Technology [00251] General.
  • the anti-CD3 antibodies of the present technology are useful in methods known in the art relating to the localization and/or quantitation of CD3 protein (e.g ., for use in measuring levels of the CD3 protein within appropriate physiological samples, for use in diagnostic methods, for use in imaging the polypeptide, and the like).
  • Antibodies of the present technology are useful to isolate a CD3 protein by standard techniques, such as affinity chromatography or immunoprecipitation.
  • An anti-CD3 antibody of the present technology can facilitate the purification of natural immunoreactive CD3 proteins from biological samples, e.g., mammalian sera or cells as well as recombinantly-produced immunoreactive CD3 proteins expressed in a host system.
  • anti-CD3 antibodies can be used to detect an immunoreactive CD3 protein (e.g, in plasma, a cellular lysate or cell supernatant) in order to evaluate the abundance and pattern of expression of the immunoreactive polypeptide.
  • the anti-CD3 antibodies of the present technology can be used diagnostically to monitor immunoreactive CD3 protein levels in tissue as part of a clinical testing procedure, e.g, to determine the efficacy of a given treatment regimen.
  • the detection can be facilitated by coupling (i.e., physically linking) the anti-CD3 antibodies of the present technology to a detectable substance.
  • An exemplary method for detecting the presence or absence of an immunoreactive CD3 protein in a biological sample involves obtaining a biological sample from a test subject and contacting the biological sample with an anti-CD3 antibody of the present technology capable of detecting an immunoreactive CD3 protein such that the presence of an immunoreactive CD3 protein is detected in the biological sample. Detection may be accomplished by means of a detectable label attached to the antibody.
  • labeling with regard to the anti-CD3 antibody is intended to encompass direct labeling of the antibody by coupling (i.e., physically linking) a detectable substance to the antibody, as well as indirect labeling of the antibody by reactivity with another compound that is directly labeled, such as a secondary antibody.
  • indirect labeling include detection of a primary antibody using a fluorescently-labeled secondary antibody and end-labeling of a DNA probe with biotin such that it can be detected with fluorescently-labeled streptavidin.
  • the anti-CD3 antibodies disclosed herein are conjugated to one or more detectable labels.
  • anti-CD3 antibodies may be detectably labeled by covalent or non-covalent attachment of a chromogenic, enzymatic, radioisotopic, isotopic, fluorescent, toxic, chemiluminescent, nuclear magnetic resonance contrast agent or other label.
  • chromogenic labels include diaminobenzidine and 4- hydroxyazo-benzene-2-carboxylic acid.
  • suitable enzyme labels include malate dehydrogenase, staphylococcal nuclease, D-5-steroid isomerase, yeast-alcohol dehydrogenase, a-glycerol phosphate dehydrogenase, triose phosphate isomerase, peroxidase, alkaline phosphatase, asparaginase, glucose oxidase, b-galactosidase, ribonuclease, urease, catalase, glucose-6-phosphate dehydrogenase, glucoamylase, and acetylcholine esterase.
  • radioisotopic labels examples include 3 H, U1 ln, 125 I, 131 1, 32 P, 35 S, 14 C, 51 Cr, 57 To, 58 Co, 59 Fe, 75 Se, 152 Eu, 90 Y, 67 Cu, 217 Ci, 211 At, 212 Pb, 47 Sc, 109 Pd, etc.
  • U1 ln is an exemplary isotope where in vivo imaging is used since its avoids the problem of dehalogenation of the 125 I or 131 I-labeled CD3-binding antibodies by the liver. In addition, this isotope has a more favorable gamma emission energy for imaging (Perkins et al , Eur. ./. Nucl. Med.
  • fluorescent labels examples include an 152 Eu label, a fluorescein label, an isothiocyanate label, a rhodamine label, a phycoerythrin label, a phycocyanin label, an allophycocyanin label, a Green Fluorescent Protein (GFP) label, an o-phthaldehyde label, and a fluorescamine label.
  • suitable toxin labels include diphtheria toxin, ricin, and cholera toxin.
  • chemiluminescent labels include a luminol label, an isoluminol label, an aromatic acridinium ester label, an imidazole label, an acridinium salt label, an oxalate ester label, a luciferin label, a luciferase label, and an aequorin label.
  • nuclear magnetic resonance contrasting agents include heavy metal nuclei such as Gd, Mn, and iron.
  • In vitro techniques for detection of an immunoreactive CD3 protein include enzyme linked immunosorbent assays (ELISAs), Western blots, immunoprecipitations, radioimmunoassay, and immunofluorescence.
  • in vivo techniques for detection of an immunoreactive CD3 protein include introducing into a subject a labeled anti-CD3 antibody.
  • the anti-CD3 antibody can be labeled with a radioactive marker whose presence and location in a subject can be detected by standard imaging techniques.
  • the biological sample contains CD3 protein molecules from the test subject.
  • An anti-CD3 antibody of the present technology can be used to assay immunoreactive CD3 protein levels in a biological sample (e.g. , human plasma) using antibody-based techniques.
  • a biological sample e.g. , human plasma
  • protein expression in tissues can be studied with classical immunohistological methods. Jalkanen, M. el at. , ./. Cell. Biol. 101: 976-985, 1985; Jalkanen, M. etal., J. Cell. Biol. 105: 3087-3096, 1987.
  • Other antibody- based methods useful for detecting protein gene expression include immunoassays, such as the enzyme linked immunosorbent assay (ELISA) and the radioimmunoassay (RIA).
  • ELISA enzyme linked immunosorbent assay
  • RIA radioimmunoassay
  • Suitable antibody assay labels are known in the art and include enzyme labels, such as, glucose oxidase, and radioisotopes or other radioactive agent, such as iodine ( 125 I, 121 I, 131 I), carbon ( 14 C), sulfur ( 35 S), tritium ( 3 H), indium ( 112 In), and technetium ( 99 mTc), and fluorescent labels, such as fluorescein, rhodamine, and green fluorescent protein (GFP), as well as biotin.
  • enzyme labels such as, glucose oxidase, and radioisotopes or other radioactive agent, such as iodine ( 125 I, 121 I, 131 I), carbon ( 14 C), sulfur ( 35 S), tritium ( 3 H), indium ( 112 In), and technetium ( 99 mTc)
  • fluorescent labels such as fluorescein, rhodamine, and green fluorescent protein (GFP), as well as biotin.
  • anti-CD3 antibodies of the present technology may be used for in vivo imaging of CD3.
  • Antibodies useful for this method include those detectable by X-radiography, NMR or ESR.
  • suitable labels include radioisotopes such as barium or cesium, which emit detectable radiation but are not overtly harmful to the subject.
  • Suitable markers for NMR and ESR include those with a detectable characteristic spin, such as deuterium, which can be incorporated into the anti-CD3 antibodies by labeling of nutrients for the relevant scFv clone.
  • An anti-CD3 antibody which has been labeled with an appropriate detectable imaging moiety such as a radioisotope (e.g, 131 I, 112 In, 99 mTc), a radio-opaque substance, or a material detectable by nuclear magnetic resonance, is introduced ( e.g ., parenterally, subcutaneously, or intraperitoneally) into the subject.
  • a radioisotope e.g, 131 I, 112 In, 99 mTc
  • a radio-opaque substance e.g., a radio-opaque substance, or a material detectable by nuclear magnetic resonance
  • the quantity of imaging moiety needed to produce diagnostic images.
  • the quantity of radioactivity injected will normally range from about 5 to 20 millicuries of "mTc.
  • the labeled anti-CD3 antibody will then accumulate at the location of cells which contain the specific target polypeptide.
  • labeled anti-CD3 antibodies of the present technology will accumulate within the subject in cells and tissues in
  • the present technology provides a diagnostic method of a medical condition, which involves: (a) assaying the expression of immunoreactive CD3 protein by measuring binding of an anti-CD3 antibody of the present technology in cells or body fluid of an individual; (b) comparing the amount of immunoreactive CD3 protein present in the sample with a standard reference, wherein an increase or decrease in immunoreactive CD3 protein levels compared to the standard is indicative of a medical condition.
  • the anti-CD3 antibodies of the present technology may be used to purify immunoreactive CD3 protein from a sample.
  • the antibodies are immobilized on a solid support.
  • solid supports include plastics such as polycarbonate, complex carbohydrates such as agarose and sepharose, acrylic resins and such as polyacrylamide and latex beads. Techniques for coupling antibodies to such solid supports are well known in the art (Weir et al ., “Handbook of Experimental Immunology” 4th Ed., Blackwell Scientific Publications, Oxford, England, Chapter 10 (1986); Jacoby et al.,Meth. Enzym. 34 Academic Press, N.Y. (1974)).
  • the simplest method to bind the antigen to the antibody-support matrix is to collect the beads in a column and pass the antigen solution down the column.
  • the efficiency of this method depends on the contact time between the immobilized antibody and the antigen, which can be extended by using low flow rates.
  • the immobilized antibody captures the antigen as it flows past.
  • an antigen can be contacted with the antibody-support matrix by mixing the antigen solution with the support (e.g., beads) and rotating or rocking the slurry, allowing maximum contact between the antigen and the immobilized antibody.
  • the slurry is passed into a column for collection of the beads.
  • the beads are washed using a suitable washing buffer and then the pure or substantially pure antigen is eluted.
  • An antibody or polypeptide of interest can be conjugated to a solid support, such as a bead.
  • a first solid support such as a bead
  • a second solid support which can be a second bead or other support, by any suitable means, including those disclosed herein for conjugation of a polypeptide to a support.
  • any of the conjugation methods and means disclosed herein with reference to conjugation of a polypeptide to a solid support can also be applied for conjugation of a first support to a second support, where the first and second solid support can be the same or different.
  • Appropriate linkers which can be cross-linking agents, for use for conjugating a polypeptide to a solid support include a variety of agents that can react with a functional group present on a surface of the support, or with the polypeptide, or both.
  • Reagents useful as cross-linking agents include homo-bi-functional and, in particular, hetero-bi-functional reagents.
  • Useful bi-functional cross-linking agents include, but are not limited to, A-SIAB, dimaleimide, DTNB, N-SATA, N-SPDP, SMCC and 6-HYNIC.
  • a cross-linking agent can be selected to provide a selectively cleavable bond between a polypeptide and the solid support.
  • a photolabile cross-linker such as 3-amino-(2-nitrophenyl)propionic acid can be employed as a means for cleaving a polypeptide from a solid support.
  • a photolabile cross-linker such as 3-amino-(2-nitrophenyl)propionic acid
  • Other cross-linking reagents are well-known in the art. (See, e.g., Wong (1991), supra ; and Hermanson (1996), supra).
  • An antibody or polypeptide can be immobilized on a solid support, such as a bead, through a covalent amide bond formed between a carboxyl group functionalized bead and the amino terminus of the polypeptide or, conversely, through a covalent amide bond formed between an amino group functionalized bead and the carboxyl terminus of the polypeptide.
  • a bi-functional trityl linker can be attached to the support, e.g, to the 4-nitrophenyl active ester on a resin, such as a Wang resin, through an amino group or a carboxyl group on the resin via an amino resin.
  • the solid support can require treatment with a volatile acid, such as formic acid or trifluoroacetic acid to ensure that the polypeptide is cleaved and can be removed.
  • a volatile acid such as formic acid or trifluoroacetic acid
  • the polypeptide can be deposited as a headless patch at the bottom of a well of a solid support or on the flat surface of a solid support.
  • the polypeptide can be desorbed into a MS.
