WO2021188969A2 - Coronavirus vaccines and methods of use - Google Patents

Coronavirus vaccines and methods of use Download PDF

Info

Publication number
WO2021188969A2
WO2021188969A2 PCT/US2021/023267 US2021023267W WO2021188969A2 WO 2021188969 A2 WO2021188969 A2 WO 2021188969A2 US 2021023267 W US2021023267 W US 2021023267W WO 2021188969 A2 WO2021188969 A2 WO 2021188969A2
Authority
WO
WIPO (PCT)
Prior art keywords
sequence
epitope
composition
pharmaceutical composition
protein
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2021/023267
Other languages
English (en)
French (fr)
Other versions
WO2021188969A3 (en
Inventor
Richard B. Gaynor
Lakshmi SRINIVASAN
Asaf PORAN
Dewi HARJANTO
Christina KUKSIN
David Abram ROTHENBERG
John SROUJI
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Biontech US Inc
Original Assignee
Biontech US Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Biontech US Inc filed Critical Biontech US Inc
Priority to EP21772515.9A priority Critical patent/EP4121104A4/en
Priority to CN202180034574.9A priority patent/CN116710126A/zh
Priority to BR112022018819A priority patent/BR112022018819A2/pt
Priority to AU2021237720A priority patent/AU2021237720A1/en
Priority to US17/912,841 priority patent/US20230141371A1/en
Priority to MX2022011671A priority patent/MX2022011671A/es
Priority to CA3172315A priority patent/CA3172315A1/en
Priority to JP2022557136A priority patent/JP2023518821A/ja
Priority to IL296617A priority patent/IL296617A/en
Priority to KR1020227036217A priority patent/KR20230004508A/ko
Priority to US17/481,781 priority patent/US20230083931A1/en
Publication of WO2021188969A2 publication Critical patent/WO2021188969A2/en
Publication of WO2021188969A3 publication Critical patent/WO2021188969A3/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • A61K39/215Coronaviridae, e.g. avian infectious bronchitis virus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/11T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/46Viral antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N7/00Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/515Animal cells
    • A61K2039/5154Antigen presenting cells [APCs], e.g. dendritic cells or macrophages
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/53DNA (RNA) vaccination
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/57Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/57Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
    • A61K2039/572Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 cytotoxic response
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/57Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
    • A61K2039/575Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 humoral response
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/60Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • A61K2039/6018Lipids, e.g. in lipopeptides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/60Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • A61K2039/6031Proteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/60Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • A61K2039/6031Proteins
    • A61K2039/6056Antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/70Multivalent vaccine
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2770/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
    • C12N2770/00011Details
    • C12N2770/20011Coronaviridae
    • C12N2770/20022New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2770/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
    • C12N2770/00011Details
    • C12N2770/20011Coronaviridae
    • C12N2770/20034Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2770/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
    • C12N2770/00011Details
    • C12N2770/20011Coronaviridae
    • C12N2770/20071Demonstrated in vivo effect

Definitions

  • Newly emerging acute respiratory virus infections caused by novel coronavirus is a significant public health concern. Importantly, there are no vaccines or specific antivirals at the time of an outbreak, specifically, for example the MERS-CoV of 2015, or 2019 SARS CoV-2 infections. The 2019 SARS CoV-2 infection outbreak in December of 2019 claimed more than 2000 lives in less than 2 months from the first reported case. Accordingly, novel and easily scalable therapeutics are necessary to combat a disease caused by such a viral infection.
  • Coronaviruses are single positive stranded RNA viruses that have emerged occasionally from zoonotic sources to infect human populations. Most of the infections in humans cause mild respiratory symptoms, though some recent coronavirus infections in the last decade have resulted in severe morbidity and mortality. These include the severe acute respiratory syndrome coronavirus (SARS-CoV), middle east respiratory syndrome coronavirus (MERS-CoV) and the currently ongoing pandemic of SARS-CoV-2. Infection with these viruses can lead to acute respiratory distress resulting in a high mortality rate. SARS- CoV originated in 2002 in South China and its global spread led to 8096 cases and 774 deaths.
  • SARS CoV-2 has a genome size of 30 kilobases that encodes for at least four (4) structural (spike [S], envelope [E], membrane [M], and nucleocapsid [N])and at least fifteen (15) non-structural (NSP 1-15) proteins.
  • the structural proteins are the spike protein (S), the membrane protein (M), the envelope protein (E) and the nucleocapsid protein (N).
  • the S protein facilitates viral entry into target cells and entry depends on binding of the spike protein to a cellular receptor ACE2 for both SARS- CoV and SARS-CoV-2. Both viruses share a 76% amino acid identity across the genome that could help leverage the previous research on protective immune responses to SAR-CoV to aid in vaccine development for SARS-CoV-2
  • the field of the present invention relates to immunotherapeutic peptides, nucleic acids encoding the peptides, peptide binding agents, and their use, for example, in the immunotherapy of a viral disease.
  • the invention provides viral epitopes expressed in virus infected cells, useful alone or in combination with other anti-viral, or immunomodulatory agents to treat viral infection.
  • the present invention is useful in immunotherapy for a coronavirus infection.
  • composition comprising: (i) a polypeptide comprising at least two of the following (a) a sequence comprising an epitope sequence from ORFlab, (b) a sequence comprising an epitope sequence from membrane glycoprotein (M) and (c) a sequence comprising an epitope sequence from nucleocapsid phosphoprotein (N); (ii) a polynucleotide encoding a polypeptide, wherein the polypeptide comprises at least two of the following (a) a sequence comprising an epitope sequence from ORFlab, (b) a sequence comprising an epitope sequence from membrane glycoprotein (M) and (c) a sequence comprising an epitope sequence from nucleocapsid phosphoprotein (N); (iii) a T cell receptor (TCR) or a T cell comprising the TCR, wherein the TCR binds to an epitope sequence of the polypeptide in complex with a corresponding HLA class I or class
  • the polypeptide comprises (a) a sequence comprising an epitope sequence from ORFlab, (b) a sequence comprising an epitope sequence from membrane glycoprotein (M) and (c) a sequence comprising an epitope sequence from nucleocapsid phosphoprotein (N).
  • the sequence comprising an epitope sequence from ORFlab is C-terminal to the sequence comprising an epitope sequence from nucleocapsid phosphoprotein (N).
  • the sequence comprising an epitope sequence from ORFlab is N-terminal to the sequence comprising an epitope sequence from membrane glycoprotein (M).
  • the sequence comprising an epitope sequence from nucleocapsid phosphoprotein (N) is N-terminal to the sequence comprising an epitope sequence from membrane glycoprotein (M).
  • the polypeptide comprises at least two of the following (a) a sequence comprising an epitope sequence from ORFlab, (b) a sequence comprising an epitope sequence from membrane glycoprotein (M) and (c) a sequence comprising an epitope sequence from nucleocapsid phosphoprotein (N)
  • the polypeptide comprises (a) 2, 3, 4, 5, 6, 7, 8, 9 or 10 or more epitope sequence from ORFlab, (b) a sequence comprising an epitope sequence from membrane glycoprotein (M) and (c) a sequence comprising an epitope sequence from nucleocapsid phosphoprotein (N).
  • the epitope sequence from ORFlab is an epitope sequence from a non- structural protein.
  • the non-structural protein is selected from the group consisting of NSP1, NSP2, NSP3, NSP4 and combinations thereof.
  • the polypeptide comprises a sequence comprising an epitope sequence from NSP1, a sequence comprising an epitope sequence from NSP2, a sequence comprising an epitope sequence from NSP3 and a sequence comprising an epitope sequence from NSP4.
  • the epitope sequence from ORFlab is selected from the group consisting of YLFDESGEFKL, YLFDESGEF, FGDDTVIEV, QLMCQPILL, TTDPSFLGRY, PTDNYITTY, PSFLGRY, AEAELAKNV, KTIQPRVEK and any combination thereof.
  • the epitope sequence from nucleocapsid glycoprotein (N) is LLLDRLNQL.
  • the epitope sequence from membrane phosphoprotein (M) is VATSRTLSY.
  • the polypeptide comprises an epitope sequence from nucleocapsid glycoprotein (N) that is LLLDRLNQL and an epitope sequence from membrane phosphoprotein (M) that is VATSRTLSY.
  • the polypeptide comprises (a) each of the following epitope sequences from ORFlab: YLFDESGEFKL, YLFDESGEF, FGDDTVIEV, QLMCQPILL, TTDPSFLGRY, PTDNYITTY, PSFLGRY, AEAELAKNV, KTIQPRVEK; (b) an epitope sequence from nucleocapsid glycoprotein (N) that is LLLDRLNQL; and (c) an epitope sequence from membrane phosphoprotein (M) that is VATSRTLSY.
  • ORFlab YLFDESGEFKL, YLFDESGEF, FGDDTVIEV, QLMCQPILL, TTDPSFLGRY, PTDNYITTY, PSFLGRY, AEAELAKNV, KTIQPRVEK
  • N nucleocapsid glycoprotein
  • M membrane phosphoprotein
  • sequence comprising an epitope sequence from ORFlab is selected from the group consisting of the following sequences or fragments thereof:
  • the sequence comprising an epitope sequence from membrane glycoprotein (M) is selected from the group consisting of the following sequences or fragments thereof: AD SN GTITVEELKKLLEQ WNLVIGFLFLTWICLLQF A Y ANRNRFL YIIKLIFLWLLWPVTL ACFVL AAVYRINWIT GGIAIAMACLV GLMWLS YFIASFRLFARTRSMW SFNPETNILLNVPLHGTILTRPL LE SEL VIGAVILRGHLRI AGHHLGRCDIKDLPKEIT VAT SRTL S YYKLGAS QRV AGD SGF AA Y SR YRIGNYKLNTDHS S S SDNIALLVQ
  • sequence comprising an epitope sequence from nucleocapsid phosphoprotein (N) is selected from the group consisting of the following sequences or fragments thereof:
  • the polypeptide comprises one or more linker sequences.
  • the one or more linker sequences are selected from the group consisting of GGSGGGGSGG, GGSLGGGGSG.
  • the one or more linker sequences comprise cleavage sequences.
  • the one or more cleavage sequences are selected from the group consisting of FRAC, KRCF, KKRY, ARMA, RRSG, MRAC, KMCG, ARC A, KKQG, YRSY, SFMN, FKAA, KRNG, YNSF, KKNG, RRRG, KRYS, and ARYA.
  • the polypeptide comprises a transmembrane domain sequence.
  • the transmembrane sequence is C-terminal to the sequence comprising an epitope sequence from ORFlab, the sequence comprising an epitope sequence from membrane glycoprotein (M) and the sequence comprising an epitope sequence from nucleocapsid phosphoprotein (N).
  • the transmembrane sequence is
  • the polypeptide comprises an SEC sequence.
  • the SEC sequence is N-terminal to the sequence comprising an epitope sequence from ORFlab, the sequence comprising an epitope sequence from membrane glycoprotein (M) and the sequence comprising an epitope sequence from nucleocapsid phosphoprotein (N).
  • the SEC sequence is MF VFLVLLPLVS SQCVNLT.
  • the composition comprises the polynucleotide encoding the polypeptide.
  • the polynucleotide is an mRNA.
  • the polynucleotide comprises a codon optimized sequence for expression in a human.
  • the polynucleotide comprises a dEarl-hAg sequence.
  • the dEarl-hAg sequence is ATTCTTCTGGTCCCCACAGACTCAGAGAGAACCC, optionally wherein each T is a U.
  • the polynucleotide comprises a Kozak sequence.
  • the a Kozak sequences is GCCACC.
  • the polynucleotide comprises an F element sequence.
  • the F element sequence is a 3 UTR of amino-terminal enhancer of split (AES). In some embodiments, the F element sequence is
  • the polynucleotide comprises an I element sequence.
  • the I element sequence is a 3' UTR of mitochondrially encoded 12S rRNA (mtRNR10. In some embodiments, the I element sequence is
  • each T is a U.
  • the polynucleotide comprises a poly A sequence.
  • the poly A sequence is
  • each T is a U.
  • each of the epitope sequences from the ORFlab, the membrane glycoprotein, and the nucleocapsid phosphoprotein are from 2019 SARS-CoV-2.
  • one or more or each epitope elicits a T cell response.
  • one or more or each epitope has been observed by mass spectrometry as being presented by an HLA molecule.
  • the composition comprises (i) a polypeptide with at least 70%, 80%, 90% or 100% sequence identity to a sequence selected from the group consisting of RS Clplfull, RS C2plfull, RS C3 pi full, RS C4plfull, RS C5pl, RS C5p2, RS C5p2full, RS C6pl, RS C6p2, RS C6p2full, RS C7pl, RS C7p2, RS C7p2full, RS C8pl, RS C8p2 and RS C8p2full; (ii) a polynucleotide encoding a polypeptide with at least 70%, 80%, 90% or 100% sequence identity to a sequence selected from the group consisting of RS Clplfull, RS C2plfull, RS C3plfull, RS C4plfull, RS C5pl, RS
  • compositions described herein comprising any of the compositions described herein.
  • a pharmaceutical composition comprising: (i) a polypeptide comprising an epitope sequence of Table 1A, Table IB, Table 1C, Table 2Ai, Table 2Aii, Table 2B and/or Table 16; (ii) a polynucleotide encoding the polypeptide; (iii) a T cell receptor (TCR) or a T cell comprising the TCR, wherein the TCR binds to the epitope sequence in complex with a corresponding HLA class I or class II molecule; (iv) an antigen presenting cell comprising (i) or (ii); or (v) an antibody or B cell comprising the antibody, wherein the antibody binds to the epitope sequence; and a pharmaceutically acceptable excipient.