  • Hydrophobic trityl linkers can also be exploited as acid-labile linkers by using a volatile acid or an appropriate matrix solution, e.g ., a matrix solution containing 3 -HP A, to cleave an amino linked trityl group from the polypeptide.
  • Acid lability can also be changed.
  • trityl, monomethoxytrityl, dimethoxytrityl or trimethoxytrityl can be changed to the appropriate ⁇ -substituted, or more acid-labile tritylamine derivatives, of the polypeptide, i.e., trityl ether and tritylamine bonds can be made to the polypeptide.
  • a polypeptide can be removed from a hydrophobic linker, e.g. , by disrupting the hydrophobic attraction or by cleaving tritylether or tritylamine bonds under acidic conditions, including, if desired, under typical MS conditions, where a matrix, such as 3- HPA acts as an acid.
  • Orthogonally cleavable linkers can also be useful for binding a first solid support, e.g. , a bead to a second solid support, or for binding a polypeptide of interest to a solid support.
  • a first solid support e.g. , a bead
  • a second solid support without cleaving the polypeptide from the support; the polypeptide then can be cleaved from the bead at a later time.
  • a disulfide linker which can be cleaved using a reducing agent, such as DTT, can be employed to bind a bead to a second solid support, and an acid cleavable bi-functional trityl group could be used to immobilize a polypeptide to the support.
  • the linkage of the polypeptide to the solid support can be cleaved first, e.g. , leaving the linkage between the first and second support intact.
  • Trityl linkers can provide a covalent or hydrophobic conjugation and, regardless of the nature of the conjugation, the trityl group is readily cleaved in acidic conditions.
  • a bead can be bound to a second support through a linking group which can be selected to have a length and a chemical nature such that high density binding of the beads to the solid support, or high density binding of the polypeptides to the beads, is promoted.
  • a linking group can have, e.g. , “tree-like” structure, thereby providing a multiplicity of functional groups per attachment site on a solid support. Examples of such linking group; include polylysine, polyglutamic acid, penta-erythrole and //v.s-hydroxy- aminomethane.
  • An antibody or polypeptide can be conjugated to a solid support, or a first solid support can also be conjugated to a second solid support, through a noncovalent interaction.
  • a magnetic bead made of a ferromagnetic material which is capable of being magnetized, can be attracted to a magnetic solid support, and can be released from the support by removal of the magnetic field.
  • the solid support can be provided with an ionic or hydrophobic moiety, which can allow the interaction of an ionic or hydrophobic moiety, respectively, with a polypeptide, e.g ., a polypeptide containing an attached trityl group or with a second solid support having hydrophobic character.
  • a solid support can also be provided with a member of a specific binding pair and, therefore, can be conjugated to a polypeptide or a second solid support containing a complementary binding moiety.
  • a bead coated with avidin or with streptavidin can be bound to a polypeptide having a biotin moiety incorporated therein, or to a second solid support coated with biotin or derivative of biotin, such as iminobiotin.
  • biotin e.g.
  • avidin or other biotin binding moiety would be incorporated into the support or the polypeptide, respectively.
  • Other specific binding pairs contemplated for use herein include, but are not limited to, hormones and their receptors, enzyme, and their substrates, a nucleotide sequence and its complementary sequence, an antibody and the antigen to which it interacts specifically, and other such pairs knows to those skilled in the art.
  • the anti-CD3 antibodies of the present technology are useful in diagnostic methods. As such, the present technology provides methods using the antibodies in the diagnosis of CD3 activity in a subject.
  • Anti-CD3 antibodies of the present technology may be selected such that they have any level of epitope binding specificity and very high binding affinity to a CD3 protein. In general, the higher the binding affinity of an antibody the more stringent wash conditions can be performed in an immunoassay to remove nonspecifically bound material without removing target polypeptide.
  • anti-CD3 antibodies of the present technology useful in diagnostic assays usually have binding affinities of about 10 8 M 1 , 10 9 M 1 , 10 10 M 1 , 10 11 M 1 or 10 12 M 1 . Further, it is desirable that anti-CD3 antibodies used as diagnostic reagents have a sufficient kinetic on- rate to reach equilibrium under standard conditions in at least 12 h, at least five (5) h, or at least one (1) hour.
  • Anti-CD3 antibodies can be used to detect an immunoreactive CD3 protein in a variety of standard assay formats. Such formats include immunoprecipitation, Western blotting, ELISA, radioimmunoassay, and immunometric assays. See Harlow & Lane, Antibodies, A Laboratory Manual (Cold Spring Harbor Publications, New York, 1988); U.S. Pat. Nos.
  • Bio samples can be obtained from any tissue or body fluid of a subject.
  • the subject is at an early stage of cancer.
  • the early stage of cancer is determined by the level or expression pattern of CD3 protein in a sample obtained from the subject.
  • the sample is selected from the group consisting of urine, blood, serum, plasma, saliva, amniotic fluid, cerebrospinal fluid (CSF), and biopsied body tissue.
  • Immunometric or sandwich assays are one format for the diagnostic methods of the present technology. See U.S. Pat. No. 4,376,110, 4,486,530, 5,914,241, and 5,965,375.
  • Such assays use one antibody, e.g ., an anti-CD3 antibody or a population of anti-CD3 antibodies immobilized to a solid phase, and another anti-CD3 antibody or a population of anti-CD3 antibodies in solution.
  • the solution anti-CD3 antibody or population of anti-CD3 antibodies is labeled. If an antibody population is used, the population can contain antibodies binding to different epitope specificities within the target polypeptide. Accordingly, the same population can be used for both solid phase and solution antibody.
  • first and second CD3 monoclonal antibodies having different binding specificities are used for the solid and solution phase.
  • Solid phase (also referred to as “capture”) and solution (also referred to as “detection”) antibodies can be contacted with target antigen in either order or simultaneously. If the solid phase antibody is contacted first, the assay is referred to as being a forward assay. Conversely, if the solution antibody is contacted first, the assay is referred to as being a reverse assay. If the target is contacted with both antibodies simultaneously, the assay is referred to as a simultaneous assay.
  • a sample is incubated for a period that usually varies from about 10 min to about 24 hr and is usually about 1 hr.
  • a wash step is then performed to remove components of the sample not specifically bound to the anti-CD3 antibody being used as a diagnostic reagent.
  • a wash can be performed after either or both binding steps.
  • binding is quantified, typically by detecting a label linked to the solid phase through binding of labeled solution antibody.
  • a calibration curve is prepared from samples containing known concentrations of target antigen.
  • Concentrations of the immunoreactive CD3 protein in samples being tested are then read by interpolation from the calibration curve (i.e., standard curve).
  • Analyte can be measured either from the amount of labeled solution antibody bound at equilibrium or by kinetic measurements of bound labeled solution antibody at a series of time points before equilibrium is reached. The slope of such a curve is a measure of the concentration of the CD3 protein in a sample.
  • Suitable supports for use in the above methods include, e.g ., nitrocellulose membranes, nylon membranes, and derivatized nylon membranes, and also particles, such as agarose, a dextran-based gel, dipsticks, particulates, microspheres, magnetic particles, test tubes, microtiter wells, SEPHADEXTM (Amersham Pharmacia Biotech, Piscataway N. J.), and the like. Immobilization can be by absorption or by covalent attachment.
  • anti-CD3 antibodies can be joined to a linker molecule, such as biotin for attachment to a surface bound linker, such as avidin.
  • the present disclosure provides an anti-CD3 antibody of the present technology conjugated to a diagnostic agent.
  • the diagnostic agent may comprise a radioactive or non-radioactive label, a contrast agent (such as for magnetic resonance imaging, computed tomography or ultrasound), and the radioactive label can be a gamma-, beta-, alpha-, Auger electron-, or positron-emitting isotope.
  • a diagnostic agent is a molecule which is administered conjugated to an antibody moiety, i.e., antibody or antibody fragment, or subfragment, and is useful in diagnosing or detecting a disease by locating the cells containing the antigen.
  • Useful diagnostic agents include, but are not limited to, radioisotopes, dyes (such as with the biotin-streptavidin complex), contrast agents, fluorescent compounds or molecules and enhancing agents (e.g., paramagnetic ions) for magnetic resonance imaging (MRI).
  • MRI magnetic resonance imaging
  • enhancing agents e.g., paramagnetic ions
  • U.S. Pat. No. 6,331,175 describes MRI technique and the preparation of antibodies conjugated to a MRI enhancing agent and is incorporated in its entirety by reference.
  • the diagnostic agents are selected from the group consisting of radioisotopes, enhancing agents for use in magnetic resonance imaging, and fluorescent compounds.
  • a reagent having a long tail to which are attached a multiplicity of chelating groups for binding the ions.
  • a tail can be a polymer such as a polylysine, polysaccharide, or other derivatized or derivatizable chain having pendant groups to which can be bound chelating groups such as, e.g., ethylenediaminetetraacetic acid (EDTA), diethylenetriaminepentaacetic acid (DTP A), porphyrins, polyamines, crown ethers, bis-thiosemicarbazones, polyoximes, and like groups known to be useful for this purpose.
  • EDTA ethylenediaminetetraacetic acid
  • DTP A diethylenetriaminepentaacetic acid
  • porphyrins polyamines, crown ethers, bis-thiosemicarbazones, polyoximes, and like groups known to be useful for this purpose.
  • Chelates may be coupled to the antibodies of the present technology using standard chemistries.
  • the chelate is normally linked to the antibody by a group which enables formation of a bond to the molecule with minimal loss of immunoreactivity and minimal aggregation and/or internal cross-linking.
  • Other methods and reagents for conjugating chelates to antibodies are disclosed in U.S. Pat. No. 4,824,659.
  • Particularly useful metal-chelate combinations include 2-benzyl-DTPA and its monomethyl and cyclohexyl analogs, used with diagnostic isotopes for radio-imaging.
  • the same chelates, when complexed with non-radioactive metals, such as manganese, iron and gadolinium are useful for MRI, when used along with the CD3 antibodies of the present technology.
  • Macrocyclic chelates such as NOTA (l,4,7-triaza-cyclononane-N,N',N"-triacetic acid), DOTA, and TETA (p-bromoacetamido-benzyl-tetraethylaminetetraacetic acid) are of use with a variety of metals and radiometals, such as radionuclides of gallium, yttrium and copper, respectively. Such metal-chelate complexes can be stabilized by tailoring the ring size to the metal of interest.
  • ring-type chelates such as macrocyclic polyethers, which are of interest for stably binding nuclides, such as 223 Ra for RAIT are also contemplated.
  • the immunoglobulin-related compositions e.g ., antibodies or antigen binding fragments thereof
  • the immunoglobulin-related compositions are useful for the treatment of solid tumors or liquid tumors.
  • Non-limiting examples of suitable solid or liquid tumors include adrenal cancers, bladder cancers, blood cancers, bone cancers, brain cancers, breast cancers, carcinoma, cervical cancers, colon cancers, colorectal cancers, corpus uterine cancers, ear, nose and throat (ENT) cancers, endometrial cancers, esophageal cancers, gastrointestinal cancers, head and neck cancers, Hodgkin's disease, intestinal cancers, kidney cancers, larynx cancers, acute and chronic leukemias, liver cancers, lymph node cancers, lymphomas, lung cancers, melanomas, mesothelioma, myelomas, nasopharynx cancers, neuroblastomas, non-Hodgkin's lymphoma, oral cancers, ovarian cancers, pancreatic cancers, penile cancers, pharynx cancers, prostate cancers, rectal cancers, sarcoma, seminomas, skin cancers, stomach cancers
  • the immunoglobulin-related compositions are useful for the treatment of CD 3 -associated pathologies, such as multiple sclerosis (MS), rheumatoid arthritis (RA), systemic lupus erythematosus, Celiac disease, Sympathetic ophthalmia, Type 1 diabetes, graft-versus-host disease, precursor T acute lymphoblastic leukemia/lymphoma, anaplastic large-cell lymphoma, lymphomatoid papulosis type A, Mycosis fungoides, pagetoid reticulosis, granulomatous slack skin, Sezary disease, adult T-cell leukemia/lymphoma, cutaneous large T cell lymphoma, pleomorphic T-cell lymphoma, lymphomatoid papulosis type B, secondary cutaneous CD30+ large-cell lymphoma, hepato
  • Such treatment can be used in patients identified as having pathologically high levels of the CD3 (e.g ., those diagnosed by the methods described herein) or in patients diagnosed with a disease known to be associated with such pathological levels.
  • the present disclosure provides a method for treating a CD3 -associated pathology in a subject in need thereof, comprising administering to the subject an effective amount of an antibody (or antigen binding fragment thereof) of the present technology.
  • CD3 -associated pathologies that can be treated by the antibodies of the present technology include, but are not limited to: multiple sclerosis (MS), rheumatoid arthritis (RA), systemic lupus erythematosus, Celiac disease, Sympathetic ophthalmia, Type 1 diabetes, graft-versus-host disease, precursor T acute lymphoblastic leukemia/lymphoma, anaplastic large-cell lymphoma, lymphomatoid papulosis type A, Mycosis fungoides, pagetoid reticulosis, granulomatous slack skin, Sezary disease, adult T-cell leukemia/lymphoma, cutaneous large T cell lymphoma, pleomorphic T-cell lymphoma, lymphomatoid papulosis type B, secondary cutaneous CD30+ large-cell lymphoma, hepatosplenic T-cell lymphoma, angioimmunoblastic T-cell lymphom
  • compositions of the present technology may be employed in conjunction with other therapeutic agents useful in the treatment of autoimmune diseases or T-cell malignancies.
  • the antibodies of the present technology may be separately, sequentially or simultaneously administered with at least one additional therapeutic agent selected from the group consisting of non-steroidal anti-inflammatory drugs (NSAIDs), selective COX-2 inhibitors, glucocorticoids, and conventional disease-modifying anti rheumatic drugs (cDMARDs).
  • NSAIDs non-steroidal anti-inflammatory drugs
  • COX-2 inhibitors selective COX-2 inhibitors
  • glucocorticoids glucocorticoids
  • cDMARDs conventional disease-modifying anti rheumatic drugs
  • NSAIDs include, but are not limited to, (1) salicylic acid derivatives: acetylsalicylic acid (aspirin), diflunisal and sulfasalazine; (2) para-aminophenol derivatives: acetaminophen; (3) fenamates: mefenamic acid, meclofenamate, flufenamic acid; (4) propionic acid derivatives: ibuprofen, naproxen, fenoprofen, ketoprofen, flurbiprofen, oxaprozin; and (5) enolic acid (oxicam) derivatives: piroxicam, tenoxicam.
  • salicylic acid derivatives acetylsalicylic acid (aspirin), diflunisal and sulfasalazine
  • para-aminophenol derivatives acetaminophen
  • fenamates mefenamic acid, meclofenamate, flufena
  • Examples of selective COX-2 inhibitors include, but are not limited to, meloxicam, salicylate, nimesulide, celecoxib, ofecoxib, valdecoxib, lumiracoxib, parecoxib, and etoricoxib.
  • Examples of glucocorticoids include, but are not limited to, prednisone/prednisolone, methylprednisolone, and fluorinated glucocorticoids such as dexamethasone and betamethasone.
  • DMARDS examples include, but are not limited to, methotrexate, leflunomide, gold compounds, sulfasalazine, azathioprine, cyclophosphamide, antimalarials, d-penicillamine, cyclosporine, hydroxychloroquine, etanercept, infliximab, adalimumab, golimumab, and certolizumab pegol.
  • compositions of the present technology may be employed in conjunction with other therapeutic agents useful in the treatment of CD3 -associated cancers.
  • the antibodies of the present technology may be separately, sequentially or simultaneously administered with at least one additional therapeutic agent-selected from the group consisting of alkylating agents, platinum agents, taxanes, vinca agents, anti-estrogen drugs, aromatase inhibitors, ovarian suppression agents, VEGF/VEGFR inhibitors, EGF/EGFR inhibitors, PARP inhibitors, cytostatic alkaloids, cytotoxic antibiotics, antimetabolites, endocrine/hormonal agents, bisphosphonate therapy agents and targeted biological therapy agents (e.g ., therapeutic peptides described in US 6306832, WO 2012007137, WO 2005000889, WO 2010096603 etc.).
  • the at least one additional therapeutic agent is a chemotherapeutic agent.
  • chemotherapeutic agents include, but are not limited to, cyclophosphamide, fluorouracil (or 5-fluorouracil or 5-FU), methotrexate, edatrexate (10-ethyl- 10-deaza-aminopterin), thiotepa, carboplatin, cisplatin, taxanes, paclitaxel, protein-bound paclitaxel, docetaxel, vinorelbine, tamoxifen, raloxifene, toremifene, fulvestrant, gemcitabine, irinotecan, ixabepilone, temozolmide, topotecan, vincristine, vinblastine, eribulin, mutamycin, capecitabine, anastrozole, exemestane, letrozole, leuprolide, abarelix, buserlin, go
  • compositions of the present technology may optionally be administered as a single bolus to a subject in need thereof.
  • the dosing regimen may comprise multiple administrations performed at various times after the appearance of tumors.
  • Administration can be carried out by any suitable route, including orally, intranasally, parenterally (intravenously, intramuscularly, intraperitoneally, or subcutaneously), rectally, intracranially, intratumorally, intrathecally, or topically. Administration includes self-administration and the administration by another. It is also to be appreciated that the various modes of treatment of medical conditions as described are intended to mean “substantial”, which includes total but also less than total treatment, and wherein some biologically or medically relevant result is achieved.
  • the antibodies of the present technology comprise pharmaceutical formulations which may be administered to subjects in need thereof in one or more doses. Dosage regimens can be adjusted to provide the desired response (e.g ., a therapeutic response).
  • an effective amount of the antibody compositions of the present technology ranges from about 0.000001 mg per kilogram body weight per day to about 10,000 mg per kilogram body weight per day.
  • the dosage ranges are from about 0.0001 mg per kilogram body weight per day to about 100 mg per kilogram body weight per day.
  • the dosage ranges from about 0.0001 to 100 mg/kg, and more usually 0.01 to 5 mg/kg every week, every two weeks or every three weeks, of the subject body weight.
  • dosages can be 1 mg/kg body weight or 10 mg/kg body weight every week, every two weeks or every three weeks or within the range of 1-10 mg/kg every week, every two weeks or every three weeks.
  • a single dosage of antibody ranges from 0.1-10,000 micrograms per kg body weight. In one embodiment, antibody concentrations in a carrier range from 0.2 to 2000 micrograms per delivered milliliter.
  • An exemplary treatment regime entails administration once per every two weeks or once a month or once every 3 to 6 months.
  • Anti-CD3 antibodies may be administered on multiple occasions. Intervals between single dosages can be hourly, daily, weekly, monthly or yearly. Intervals can also be irregular as indicated by measuring blood levels of the antibody in the subject.
  • dosage is adjusted to achieve a serum antibody concentration in the subject of from about 75 pg/mL to about 125 pg/mL, 100 pg/mL to about 150 pg/mL, from about 125 pg/mL to about 175 pg/mL, or from about 150 pg/mL to about 200 pg/mL.
  • anti-CD3 antibodies can be administered as a sustained release formulation, in which case less frequent administration is required.
  • Dosage and frequency vary depending on the half-life of the antibody in the subject. The dosage and frequency of administration can vary depending on whether the treatment is prophylactic or therapeutic. In prophylactic applications, a relatively low dosage is administered at relatively infrequent intervals over a long period of time. In therapeutic applications, a relatively high dosage at relatively short intervals is sometimes required until progression of the disease is reduced or terminated, or until the subject shows partial or complete amelioration of symptoms of disease. Thereafter, the patient can be administered a prophylactic regime.
  • the present disclosure provides a method for detecting cancer in a subject in vivo comprising (a) administering to the subject an effective amount of an antibody (or antigen binding fragment thereof) of the present technology, wherein the antibody is configured to localize to a cancer cell expressing CD3 and is labeled with a radioisotope; and (b) detecting the presence of a tumor in the subject by detecting radioactive levels emitted by the antibody that are higher than a reference value.
  • the reference value is expressed as injected dose per gram (%ID/g).
  • the reference value may be calculated by measuring the radioactive levels present in non-tumor (normal) tissues, and computing the average radioactive levels present in non-tumor (normal) tissues ⁇ standard deviation.
  • the ratio of radioactive levels between a tumor and normal tissue is about 2: 1, 3: 1, 4: 1, 5: 1, 6: 1, 7: 1, 8: 1, 9: 1, 10: 1, 15: 1, 20: 1, 25: 1, 30: 1, 35: 1, 40: 1, 45: 1, 50:1, 55: 1, 60: 1, 65: 1, 70: 1, 75: 1, 80: 1, 85: 1, 90:1, 95: 1 or 100: 1.
  • the subject is diagnosed with or is suspected of having cancer.
  • Radioactive levels emitted by the antibody may be detected using positron emission tomography or single photon emission computed tomography.
  • the method further comprises administering to the subject an effective amount of an immunoconjugate comprising an antibody of the present technology conjugated to a radionuclide.
  • the radionuclide is an alpha particle-emitting isotope, a beta particle-emitting isotope, an Auger-emitter, or any combination thereof. Examples of beta particle-emitting isotopes include 86 Y, 90 Y, 89 Sr, 165 Dy, 186 Re, 188 Re, 177 Lu, and 67 Cu.
  • alpha particle-emitting isotopes examples include 213 Bi, 211 At, 225 Ac, 152 Dy, 212 Bi, 223 Ra, 219 Rn, 215 Po, 211 Bi, 22i Fr, 217 At, and 255 Fm.
  • Auger-emitters include U1 ln, 67 Ga, 51 Cr, 58 Co, 99m Tc, 103m Rh, 195m Pt, 119 Sb, 161 HO, 189m Os, 192 Ir, 201 T1, and 203 Pb.
  • nonspecific FcR-dependent binding in normal tissues is eliminated or reduced ( e.g ., via N297A mutation in Fc region, which results in aglycosylation).
  • the therapeutic effectiveness of such an immunoconjugate may be determined by computing the area under the curve (AUC) tumor: AUC normal tissue ratio.
  • the immunoconjugate has a AUC tumor: AUC normal tissue ratio of about 2: 1, 3:1, 4: 1, 5: 1, 6:1, 7:1, 8:1, 9:1, 10:1, 15:1, 20:1, 25:1, 30:1, 35:1, 40:1, 45:1, 50:1, 55:1, 60:1, 65:1, 70:1, 75:1, 80:1, 85:1, 90:1, 95:1 or 100:1.
  • the present disclosure provides a method for detecting tumors in a subject in need thereof comprising (a) administering to the subject an effective amount of a complex comprising a radiolabeled DOTA hapten and a multi-specific antibody or antigen binding fragment of the present technology that binds to the radiolabeled DOTA hapten, a tumor antigen, and a CD3 antigen, wherein the complex is configured to localize to a tumor expressing the tumor antigen recognized by the multi-specific antibody or antigen binding fragment of the complex; and (b) detecting the presence of tumors in the subject by detecting radioactive levels emitted by the complex that are higher than a reference value.
  • the subject is human.