  • TCR T cell receptor
  • an antigen presenting cell comprising (i) or (ii); or (v) an antibody or B cell comprising the antibody, wherein the antibody binds to the epitope sequence
  • a pharmaceutically acceptable excipient comprising
  • the epitope sequence comprises one or more or each of the following: YLFDESGEFKL, YLFDESGEF, FGDDTVIEV, LLLDRLNQL, QLMCQPILL, TTDPSFLGRY, PTDNYITTY, PSFLGRY, AEAELAKNV, VATSRTLSY and KTIQPRVEK.
  • the epitope sequence comprises one or more or each of the following: SAPPAQYEL, AVASKILGL, EYADVFHLY, DEFTPFDVV, VRIQPGQTF, SFRLFARTR, KFLPFQQF, VVQEGVLTA, RLDKVEAEV, FGADPIHSL, NYNYLYRLF, KYIKWPWYI, KWPWYIWLGF, LPFNDGVYF, QPTESIVRF, IPFAMQMAY, YLQPRTFLL and RLQSLQTYV.
  • the epitope sequence is from an orflab protein. In some embodiments, the epitope sequence is from an orfla protein In some embodiments, the epitope sequence is from a surface glycoprotein (S) or a shifted reading frame thereof. In some embodiments, the epitope sequence is from a nucleocapsid phosphoprotein (N). In some embodiments, the epitope sequence is from an ORF3a protein. In some embodiments, the epitope sequence is from a membrane glycoprotein (M). In some embodiments, the epitope sequence is from an ORF7a protein. In some embodiments, the epitope sequence is from an ORF8 protein. In some embodiments, the epitope sequence is from an envelope protein (E).
  • the epitope sequence is from an ORF6 protein. In some embodiments, the epitope sequence is from an ORF7b protein. In some embodiments, the epitope sequence is from an ORF10 protein. In some embodiments, the epitope sequence is from an ORF9b protein.
  • compositions comprising: a polypeptide having an amino acid sequence with at least 70%, 80%, 90% or 100% sequence identity to a sequence of any one of the sequences depicted in column 2 of Table 11, column 2 of Table 12 or column 3 of Table 15; or a recombinant polynucleotide encoding a polypeptide having an amino acid sequence with at least 70%, 80%, 90% or 100% sequence identity to a sequence of any one of the sequences depicted in column 2 of Table 11, column 2 of Table 12 or column 3 of Table 15.
  • the pharmaceutical composition comprises a polypeptide with at least 70%, 80%, 90% or 100% sequence identity to a sequence selected from the group consisting of RS Clplfull, RS C2plfull, RS C3plfull, RS C4plfull, RS C5pl, RS C5p2, RS C5p2full, RS C6pl, RS C6p2, RS C6p2full, RS C7pl, RS C7p2, RS C7p2full, RS C8pl, RS C8p2 and RS C8p2full; or a polynucleotide encoding a polypeptide with at least 70%, 80%, 90% or 100% sequence identity to a sequence selected from the group consisting of RS Clplfull, RS C2plfull, RS C3plfull, RS C4plfull, RS C5pl, RS C5p
  • the pharmaceutical composition comprises a polynucleotide with at least 70%, 80%, 90% or 100% sequence identity to a sequence selected from the group consisting of SEQ ID NOs: RS Clnl, RS C2nl, RS C3nl, RS C4nl, RS C5nl, RS C6nl, RS C7nl, RS C8nl, RS C5n2, RS C6n2, RS C7n2, RS C8n2, RS C5n2full, RS C6n2full, RS C7n2full and RS C8n2full.
  • SEQ ID NOs RS Clnl, RS C2nl, RS C3nl, RS C4nl, RS C5nl, RS C6nl, RS C7nl, RS C8nl, RS C5n2, RS C6n2, RS C7n2, RS C8n2, RS C5n2full,
  • the polynucleotide is an mRNA.
  • the pharmaceutical composition further comprises one or more lipid components.
  • the one or more lipids comprise a lipid nanoparticle (LNP).
  • the LNP encapsulates the recombinant polynucleotide construct.
  • the polypeptide is synthetic. In some embodiments, the polypeptide is recombinant.
  • the polypeptide is from 8-1000 amino acids in length.
  • the epitope sequence binds to or is predicted to bind to an HLA class I or class II molecule with a KD of 1000 nM or less. In some embodiments, the epitope sequence binds to or is predicted to bind to an HLA class I or class II molecule with a KD of 500 nM or less.
  • the epitope sequence comprises a sequence of a viral protein expressed by a virus-infected cell of a subject.
  • Also provided herein is a method of treating or preventing a infection by a virus or treating a respiratory disease or condition associated with an infection by a virus comprising administering to a subject in need thereof a pharmaceutical composition described herein.
  • the virus is a coronavirus. In some embodiments, the virus is 2019 SARS-CoV 2. In some embodiments, an HLA molecule expressed by the subject is unknown at the time of administration. In some embodiments, the ability of the virus to avoid escape of recognition by an immune system of the subject is less compared to the ability of the virus to avoid escape of recognition by an immune system of a subject administered a pharmaceutical composition containing an epitope from a single protein or epitopes from fewer proteins than in a pharmaceutical composition described herein.
  • the subject express an HLA molecule encoded by an HLA allele of any one of Table 1A, Table IB, Table 1C, Table 2Ai or Table 2Aii, Table 2B or Table 16 and the epitope sequence is an HLA allele-matched epitope sequence.
  • the epitope sequence comprises one or more or each of the following: SAPPAQYEL, AVASKILGL, EYADVFHLY, DEFTPFDW, VRIQPGQTF, SFRLFARTR, KFLPFQQF, VVQEGVLTA, RLDKVEAEV and FGADPIHSL.
  • Also provided herein is a method of treating or preventing a 2019 SARS-CoV 2 infection in a subject in need thereof, comprising administering to the subject a pharmaceutical composition described herein.
  • the pharmaceutical composition is administered in addition to one or more therapeutics for the 2019 SARS-CoV 2 viral infection in the subject.
  • the pharmaceutical composition is administered in combination with (a) a polypeptide having an amino acid sequence of a 2019 SARS-CoV 2 spike protein or fragment thereof; (b) a recombinant polynucleotide encoding a 2019 SARS-CoV 2 spike protein or fragment thereof; or a 2019 SARS-CoV 2 spike protein pharmaceutical composition comprising (a) or (b).
  • the 2019 SARS-CoV 2 spike protein or fragment thereof is a SARS-CoV-2 spike protein or a fragment thereof.
  • the pharmaceutical composition is administered 1-10 weeks after a first administration of the 2019 SARS-CoV 2 spike protein pharmaceutical composition. In some embodiments, the pharmaceutical composition is administered 1-6 weeks, 1-6 months or 1-2 years or later after a first administration of the 2019 SARS-CoV 2 spike protein pharmaceutical composition. In some embodiments, the pharmaceutical composition is administered on the same day or simultaneously with an administration of the 2019 SARS-CoV 2 spike protein pharmaceutical composition. In some embodiments, the pharmaceutical composition is co-formulated with the polypeptide having an amino acid sequence of a 2019 SARS-CoV 2 spike protein or fragment thereof or the recombinant polynucleotide encoding a 2019 SARS-CoV 2 spike protein or fragment thereof.
  • the pharmaceutical composition is administered before an administration of the 2019 SARS-CoV 2 spike protein pharmaceutical composition, such as 2-10 weeks before an administration of the 2019 SARS- CoV 2 spike protein pharmaceutical composition.
  • the pharmaceutical composition is administered prophylactically.
  • the pharmaceutical composition is administered once every 1, 2, 3, 4, 5, 6 or more weeks; or once every 1-7, 7-14, 14-21, 21-28, or 28-35 days; or once every 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, or 35 days.
  • composition described herein for preparing a therapeutic for treating or preventing a respiratory viral infection caused by 2019 SARS CoV-2 virus.
  • composition described herein or a pharmaceutical composition described herein for use as a medicament.
  • composition described herein or a pharmaceutical composition described herein for use in the treatment or prevention of a respiratory viral infection caused by 2019 SARS CoV-2 virus.
  • an antigenic peptide comprising an epitope sequence from Table 1A, Table IB, Table 1C, Table 2Ai, Table 2Aii or Table 2B.
  • a polynucleotide encoding and antigenic peptide comprising an epitope sequence from Table 1A, Table IB, Table 1C, Table 2Ai, Table 2Aii or Table 2B.
  • the antigenic peptide and/or polynucleotide may be recombinant.
  • the antigenic peptide and/or polynucleotide may be isolated or purified.
  • the antigenic peptide may be synthetic or expressed from a polynucleotide.
  • an antibody or B cell comprising an antibody that binds to an antigenic peptide comprising an epitope sequence from Table 1A, Table IB, Table 1C, Table 2Ai, Table 2Aii or Table 2B.
  • TCR T cell receptor
  • T cell comprising a TCR that binds an epitope sequence from Table 1A or Table IB in complex with a corresponding MHC class I molecule according to Table 1 A or Table IB.
  • the TCR can bind to an epitope sequence from column 2 (set 1) of Table 1A in complex with a corresponding MHC class I molecule from column 3 (set 1) in the same row of Table 1A.
  • the TCR can bind to an epitope sequence from column 4 (set 2) of Table 1A in complex with a corresponding MHC class I molecule from column 5 (set 2) in the same row of Table 1A.
  • the TCR can bind to an epitope sequence from column 6 (set 3) of Table 1 A in complex with a corresponding MHC class I molecule from column 7 (set 3) in the same row of Table 1A.
  • the TCR can bind to an epitope sequence from column 2 (set 1) of Table IB in complex with a corresponding MHC class I molecule from column 3 (set 1) in the same row of Table IB.
  • the TCR can bind to an epitope sequence from column 4 (set 2) of Table IB in complex with a corresponding MHC class I molecule from column 5 (set 2) in the same row of Table IB.
  • TCR T cell receptor
  • T cell comprising a TCR that binds to an epitope sequence from Table 2Ai or Table 2Aii in complex with a corresponding MHC class II molecule according to Table 2Ai or Table 2Aii.
  • the TCR can bind to an epitope sequence from column 2 (set 1) of Table 2Ai in complex with a corresponding MHC class II molecule from column 3 (set 1) in the same row of Table 2Ai.
  • the TCR can bind to an epitope sequence from column 4 (set 2) of Table 2Ai in complex with a corresponding MHC class II molecule from column 5 (set 2) in the same row of Table 2Ai.
  • a TCR can bind to an epitope sequence from the left column of Table 2Aii in complex with a corresponding MHC class II molecule from the right column of Table 2Aii.
  • a method of treating or preventing viral infection in a subject in need thereof comprising administering to the subject an antigenic peptide comprising an epitope sequence from Table 1A, Table IB, Table 1C, Table 2Ai, Table 2Aii or Table 2B.
  • a method of treating or preventing viral infection in a subject in need thereof comprising administering to the subject a polynucleotide encoding and antigenic peptide comprising an epitope sequence from Table 1A, Table IB, Table 1C, Table 2Ai, Table 2Aii or Table 2B.
  • Also provided herein is a method of treating or preventing a viral infection in a subject in need thereof comprising administering to the subject an antibody or B cell comprising an antibody that binds to an antigenic peptide comprising an epitope sequence from Table 1 A, Table IB, Table 1C, Table 2Ai, Table 2Aii or Table 2B.
  • Also provided herein is a method of treating or preventing viral infection in a subject in need thereof comprising administering to the subject a T cell receptor (TCR) or T cell comprising a TCR that that binds an epitope sequence from Table 1A or Table IB in complex with a corresponding MHC class I molecule according to Table 1A or Table IB.
  • TCR T cell receptor
  • the method can comprise administering to the subject a TCR or T cell comprising a TCR that can bind to an epitope sequence from column 2 (set 1) of Table 1A in complex with a corresponding MHC class I molecule from column 3 (set 1) in the same row of Table 1 A.
  • the method can comprise administering to a TCR or T cell comprising a TCR that can bind to an epitope sequence from column 2 (set 1) of Table 1A in complex with a corresponding MHC class I molecule from column 3 (set 1) in the same row of Table 1 A to a subject that expresses the corresponding MHC class I molecule from column 3 (set 1).
  • the method can comprise administering to the subject a TCR or T cell comprising a TCR that can bind to an epitope sequence from column 4 (set 2) of Table 1 A in complex with a corresponding MHC class I molecule from column 5 (set 2) in the same row of Table 1A.
  • the method can comprise administering to a TCR or T cell comprising a TCR that can bind to an epitope sequence from column 4 (set 2) of Table 1A in complex with a corresponding MHC class I molecule from column 5 (set 2) in the same row of Table 1 A to a subject that expresses the corresponding MHC class I molecule from column 5 (set 2).
  • the method can comprise administering to the subject a TCR or T cell comprising a TCR that can bind to an epitope sequence from column 6 (set 3) of Table 1A in complex with a corresponding MHC class I molecule from column 7 (set 3) in the same row of Table 1 A.
  • the method can comprise administering to a TCR or T cell comprising a TCR that can bind to an epitope sequence from column 6 (set 3) of Table 1A in complex with a corresponding MHC class I molecule from column 7 (set 3) in the same row of Table 1A to a subject that expresses the corresponding MHC class I molecule from column 7 (set 3).
  • the method can comprise administering to the subject a TCR or T cell comprising a TCR that can bind to an epitope sequence from column 2 (set 1) of Table IB in complex with a corresponding MHC class I molecule from column 3 (set 1) in the same row of Table IB.
  • the method can comprise administering to a TCR or T cell comprising a TCR that can bind to an epitope sequence from column 2 (set 1) of Table IB in complex with a corresponding MHC class I molecule from column 3 (set 1) in the same row of Table IB to a subject that expresses the corresponding MHC class I molecule from column 3 (set 1).
  • the method can comprise administering to the subject a TCR or T cell comprising a TCR that can bind to an epitope sequence from column 4 (set 2) of Table IB in complex with a corresponding MHC class I molecule from column 5 (set 2) in the same row of Table IB.
  • the method can comprise administering to a TCR or T cell comprising a TCR that can bind to an epitope sequence from column 4 (set 2) of Table IB in complex with a corresponding MHC class I molecule from column 5 (set 2) in the same row of Table IB to a subject that expresses the corresponding MHC class I molecule from column 5 (set 2).
  • the method can comprise administering to the subject a TCR or T cell comprising a TCR that can bind to an epitope sequence from column 2 (set 1) of Table 2Ai in complex with a corresponding MHC class II molecule from column 3 (set 1) in the same row of Table 2Ai.
  • the method can comprise administering to a TCR or T cell comprising a TCR that can bind to an epitope sequence from column 2 (set 1) of Table 2Ai in complex with a corresponding MHC class II molecule from column 3 (set 1) in the same row of Table 2Ai to a subject that expresses the corresponding MHC class II molecule from column 3 (set 1).
  • the method can comprise administering to the subject a TCR or T cell comprising a TCR that can bind to an epitope sequence from column 4 (set 2) of Table 2Ai in complex with a corresponding MHC class II molecule from column 5 (set 2) in the same row of Table 2Ai.
  • the method can comprise administering to a TCR or T cell comprising a TCR that can bind to an epitope sequence from column 4 (set 2) of Table 2Ai in complex with a corresponding MHC class II molecule from column 5 (set 2) in the same row of Table 2Ai to a subject that expresses the corresponding MHC class II molecule from column 5 (set 2).
  • the method can comprise administering to the subject a TCR or T cell comprising a TCR that can bind to an epitope sequence from the left column of Table 2Aii in complex with a corresponding MHC class II molecule from the right column in the same row of Table 2Aii.
  • the antigenic peptide is a viral antigen. In another embodiment, the antigenic peptide is a non-mutated overexpressed antigen. In some embodiments, the viral antigen is derived from publicly disclosed information on the viral genetic information. In some embodiments, the viral antigen is derived from analysis of the viral genome to predict suitable epitopes for T cell activation. In some embodiments, the viral antigen is derived from analysis of the sequence of the viral genome in a MHC- peptide presentation prediction algorithm implemented in a computer processor.
  • the viral antigen is derived from analysis of the viral sequences in an MHC -peptide presentation prediction algorithm implemented in a computer processor that has been trained by a machine learning software, which predicts the likelihood of binding and presentation of an epitope by an MHC class I or an MHC class II antigen.
  • the MHC -peptide presentation predictor is neonmhc2.
  • the MHC -peptide presentation prediction algorithm or MHC -peptide presentation predictor is NetMHCpan or NetMHCIIpan and in addition, further analyzed in MHC -peptide presentation predictor NetMHCpan or NetMHCIIpan for comparison.
  • a skilled artisan may use hidden markov model approach for MHC -peptide presentation prediction.
  • the peptide prediction model MARIA may be utilized.
  • the MHC- peptide presentation prediction algorithm or MHC -peptide presentation predictor used is not NetMHCpan or NetMHCIIpan.
  • the viral sequences are analyzed in MHC -peptide presentation prediction algorithm implemented in a computer processor where the MHC -peptide presentation predictor is neonmhc 1 or neonmhc2, that refer respectively to class I and class II binding prediction.
  • the MHC -peptide presentation predictor model is RECON, which offers high quality MHC- peptide presentation prediction based on expression, processing and binding capabilities.
  • a method of treating a viral disease in a subject caused by a coronavirus comprising: administering to the subject a composition comprising one or more viral peptide antigens, wherein the viral peptide antigens are predicted to bind to an MHC class I or an MHC class II peptide of the subject, and are predicted to be presented by an antigen presenting cell to a T cell of the subject such that an antiviral response is initiated in the subject.
  • the viral antigen is derived from analysis of the sequence of the viral genome in a MHC -peptide presentation prediction algorithm implemented in a computer processor.
  • the viral antigen is derived from analysis of the viral sequences in an MHC -peptide presentation prediction algorithm implemented in a computer processor that has been trained by a machine learning software, which predicts the likelihood of binding and presentation of an epitope by an MHC class I or an MHC class II antigen.
  • the MHC -peptide presentation predictor is neonmhc2.
  • the method further comprises analyzing nucleic acid sequence derived from viral genome in an MHC -peptide presentation prediction model, comprising an algorithm implemented in a computer processor that has been trained by a machine learning software, wherein the MHC -peptide presentation prediction model predicts the likelihood of binding and presentation of an epitope encoded by the viral genome by an MHC class I or an MHC class II antigen.
  • the method further comprises analyzing a biological sample from a subject for identification of the MHC class I and MHC class II repertoire, wherein the analyzing comprises analyzing by genome or whole exome sequencing or by analysis of proteins encoded by an HLA gene.
  • the method further comprises matching the epitopes predicted by the MHC -peptide presentation prediction model that have a high affinity for an MHC class I or an MHC class II peptide encoded by an HLA gene of the subject, and selecting one or more peptides that are predicted to bind an MHC peptide encoded by an HLA gene of the subject with a high affinity ranked by the MHC -peptide presentation prediction model.
  • the one or more peptides that are selected have been predicted to bind an MHC peptide encoded by an HLA gene of the subject with an affinity of at least 1000 nM.
  • the one or more peptides that are selected have been predicted to bind an MHC class I peptide encoded by an HLA gene of the subject with an affinity of at least 500 nM. In some embodiments, the one or more peptides that are selected have been predicted to bind an MHC class II peptide encoded by an HLA gene of the subject with an affinity of at least 1000 nM. [00066] In some embodiments, the MHC -peptide presentation prediction model is programmed to provide a ranking order in decreasing order of a likelihood for a particular epitope or antigenic peptide to bind to an HLA allele that would present the peptide to a T cell receptor.
  • epitope sequences that have the highest likelihood of binding and being presented by an HLA are selected for preparing a therapeutic.
  • the selection of the HLA may be restricted by HLA expressed in a subject.
  • the selection of the HLA may be based on the prevalence (e.g., higher prevalence) of the allele in a population.
  • the epitopes may be selected for preparing a therapeutic based on the higher likelihood for the peptide (epitope) of binding to and being presented by an HLA allele, e.g., an HLA allele of interest.
  • this % rank value may be determined by evaluating the percentile in which a query peptide scores for a specific allele compared to a fixed set of reference peptides (with a different set of reference peptides for class I and class II).
  • the top 10% of the epitopes that have the highest likelihood of binding to an HLA allele may be selected.
  • the top 2% of the epitopes that have the highest likelihood of binding to an HLA allele may be selected.
  • the top 5% of the epitopes that have the highest likelihood of binding to an HLA allele may be selected.
  • the top 8% of the epitopes that have the highest likelihood of binding to an HLA allele may be selected.
  • the top 1% of the epitopes that have the highest likelihood of binding to an HLA allele may be selected. In some embodiments the top 0.5 % of the epitopes that have the highest likelihood of binding to an HLA allele may be selected. In some embodiments the top 0.1 % of the epitopes that have the highest likelihood of binding to an HLA allele may be selected. In some embodiments the top 0.01 % of the epitopes that have the highest likelihood of binding to an HLA allele may be selected. In some embodiments the selection of the cut off may be dependent on the availability and number of epitopes predicted to have a high likelihood of binding to an HLA allele as determined by the prediction model.
  • the subject may be infected by the virus. In some embodiments, the subject may be at risk of infection by the virus.
  • the virus is a coronavirus. In some embodiments, the coronavirus is selected from a SARS virus, a MERS coronavirus or a 2019 SARS CoV- 2 virus.
  • the one or more viral peptide antigen comprises a peptide comprising at least 8 contiguous amino acids of a sequence in Table 1A, Table IB, Table 1C, Table 2Ai, Table 2Aii, Table 2B, Table 9, Table 10, Table 11, Table 12, Table 14A, Table 14B, Table 15 or Table 16.
  • the one or more viral peptide antigen comprises a peptide comprising at least 7 contiguous amino acids of a sequence in Table 1A, Table IB, Table 1C, Table 2Ai, Table 2Aii, Table 2B, Table 9, Table 10, Table 11, Table 12, Table 14A, Table 14B, Table 15 or Table 16.
  • the one or more viral peptide antigen comprises a peptide comprising at least 6 contiguous amino acids of a sequence in Table 1A, Table IB, Table 1C, Table 2Ai, Table 2Aii, Table 2B, Table 9, Table 10, Table 11, Table 12, Table 14A, Table 14B, Table 15 or Table 16.
  • the antigenic peptide is between about 5 to about 50 amino acids in length. In another embodiment, the antigenic peptide is between about 15 to about 35 amino acids in length. In another embodiment, the antigenic peptide is about 15 amino acids or less in length. In another embodiment, the antigenic peptide is between about 8 and about 11 amino acids in length. In another embodiment, the antigenic peptide is 9 or 10 amino acids in length. In one embodiment, the antigenic peptide binds major histocompatibility complex (MHC) class I. In another embodiment, the antigenic peptide binds MHC class I with a binding affinity of less than about 500 nM.
  • MHC major histocompatibility complex
  • the antigenic peptide is about 30 amino acids or less in length. In another embodiment, the antigenic peptide is between about 6 and about 25 amino acids in length. In another embodiment, the antigenic peptide is between about 15 and about 24 amino acids in length. In another embodiment, the antigenic peptide is between about 9 and about 15 amino acids in length. In one embodiment, the antigenic peptide binds MHC class II. In another embodiment, the antigenic peptide binds MHC class II with a binding affinity of less than about 1000 nM.
  • the antigenic peptide further comprises flanking amino acids.
  • the flanking amino acids are not native flanking amino acids.
  • the antigenic peptide is linked to at least a second antigenic peptide.
  • the peptides are linked using a poly-glycine or poly-serine linker.
  • the second antigenic peptide binds MHC class I or class P with a binding affinity of less than about 1000 nM.
  • the second antigenic peptide binds MHC class I or class II with a binding affinity of less than about 500 nM.
  • both of the epitopes bind to human leukocyte antigen (HLA) -A, -B, -C, -DP, -DQ, or -DR.
  • HLA human leukocyte antigen
  • the antigenic peptide binds a class I HLA and the second antigenic peptide binds a class II HLA.
  • the antigenic peptide binds a class II HLA and the second antigenic peptide binds a class I HLA.
  • the antigenic peptide further comprises modifications which increase in vivo half-life, cellular targeting, antigen uptake, antigen processing, MHC affinity, MHC stability, or antigen presentation.
  • the modification is conjugation to a carrier protein, conjugation to a ligand, conjugation to an antibody, PEGylation, polysialylation HESylation, recombinant PEG mimetics, Fc fusion, albumin fusion, nanoparticle attachment, nanoparticulate encapsulation, cholesterol fusion, iron fusion, acylation, amidation, glycosylation, side chain oxidation, phosphorylation, biotinylation, the addition of a surface active material, the addition of amino acid mimetics, or the addition of unnatural amino acids, for example, synthetic amino acids, or f-moc amino acids, D-amino acids N-methyl amino acids.
  • the cells that are targeted are antigen presenting cells.
  • the antigen presenting cells are dendritic cells.
  • the dendritic cells are targeted using DEC205, XCR1, CD197, CD80, CD86, CD123, CD209, CD273, CD283, CD289, CD184, CD85h, CD85], CD85k, CD85d, CD85g, CD85a, CD141, CD11 c, CD83, TSLP receptor, or CDla marker.
  • the dendritic cells are targeted using the CD141, DEC205, or XCR1 marker.
  • an in vivo delivery system comprising an antigenic peptide described herein.
  • the delivery system includes cell-penetrating peptides, nanoparticulate encapsulation, virus like particles, or liposomes.
  • the cell- penetrating peptide is TAT peptide, herpes simplex virus VP22, transportan, or Antp.
  • a cell comprising an antigenic peptide described herein.
  • the cell is an antigen presenting cell.
  • the cell is a dendritic cell.
  • composition comprising an antigenic peptide described herein.
  • the composition comprises at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, or at least 30 of the antigenic peptides comprising an epitope of Table 1A.
  • the composition comprises at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, or at least 30 of the antigenic peptides comprising an epitope of Table IB.
  • the composition comprises at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, or at least 30 of the antigenic peptides comprising an epitope of Table 2B.
  • the composition comprises between 2 and 20 antigenic peptides.
  • the composition further comprises at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, or at least 25, at least 26, at least 27, at least 28, at least 29, or at least 30 additional antigenic peptides.
  • the composition comprises between about 4 and about 20 additional antigenic peptides.
  • the additional antigenic peptide is specific for coronavirus.
  • RNA RNA
  • DNA DNA
  • the RNA is modified to increase stability, increase cellular targeting, increase translation efficiency, adjuvanticity, cytosol accessibility, and/or decrease cytotoxicity.