  • the present disclosure provides a method for selecting a subject for pretargeted radioimmunotherapy comprising (a) administering to the subject an effective amount of a complex comprising a radiolabeled DOTA hapten and a multi-specific antibody or antigen binding fragment of the present technology that binds to the radiolabeled DOTA hapten, a tumor antigen, and a CD3 antigen, wherein the complex is configured to localize to a tumor expressing the tumor antigen recognized by the multi-specific antibody or antigen binding fragment of the complex; (b) detecting radioactive levels emitted by the complex; and (c) selecting the subject for pretargeted radioimmunotherapy when the radioactive levels emitted by the complex are higher than a reference value.
  • the subject is human.
  • Also disclosed herein is a method for selecting a subject for pretargeted radioimmunotherapy comprising (a) administering to the subject an effective amount of the multi-specific antibody or antigen binding fragment of the present technology that binds to a radiolabeled DOTA hapten, a tumor antigen, and a CD3 antigen, wherein the multi specific antibody is configured to localize to a tumor expressing the tumor antigen recognized by the multi-specific antibody or antigen binding fragment; (b) administering an effective amount of a radiolabeled-DOTA hapten to the subject, wherein the radiolabeled- DOTA hapten is configured to bind to the multi-specific antibody or antigen binding fragment; (c) detecting radioactive levels emitted by the multi-specific antibody; and (d) selecting the subject for pretargeted radioimmunotherapy when the radioactive levels emitted by the multi-specific antibody are higher than a reference value.
  • DOTA haptens include (i) DOTA-Phe-Lys(HSG)-D-Tyr- Lys(HSG)-NH 2 ; (ii) Ac-Lys(HSG)D-Tyr-Lys(HSG)-Lys(Tscg-Cys)-NH2; (iii) DOTA-D- Asp-D-Lys(HSG)-D-Asp-D-Lys(HSG)-NH 2 ; (iv) DOTA-D-Glu-D-Lys(HSG)-D-Glu-D- Lys(HSG)-NH 2 ; (v) DOTA-D-Tyr-D-Lys(HSG)-D-Glu-D-Lys(HSG)-NH 2 ; (vi) DOTA-D- Ala-D-Lys(HSG)-D-Glu-D-Lys(HSG)-NH 2 ; (vii)
  • the radioactive levels emitted by the complex are detected using positron emission tomography or single photon emission computed tomography.
  • the subject is diagnosed with, or is suspected of having multiple sclerosis (MS), rheumatoid arthritis (RA), systemic lupus erythematosus, Celiac disease, Sympathetic ophthalmia, Type 1 diabetes, graft-versus-host disease, precursor T acute lymphoblastic leukemia/lymphoma, anaplastic large-cell lymphoma, lymphomatoid papulosis type A, Mycosis fungoides, pagetoid reticulosis, granulomatous slack skin, Sezary disease, adult T- cell leukemia/lymphoma, cutaneous large T cell lymphoma, pleomorphic T-cell lymphoma, lymphomatoid papulosis type B, secondary cutaneous CD30+ large-cell lymphoma, hepatosplenic T-cell lymphoma, angioimmunoblastic T-cell lymph lymph
  • the subject is diagnosed with, or is suspected of having adrenal cancers, bladder cancers, blood cancers, bone cancers, brain cancers, breast cancers, carcinoma, cervical cancers, colon cancers, colorectal cancers, corpus uterine cancers, ear, nose and throat (ENT) cancers, endometrial cancers, esophageal cancers, gastrointestinal cancers, head and neck cancers, Hodgkin's disease, intestinal cancers, kidney cancers, larynx cancers, acute and chronic leukemias, liver cancers, lymph node cancers, lymphomas, lung cancers, melanomas, mesothelioma, myelomas, nasopharynx cancers, neuroblastomas, non-Hodgkin's lymphoma, oral cancers, ovarian cancers, pancreatic cancers, penile cancers, pharynx cancers, prostate cancers, rectal cancers, sarcoma, seminoma
  • the complex is administered intravenously, intramuscularly, intraarterially, intrathecally, intracapsularly, intraorbitally, intradermally, intraperitoneally, transtracheally, subcutaneously, intracerebroventricularly, orally, intratumorally, or intranasally.
  • the complex is administered into the cerebral spinal fluid or blood of the subject.
  • the radioactive levels emitted by the complex are detected between 2 to 120 hours after the complex is administered.
  • the radioactive levels emitted by the complex are expressed as the percentage injected dose per gram tissue (%ID/g).
  • the reference value may be calculated by measuring the radioactive levels present in non-tumor (normal) tissues, and computing the average radioactive levels present in non-tumor (normal) tissues ⁇ standard deviation.
  • the reference value is the standard uptake value (SUV). See Thie JA, JNucl Med. 45(9): 1431-4 (2004).
  • the ratio of radioactive levels between a tumor and normal tissue is about 2:1, 3:1, 4:1, 5:1, 6:1, 7:1, 8:1, 9:1, 10:1, 15:1, 20:1, 25:1, 30:1, 35:1, 40:1, 45:1, 50:1, 55:1, 60:1, 65:1, 70:1, 75:1, 80:1, 85:1, 90:1, 95:1 or 100:1.
  • the present disclosure provides a method for increasing tumor sensitivity to radiation therapy in a subject diagnosed with cancer comprising (a) administering to the subject an effective amount of the multi-specific antibody or antigen binding fragment of the present technology that binds to a radiolabeled DOTA hapten, a tumor antigen, and a CD3 antigen, wherein the multi-specific antibody is configured to localize to a tumor expressing the tumor antigen recognized by the multi-specific antibody or antigen binding fragment; and (b) administering an effective amount of a radiolabeled- DOTA hapten to the subject, wherein the radiolabeled-DOTA hapten is configured to bind to the multi-specific antibody or antigen binding fragment.
  • the subject is human.
  • the anti-DOTA multi-specific antibody is administered under conditions and for a period of time (e.g ., according to a dosing regimen) sufficient for it to saturate tumor cells.
  • unbound anti-DOTA multi-specific antibody is removed from the blood stream after administration of the anti-DOTA multi-specific antibody.
  • the radiolabeled-DOTA hapten is administered after a time period that may be sufficient to permit clearance of unbound anti-DOTA multi-specific antibody.
  • the radiolabeled-DOTA hapten may be administered at any time between 1 minute to 4 or more days following administration of the anti-DOTA multi-specific antibody.
  • the radiolabeled-DOTA hapten is administered 1 minute, 2 minutes, 3 minutes, 4 minutes, 5 minutes, 10 minutes, 15 minutes, 20 minutes, 25 minutes, 30 minutes, 35 minutes, 40 minutes, 45 minutes, 50 minutes, 55 minutes, 1 hour, 1.25 hours, 1.5 hours, 1.75 hours, 2 hours, 2.5 hours, 3 hours, 3.5 hours, 4 hours, 4.5 hours, 5 hours, 5.5 hours, 6 hours, 6.5 hours, 7 hours, 7.5 hours, 8 hours, 8.5 hours, 9 hours, 9.5 hours, 10 hours, 11 hours, 12 hours, 13 hours, 14 hours, 15 hours, 16 hours, 17 hours, 18 hours, 19 hours, 20 hours, 21 hours, 22 hours, 23 hours, 24 hours, 48 hours, 72 hours, 96 hours, or any range therein, following administration of the anti-DOTA multi-specific antibody.
  • the radiolabeled-DOTA hapten
  • the method further comprises administering an effective amount of a clearing agent to the subject prior to administration of the radiolabeled-DOTA hapten.
  • a clearing agent can be any molecule (dextran or dendrimer or polymer) that can be conjugated with C825-hapten.
  • the clearing agent is no more than 2000 kD, 1500 kD, 1000 kD, 900 kD, 800 kD, 700 kD, 600 kD, 500 kD, 400 kD, 300 kD, 200 kD, 100 kD, 90 kD, 80 kD, 70 kD, 60 kD, 50 kD, 40 kD, 30 kD, 20 kD, 10 kD, or 5kD.
  • the clearing agent is a 500 kD aminodextran-DOTA conjugate (e.g., 500 kD dextran-DOTA-Bn (Y), 500 kD dextran-DOTA-Bn (Lu), or 500 kD dextran-DOTA-Bn (In) etc.).
  • the clearing agent and the radiolabeled-DOTA hapten are administered without further administration of the anti-DOTA multi-specific antibody or antigen binding fragment of the present technology.
  • an anti-DOTA multi-specific antibody or antigen binding fragment of the present technology is administered according to a regimen that includes at least one cycle of: (i) administration of the anti-DOTA multi-specific antibody or antigen binding fragment of the present technology (optionally so that relevant tumor cells are saturated); (ii) administration of a radiolabeled-DOTA hapten and, optionally a clearing agent; (iii) optional additional administration of the radiolabeled-DOTA hapten and/or the clearing agent, without additional administration of the anti-DOTA multi-specific antibody.
  • the method may comprise multiple such cycles (e.g ., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more cycles).
  • the anti- DOTA multi-specific antibody and/or the radiolabeled-DOTA hapten is administered intravenously, intramuscularly, intraarterially, intrathecally, intracapsularly, intraorbitally, intradermally, intraperitoneally, transtracheally, subcutaneously, intracerebroventricularly, intratumorally, orally or intranasally.
  • the present disclosure provides a method for increasing tumor sensitivity to radiation therapy in a subject diagnosed with cancer comprising administering to the subject an effective amount of a complex comprising a radiolabeled-DOTA hapten and a multi-specific antibody or antigen binding fragment of the present technology that recognizes and binds to the radiolabeled-DOTA hapten, a CD3 antigen and a tumor antigen, wherein the complex is configured to localize to a tumor expressing the tumor antigen recognized by the multi-specific antibody or antigen binding fragment of the complex.
  • the complex may be administered intravenously, intramuscularly, intraarterially, intrathecally, intracapsularly, intraorbitally, intradermally, intraperitoneally, transtracheally, subcutaneously, intracerebroventricularly, orally, intratumorally, or intranasally.
  • the subject is human.
  • the present disclosure provides a method for treating cancer in a subject in need thereof comprising (a) administering an effective amount of an anti-DOTA multi-specific antibody or antigen binding fragment of the present technology to the subject, wherein the anti-DOTA multi-specific antibody is configured to (i) bind to a CD3 antigen, and (ii) bind and localize to a tumor antigen; and (b) administering an effective amount of a radiolabeled-DOTA hapten to the subject, wherein the radiolabeled-DOTA hapten is configured to bind to the anti-DOTA multi-specific antibody or antigen binding fragment.
  • the anti-DOTA multi-specific antibody is administered under conditions and for a period of time (e.g ., according to a dosing regimen) sufficient for it to saturate tumor cells.
  • unbound anti-DOTA multi-specific antibody is removed from the blood stream after administration of the anti-DOTA multi-specific antibody.
  • the radiolabeled-DOTA hapten is administered after a time period that may be sufficient to permit clearance of unbound anti-DOTA multi-specific antibody.
  • the subject is human.
  • the method further comprises administering an effective amount of a clearing agent to the subject prior to administration of the radiolabeled-DOTA hapten.
  • the radiolabeled-DOTA hapten may be administered at any time between 1 minute to 4 or more days following administration of the anti-DOTA multi specific antibody.
  • the radiolabeled-DOTA hapten is administered 1 minute, 2 minutes, 3 minutes, 4 minutes, 5 minutes, 10 minutes, 15 minutes, 20 minutes, 25 minutes, 30 minutes, 35 minutes, 40 minutes, 45 minutes, 50 minutes, 55 minutes, 1 hour, 1.25 hours, 1.5 hours, 1.75 hours, 2 hours, 2.5 hours, 3 hours, 3.5 hours, 4 hours, 4.5 hours, 5 hours, 5.5 hours, 6 hours, 6.5 hours, 7 hours, 7.5 hours, 8 hours, 8.5 hours, 9 hours, 9.5 hours, 10 hours, 11 hours, 12 hours, 13 hours, 14 hours, 15 hours, 16 hours, 17 hours, 18 hours, 19 hours, 20 hours, 21 hours, 22 hours, 23 hours, 24 hours, 48 hours, 72 hours, 96 hours, or any range therein, following administration of the anti-DOTA multi-specific antibody.
  • the radiolabeled-DOTA hapten may be administered at any time after 4 or more days following administration of the anti-DOTA multi-specific antibody.
  • the clearing agent may be a 500 kD aminodextran-DOTA conjugate (e.g., 500 kD dextran-DOTA-Bn (Y), 500 kD dextran-DOTA-Bn (Lu), or 500 kD dextran-DOTA-Bn (In) etc.).
  • the clearing agent and the radiolabeled-DOTA hapten are administered without further administration of the anti-DOTA multi-specific antibody.