  • the modification is conjugation to a carrier protein, conjugation to a ligand, conjugation to an antibody, codon optimization, increased GC-content, incorporation of modified nucleosides, incorporation of 5'-cap or cap analog, and/or incorporation of a poly-A sequence e.g., an unmasked poly-A sequence, or a disrupted poly-A sequence in which two segments of contiguous A sequences linked by a linker.
  • a poly-A sequence e.g., an unmasked poly-A sequence, or a disrupted poly-A sequence in which two segments of contiguous A sequences linked by a linker.
  • a cell comprising a polynucleotide described herein.
  • a vector comprising a polynucleotide described herein.
  • the polynucleotide is operably linked to a promoter.
  • the vector is a self-amplifying RNA replicon, plasmid, phage, transposon, cosmid, virus, or virion.
  • the vector is an adeno-associated virus, herpesvirus, lentivirus, or pseudotypes thereof
  • provided herein is an in vivo delivery system comprising an polynucleotide described herein.
  • the delivery system includes spherical nucleic acids, viruses, virus-like particles, plasmids, bacterial plasmids, or nanoparticles.
  • a cell comprising a vector or delivery system described herein.
  • the cell is an antigen presenting cell.
  • the cell is a dendritic cell.
  • the cell is an immature dendritic cell.
  • provided herein is a composition comprising at least one polynucleotide described herein.
  • a composition comprising one or more antigenic peptides described herein in combination with one or more 2019 SARS CoV-2 vaccines e.g., mRNA-based vaccines, DNA-based vaccines, AAV-based vaccines, protein-based vaccines.
  • a composition comprising one or more polynucleotides encoding at least one antigenic peptide described herein in combination with one or more 2019 SARS CoV-2 vaccines e.g., mRNA-based vaccines, DNA-based vaccines, AAV-based vaccines, protein-based vaccines.
  • provided herein is a single polynucleotide encoding more than one antigenic peptide as described herein. In some embodiments, provided herein is a single polynucleotide encoding (i) at least one antigenic peptide as described herein and (ii) a 2019 SARS CoV-2 protein (e.g., S protein) and/or immunogenic fragments thereof (e.g., receptor binding domain (RBD) of S protein).
  • 2019 SARS CoV-2 protein e.g., S protein
  • RBD receptor binding domain
  • the composition comprises at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, or at least 30 of the polynucleotides.
  • the composition comprises between about 2 and about 20 polynucleotides.
  • the composition further comprises at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, or at least 30 additional antigenic polynucleotides encoding for additional antigenic peptides.
  • the composition comprises between about 4 and about 20 additional antigenic polynucleotides.
  • the polynucleotides and the additional antigenic polynucleotides are linked.
  • the polynucleotides are linked using nucleic acids that encode a poly-glycine or poly-serine linker.
  • a T cell receptor capable of binding at least one antigenic peptide described herein.
  • the TCR is capable of binding the antigenic peptide in the context of MHC class I or class II.
  • a chimeric antigen receptor comprising: (i) a T cell activation molecule; (ii) a transmembrane region; and (iii) an antigen recognition moiety capable of binding an antigenic peptide described herein.
  • CD3-zeta is the T cell activation molecule.
  • the chimeric antigen receptor further comprises at least one costimulatory signaling domain.
  • the signaling domain is CD28, 4-1BB, ICOS, 0X40, IT AM, or Fc epsilon Rl-gamma.
  • the antigen recognition moiety is capable of binding the antigenic peptide in the context of MHC class I or class II.
  • the chimeric antigen receptor comprises the CD3-zeta, CD28, CTLA-4, ICOS, BTLA, KIR, LAG3, CD137, 0X40, CD27, CD40L, Tim-3, A2aR, or PD-1 transmembrane region.
  • a T cell comprising the T cell receptor or chimeric antigen receptor described herein.
  • the T cell is a helper or cytotoxic T cell.
  • a nucleic acid comprising a promoter operably linked to a polynucleotide encoding a T cell receptor described herein.
  • the TCR is capable of binding the at least one antigenic peptide in the context of major histocompatibility complex (MHC) class I or class II.
  • the nucleic acid comprises a promoter operably linked to a polynucleotide encoding a chimeric antigen receptor described herein.
  • the antigen recognition moiety is capable of binding the at least one antigenic peptide in the context of major histocompatibility complex (MHC) class I or class II.
  • an antibody capable of binding a peptide comprising an epitope of Table IB is provided herein.
  • a modified cell transfected or transduced with a nucleic acid described herein is provided herein.
  • the modified cell is a T cell, tumor infiltrating lymphocyte, NK-T cell, TCR-expressing cell, CD4+ T cell, CD8+ T cell, or NK cell.
  • a composition comprising a T cell receptor or chimeric antigen receptor described herein.
  • a composition comprises autologous patient T cells containing a T cell receptor or chimeric antigen receptor described herein.
  • the composition further comprises an immune checkpoint inhibitor.
  • the composition further comprises at least two immune checkpoint inhibitors.
  • each of the immune checkpoint inhibitors inhibits a checkpoint protein selected from the group consisting of CTLA-4, PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD160, CGEN-15049, CLIK 1, CHK2, A2aR, andB-7 family ligands or a combination thereof.
  • a checkpoint protein selected from the group consisting of CTLA-4, PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD160, CGEN-15049, CLIK 1, CHK2, A2aR, andB-7 family ligands or a combination thereof.
  • each of the immune checkpoint inhibitors interacts with a ligand of a checkpoint protein selected from the group consisting of CTLA-4, PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD160, CGEN-15049, CHK 1, CHK2, A2aR, and B-7 family ligands or a combination thereof.
  • a checkpoint protein selected from the group consisting of CTLA-4, PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD160, CGEN-15049, CHK 1, CHK2, A2aR, and B-7 family ligands or a combination thereof.
  • the composition further comprises an immune modulator or adjuvant.
  • the immune modulator is a co-stimulatory ligand, a TNF ligand, an Ig superfamily ligand, CD28, CD80, CD86, ICOS, CD40L, 0X40, CD27, GITR, CD30, DR3, CD69, or 4-1BB.
  • the immune modulator is at least one an infected cell extract.
  • the infected cell is autologous to the subject in need of the composition.
  • the infected cell has undergone lysis or been exposed to UV radiation.
  • the composition further comprises an adjuvant.
  • the adjuvant is selected from the group consisting of: Poly(EC), Poly-ICLC, STING agonist, 1018 ISS, aluminum salts, Amplivax, AS15, BCG, CP-870,893, CpG7909, CyaA, dSLIM, GM-CSF, IC30, IC31, Imiquimod, ImuFact IMP321, IS Patch, ISS, ISCOMATRIX, Juvlmmune, LipoVac, MF59, monophosphoryl lipid A, Montanide IMS 1312 VG, Montanide ISA 206 VG, Montanide ISA 50 V2, Montanide ISA 51 VG, OK-432, OM-174, OM-197-MP- EC, ISA-TLR2 agonist, ONTAK, PepTel®.
  • the adjuvant induces a humoral when administered to a subject.
  • the adjuvant induces a T helper cell type 1 when administered to a subject.
  • a vaccine composition comprising one or more peptides comprising at least 8 contiguous amino acids from the epitopes defined in Table 1A, Table IB, Table 1C, Table 2Ai, Table 2Aii or Table 2B, comprising contacting a cell with a peptide, polynucleotide, delivery system, vector, composition, antibody, or cells of the invention.
  • a method of treating a viral infection specifically, a coronaviral infection, for example a 2019 SARS CoV-2 infection by enhancing, or prolonging an antiviral response in a subject in need thereof comprising administering to the subject the peptide, polynucleotide, vector, composition, antibody, or cells described herein.
  • the subj ect is a human. In another embodiment, the subj ect has a viral infection.
  • the subject is infected by a respiratory virus, such as an acute respiratory virus, for example, a SARS-like virus or a MERS or MERS-like virus, or more specifically, a coronavirus of the 2019 SARS CoV-2 strain.
  • the subject is infected with a 2019 SARS CoV-2 coronavirus.
  • the subject has been detectably infected with the 2019 SARS CoV-2 coronavirus.
  • the subject is asymptomatic. In some embodiments, the subject is symptomatic.
  • the subject is not detected to have been infected by a 2019 SARS CoV-2 virus or a related virus, but the subject is in close proximity of an infected person, in an infected area or otherwise at risk of infection.
  • a peptide is administered. In another embodiment, the administration is systemic. In another embodiment of the method, a polynucleotide, optionally RNA, is administered. In one embodiment, the polynucleotide is administered parenterally. In one embodiment, the polynucleotide is administered intravenously. In another embodiment, the polynucleotide is administered intradermally or intramuscularly, or subcutaneously. In one embodiment, the polynucleotide is administered intramuscularly. In one embodiment of the method, a cell is administered. In another embodiment, the cell is a T cell or dendritic cell. In another embodiment, the peptide or polynucleotide comprises an antigen presenting cell targeting moiety.
  • the peptide, polynucleotide, vector, composition, or cells is administered prior to administering concurrent with another therapy, such as another antiviral therapy.
  • another therapy such as another antiviral therapy.
  • the peptide, polynucleotide, vector, composition, or cells is administered before or after the another antiviral therapy.
  • administration of the another antiviral therapy is continued throughout antigen peptide, polynucleotide, vector, composition, or cell therapy.
  • an additional agent is administered.
  • the agent is a chemotherapeutic agent, an immunomodulatory drug, an immune metabolism modifying drug, a targeted therapy, radiation an anti-angiogenesis agent, or an agent that reduces immune-suppression.
  • the administration of a pharmaceutical composition described herein elicits or promotes a CD4+ T cell immune response.
  • the administration of a pharmaceutical composition described herein elicits or promotes a CD4+ T cell immune response and a CD8+ T cell immune response.
  • the patient received a chemotherapeutic agent, an immunomodulatory drug, an immune metabolism modifying drug, targeted therapy or radiation prior to and/or during receipt of the antigen peptide or nucleic acid vaccine.
  • the autologous T cells are obtained from a patient that has already received at least one round of T cell therapy containing an antigen.
  • the method further comprises adoptive T cell therapy.
  • the adoptive T cell therapy comprises autologous T cells.
  • the autologous T cells are targeted against viral antigens.
  • the adoptive T cell therapy further comprises allogenic T cells.
  • the allogenic T cells are targeted against viral antigens.
  • a method for evaluating the efficacy of treatment comprising: (i) measuring the number or concentration of target cells in a first sample obtained from the subject before administering the modified cell, (ii) measuring the number or concentration of target cells in a second sample obtained from the subject after administration of the modified cell, and (iii) determining an increase or decrease of the number or concentration of target cells in the second sample compared to the number or concentration of target cells in the first sample.
  • the treatment efficacy is determined by monitoring a clinical outcome; an increase, enhancement or prolongation of antiviral activity by T cells; an increase in the number of antiviral T cells or activated T cells as compared with the number prior to treatment; B cell activity; CD4 T cell activity; or a combination thereof.
  • the treatment efficacy is determined by monitoring a biomarker.
  • the treatment effect is predicted by presence of T cells or by presence of a gene signature indicating T cell inflammation or a combination thereof.
  • composition comprising: one or more polypeptides having an amino acid sequence of any one of the sequences depicted in column 2 of Table 11 and 12; or one or more recombinant polynucleotide constructs each encoding a polypeptide having an amino acid sequence of any one of the sequences depicted in column 2 of Table 11 and 12.
  • the one or more polypeptides comprises at least 2, 3, 4, 5, 6, 7 or 8 different polypeptides having an amino acid sequence of any one of the sequences depicted in column 2 of Table 11 and 12; or wherein the one or more recombinant polynucleotide constructs comprises at least 2, 3, 4, 5, 6, 7 or 8 recombinant polynucleotide constructs each encoding a different polypeptide having an amino acid sequence of any one of the sequences depicted in column 2 of Table 11 and 12.
  • the pharmaceutical composition comprises at least 8 recombinant polynucleotide strings.
  • the one or more recombinant polynucleotide strings encoding a plurality of coronavirus peptide antigens comprises a sequence selected from a group of sequences depicted in SEQ ID RS Cln, RS C2n, RS C3n, RSC4n, RS C5n, RS C6n, RS C7n, and RS C8n, or a sequence that is at least 70% sequence identity to any one of the above.
  • the recombinant polynucleotide construct comprises an mRNA.
  • the recombinant polynucleotide construct is an mRNA.
  • the pharmaceutical composition further comprises one or more lipid components.
  • the one or more lipids comprise a lipid nanoparticle (LNP).
  • the LNP encapsulates the recombinant polynucleotide construct.
  • the pharmaceutical composition is administered to a subject in need thereof.
  • a method of treating COVID in a subject in need thereof comprising administering to the subject a pharmaceutical composition described above.
  • the pharmaceutical composition is administered in addition to one or more therapeutic for COVID.
  • the pharmaceutical composition is administered in combination with one or more polypeptides having an amino acid sequence of a 2019 SARS CoV-2 spike protein or fragment thereof; or one or more recombinant polynucleotide constructs encoding a 2019 SARS CoV-2 spike protein or fragment thereof.
  • the 2019 SARS CoV-2 spike protein or fragment thereof is a SARS-CoV-2 spike protein or a fragment thereof.
  • the pharmaceutical composition is administered 2-10 weeks after a first administration of the 2019 SARS CoV-2 spike protein or fragment thereof. In some embodiments, the pharmaceutical composition is administered 1-6 months after a first administration of the 2019 SARS CoV-2 spike protein or fragment thereof. In some embodiments, the pharmaceutical composition is administered simultaneously with an administration of the 2019 SARS CoV-2 spike protein or fragment thereof. In some embodiments, the pharmaceutical composition is administered 2-10 weeks before an administration of the 2019 SARS CoV-2 spike protein or fragment thereof. In some embodiments, the pharmaceutical composition is administered 2-10 weeks after the first administration of vaccine comprising a SARS-CoV-2 spike protein or polynucleotide encoding the same.
  • the pharmaceutical composition is administered 1-6 months after the first administration of a SARS-CoV-2 spike protein or polynucleotide encoding the same. In some embodiments, the pharmaceutical composition is administered simultaneously with the administration of a SARS-CoV-2 spike protein or polynucleotide encoding the same. In some embodiments, the pharmaceutical composition is administered prophylactically. In some embodiments, the pharmaceutical composition is administered once every 1, 2, 3, 4, 5, 6 or more weeks.
  • compositions described herein for preparing a therapeutic for treating or preventing a respiratory viral infection caused by 2019 SARS CoV-2 virus.
  • present invention encompasses not only the entire group listed as a whole, but also each member of the group individually and all possible subgroups of the main group, and also the main group absent one or more of the group members.
  • present invention also envisages the explicit exclusion of one or more of any of the group members in the embodiments of the invention.
  • FIG. 1 depicts an exemplary flow diagram of a method to identify peptides most relevant to the generation of CD8+ T cell responses against the viral epitopes described herein.
  • FIG. 2 depicts exemplary graphs of results obtained using a T cell epitope prediction algorithm applied to class I peptide-MHC allele pairs in a validation dataset and comparison of the computed percent- ranks of these pairs with reported MHC -binding assay results.
  • the percent-ranks of peptide-MHC allele pairs which had a binary “Positive” result in the MHC -binding assay were significantly lower than pairs with a “Negative” result. In the more granular positive results, stronger assay results (low intermediate ⁇ high) were associated with significantly lower percent-ranks.
  • FIG. 3 depicts experimental validation of HLA-A02:01 predicted epitopes from 2019 SARS CoV- 2 in human T cell induction assays.
  • 23 peptides that were predicted to be high binders to HLA-A02:01 were synthesized and assayed in T cell inductions using PBMCs from three human donors.
  • Epitopes were considered to be immunogenic if at least one donor raised a T cell response to the peptide as determined by pMHC multimer technology.
  • Representative flow cytometry plots of pMHC staining using peptides from Table 4 of Example 8 are shown.
  • FIG. 4A depicts exemplary graphs of cumulative EISA population coverage of HLA alleles for the indicated peptides predicted to be MHC class I epitopes (left) and the cumulative EISA population coverage of HLA alleles for 25mer peptides predicted to be MHC class II epitopes (right).
  • FIG. 4B depicts a small number of predicted multi-allele binding epitopes from individual 2019 SARS- CoV-2 proteins (alternatively termed 2019-CoV-2 proteins) can achieve broad population coverage.
  • the upper panel shows cumulative HLA-I coverage for USA, EUR, and API populations versus the number of included prioritized HLA-I epitopes for M, N, and S proteins, respectively.
  • Peptide sequences corresponding to the upper panel are shown in Table 6.
  • the lower panel shows cumulative HLA- II coverage for each population versus the number of included prioritized HLA-II 25mers for M, N, and S proteins, respectively.
  • Peptide sequences corresponding to the lower panel are shown in Table 7.
  • FIG. 5 depicts results from analysis of publicly available proteomic datasets showing relative 2019 SARS CoV-2 protein expression levels that can be leveraged to prioritize potential vaccine targets.
  • Three datasets examining the proteomic response to 2019 SARS CoV-2 infection (alternatively termed 2019 SARS CoV-2 infection) were re-analyzed and protein abundance was estimated by spectral counts normalized to protein length. Any annotated ORF not shown in the figure was not detected in these proteomic studies. Across all three studies, the nucleocapsid protein is the most abundant protein during 2019 SARS CoV-2 infection.
  • FIG. 6A depicts a graphical representation of a string construct described as group 1, also described in Tables 9 and 11.
  • FIG. 6B provides a detailed and expanded view of the constructs in FIG. 6A.
  • FIG. 7A depicts a graphical representation of a string construct described as group 2, also described in Tables 10 and 12.
  • FIG. 7B provides a detailed and expanded view of the constructs in FIG. 7A.
  • FIG. 8Ai-8Aii show characterization of BNT mRNA vaccine-induced T cells on a single epitope level. Included data shows epitope responsive T cells for the indicated epitopes in three different participants.
  • the vaccine comprises mRNA encoding a SARS-CoV-2 spike protein of 2019 SARS COV- 2 encapsulated in a lipid nanoparticle.
  • FIG.8B shows multimer positive CD8+ cells analysed by flow cytometry for cell surface markers, CCR7, CD45RA, CD3, PD-1, CD38, HLA-DR, CD28 and CD27.
  • FIG. 8C shows a polypeptide vaccine including the spike proteins SI and S2, with indicated epitope regions that can bind to specific MHC molecules indicated by the solid shapes along the length, corresponding HLA allele to which it binds is indicated below.
  • FIG. 8D shows time course of T cell responses after vaccination of patients with Spike protein mRNA vaccines at different doses (10, 20 and 30 micrograms as indicated).
  • Upper panel shows CD4+ T cell responses, indicated by IFN-g expression using ELISPOT assay.
  • Lower panel shows CD8+ T cell responses, indicated by IFN-g expression using ELISPOT assay.
  • CEF and CEFT are controls CMV, EBV and influenza pools.
  • FIG. 8E shows time course of CD4+ T cells and CD8+ T cell responses in older adult population who are administered Spike protein mRNA vaccine (10 microgram each).
  • FIG. 9 shows design of vaccine strings comprising ORF-lab epitopes, with specific use of MS- based HLA-I cleavage predictor information in ordering the epitopes.
  • the design utilizes minimum number of linker sequences.
  • FIG. 10A shows experimental design for validating immunogenicity of the string vaccine compositions in an animal model.
  • FIG. 10B shows experimental design for validating immunogenicity of the string vaccine compositions in an animal model, and comparing vaccines with spike protein mRNA vaccine composition alone, a string vaccine composition alone, or various combinations of the two as shown in the figure.
  • coformulations of the two vaccines are dosed to mice, where exemplary coformulation ratios are: spike protein mRNA vaccine: string vaccine (e.g., 9:1, 3:1, or 1:1).
  • FIG. 11 demonstrates sequence variants and mutants across the spike protein in various SARS CoV-2 isolates, and the respective mapping of the vaccine epitope sequences.
  • FIG. 12 demonstrates sequence variants and mutants across the nucleocapsid protein in various SARS CoV-2 isolates, and the respective mapping of the vaccine epitope sequences.
  • FIG. 13 demonstrates sequence variants and mutants across the membrane protein in various SARS CoV-2 isolates, and the respective mapping of the vaccine epitope sequences.
  • FIG. 14 demonstrates sequence variants and mutants across the NSP1 protein in various SARS CoV-2 isolates, and the respective mapping of the vaccine epitope sequences.
  • FIG. 15 demonstrates sequence variants and mutants across the NSP2 protein in various SARS CoV-2 isolates, and the respective mapping of the vaccine epitope sequences.
  • FIG. 16 demonstrates sequence variants and mutants across the NSP3 protein in various SARS CoV-2 isolates, and the respective mapping of the vaccine epitope sequences.
  • FIG. 17 demonstrates sequence variants and mutants across the NSP4 protein in various SARS CoV-2 isolates, and the respective mapping of the vaccine epitope sequences.
  • Described herein are novel therapeutics and vaccines based on viral epitopes. Accordingly, the invention described herein provides peptides, polynucleotides encoding the peptides, and peptide binding agents that can be used, for example, to stimulate an immune response to a viral antigen, to create an immunogenic composition or vaccine for use in treating or preventing a viral infection.
  • “Viral antigens” refer to antigens encoded by a virus. They include, but are not limited to, antigens of coronaviruses, such as COVID19.
  • binding data results can be expressed in terms of “IC50.”
  • IC50 is the concentration of the tested peptide in a binding assay at which 50% inhibition of binding of a labeled reference peptide is observed. Given the conditions in which the assays are run (i.e., limiting HLA protein and labeled reference peptide concentrations), these values approximate KD values.
  • Assays for determining binding are well known in the art and are described in detail, for example, in PCT publications WO 94/20127 and WO 94/03205, and other publications such Sidney et al., Current Protocols in Immunology 18.3.1 (1998); Sidney, et al., J. Immunol.
  • binding can be expressed relative to binding by a reference standard peptide.
  • a reference standard peptide For example, can be based on its IC50, relative to the IC50 of a reference standard peptide. Binding can also be determined using other assay systems including those using: live cells (e.g., Ceppellini et al., Nature 339:392 (1989); Christnick et al., Nature 352:67 (1991); Busch et al., Int. Immunol. 2:443 (1990); Hill et al., J. Immunol.
  • Synthetic epitopes can comprise artificial amino acid residues “amino acid mimetics,” such as D isomers of natural occurring L amino acid residues or non-natural amino acid residues such as cyclohexylalanine.
  • a derived or prepared epitope can be an analog of a native epitope.
  • a “diluent” includes sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Water is also a diluent for pharmaceutical compositions. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as diluents, for example, in injectable solutions.
  • an epitope is the collective features of a molecule, such as primary, secondary and tertiary peptide structure, and charge, that together form a site recognized by, for example, an immunoglobulin, T cell receptor, HLA molecule, or chimeric antigen receptor.
  • an epitope can be a set of amino acid residues which is involved in recognition by a particular immunoglobulin, or in the context of T cells, those residues necessary for recognition by T cell receptor proteins, chimeric antigen receptors, and/or Major Histocompatibility Complex (MHC) receptors.
  • Epitopes can be prepared by isolation from a natural source, or they can be synthesized according to standard protocols in the art.
  • Synthetic epitopes can comprise artificial amino acid residues, “amino acid mimetics,” such as D isomers of naturally-occurring L amino acid residues or non-naturally-occurring amino acid residues such as cyclohexylalanine.
  • epitopes may be referred to in some cases as peptides or peptide epitopes.
  • proteins or peptides that comprise an epitope or an analog described herein as well as additional amino acid(s) are still within the bounds of the invention.
  • the peptide comprises a fragment of an antigen.
  • a peptide of the invention there is a limitation on the length of a peptide of the invention.
  • the embodiment that is length-limited occurs when the protein or peptide comprising an epitope described herein comprises a region (i.e., a contiguous series of amino acid residues) having 100% identity with a native sequence.
  • a region i.e., a contiguous series of amino acid residues
  • the region with 100% identity to a native sequence generally has a length of: less than or equal to 600 amino acid residues, less than or equal to 500 amino acid residues, less than or equal to 400 amino acid residues, less than or equal to 250 amino acid residues, less than or equal to 100 amino acid residues, less than or equal to 85 amino acid residues, less than or equal to 75 amino acid residues, less than or equal to 65 amino acid residues, and less than or equal to 50 amino acid residues.
  • an “epitope” described herein is comprised by a peptide having a region with less than 51 amino acid residues that has 100% identity to a native peptide sequence, in any increment down to 5 amino acid residues; for example 50, 49, 48, 47, 46, 45, 44, 43, 42, 41, 40, 39, 38, 37, 36, 35, 34, 33, 32, 31, 30, 29, 28, 27, 26, 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1 ammo acid residues.
  • HLA Human Leukocyte Antigen
  • MMC Major Histocompatibility Complex
  • An “HLA supertype or HLA family”, as used herein, describes sets of HLA molecules grouped on the basis of shared peptide-binding specificities. HLA class I molecules that share somewhat similar binding affinity for peptides bearing certain amino acid motifs are grouped into such HLA supertypes.
  • HLA superfamily, HLA supertype family, HLA family, and HLA xx-like molecules are synonyms.
  • identity in the context of two or more peptide sequences or antigen fragments, refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues that are the same, when compared and aligned for maximum correspondence over a comparison window, as measured using a sequence comparison algorithm or by manual alignment and visual inspection.
  • immunogenic peptide or an “immunogenic” epitope or “peptide epitope” is a peptide that comprises an allele-specific motif such that the peptide will bind an HLA molecule and induce a cell- mediated or humoral response, for example, cytotoxic T lymphocyte (CTL), helper T lymphocyte (HTL) and/or B lymphocyte response.
  • CTL cytotoxic T lymphocyte
  • HTL helper T lymphocyte
  • B lymphocyte response for example, cytotoxic T lymphocyte (CTL), helper T lymphocyte (HTL) and/or B lymphocyte response.
  • a “chimeric antigen receptor” or “CAR” refers to an antigen binding protein in that includes an immunoglobulin antigen binding domain (e.g., an immunoglobulin variable domain) and a T cell receptor (TCR) constant domain.
  • an immunoglobulin antigen binding domain e.g., an immunoglobulin variable domain
  • TCR T cell receptor
  • a “constant domain” of a TCR polypeptide includes a membrane-proximal TCR constant domain, and may also include a TCR transmembrane domain and/or a TCR cytoplasmic tail.
  • the CAR is a dimer that includes a first polypeptide comprising a immunoglobulin heavy chain variable domain linked to a TCR-beta constant domain and a second polypeptide comprising an immunoglobulin light chain variable domain (e.g., a lc or 2Y, variable domain) linked to a TCRa constant domain.
  • the CAR is a dimer that includes a first polypeptide comprising a immunoglobulin heavy chain variable domain linked to a TCRa constant domain and a second polypeptide comprising an immunoglobulin light chain variable domain linked to a TCRp constant domain.