  • an anti-DOTA multi-specific antibody is administered according to a regimen that includes at least one cycle of: (i) administration of the an anti- DOTA multi-specific antibody or antigen binding fragment of the present technology (optionally so that relevant tumor cells are saturated); (ii) administration of a radiolabeled- DOTA hapten and, optionally a clearing agent; (iii) optional additional administration of the radiolabeled-DOTA hapten and/or the clearing agent, without additional administration of the anti-DOTA multi-specific antibody.
  • the method may comprise multiple such cycles (e.g ., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more cycles).
  • Also provided herein are methods for treating cancer in a subject in need thereof comprising administering to the subject an effective amount of a complex comprising a radiolabeled-DOTA hapten and a multi-specific antibody or antigen binding fragment of the present technology that recognizes and binds to the radiolabeled-DOTA hapten, a CD3 antigen, and a tumor antigen, wherein the complex is configured to localize to a tumor expressing the tumor antigen recognized by the multi-specific antibody of the complex.
  • the therapeutic effectiveness of such a complex may be determined by computing the area under the curve (AUC) tumor: AUC normal tissue ratio.
  • AUC tumor AUC normal tissue ratio of about 2:1, 3:1, 4:1, 5:1, 6:1, 7:1,
  • the tumor antigen is selected from the group consisting of CD3, GPA33, HER2/neu, GD2, MAGE-1, MAGE-3, BAGE, GAGE-1, GAGE-2, MUM-1, CDK4, N-acetylglucosaminyltransferase, pl5, gp75, beta-catenin, ErbB2, cancer antigen 125 (CA-125), carcinoembryonic antigen (CEA), RAGE, MART (melanoma antigen), MUC-1, MUC-2, MUC-3, MUC-4, MUC-5ac, MUC- 16, MUC-17, tyrosinase, Pmel 17 (gplOO), GnT-V intron V sequence (N- acetylglucoaminyltransferase V intron V sequence), Prostate cancer psm, PRAME (melanoma antigen), b-catenin, EBNA (Epstein
  • Toxicity Optimally, an effective amount (e.g ., dose) of an anti-CD3 antibody described herein will provide therapeutic benefit without causing substantial toxicity to the subject.
  • Toxicity of the anti-CD3 antibody described herein can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., by determining the LD50 (the dose lethal to 50% of the population) or the LD100 (the dose lethal to 100% of the population). The dose ratio between toxic and therapeutic effect is the therapeutic index. The data obtained from these cell culture assays and animal studies can be used in formulating a dosage range that is not toxic for use in human.
  • the dosage of the anti-CD3 antibody described herein lies within a range of circulating concentrations that include the effective dose with little or no toxicity.
  • the dosage can vary within this range depending upon the dosage form employed and the route of administration utilized.
  • the exact formulation, route of administration and dosage can be chosen by the individual physician in view of the subject’s condition. See, e.g., Fingl et al, In: The Pharmacological Basis of Therapeutics, Ch. 1 (1975).
  • the anti-CD3 antibody can be incorporated into pharmaceutical compositions suitable for administration.
  • the pharmaceutical compositions generally comprise recombinant or substantially purified antibody and a pharmaceutically-acceptable carrier in a form suitable for administration to a subject.
  • Pharmaceutically-acceptable carriers are determined in part by the particular composition being administered, as well as by the particular method used to administer the composition. Accordingly, there is a wide variety of suitable formulations of pharmaceutical compositions for administering the antibody compositions (See, e.g., Remington’ s Pharmaceutical Sciences, Mack Publishing Co., Easton, PA 18 th ed., 1990).
  • the pharmaceutical compositions are generally formulated as sterile, substantially isotonic and in full compliance with all Good Manufacturing Practice (GMP) regulations of the U.S. Food and Drug Administration.
  • GMP Good Manufacturing Practice
  • compositions, carriers, diluents and reagents are used interchangeably and represent that the materials are capable of administration to or upon a subject without the production of undesirable physiological effects to a degree that would prohibit administration of the composition.
  • pharmaceutically-acceptable excipient means an excipient that is useful in preparing a pharmaceutical composition that is generally safe, non-toxic, and desirable, and includes excipients that are acceptable for veterinary use as well as for human pharmaceutical use. Such excipients can be solid, liquid, semisolid, or, in the case of an aerosol composition, gaseous.
  • “Pharmaceutically-acceptable salts and esters” means salts and esters that are pharmaceutically-acceptable and have the desired pharmacological properties. Such salts include salts that can be formed where acidic protons present in the composition are capable of reacting with inorganic or organic bases. Suitable inorganic salts include those formed with the alkali metals, e.g., sodium and potassium, magnesium, calcium, and aluminum. Suitable organic salts include those formed with organic bases such as the amine bases, e.g, ethanolamine, diethanolamine, triethanolamine, tromethamine, N-methylglucamine, and the like.
  • Such salts also include acid addition salts formed with inorganic acids (e.g, hydrochloric and hydrobromic acids) and organic acids (e.g, acetic acid, citric acid, maleic acid, and the alkane- and arene-sulfonic acids such as methanesulfonic acid and benzenesulfonic acid).
  • Pharmaceutically-acceptable esters include esters formed from carboxy, sulfonyloxy, and phosphonoxy groups present in the anti-CD3 antibody, e.g, Ci- 6 alkyl esters.
  • a pharmaceutically-acceptable salt or ester can be a mono-acid-mono-salt or ester or a di-salt or ester; and similarly where there are more than two acidic groups present, some or all of such groups can be salified or esterified.
  • An anti-CD3 antibody named in this technology can be present in unsalified or unesterified form, or in salified and/or esterified form, and the naming of such anti-CD3 antibody is intended to include both the original (unsalified and unesterified) compound and its pharmaceutically-acceptable salts and esters.
  • certain embodiments of the present technology can be present in more than one stereoisomeric form, and the naming of such anti-CD3 antibody is intended to include all single stereoisomers and all mixtures (whether racemic or otherwise) of such stereoisomers.
  • a person of ordinary skill in the art would have no difficulty determining the appropriate timing, sequence and dosages of administration for particular drugs and compositions of the present technology.
  • Examples of such carriers or diluents include, but are not limited to, water, saline, Ringer's solutions, dextrose solution, and 5% human serum albumin. Liposomes and non-aqueous vehicles such as fixed oils may also be used.
  • the use of such media and compounds for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or compound is incompatible with the anti-CD3 antibody, use thereof in the compositions is contemplated. Supplementary active compounds can also be incorporated into the compositions.
  • a pharmaceutical composition of the present technology is formulated to be compatible with its intended route of administration.
  • the anti-CD3 antibody compositions of the present technology can be administered by parenteral, topical, intravenous, oral, subcutaneous, intraarterial, intradermal, transdermal, rectal, intracranial, intrathecal, intraperitoneal, intranasal; or intramuscular routes, or as inhalants.
  • the anti-CD3 antibody can optionally be administered in combination with other agents that are at least partly effective in treating various CD3 -associated pathologies.
  • Solutions or suspensions used for parenteral, intradermal, or subcutaneous application can include the following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial compounds such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating compounds such as ethylenediaminetetraacetic acid (EDTA); buffers such as acetates, citrates or phosphates, and compounds for the adjustment of tonicity such as sodium chloride or dextrose.
  • the pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide.
  • the parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic.
  • compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
  • suitable carriers include physiological saline, bacteriostatic water, Cremophor ELTM (BASF, Parsippany, N. J.) or phosphate buffered saline (PBS).
  • the composition must be sterile and should be fluid to the extent that easy syringeability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms such as bacteria and fungi.
  • the carrier can be a solvent or dispersion medium containing, e.g ., water, ethanol, polyol (e.g, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof.
  • the proper fluidity can be maintained, e.g. , by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
  • Prevention of the action of microorganisms can be achieved by various antibacterial and antifungal compounds, e.g. , parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like.
  • isotonic compounds e.g. , sugars, polyalcohols such as manitol, sorbitol, sodium chloride in the composition.
  • Prolonged absorption of the injectable compositions can be brought about by including in the composition a compound which delays absorption, e.g. , aluminum monostearate and gelatin.
  • Sterile injectable solutions can be prepared by incorporating an anti-CD3 antibody of the present technology in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization.
  • dispersions are prepared by incorporating the anti-CD3 antibody into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above.
  • methods of preparation are vacuum drying and freeze-drying that yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
  • the antibodies of the present technology can be administered in the form of a depot injection or implant preparation which can be formulated in such a manner as to permit a sustained or pulsatile release of the active ingredient.
  • Oral compositions generally include an inert diluent or an edible carrier. They can be enclosed in gelatin capsules or compressed into tablets. For the purpose of oral therapeutic administration, the anti-CD3 antibody can be incorporated with excipients and used in the form of tablets, troches, or capsules. Oral compositions can also be prepared using a fluid carrier for use as a mouthwash, wherein the compound in the fluid carrier is applied orally and swished and expectorated or swallowed. Pharmaceutically compatible binding compounds, and/or adjuvant materials can be included as part of the composition.
  • the tablets, pills, capsules, troches and the like can contain any of the following ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; an excipient such as starch or lactose, a disintegrating compound such as alginic acid, Primogel, or com starch; a lubricant such as magnesium stearate or Sterotes; a glidant such as colloidal silicon dioxide; a sweetening compound such as sucrose or saccharin; or a flavoring compound such as peppermint, methyl salicylate, or orange flavoring.
  • a binder such as microcrystalline cellulose, gum tragacanth or gelatin
  • an excipient such as starch or lactose, a disintegrating compound such as alginic acid, Primogel, or com starch
  • a lubricant such as magnesium stearate or Sterotes
  • a glidant such as colloidal silicon dioxide
  • the anti-CD3 antibody is delivered in the form of an aerosol spray from pressured container or dispenser which contains a suitable propellant, e.g., a gas such as carbon dioxide, or a nebulizer.
  • a suitable propellant e.g., a gas such as carbon dioxide, or a nebulizer.
  • Systemic administration can also be by transmucosal or transdermal means.
  • penetrants appropriate to the barrier to be permeated are used in the formulation. Such penetrants are generally known in the art, and include, e.g ., for transmucosal administration, detergents, bile salts, and fusidic acid derivatives.
  • Transmucosal administration can be accomplished through the use of nasal sprays or suppositories.
  • the anti-CD3 antibody is formulated into ointments, salves, gels, or creams as generally known in the art.
  • the anti-CD3 antibody can also be prepared as pharmaceutical compositions in the form of suppositories (e.g, with conventional suppository bases such as cocoa butter and other glycerides) or retention enemas for rectal delivery.