  • isolated or “biologically pure” refer to material which is substantially or essentially free from components which normally accompany the material as it is found in its native state. Thus, peptides described herein do not contain some or all of the materials normally associated with the peptides in their in situ environment.
  • An “isolated” epitope refers to an epitope that does not include the whole sequence of the antigen from which the epitope was derived. Typically, the “isolated” epitope does not have attached thereto additional amino acid residues that result in a sequence that has 100% identity over the entire length of a native sequence.
  • the native sequence can be a sequence such as a viral antigen from which the epitope is derived.
  • isolated means that the material is removed from its original environment (e.g., the natural environment if it is naturally occurring).
  • a naturally-occurring polynucleotide or peptide present in a living animal is not isolated, but the same polynucleotide or peptide, separated from some or all of the coexisting materials in the natural system, is isolated.
  • Such a polynucleotide could be part of a vector, and/or such a polynucleotide or peptide could be part of a composition, and still be “isolated” in that such vector or composition is not part of its natural environment.
  • RNA molecules include in vivo or in vitro RNA transcripts of the DNA molecules described herein, and further include such molecules produced synthetically.
  • MHC Major Histocompatibility Complex
  • HLA human leukocyte antigen
  • a “native” or a “wild type” sequence refers to a sequence found in nature. Such a sequence can comprise a longer sequence in nature.
  • a “T cell epitope” is to be understood as meaning a peptide sequence which can be bound by the MHC molecules of class I or II in the form of a peptide-presenting MHC molecule or MHC complex and then, in this form, be recognized and bound by cytotoxic T-lymphocytes or T-helper cells, respectively.
  • a “receptor” is to be understood as meaning a biological molecule or a molecule grouping capable of binding a ligand.
  • a receptor may serve, to transmit information in a cell, a cell formation or an organism.
  • the receptor comprises at least one receptor unit, for example, where each receptor unit may consist of a protein molecule.
  • the receptor has a structure which complements that of a ligand and may complex the ligand as a binding partner.
  • the information is transmitted in particular by conformational changes of the receptor following complexation of the ligand on the surface of a cell.
  • a receptor is to be understood as meaning in particular proteins of MHC classes I and II capable of forming a receptor/ligand complex with a ligand, in particular a peptide or peptide fragment of suitable length.
  • a “ligand” is to be understood as meaning a molecule which has a structure complementary to that of a receptor and is capable of forming a complex with this receptor.
  • a ligand is to be understood as meaning a peptide or peptide fragment which has a suitable length and suitable binding motifs in its amino acid sequence, so that the peptide or peptide fragment is capable of forming a complex with proteins of MHC class I or MHC class II.
  • a “receptor/ligand complex” is also to be understood as meaning a “receptor/peptide complex” or “receptor/peptide fragment complex”, including a peptide- or peptide fragment-presenting MHC molecule of class I or of class IF
  • MHC major histocompatibility complex
  • MHC molecules proteins
  • MHC proteins proteins
  • HLA proteins proteins capable of binding peptides resulting from the proteolytic cleavage of protein antigens and representing potential lymphocyte epitopes, (e.g., T cell epitope and B cell epitope) transporting them to the cell surface and presenting them there to specific cells, in particular cytotoxic T-lymphocytes, T-helper cells, or B cells.
  • the major histocompatibility complex in the genome comprises the genetic region whose gene products expressed on the cell surface are important for binding and presenting endogenous and/or foreign antigens and thus for regulating immunological processes.
  • the major histocompatibility complex is classified into two gene groups coding for different proteins, namely molecules of MHC class I and molecules of MHC class II. The cellular biology and the expression patterns of the two MHC classes are adapted to these different roles.
  • peptide and peptide epitope are used interchangeably with “oligopeptide” in the present specification to designate a series of residues connected one to the other, typically by peptide bonds between the a-amino and carboxyl groups of adjacent amino acid residues.
  • “Synthetic peptide” refers to a peptide that is obtained from a non-natural source, e.g., is manmade. Such peptides can be produced using such methods as chemical synthesis or recombinant DNA technology. “Synthetic peptides” include “fusion proteins.”
  • a “PanDR binding” peptide, a “PanDR binding epitope” is a member of a family of molecules that binds more than one HLA class II DR molecule.
  • “Pharmaceutically acceptable” refers to a generally non-toxic, inert, and/or physiologically compatible composition or component of a composition.
  • a “pharmaceutical excipient” or “excipient” comprises a material such as an adjuvant, a carrier, pH-adjusting and buffering agents, tonicity adjusting agents, wetting agents, preservatives, and the like.
  • a “pharmaceutical excipient” is an excipient which is pharmaceutically acceptable.
  • motif refers to a pattern of residues in an amino acid sequence of defined length, for example, a peptide of less than about 15 amino acid residues in length, or less than about 13 amino acid residues in length, for example, from about 8 to about 13 amino acid residues (e.g., 8, 9, 10, 11, 12, or 13) for a class I HLA motif and from about 6 to about 25 amino acid residues (e.g., 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25) fora class II HLA motif, which is recognized by a particular HLA molecule.
  • Motifs are typically different for each HLA protein encoded by a given human HLA allele. These motifs differ in their pattern of the primary and secondary anchor residues.
  • an MHC class I motif identifies a peptide of 9, 10, or 11 amino acid residues in length.
  • a “supermotif” is a peptide binding specificity shared by HLA molecules encoded by two or more HLA alleles.
  • a supermotif-bearing peptide described herein is recognized with high or intermediate affinity (as defined herein) by two or more HLA antigens.
  • Naturally occurring refers to the fact that an object can be found in nature.
  • a peptide or nucleic acid that is present in an organism (including viruses) and can be from a source in nature and which has not been intentionally modified by man in the laboratory is naturally occurring.
  • the term “vaccine” relates to a pharmaceutical preparation (pharmaceutical composition) or product that upon administration induces an immune response, for example, a cellular or humoral immune response, which recognizes and attacks a pathogen or a diseased cell such as a cell infected with a virus.
  • a vaccine may be used for the prevention or treatment of a disease.
  • a “protective immune response” or “therapeutic immune response” refers to a CTL and/or an HTL response to an antigen derived from an pathogenic antigen (e.g., a viral antigen), which in some way prevents or at least partially arrests disease symptoms, side effects or progression.
  • the immune response can also include an antibody response which has been facilitated by the stimulation of helper T cells.
  • Antigen processing refers to the degradation of a polypeptide or antigen into procession products, which are fragments of said polypeptide or antigen (e.g., the degradation of a polypeptide into peptides) and the association of one or more of these fragments (e.g., via binding) with MHC molecules for presentation by cells, for example, antigen presenting cells, to specific T cells.
  • Antigen presenting cells are cells which present peptide fragments of protein antigens in association with MHC molecules on their cell surface. Some APCs may activate antigen specific T cells. Professional antigen-presenting cells are very efficient at internalizing antigen, either by phagocytosis or by receptor-mediated endocytosis, and then displaying a fragment of the antigen, bound to a class II MHC molecule, on their membrane. The T cell recognizes and interacts with the antigen-class II MHC molecule complex on the membrane of the antigen presenting cell. An additional co-stimulatory signal is then produced by the antigen presenting cell, leading to activation of the T cell. The expression of co-stimulatory molecules is a defining feature of professional antigen-presenting cells.
  • dendritic cells which have the broadest range of antigen presentation, and are probably the most important antigen presenting cells, macrophages, B-cells, and certain activated epithelial cells.
  • DCs Dendritic cells
  • MHC class II and I antigen presentation pathways It is well known that dendritic cells are potent inducers of immune responses and the activation of these cells is a critical step for the induction of antiviral immunity.
  • Dendritic cells are conveniently categorized as “immature” and “mature” cells, which can be used as a simple way to discriminate between two well characterized phenotypes. However, this nomenclature should not be construed to exclude all possible intermediate stages of differentiation.
  • Immature dendritic cells are characterized as antigen presenting cells with a high capacity for antigen uptake and processing, which correlates with the high expression of Fey receptor and mannose receptor.
  • the mature phenotype is typically characterized by a lower expression of these markers, but a high expression of cell surface molecules responsible for T cell activation such as class I and class II MHC, adhesion molecules (e. g. CD54 and CD11) and costimulatory molecules (e. g., CD40, CD80, CD86 and 4-1 BB).
  • residue refers to an amino acid residue or amino acid mimetic residue incorporated into a peptide or protein by an amide bond or amide bond mimetic, or nucleic acid (DNA or RNA) that encodes the amino acid or amino acid mimetic.
  • each residue is generally represented by standard three letter or single letter designations.
  • the L-form of an amino acid residue is represented by a capital single letter or a capital first letter of a three-letter symbol
  • the D- form for those amino acid residues having D-forms is represented by a lower case single letter or a lower case three letter symbol.
  • Glycine has no asymmetric carbon atom and is simply referred to as “Gly” or “G”.
  • the amino acid sequences of peptides set forth herein are generally designated using the standard single letter symbol.
  • polynucleotide and “nucleic acid” are used interchangeably herein and refer to polymers of nucleotides of any length, and include DNA and RNA, for example, mRNA.
  • the nucleotides can be deoxyribonucleotides, ribonucleotides, modified nucleotides or bases, and/or their analogs, or any substrate that can be incorporated into a polymer by DNA or RNA polymerase.
  • the polynucleotide and nucleic acid can be in vitro transcribed mRNA.
  • the polynucleotide that is administered is mRNA.
  • nucleic acids or polypeptides refer to two or more sequences or subsequences that are the same or have a specified percentage of nucleotides or amino acid residues that are the same, when compared and aligned (introducing gaps, if necessary) for maximum correspondence, not considering any conservative amino acid substitutions as part of the sequence identity.
  • the percent identity can be measured using sequence comparison software or algorithms or by visual inspection.
  • Various algorithms and software that can be used to obtain alignments of amino acid or nucleotide sequences are well-known in the art. These include, but are not limited to, BLAST, ALIGN, Megalign, BestFit, GCG Wisconsin Package, and variations thereof.
  • two nucleic acids or polypeptides described herein are substantially identical, meaning they have at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, and in some embodiments at least 95%, 96%, 97%, 98%, 99% nucleotide or amino acid residue identity, when compared and aligned for maximum correspondence, as measured using a sequence comparison algorithm or by visual inspection.
  • identity exists over a region of the sequences that is at least about 10, at least about 20, at least about 40-60 residues, at least about 60-80 residues in length or any integral value 2between.
  • identity exists over a longer region than 60-80 residues, such as at least about 80-100 residues, and in some embodiments the sequences are substantially identical over the full length of the sequences being compared, such as the coding region of a nucleotide sequence.
  • a “conservative amino acid substitution” is one in which one amino acid residue is replaced with another amino acid residue having a similar side chain.
  • Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
  • basic side chains e.g., lysine, arginine, histidine
  • acidic side chains e.g., aspartic acid
  • vector means a construct, which is capable of delivering, and usually expressing, one or more gene(s) or sequence(s) of interest in a host cell.
  • vectors include, but are not limited to, viral vectors, naked DNA or RNA expression vectors, plasmid, cosmid, or phage vectors, DNA or RNA expression vectors associated with cationic condensing agents, and DNA or RNA expression vectors encapsulated in liposomes.
  • a polypeptide, antibody, polynucleotide, vector, cell, or composition which is “isolated” is a polypeptide, antibody, polynucleotide, vector, cell, or composition which is in a form not found in nature. Isolated polypeptides, antibodies, polynucleotides, vectors, cells, or compositions include those which have been purified to a degree that they are no longer in a form in which they are found in nature. In some embodiments, a polypeptide, antibody, polynucleotide, vector, cell, or composition which is substantially pure. In one embodiment, a “polynucleotide” encompasses a PCR or quantitative PCR reaction comprising the polynucleotide amplified in the PCR or quantitative PCR reaction.
  • substantially pure refers to material which is at least 50% pure (i.e., free from contaminants), at least 90% pure, at least 95% pure, at least 98% pure, or at least 99% pure.
  • subject refers to any animal (e.g., a mammal), including, but not limited to, humans, non-human primates, canines, felines, rodents, and the like, which is to be the recipient of a particular treatment.
  • subject and patient are used interchangeably herein in reference to a human subject.
  • the terms “effective amount” or “therapeutically effective amount” or “therapeutic effect” refer to an amount of a therapeutic effective to “treat” a disease or disorder in a subject or mammal.
  • the therapeutically effective amount of a drug has a therapeutic effect and as such can prevent the development of a disease or disorder; slow down the development of a disease or disorder; slow down the progression of a disease or disorder; relieve to some extent one or more of the symptoms associated with a disease or disorder; reduce morbidity and mortality; improve quality of life; or a combination of such effects.
  • treating or “treatment” or “to treat” or “alleviating” or “to alleviate” refer to both 1) therapeutic measures that cure, slow down, lessen symptoms of, and/or halt progression of a diagnosed pathologic condition or disorder and 2) prophylactic or preventative measures that prevent or slow the development of a targeted pathologic condition or disorder.
  • those in need of treatment include those already with the disorder; those prone to have the disorder; and those in whom the disorder is to be prevented.
  • a therapeutic refers a composition that is used to treat or prevent a disease or a condition, such as viral infect, e.g. coronaviral infection.
  • a therapeutic is may be vaccine.
  • a therapeutic may be a drug, e.g., a small molecule drug.
  • a therapeutic may be administered to a subject in need thereof, to prevent a disease or an infection, or to reduce or ameliorate one or more symptoms associated with a disease.
  • a therapeutic may also be considered to treat at least a symptom of the disease.
  • the term “and/or” as used in a phrase such as “A and/or B” herein is intended to include both A and B; A or B; A (alone); and B (alone).
  • the term “and/or” as used in a phrase such as “A, B, and/or C” is intended to encompass each of the following embodiments: A, B, and C; A, B, or C; A or C; A or B; B or C; A and C; A and B; B and C; A (alone); B (alone); and C (alone).
  • sequencing methods may be used to identify virus specific epitopes. Any suitable sequencing method can be used according to the invention, for example, Next Generation Sequencing (NGS) technologies. Third Generation Sequencing methods might substitute for the NGS technology in the future to speed up the sequencing step of the method.
  • NGS Next Generation Sequencing
  • next Generation Sequencing or “NGS” in the context of the present invention mean all novel high throughput sequencing technologies which, in contrast to the “conventional” sequencing methodology known as Sanger chemistry, read nucleic acid templates randomly in parallel along the entire genome by breaking the entire genome into small pieces.
  • NGS technologies also known as massively parallel sequencing technologies
  • Such NGS technologies are able to deliver nucleic acid sequence information of a whole genome, exome, transcriptome (all transcribed sequences of a genome) or methylome (all methylated sequences of a genome) in very short time periods, e.g. within 1-2 weeks, for example, within 1-7 days or within less than 24 hours and allow, in principle, single cell sequencing approaches.
  • Multiple NGS platforms which are commercially available or which are mentioned in the literature can be used in the context of the invention e.g. those described in detail in WO 2012/159643.
  • a viral epitope peptide described herein molecule can comprise, but is not limited to, about 5, about 6, about 7, about 8, about 9, about 10, about 11, about 12, about 13, about 14, about 15, about 16, about 17, about 18, about 19, about 20, about 21, about 22, about 23, about 24, about
  • a viral epitope peptide molecule is equal to or less than 100 amino acids.
  • viral epitope peptides described herein for MHC Class I are 13 residues or less in length and usually consist of between about 8 and about 11 residues, particularly 9 or 10 residues. In some embodiments, viral epitope peptides described herein for MHC Class II are 9-24 residues in length. [000182]A longer viral protein epitope peptide can be designed in several ways.
  • a longer viral protein epitope peptide could consist of (1) individual binding peptides with extensions of 2-5 amino acids toward the N- and C-terminus of each corresponding peptide; or (2) a concatenation of some or all of the binding peptides with extended sequences for each.
  • use of a longer peptide is presumed to allow for endogenous processing by patient cells and can lead to more effective antigen presentation and induction of T cell responses.
  • two or more peptides can be used, where the peptides overlap and are tiled over the long viral epitope peptide.
  • the viral epitope peptides and polypeptides bind an HLA protein (e.g., HLA class I or HLA class II).
  • HLA protein e.g., HLA class I or HLA class II.
  • the viral epitope peptide or polypeptide has an IC 50 of at least less than 5000 nM, at least less than 500 nM, at least less than 100 nM, at least less than 50 nM or less.
  • a viral protein epitope peptide described herein can be in solution, lyophilized, or can be in crystal form.
  • a viral protein epitope peptide described herein can be prepared synthetically, by recombinant DNA technology or chemical synthesis, or can be from natural sources such as native viruses. Epitopes can be synthesized individually or joined directly or indirectly in a peptide. Although a viral epitope peptide described herein will be substantially free of other naturally occurring host cell proteins and fragments thereof, in some embodiments the peptide can be synthetically conjugated to be joined to native fragments or particles.
  • a viral protein epitope peptide described herein can be prepared in a wide variety of ways.
  • the peptides can be synthesized in solution or on a solid support according to conventional techniques.
  • Various automatic synthesizers are commercially available and can be used according to known protocols. (See, for example, Stewart & Young, Solid Phase Peptide Synthesis, 2D. ED., Pierce Chemical Co., 1984).
  • individual peptides can be joined using chemical ligation to produce larger peptides that are still within the bounds of the invention.
  • recombinant DNA technology can be employed wherein a nucleotide sequence which encodes a peptide inserted into an expression vector, transformed or transfected into an appropriate host cell and cultivated under conditions suitable for expression.
  • a nucleotide sequence which encodes a peptide inserted into an expression vector transformed or transfected into an appropriate host cell and cultivated under conditions suitable for expression.
  • These procedures are generally known in the art, as described generally in Sambrook et al., MOLECULAR CLONING, A LABORATORY MANUAL, Cold Spring Harbor Press, Cold Spring Harbor, N.Y. (1989).
  • recombinant peptides which comprise or consist of one or more epitopes described herein, can be used to present the appropriate T cell epitope.
  • the invention described herein also provides compositions comprising one, at least two, or more than two viral epitope peptides.
  • a composition described herein contains at least two distinct peptides.
  • the at least two distinct peptides are derived from the same polypeptide.
  • distinct polypeptides is meant that the peptide vary by length, amino acid sequence or both.
  • the peptides are derived from any polypeptide known to or have been found to contain a viral-specific epitope.
  • Polynucleotides encoding each of the peptides described herein are also part of the invention. As appreciated by one of ordinary skill in the art, various nucleic acids will encode the same peptide due to the redundancy of the genetic code. Each of these nucleic acids falls within the scope of the present invention.
  • This embodiment of the invention comprises DNA and RNA, for example, mRNA, and in certain embodiments a combination of DNA and RNA. In one embodiment, the mRNA is a self-amplifying mRNA. (Brito et al., Adv. Genet. 2015; 89:179-233). It is to be appreciated that any polynucleotide that encodes a peptide described herein falls within the scope of this invention.
  • RNA includes and in some embodiments relates to “mRNA”.
  • mRNA means “messenger-RNA” and relates to a “transcript” which is generated by using a DNA template and encodes a peptide or polypeptide.
  • an mRNA comprises a 5'-UTR, a protein coding region, and a 3'-UTR.
  • mRNA only possesses limited half-life in cells and in vitro.
  • the mRNA is self-amplifying mRNA.
  • mRNA may be generated by in vitro transcription from a DNA template.
  • the in vitro transcription methodology is known to the skilled person. For example, there is a variety of in vitro transcription kits commercially available.
  • RNA may be stabilized and its translation increased by one or more modifications having a stabilizing effects and/or increasing translation efficiency of RNA.
  • modifications are described, for example, in PCT/EP2006/009448 incorporated herein by reference.
  • the RNA used according to the present invention it may be modified within the coding region, i.e. the sequence encoding the expressed peptide or protein, without altering the sequence of the expressed peptide or protein, so as to increase the GC-content to increase mRNA stability and to perform a codon optimization and, thus, enhance translation in cells.
  • RNA used in the present invention includes any modification of an RNA which is not naturally present in said RNA.
  • the RNA used according to the invention does not have uncapped 5'-triphosphates. Removal of such uncapped 5 '-triphosphates can be achieved by treating RNA with a phosphatase.
  • the RNA according to the invention may have modified ribonucleotides in order to increase its stability and/or decrease cytotoxicity.
  • cytidine may be substituted by 5-methylcytidine; 5-methylcytidine is substituted partially or completely, for example, completely, for cytidine.
  • uridine in the RNA used according to the invention may be substituted by pseudouridine or 1 -methyl pseudouridine; pseudouridine or 1- methyl pseudouridine is substituted partially or completely, for example, completely, for uridine.
  • modification relates to providing an RNA with a 5'-cap or 5'- cap analog.
  • 5'-cap refers to a cap structure found on the 5'-end of an mRNA molecule and generally consists of a guanosine nucleotide connected to the mRNA via an unusual 5' to 5' triphosphate linkage. In one embodiment, this guanosine is methylated at the 7-position.
  • RNA 5'-cap refers to a naturally occurring RNA 5'-cap, to the 7-methylguanosine cap (m G).
  • m G 7-methylguanosine cap
  • 5'-cap includes a 5'-cap analog that resembles the RNA cap structure and is modified to possess the ability to stabilize RNA and/or enhance translation of RNA if attached thereto, in vivo and/or in a cell.
  • an mRNA encoding a viral epitope is administered to a subject in need thereof.
  • the invention provides RNA, oligoribonucleotide, and polyribonucleotide molecules comprising a modified nucleoside, gene therapy vectors comprising same, gene therapy methods and gene transcription silencing methods comprising same.
  • the mRNA to be administered comprises at least one modified nucleoside.
  • polynucleotides encoding peptides described herein can be synthesized by chemical techniques, for example, the phosphotriester method of Matteucci, et al., J. Am. Chem. Soc. 103:3185 (1981). Polynucleotides encoding peptides comprising or consisting of an analog can be made simply by substituting the appropriate and desired nucleic acid base(s) for those that encode the native epitope.
  • a large number of vectors and host systems suitable for producing and administering a viral epitope peptide described herein are known to those of skill in the art, and are commercially available. The following vectors are provided by way of example.
  • Bacterial pQE70, pQE60, pQE-9 (Qiagen), pBS, pDIO, phagescript, psiX174, pBluescript SK, pbsks, pNH8A, pNH16a, pNH18A, pNH46A (Stratagene); ptrc99a, pKK223-3, pKK233-3, pDR540, pRIT5 (Pharmacia); pCR (Invitrogen).
  • Eukaryotic pWLNEO, pSV2CAT, pOG44, pXTl, pSG (Stratagene) pSVK3, pBPV, pMSG, pSVL (Pharmacia); p75.6 (Valentis); pCEP (Invitrogen); pCEI (Epimmune).
  • any other plasmid or vector can be used as long as it is replicable and viable in the host.
  • bacterial cells such as E. coli, Bacillus subtilis, Salmonella typhimurium and various species within the genera Pseudomonas, Streptomyces, and Staphylococcus
  • fungal cells such as yeast
  • insect cells such as Drosophila and Sf9
  • animal cells such as COS-7 lines of monkey kidney fibroblasts, described by Gluzman, Cell 23:175 (1981), and other cell lines capable of expressing a compatible vector, for example, the C127, 3T3, CHO, HeLa and BHK cell lines or Bowes melanoma; plant cells, etc.
  • the selection of an appropriate host is deemed to be within the scope of those skilled in the art from the teachings herein.
  • the present disclosure is also directed to vectors, and expression vectors useful for the production and administration of the viral epitope peptides described herein, and to host cells comprising such vectors.
  • Host cells are genetically engineered (transduced or transformed or transfected) with the vectors which can be, for example, a cloning vector or an expression vector.
  • the vector can be, for example, in the form of a plasmid, a viral particle, a phage, etc.
  • the engineered host cells can be cultured in conventional nutrient media modified as appropriate for activating promoters, selecting transformants or amplifying the polynucleotides.
  • the culture conditions such as temperature, pH and the like, are those previously used with the host cell selected for expression, and will be apparent to the ordinarily skilled artisan.
  • the coding sequence will be provided operably linked start and stop codons, promoter and terminator regions, and in some embodiments, and a replication system to provide an expression vector for expression in the desired cellular host.
  • promoter sequences compatible with bacterial hosts are provided in plasmids containing convenient restriction sites for insertion of the desired coding sequence.
  • the resulting expression vectors are transformed into suitable bacterial hosts.
  • recombinant expression vectors will include origins of replication and selectable markers permitting transformation of the host cell, e.g., the ampicillin resistance gene of E. coli and S. cerevisiae TRP1 gene, and a promoter derived from a highly-expressed gene to direct transcription of a downstream structural sequence.
  • promoters can be derived from operons encoding glycolytic enzymes such as 3 -phosphogly cerate kinase (PGK), acid phosphatase, or heat shock proteins, among others.
  • the heterologous structural sequence is assembled in appropriate phase with translation initiation and termination sequences, and in some embodiments, a leader sequence capable of directing secretion of translated protein into the periplasmic space or extracellular medium.
  • the heterologous sequence can encode a fusion protein including an N-terminal identification peptide imparting desired characteristics, e.g., stabilization or simplified purification of expressed recombinant product.
  • Yeast, insect or mammalian cell hosts can also be used, employing suitable vectors and control sequences.
  • mammalian expression systems include the COS-7 lines of monkey kidney fibroblasts, described by Gluzman, Cell 23:175 (1981), and other cell lines capable of expressing a compatible vector, for example, the Cl 27, 3T3, CHO, HeLa and BHK cell lines.
  • Mammalian expression vectors will comprise an origin of replication, a suitable promoter and enhancer, and also any necessary ribosome binding sites, polyadenylation site, splice donor and acceptor sites, transcriptional termination sequences, and 5' flanking non-transcribed sequences.
  • Such promoters can also be derived from viral sources, such as, e.g., human cytomegalovirus (CMV-IE promoter) or herpes simplex virus type-1 (HSV TK promoter). Nucleic acid sequences derived from the SV40 splice, and polyadenylation sites can be used to provide the non-transcribed genetic elements.
  • CMV-IE promoter human cytomegalovirus
  • HSV TK promoter herpes simplex virus type-1
  • Polynucleotides encoding viral epitope peptides described herein can also comprise a ubiquitination signal sequence, and/or a targeting sequence such as an endoplasmic reticulum (ER) signal sequence to facilitate movement of the resulting peptide into the endoplasmic reticulum.
  • ER endoplasmic reticulum
  • Polynucleotides described herein can be administered and expressed in human cells (e.g., immune cells, including dendritic cells).
  • a human codon usage table can be used to guide the codon choice for each amino acid.