  • suppositories e.g, with conventional suppository bases such as cocoa butter and other glycerides
  • retention enemas for rectal delivery.
  • the anti-CD3 antibody is prepared with carriers that will protect the anti-CD3 antibody against rapid elimination from the body, such as a controlled release formulation, including implants and microencapsulated delivery systems.
  • a controlled release formulation including implants and microencapsulated delivery systems.
  • Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Methods for preparation of such formulations will be apparent to those skilled in the art.
  • the materials can also be obtained commercially from Alza Corporation and Nova Pharmaceuticals, Inc.
  • Liposomal suspensions (including liposomes targeted to infected cells with monoclonal antibodies to viral antigens) can also be used as pharmaceutically- acceptable carriers. These can be prepared according to methods known to those skilled in the art, e.g., as described in U.S. Pat. No. 4,522,811.
  • kits for the detection and/or treatment of CD3- associated pathologies comprising at least one immunoglobulin-related composition of the present technology (e.g., any antibody or antigen binding fragment described herein), or a functional variant (e.g., substitutional variant) thereof.
  • the above described components of the kits of the present technology are packed in suitable containers and labeled for diagnosis and/or treatment of CD3 -associated pathologies.
  • the above- mentioned components may be stored in unit or multi-dose containers, for example, sealed ampoules, vials, bottles, syringes, and test tubes, as an aqueous, preferably sterile, solution or as a lyophilized, preferably sterile, formulation for reconstitution.
  • the kit may further comprise a second container which holds a diluent suitable for diluting the pharmaceutical composition towards a higher volume. Suitable diluents include, but are not limited to, the pharmaceutically acceptable excipient of the pharmaceutical composition and a saline solution. Furthermore, the kit may comprise instructions for diluting the pharmaceutical composition and/or instructions for administering the pharmaceutical composition, whether diluted or not.
  • the containers may be formed from a variety of materials such as glass or plastic and may have a sterile access port (for example, the container may be an intravenous solution bag or a vial having a stopper which may be pierced by a hypodermic injection needle).
  • the kit may further comprise more containers comprising a pharmaceutically acceptable buffer, such as phosphate-buffered saline, Ringer's solution and dextrose solution. It may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, syringes, culture medium for one or more of the suitable hosts.
  • a pharmaceutically acceptable buffer such as phosphate-buffered saline, Ringer's solution and dextrose solution. It may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, syringes, culture medium for one or more of the suitable hosts.
  • the kits may optionally include instructions customarily included in commercial packages of therapeutic or diagnostic products, that contain information about, for example, the indications, usage, dosage, manufacture, administration, contraindications and/or warnings concerning the use of such therapeutic or diagnostic products.
  • kits are useful for detecting the presence of an immunoreactive CD3 protein in a biological sample, e.g ., any body fluid including, but not limited to, e.g. , serum, plasma, lymph, cystic fluid, urine, stool, cerebrospinal fluid, ascitic fluid or blood and including biopsy samples of body tissue.
  • the kit can comprise: one or more humanized, chimeric, or bispecific anti-CD3 antibodies of the present technology (or antigen binding fragments thereof) capable of binding a CD3 protein in a biological sample; means for determining the amount of the CD3 protein in the sample; and means for comparing the amount of the immunoreactive CD3 protein in the sample with a standard.
  • One or more of the anti-CD3 antibodies may be labeled.
  • the kit components, (e.g, reagents) can be packaged in a suitable container.
  • the kit can further comprise instructions for using the kit to detect the immunoreactive CD3 protein.
  • the kit can comprise, e.g. , 1) a first antibody, e.g. a humanized, chimeric or bispecific CD3 antibody of the present technology (or an antigen binding fragment thereof), attached to a solid support, which binds to a CD3 protein; and, optionally; 2) a second, different antibody which binds to either the CD3 protein or to the first antibody, and is conjugated to a detectable label.
  • the kit can also comprise, e.g, a buffering agent, a preservative or a protein- stabilizing agent.
  • the kit can further comprise components necessary for detecting the detectable-label, e.g. , an enzyme or a substrate.
  • the kit can also contain a control sample or a series of control samples, which can be assayed and compared to the test sample.
  • Each component of the kit can be enclosed within an individual container and all of the various containers can be within a single package, along with instructions for interpreting the results of the assays performed using the kit.
  • the kits of the present technology may contain a written product on or in the kit container.
  • the written product describes how to use the reagents contained in the kit, e.g., for detection of a CD3 protein in vitro or in vivo, or for treatment of CD3 -associated pathologies in a subject in need thereof.
  • the use of the reagents can be according to the methods of the present technology.
  • the present technology is further illustrated by the following Examples, which should not be construed as limiting in any way.
  • the following Examples demonstrate the preparation, characterization, and use of illustrative anti-CD3 antibodies of the present technology.
  • the following Examples demonstrate the production of chimeric, humanized, and bispecific antibodies of the present technology, and characterization of their binding specificities and in vitro and in vivo biological activities.
  • a bivalent modular platform was chosen to build CD3-BsAb ( Figure 1A).
  • the anti-CD3 antibody OKT3 was rehumanized to >85% humanness.
  • the CDRs of the heavy and light chains of OKT3 (Arakawa, Kuroki et al, J Biochem 120(3): 657-662 (1996)) were grafted onto human IgGl frameworks based on their homology with human frameworks IGHV1-46*01-IGHJ4*01 for VH, IGKV3-11*01-IGKJ2*02 for VL, respectively.
  • FIG 12A shows the amino acid sequences of the murine and humanized OKT3 heavy chain variable domains (VH).
  • the VH domain of the murine OKT3 is set forth in SEQ ID NO: 1, which comprises VH CDRl (SEQ ID NO: 2), VH CDR2 (SEQ ID NO: 3), and VH CDR3 (SEQ ID NO: 4) ( Figure 12A).
  • SEQ ID NO: 7-10 are the humanized versions of VH domain of the murine OKT3.
  • the sequences OKT3 VH-1 (SEQ ID NO: 7), OKT3 VH-2 (SEQ ID NO: 8), OKT3 VH-3 (SEQ ID NO: 9), and OKT3 VH-4 (SEQ ID NO: 10), are four variants of the humanized OKT3 heavy chain variable domain disclosed herein, which feature >85% humanness ( Figure 12A).
  • Figure 12B shows the amino acid sequences of the murine and humanized OKT3 light chain variable domains (VL).
  • the VL domain of the murine OKT3 is set forth in SEQ ID NO: 11, which comprises VL CDRl (SEQ ID NO: 12), VL CDR2 (SEQ ID NO: 13), and VL CDR3 (SEQ ID NO: 14) ( Figure 12B).
  • SEQ ID NO: 15-20 are the humanized versions of VL domain of the OKT3.
  • the sequences OKT3 VL-1 (SEQ ID NO: 15), OKT3 VL-2 (SEQ ID NO: 16), OKT3 VL-3 (SEQ ID NO: 17), OKT3 VL-4 (SEQ ID NO: 18), OKT3 VL-5 (SEQ ID NO: 19), and OKT3 VL-6 (SEQ ID NO: 20), are six variants of the humanized OKT3 light chain variable domain disclosed herein, which feature >85% humanness (FIG. 12B). From 4 heavy chain and 6 light chain designs, 24 versions of huOKT3 were gene synthesized and expressed in CHO cells.
  • N297A mutation in a standard hlgGl Fc region was introduced.
  • the light chain was constructed by extending a humanized OKT3 IgGl light chain with a C-terminal (G4S)3 linker followed by huOKT3 scFv.
  • the DNA encoding both heavy chain and light chain was inserted into a mammalian expression vector, transfected into CHO-S cells, and stable clones of highest expression were selected. Supernatants were collected from shaker flasks and purified on protein A affinity chromatography.
  • FIGs. 13A and 13B shows the amino acid sequences of the light chain (SEQ ID NO: 21) and heavy chain (SEQ ID NOs: 23) of humanized anti-CD3 BC276 BsAb amino acid sequence that combines OKT3 VL-2 and OKT3 VT1-2 humanized variable domains disclosed herein.
  • Binding affinity data for the humanized anti-CD3 antibodies of the present disclosure are provided below:
  • Example 3 Anti-CD 3 Immunoglobulin-related Compositions of the Present Disclosure Induce Potent T Cell Fratricide in Vitro
  • T cells were cultured with 350pM BC276 BsAb in the presence of interleukin-2 to support T cell proliferation.
  • Two different antibodies were used as controls.
  • the first control antibody was an IgG-L-scFv BsAb specific for CD19 (two Fab arms of the IgG) and CD3 (two scFvs connected to the C-terminal of the IgG CL).
  • the second control antibody was the humanized OKT3 IgG. Both the control antibodies are monospecific to CD3.
  • BC276 BsAb induced strong T cell fratricide among both CD4 (Figure 3A) and CD8 ( Figure 3B) at doses as low as 350pM. T cell populations although T cell death was more prominent among CD4 T cells.
  • neither of the control antibodies induced a significant or durable T cell depletion response and T cells ultimately proliferated in the presence of the control antibodies ( Figures 3A-3B).
  • the immunoglobulin-related compositions of the present technology exhibit potent anti-T cell activity. Accordingly, the immunoglobulin- related compositions of the present technology are useful to treat diseases caused by activation of T cells, including graft-versus-host-disease (GVHD), autoimmune diseases (directly induced by T cells or where T cells have a role in activation of B cells to generate autoantibodies), and T cell malignancies.
  • GVHD graft-versus-host-disease
  • autoimmune diseases directly induced by T cells or where T cells have a role in activation of B cells to generate autoantibodies
  • Example 4 Anti-CD 3 Immunoslobulin-related Compositions of the Present Disclosure Induces Profound T Cell Depletion In Vivo
  • NSG mice were injected with 30 million PBMCs (a mix of PBMCs from 3 different donors, 10 million cells from each donor) intraperitoneally.
  • Peripheral blood was stained for the presence of T cells on day 7 and treatment was initiated on day 8.
  • Treatment comprised injection of 1 pg of BC276 BsAb or BC119, a CD3 x GD2-specific BsAb, or vehicle only (no antibody).
  • peripheral blood was stained with an anti-human CD45 antibody and subjected to flow cytometry analysis.
  • treatment with BC276 BsAb caused near complete loss of CD45+ population seen on the right hand side of the flow cytometry dot plots.
  • BC119 BsAb was comparable to the no-antibody group.
  • the number of CD45+ cells from the three treatment groups were quantitated.
  • treatment with BC276 BsAb induced profound T cell depletion in mice.
  • BC119 BsAb caused a modest effect compared to the no-antibody group.
  • BC276 induced more potent T cell depletion compared to BC119.
  • the average CD45+ cell numbers were about 10/ pi and about 35/ pi of peripheral blood following treatment with either 1 pg or 0.1 pg of BC276 BsAb, respectively (Figure 5B), with the 1 pg dose eliciting a more profound T cell depletion in mice compared to the 0.1 pg dose.
  • mice were injected with 30 million PBMCs (a mix of PBMCs from 3 different donors, 10 million cells from each donor) intraperitoneally on day 0, and the mice were treated with 1 pg or O.l pg BC276 BsAb, or 1 pg or O.l pg BC119 BsAb. A no antibody control was used as a negative control. On days 8, 15, and 22, peripheral blood was stained with an anti-human CD45, anti-human CD4, or anti-human CD8 antibodies and subjected to flow cytometry analysis.
  • the immunoglobulin-related compositions of the present technology exhibit potent anti-T cell activity. Accordingly, the immunoglobulin- related compositions of the present technology are useful to treat diseases caused by activation of T cells, including graft-versus-host-disease (GVHD), autoimmune diseases (directly induced by T cells or where T cells have a role in activation of B cells to generate autoantibodies), and T cell malignancies.
  • GVHD graft-versus-host-disease
  • autoimmune diseases directly induced by T cells or where T cells have a role in activation of B cells to generate autoantibodies
  • mice were injected with 30 million PBMCs (a mix of PBMCs from 3 different donors, 10 million cells from each donor) intraperitoneally on day 0.
  • the mice were treated with vehicle only control (no antibody), or with 1 pg or 0.1 pg BC276 BsAb, or 1 pg or 0.1 pg BC119 BsAb starting on day 8.
  • the mice were evaluated for clinical signs of distress such as weight loss, reduced activity, hunched posture, or ruffled fur.
  • the body weights of animals receiving any of the antibody treatments were comparable to those treated with the no antibody control. See Figure 7.
  • Other signs of distress, such as reduced activity, hunched posture, or ruffled fur were also not observed in animals treated with BC276 BsAb. See Figure 25.
  • the immunoglobulin-related compositions of the present technology exhibit potent anti-T cell activity. Accordingly, the immunoglobulin- related compositions of the present technology are useful to treat diseases caused by activation of T cells, including graft-versus-host-disease (GVHD), autoimmune diseases (directly induced by T cells or where T cells have a role in activation of B cells to generate autoantibodies), and T cell malignancies.
  • GVHD graft-versus-host-disease
  • autoimmune diseases directly induced by T cells or where T cells have a role in activation of B cells to generate autoantibodies
  • Example 6 Anti-CD 3 Immunoslobulin-r elated Compositions of the Present Disclosure can Reduce GVHD Signs and Extend Survival
  • mice were again randomized into 5 groups and were treated with 30 pg BC276 BsAb, 10 pg BC276 BsAb, 3 pg BC276 BsAb, 10 pg BC119 BsAb, or no antibody.
  • Dead mice were assigned a GVHD score of 5.
  • treatment of the mice with 30 pg and 10 pg BC276 BsAb reduced the score of GVHD from 2 to 0.12 (p ⁇ 0.0001) and from 1.8 to 0.12 (p ⁇ 0.0003), respectively.
  • the GVHD score in the mice treated with only 3 pg of BC276 BsAb, those treated with 10 pg of the control BsAb, and untreated mice increased.
  • mice in the BC276 BsAb group (30 pg and 10 pg) gained weight while the mice in the other groups lost weight providing further evidence of the therapeutic effects of higher doses of BC276 BsAb against GVHD (Figure 10).
  • Figure 11 all mice that received 30 pg and 10 pg BC276 BsAb survived, while those in the other groups succumbed to GVHD.
  • the immunoglobulin-related compositions of the present technology exhibit potent anti-T cell activity. Accordingly, the immunoglobulin- related compositions of the present technology are useful to treat diseases caused by activation of T cells, including graft-versus-host-disease (GVHD), autoimmune diseases (directly induced by T cells or where T cells have a role in activation of B cells to generate autoantibodies), and T cell malignancies.
  • GVHD graft-versus-host-disease
  • autoimmune diseases directly induced by T cells or where T cells have a role in activation of B cells to generate autoantibodies
  • Figures 23A-23B show results from multiple T-cell cytotoxicity assays using various cancer target cells.
  • Human activated T-cells and the targeted human tumor cells were incubated with bispecific antibodies targeting a tumor antigen and CD3 for four hours to measure anti-tumor cytotoxicity, using an anti-GD2 x CD3 BsAb comprising SEQ ID NO: 94 and SEQ ID NO: 96 sequences, or an anti-GPC3 x CD3 BsAb comprising SEQ ID NO: 102 and SEQ ID NO: 104 sequences from the present disclosure.
  • Figure 23A specifically shows the potency of an anti-GD2 anti-CD3 bispecific antibody against a GD2- expressing neuroblastoma cell line (IMR32).
  • Figure 23B shows the potency of an anti- GPC3 anti-CD3 bispecific antibody against a GPC3 -expressing liver cancer cell line (HEPG2).
  • Naive T cells were purified from human normal volunteer PBMC using Pan T cell isolation kit (Miltenyi Biotec, Bergisch Gladbach, Germany). These T cells were activated and expanded by CD3/CD28 Dynabeads (Invitrogen, Carlsbad CA) for 7 to 14 days in the presence of 30 IU/mL of IL-2 according to manufacturer’s protocol. 51 Cr release assay as described in Xu H etal, Cancer Immunol Res 3:266-77 (2015) was performed and ECso was calculated using SigmaPlot software.
  • Tumor cell lines were cultured in RPMI-1640 (Cellgro, Swedesboro, NJ) supplemented with 10% fetal bovine serum (FBS, Life Technologies, Carlsbad CA) and harvested with EDTA/Trypsin.
  • Target tumor cells were labeled with sodium 51 Cr chromate (Amersham, Arlington Height, IL) at 100 uCi/10 6 cells at 37 ° C for 1 hour. After the cells were washed twice, target tumor cells were plated at 5000 cells per well in a 96-well plate; at a E:T ratio of 10: 1, BC276 BsAb was titrated down 10 fold from starting concentration of 0.1 pg/ml.
  • Example 8 Use of Immunoglobulin-related Compositions of the Present Disclosure to Treat Autoimmune Diseases and Type 1 Diabetes Mellitus
  • Type 1 diabetes mellitus is a T-cell mediated autoimmune destruction of the pancreatic B cells that are responsible for secretion of insulin. Roep, Diabetologia , 46: 305- 321 (2003).
  • three transgenic mouse models will be used: i) OT-I mice (C57BL/6- Tg(TcraTcrb)l lOOMjb/J), which express a transgenic T cell receptor recognizing ovalbumin peptide residues 257-264 (OVA257-264); ii) RIP-mOVA mice (C57BL/6-Tg(Ins2- TFRC/OVA)296Wehi/WehiJ), which exhibit strong expression of ovalbumin in pancreatic B cells (which secrete insulin) and kidney proximal tubular cells; and iii) human CD3 transgenic (B6.Cg-Tg(CD3E)
  • OT-I mice will be crossed with CD3 transgenic mice.
  • the progenies that have T-cell expressing OT-I T-cell receptor and also a human CD3E gene will be used as T-cell donors.
  • T-cells may be harvested from spleen and lymph nodes of these mice.
  • the harvested T-cells will be injected to the RIP-mOVA mice, wherein a prior lymphodepletion may help engraftment of the donor cells.
  • the occurrence and progression of diabetes will be monitored by checking blood glucose. As soon as the blood sugar surpasses 200 mg/dl, treatment with different doses of BC276 BsAb and the control antibodies will be initiated. The severity of diabetes can be monitored through blood glucose levels.
  • pancreatic immunohistochemistry will show the extent of T-cell infiltration into the B cells.
  • the immunoglobulin-related compositions of the present technology will reduce the symptoms of autoimmune diseases and/or Type 1 diabetes mellitus in the animal models.
  • the immunoglobulin-related compositions of the present technology are useful to treat diseases caused by activation of T cells, including graft- versus-host-disease (GVHD), autoimmune diseases (directly induced by T cells or where T cells have a role in activation of B cells to generate autoantibodies), and T cell malignancies.
  • GVHD graft- versus-host-disease
  • autoimmune diseases directly induced by T cells or where T cells have a role in activation of B cells to generate autoantibodies
  • T cell malignancies including graft- versus-host-disease (GVHD)
  • Example 9 Use of Immunoglobulin-related Compositions of the Present Disclosure to Treat T Cell Malignancies
  • T-cell malignancies such as T-cell lymphomas (TCLs) and T-cell leukemias
  • TCLs T-cell lymphomas
  • T-cell leukemias T-cell leukemias
  • BLI bioluminescent imaging
  • the immunoglobulin-related compositions of the present technology are useful to treat diseases caused by activation of T cells, including graft- versus-host-disease (GVHD), autoimmune diseases (directly induced by T cells or where T cells have a role in activation of B cells to generate autoantibodies), and T cell malignancies.
  • GVHD graft- versus-host-disease
  • autoimmune diseases directly induced by T cells or where T cells have a role in activation of B cells to generate autoantibodies
  • T cell malignancies including graft- versus-host-disease (GVHD)
  • Example 10 Use of Immunoslobulin-related Compositions of the Present Disclosure to treat cancer
  • immunoglobulin-related compositions of the present technology comprising SADA domains (e.g ., SEQ ID NOs: 118-121) will effectively recruit T-cells to kill solid or liquid tumors. See Figures 20A-20D.
  • heterodimeric anti-tumor immunoglobulin-related compositions of the present technology comprising anti-DOTA antibody domains (e.g ., BsAbs comprising SEQ ID NOs: 122, 124, 126, and 137 or SEQ ID NOs: 128, 130, 132, and 139) will permit both imaging of T-cells in patients with cancer (using imaging isotopes), as well as delivery of therapeutic payloads to tumors (using therapeutic isotopes). See Figures 21A-21D and Figures 22A-22D.
  • Figure 27 shows the amino acid sequences of the anti-CD3 scFv region for each of the 5 GPC3 c CD3 bispecific antibodies (BsAbs) (SEQ ID NOs: 141-145) shown in Figure 26.
  • the light chain and heavy chain sequences of the anti-GPC-3 immunoglobulin are:
  • DIVMTQSPSSL WSIGER VTMNCKSSQSLL YSSNQKNYLA WYQQKPGQSPKLLIYWASSRE SGVPDRFSGSGSGTDFTL TISSVKAED VA VYYCQQYYNYPL TFGAGTKLELKRYY
  • BsAb #3 shows the highest binding affinity to ex vivo expanded human T cells followed by BsAb #1, #2, #5 and #4.
  • Figure 29 shows that the binding affinities of the exemplified BsAbs to human recombinant CD35/e are not drastically different as demonstrated using SPR.
  • BsAb #1, #2, #3 and #5 bind with similar affinities whereas BsAb #4 shows 1 log lower binding affinity.
  • FIGs 30-31 show that the exemplified BsAbs differentially induce surface expression of T cell activation marker CD69 and CD25, respectively.
  • BsAb #1, #2, #3 and #5 induced a similar proportion of CD69+ T cells, whereas BsAb #4 weakly activated CD8 T cell expression of CD69.
  • a similar trend was observed for CD25 expression on CD8 T cells whereby BsAb #4 weakly induced CD25 expression compared to BsAb #1, #2, #3 and #5.
  • BsAb #1, #2, #3 and #5 drove robust CD8 T cell proliferation and more than 70% of CD8 T cells underwent active division with as little as 6.4ng/ml BsAb concentration.
  • BsAb #4 not only weakly induced CD8 T cell activation, there is very little dividing CD8 T cells (15%) at 6.4ng/ml BsAb concentration. See Figure 32A. Increasing concentration of BsAb in the T and HepG2 coculture assay did not lead to reduced CD8 T cell viability. Similar CD8 T cell viability (10-20%) was observed among all BsAbs.
  • Figure 33 shows BsAb-engaged T-cell mediated killing of HepG2 hepatocellular carcinoma cell line.
  • BsAb #3 and #1 show similar EC50 followed by #2 and #5, whereas BsAb 4 showed lowest EC50.
  • FIGS 34A-34B show human T cell engraftment in HepG2 xenograft mice.
  • BsAb #3 drove the highest number of T-luc cells engraftment to HepG2 tumor site followed by BsAb #1 and #2.
  • Dosage of BsAb influenced T-luc cells engraftment. For instance, 30pg BsAb #1 induced higher T-luc infiltration than 3pg BsAb #1.
  • a range includes each individual member.
  • a group having 1-3 cells refers to groups having 1, 2, or 3 cells.
  • a group having 1-5 cells refers to groups having 1, 2, 3, 4, or 5 cells, and so forth.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Biomedical Technology (AREA)
  • Biophysics (AREA)
  • Medicinal Chemistry (AREA)
  • Biotechnology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • General Engineering & Computer Science (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Microbiology (AREA)
  • Physics & Mathematics (AREA)
  • Cell Biology (AREA)
  • Urology & Nephrology (AREA)
  • Hematology (AREA)
  • Plant Pathology (AREA)
  • Analytical Chemistry (AREA)
  • Food Science & Technology (AREA)
  • Pathology (AREA)
  • General Physics & Mathematics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicinal Preparation (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Hospice & Palliative Care (AREA)
  • Oncology (AREA)
PCT/US2021/028798 2020-04-24 2021-04-23 Anti-cd3 antibodies and uses thereof Ceased WO2021216972A1 (en)

Priority Applications (5)

Application Number Priority Date Filing Date Title
EP21792369.7A EP4139347A4 (en) 2020-04-24 2021-04-23 Anti-cd3 antibodies and uses thereof
JP2022564276A JP7791836B2 (ja) 2020-04-24 2021-04-23 抗cd3抗体及びその使用
CA3176391A CA3176391A1 (en) 2020-04-24 2021-04-23 Anti-cd3 antibodies and uses thereof
CN202180043797.1A CN115803340A (zh) 2020-04-24 2021-04-23 抗cd3抗体及其用途
US17/920,539 US20230212289A1 (en) 2020-04-24 2021-04-23 Anti-cd3 antibodies and uses thereof

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US202063015149P 2020-04-24 2020-04-24
US63/015,149 2020-04-24

Publications (1)

Publication Number Publication Date
WO2021216972A1 true WO2021216972A1 (en) 2021-10-28

Family

ID=78270196

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2021/028798 Ceased WO2021216972A1 (en) 2020-04-24 2021-04-23 Anti-cd3 antibodies and uses thereof

Country Status (6)

Country Link
US (1) US20230212289A1 (https=)
EP (1) EP4139347A4 (https=)
JP (1) JP7791836B2 (https=)
CN (1) CN115803340A (https=)
CA (1) CA3176391A1 (https=)
WO (1) WO2021216972A1 (https=)

Cited By (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11434291B2 (en) 2019-05-14 2022-09-06 Provention Bio, Inc. Methods and compositions for preventing type 1 diabetes
WO2023205733A1 (en) * 2022-04-21 2023-10-26 Academia Sinica Genetically engineered innate lymphoid cells for enhancing lifespan and/or treating cancers
US11912771B2 (en) 2021-03-09 2024-02-27 Cdr-Life Ag MAGE-A4 peptide-MHC antigen binding proteins
WO2024031009A3 (en) * 2022-08-04 2024-03-14 Memorial Sloan-Kettering Cancer Center Anti-cd24 antibodies and uses thereof
US12006366B2 (en) 2020-06-11 2024-06-11 Provention Bio, Inc. Methods and compositions for preventing type 1 diabetes
US12161673B2 (en) 2022-09-14 2024-12-10 Cdr-Life Ag MAGE-A4 peptide dual T cell engagers
US12435444B2 (en) 2021-03-09 2025-10-07 Cdr-Life Ag Rabbit-derived antigen binding protein nucleic acid libraries and methods of making the same
US12565529B2 (en) 2021-05-24 2026-03-03 Provention Bio, Inc. Methods for treating type 1 diabetes

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024199454A1 (en) * 2023-03-29 2024-10-03 Nanjing GenScript Biotech Co., Ltd. Antibodies and variants thereof against human cluster of differentiation 3 protein
CN116574182B (zh) * 2023-06-09 2024-02-06 上海交通大学医学院附属第九人民医院 一种抗人Ki-67抗体及其制备方法和用途
CN121293363B (zh) * 2025-12-09 2026-04-21 上海玄言生物科技有限公司 一种靶向cd14和cd3的双功能t细胞衔接器及其应用

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20100104553A1 (en) * 2006-12-20 2010-04-29 Gerhard Frey Antibodies and methods for making and using them
WO2018200562A1 (en) * 2017-04-24 2018-11-01 Memorial Sloan Kettering Cancer Center Anti-cd33 antibody agents
US20180371088A1 (en) * 2017-06-22 2018-12-27 Development Center For Biotechnology TARGET CELL-DEPENDENT T CELL ENGAGING AND ACTIVATION ASYMMETRIC HETERODIMERIC Fc-ScFv FUSION ANTIBODY FORMAT AND USES THEREOF IN CANCER THERAPY
US20190352419A1 (en) * 2018-03-21 2019-11-21 ALX Oncology Inc. Antibodies against signal-regulatory protein alpha and methods of use
WO2019234241A1 (en) * 2018-06-07 2019-12-12 Oncoone Research & Development Gmbh ANTI-oxMIF/ANTI-CD3 ANTIBODY FOR CANCER TREATMENT

Family Cites Families (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN102796199A (zh) * 2011-05-26 2012-11-28 中国医学科学院血液病医院 抗CD3抗体Fv片段与白介素3融合蛋白突变体、制备方法及其用途
EP2892924B1 (en) * 2012-06-14 2020-11-25 Therapix Biosciences Ltd. Humanized antibodies to cluster of differentiation 3 (cd3)
CN103173478B (zh) * 2013-03-04 2015-09-09 西北大学 一种携带ptd的抗人cd3单链抗体的制备方法
CN103467605B (zh) * 2013-09-05 2015-02-04 武汉友芝友生物制药有限公司 一种cd3抗原及其制备方法和用途
US20160326249A1 (en) * 2014-01-15 2016-11-10 Zymeworks Inc. Bi-specific cd3 and cd19 antigen-binding constructs
MA40894A (fr) * 2014-11-04 2017-09-12 Glenmark Pharmaceuticals Sa Immunoglobulines hétéro-dimères reciblant des lymphocytes t cd3/cd38 et leurs procédés de production
RU2020122439A (ru) * 2014-11-24 2020-09-24 Регенерон Фармасьютикалз, Инк. Не относящиеся к человеку животные, экспрессирующие гуманизированный комплекс cd3
US11046768B2 (en) 2017-01-27 2021-06-29 Memorial Sloan Kettering Cancer Center Bispecific HER2 and CD3 binding molecules
WO2020062155A1 (en) 2018-09-29 2020-04-02 Mab-Legend Biotech Co., Ltd. Dual targeting antigen binding molecule
CN110964114B (zh) 2018-09-29 2023-07-04 上海博槿生物科技有限公司 一种双靶点抗原结合分子

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20100104553A1 (en) * 2006-12-20 2010-04-29 Gerhard Frey Antibodies and methods for making and using them
WO2018200562A1 (en) * 2017-04-24 2018-11-01 Memorial Sloan Kettering Cancer Center Anti-cd33 antibody agents
US20180371088A1 (en) * 2017-06-22 2018-12-27 Development Center For Biotechnology TARGET CELL-DEPENDENT T CELL ENGAGING AND ACTIVATION ASYMMETRIC HETERODIMERIC Fc-ScFv FUSION ANTIBODY FORMAT AND USES THEREOF IN CANCER THERAPY
US20190352419A1 (en) * 2018-03-21 2019-11-21 ALX Oncology Inc. Antibodies against signal-regulatory protein alpha and methods of use
WO2019234241A1 (en) * 2018-06-07 2019-12-12 Oncoone Research & Development Gmbh ANTI-oxMIF/ANTI-CD3 ANTIBODY FOR CANCER TREATMENT

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See also references of EP4139347A4 *

Cited By (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11434291B2 (en) 2019-05-14 2022-09-06 Provention Bio, Inc. Methods and compositions for preventing type 1 diabetes
US12006366B2 (en) 2020-06-11 2024-06-11 Provention Bio, Inc. Methods and compositions for preventing type 1 diabetes
US11912771B2 (en) 2021-03-09 2024-02-27 Cdr-Life Ag MAGE-A4 peptide-MHC antigen binding proteins
US12435444B2 (en) 2021-03-09 2025-10-07 Cdr-Life Ag Rabbit-derived antigen binding protein nucleic acid libraries and methods of making the same
US12565529B2 (en) 2021-05-24 2026-03-03 Provention Bio, Inc. Methods for treating type 1 diabetes
WO2023205733A1 (en) * 2022-04-21 2023-10-26 Academia Sinica Genetically engineered innate lymphoid cells for enhancing lifespan and/or treating cancers
WO2024031009A3 (en) * 2022-08-04 2024-03-14 Memorial Sloan-Kettering Cancer Center Anti-cd24 antibodies and uses thereof
US12161673B2 (en) 2022-09-14 2024-12-10 Cdr-Life Ag MAGE-A4 peptide dual T cell engagers

Also Published As

Publication number Publication date
JP2023523584A (ja) 2023-06-06
EP4139347A4 (en) 2024-06-05
CA3176391A1 (en) 2021-10-28
CN115803340A (zh) 2023-03-14
JP7791836B2 (ja) 2025-12-24
EP4139347A1 (en) 2023-03-01
US20230212289A1 (en) 2023-07-06

Similar Documents

Publication Publication Date Title
JP7791836B2 (ja) 抗cd3抗体及びその使用
US12441793B2 (en) CD33 antibodies and methods of using the same to treat cancer
JP7730295B2 (ja) Cd19抗体およびこれを使用する方法
US12509515B2 (en) CD22 antibodies and methods of using the same
US20220348686A1 (en) Anti-steap1 antibodies and uses thereof
US20220251192A1 (en) Anti-cd33 antibodies for treating cancer
US20260015435A1 (en) Anti-polysialic acid antibodies and uses thereof
US20220242967A1 (en) Anti-glypican-3 antibodies and uses thereof
WO2024031009A2 (en) Anti-cd24 antibodies and uses thereof
WO2022081443A2 (en) Anti-psma antibodies and uses thereof
US12612456B2 (en) CD19 antibodies and methods of using the same
AU2024344464A1 (en) Gpa33 antibody compositions and uses thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21792369

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3176391

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2022564276

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2021792369

Country of ref document: EP

Effective date: 20221124

NENP Non-entry into the national phase

Ref country code: DE