  • Such polynucleotides comprise spacer amino acid residues between epitopes and/or analogs, such as those described above, or can comprise naturally-occurring flanking sequences adjacent to the epitopes and/or analogs (and/or CTL, HTL, and B cell epitopes).
  • a viral epitope peptide described herein can also be administered/expressed by viral or bacterial vectors.
  • expression vectors include attenuated viral hosts, such as vaccinia or fowlpox.
  • vaccinia virus is used as a vector to express nucleotide sequences that encode the viral epitope peptides described herein.
  • Vaccinia vectors and methods useful in immunization protocols are described in, e.g., U.S. Pat. No. 4,722,848.
  • Another vector is BCG (Bacille Calmette Guerin). BCG vectors are described by Stover et al., Nature 351:456-460 (1991).
  • the vector is Modified Vaccinia Ankara (VA) (e.g. Bavarian Nordic (MVA-BN)).
  • Standard regulatory sequences well known to those of skill in the art can be included in the vector to ensure expression in the human target cells.
  • a promoter with a downstream cloning site for polynucleotide e.g., minigene insertion
  • a polyadenylation signal for efficient transcription termination e.g., an E. coli origin of replication
  • an E. coli selectable marker e.g. ampicillin or kanamycin resistance
  • Numerous promoters can be used for this purpose, e.g., the human cytomegalovirus (hCMV) promoter. See, e.g., U.S. Pat. Nos. 5,580,859 and 5,589,466 for other suitable promoter sequences.
  • the promoter is the CMV-IE promoter.
  • Polynucleotides described herein can comprise one or more synthetic or naturally-occurring introns in the transcribed region. The inclusion of mRNA stabilization sequences and sequences for replication in mammalian cells can also be considered for increasing polynucleotide expression.
  • a polynucleotide described herein can comprise immunostimulatory sequences (ISSs or CpGs). These sequences can be included in the vector, outside the polynucleotide coding sequence to enhance immunogenicity.
  • Coronaviruses are enveloped positive-stranded RNA viruses that belong to the family Coronaviridae and the order Nidovirales. Coronaviruses frequently infect people around the globe. There are a large number of coronaviruses, most of which circulate among peridomestic animals including pigs, camels, bats and cats. Of the seven coronaviruses identified in human so far, Coronaviruses 229E, NL63 were classified as Group 1 antigenic viruses, OC43 and HKU1 were classified as Group 2 antigenic viruses. They typically infect upper respiratory tract in human, and can bring about acute respiratory syndrome and can be fatal. Coronaviruses may be zoonotic in origin.
  • SARS-CoV, MERS-CoV and 2019 SARS CoV- 2 have human transmission and infective capability and have caused major public health concern worldwide over a short period within the century.
  • the expansion of genetic diversity among coronaviruses and their consequent ability to cause disease in human beings is mainly achieved through infecting peridomestic animals, which serve as intermediate hosts, nurturing recombination and mutation events.
  • the spike glycoprotein (S glycoprotein) which attaches the virion to the host cell membrane, is postulated to play a dominant role in host range restriction.
  • MERS-CoV exploits dipeptidyl peptidase 4 (DPP4), a transmembrane glycoprotein, to infect type 2 pneumocytes and unciliated bronchial epithelial cells.
  • DPP4 dipeptidyl peptidase 4
  • Coronaviruses first replicate in epithelial cells of the respiratory and enteric cells. Human airway epithelial cells facilitate high growth rate for the 2019 SARS CoV-2 virus. Coronavirus infected human beings can present with influenza-like symptoms and can develop pneumonia. Associated symptoms with the disease include cough, fever, dyspnea, myalgia or fatigue. Some human patients present with mild clinical manifestation of the disease. However, the manifestation of the disease in human population can span a wide range from asymptomatic to fatal. In some cases, human coronavirus has an incubation period of 2-4 days; 2019 SARS CoV-2 is estimated to be 3-6 days, and SARS-CoV can be 4-6 days.
  • SARS coronavirus was identified in 2003 and may have originated from an animal reservoir, and first infected humans in Guangdong province in southern China in 2002. Patients presented respiratory distress and diarrhea.
  • MERS-CoV was identified in Saudi Arabia in 2012. Dromedary camels may have been the major reservoirs of MERS-CoV. Typical MERS symptoms include fever, cough, shortness of breath, pneumonia, gastrointestinal symptoms including diarrhea. 2019 SARS CoV-2 is also called SARS CoV-2 or simply CoV-2.
  • the present disclosure comprises methods and compositions for developing immunotherapy using subject’s own immune cells to activate immune response against the virus. [000213]In one aspect the method comprises one or more of the following:
  • MHC -peptide presentation prediction algorithm implemented in a computer processor wherein the MHC -peptide presentation prediction algorithm implemented in a computer processor has been trained by a machine learning training module that incorporates a large number of characteristics related to the peptide and peptide MHC interactions in order to provide an output of a selection of peptides that are predicted to bind to a certain MHC molecule.
  • the MHC -peptide presentation predictor is neonmhc2.
  • a further analysis using MHC- peptide presentation predictor NetMHCpan or NetMHCpan II is performed for comparison.
  • the MHC -peptide presentation predictor is NetMHCpan.
  • the MHC- peptide presentation predictor is NetMHCpan II.
  • the viral peptides that are selected, taken together may bind to one or more class I MHCs, or a class II MHCs or a mixture of class I and class II MHCs, wherein each of the MHCs is expressed by the subject.
  • an antigenic peptide comprising an epitope sequence from Table 1A, Table IB, Table 1C, Table 2Ai, Table 2An, Table 2B, Table 9, Table 10, Table 11, Table 12, Table 14A, Table 14B, Table 15 or Table 16.
  • a polynucleotide encoding and antigenic peptide comprising an epitope sequence from Table 1A, Table IB, Table 1C, Table 2Ai, Table 2Aii, Table 2B, Table 9, Table 10, Table 11, Table 12, Table 14A, Table 14B, Table 15 or Table 16.
  • the antigenic peptide and/or polynucleotide may be recombinant.
  • the antigenic peptide and/or polynucleotide may be isolated or purified.
  • the antigenic peptide may be synthetic or expressed from a polynucleotide.
  • Also provided herein is an antibody or B cell comprising an antibody that binds to an antigenic peptide comprising an epitope sequence from Table 1A, Table IB, Table 1C, Table 2Ai, Table 2Aii, Table 2B, Table 9, Table 10, Table 11, Table 12, Table 14A, Table 14B, Table 15 or Table 16.
  • TCR T cell receptor
  • T cell comprising a TCR that that binds an epitope sequence from Table 1A or Table IB in complex with a corresponding MHC class I molecule according to Table 1 A or Table IB.
  • the TCR can bind to an epitope sequence from column 2 (set 1) of Table 1A in complex with a corresponding MHC class I molecule from column 3 (set 1) in the same row of Table 1A.
  • the TCR can bind to an epitope sequence from column 4 (set 2) of Table 1A in complex with a corresponding MHC class I molecule from column 5 (set 2) in the same row of Table 1A.
  • the TCR can bind to an epitope sequence from column 6 (set 3) of Table 1A in complex with a corresponding MHC class I molecule from column 7 (set 3) in the same row of Table 1A.
  • the TCR can bind to an epitope sequence from column 2 (set 1) of Table IB in complex with a corresponding MHC class I molecule from column 3 (set 1) in the same row of Table IB.
  • the TCR can bind to an epitope sequence from column 4 (set 2) of Table IB in complex with a corresponding MHC class I molecule from column 5 (set 2) in the same row of Table IB.
  • TCR T cell receptor
  • T cell comprising a TCR that that binds to an epitope sequence from Table 2Ai in complex with a corresponding MHC class II molecule according to Table 2Ai.
  • the TCR can bind to an epitope sequence from column 2 (set 1) of Table 2Ai in complex with a corresponding MHC class II molecule from column 3 (set 1) in the same row of Table 2Ai.
  • the TCR can bind to an epitope sequence from column 4 (set 2) of Table 2Ai in complex with a corresponding MHC class II molecule from column 5 (set 2) in the same row of Table 2Ai.
  • TCR T cell receptor
  • T cell comprising a TCR that that binds to an epitope sequence from Table 2Aii in complex with a corresponding MHC class II molecule according to Table 2Aii.
  • the TCR can bind to an epitope sequence from column 2 (set 1) of Table 2Aii in complex with a corresponding MHC class II molecule from column 3 (set 1) in the same row of Table 2Aii.
  • Provided herein is a method of treating or preventing viral infection in a subject in need thereof comprising administering to the subject an antigenic peptide comprising an epitope sequence from Table 1A, Table IB, Table 1C, Table 2Ai, Table 2Ari, Table 2B, Table 9, Table 10, Table 11, Table 12, Table 14A, Table 14B, Table 15 or Table 16.
  • Also provided herein is a method of treating or preventing viral infection in a subject in need thereof comprising administering to the subject a polynucleotide encoding and antigenic peptide comprising an epitope sequence from Table 1A, Table IB, Table 1C, Table 2Ai, Table 2Ari, Table 2B, Table 9, Table 10, Table 11, Table 12, Table 14A, Table 14B, Table 15 or Table 16.
  • Also provided herein is a method of treating or preventing a viral infection in a subject in need thereof comprising administering to the subject an antibody or B cell comprising an antibody that binds to an antigenic peptide comprising an epitope sequence from Table 1 A, Table IB, Table 1C, Table 2Ai, Table 2Aii, Table 2B, Table 9, Table 10, Table 11, Table 12, Table 14A, Table 14B, Table 15 or Table 16.
  • Also provided herein is a method of treating or preventing viral infection in a subject in need thereof comprising administering to the subject a T cell receptor (TCR) or T cell comprising a TCR that that binds an epitope sequence from Table 1 A, Table IB, Table 1C, Table 2Ai, Table 2Aii, Table 2B, Table 9, Table 10, Table 11, Table 12, Table 14A, Table 14B, Table 15 or Table 16 in complex with a corresponding MHC class I molecule according to Table 1A, Table IB, Table 1C, Table 2Ai, Table 2Aii, Table 2B, Table 9, Table 10, Table 11, Table 12, Table 14A, Table 14B, Table 15 or Table 16.
  • TCR T cell receptor
  • the method can comprise administering to the subject a TCR or T cell comprising a TCR that can bind to an epitope sequence from column 2 (set 1) of Table 1A in complex with a corresponding MHC class I molecule from column 3 (set 1) in the same row of Table 1 A.
  • the method can comprise administering to a TCR or T cell comprising a TCR that can bind to an epitope sequence from column 2 (set 1) of Table 1A in complex with a corresponding MHC class I molecule from column 3 (set 1) in the same row of Table 1 A to a subject that expresses the corresponding MHC class I molecule from column 3 (set 1).
  • the method can comprise administering to the subject a TCR or T cell comprising a TCR that can bind to an epitope sequence from column 4 (set 2) of Table 1 A in complex with a corresponding MHC class I molecule from column 5 (set 2) in the same row of Table 1A.
  • the method can comprise administering to a TCR or T cell comprising a TCR that can bind to an epitope sequence from column 4 (set 2) of Table 1A in complex with a corresponding MHC class I molecule from column 5 (set 2) in the same row of Table 1 A to a subject that expresses the corresponding MHC class I molecule from column 5 (set 2).
  • the method can comprise administering to the subject a TCR or T cell comprising a TCR that can bind to an epitope sequence from column 6 (set 3) of Table 1A in complex with a corresponding MHC class I molecule from column 7 (set 3) in the same row of Table 1 A.
  • the method can comprise administering to a TCR or T cell comprising a TCR that can bind to an epitope sequence from column 6 (set 3) of Table 1A in complex with a corresponding MHC class I molecule from column 7 (set 3) in the same row of Table 1A to a subject that expresses the corresponding MHC class I molecule from column 7 (set 3).
  • the method can comprise administering to the subject a TCR or T cell comprising a TCR that can bind to an epitope sequence from column 2 (set 1) of Table IB in complex with a corresponding MHC class I molecule from column 3 (set 1) in the same row of Table IB.
  • the method can comprise administering to a TCR or T cell comprising a TCR that can bind to an epitope sequence from column 2 (set 1) of Table IB in complex with a corresponding MHC class I molecule from column 3 (set 1) in the same row of Table IB to a subject that expresses the corresponding MHC class I molecule from column 3 (set 1).
  • the method can comprise administering to the subject a TCR or T cell comprising a TCR that can bind to an epitope sequence from column 4 (set 2) of Table IB in complex with a corresponding MHC class I molecule from column 5 (set 2) in the same row of Table IB.
  • the method can comprise administering to a TCR or T cell comprising a TCR that can bind to an epitope sequence from column 4 (set 2) of Table IB in complex with a corresponding MHC class I molecule from column 5 (set 2) in the same row of Table IB to a subject that expresses the corresponding MHC class I molecule from column 5 (set 2).
  • the method can comprise administering to the subject a TCR or T cell comprising a TCR that can bind to an epitope sequence from column 2 (set 1) of Table 2Ai in complex with a corresponding MHC class II molecule from column 3 (set 1) in the same row of Table 2Ai.
  • the method can comprise administering to a TCR or T cell comprising a TCR that can bind to an epitope sequence from column 2 (set 1) of Table 2Ai in complex with a corresponding MHC class II molecule from column 3 (set 1) in the same row of Table 2Ai to a subject that expresses the corresponding MHC class II molecule from column 3 (set 1).
  • the method can comprise administering to the subject a TCR or T cell comprising a TCR that can bind to an epitope sequence from column 4 (set 2) of Table 2Ai in complex with a corresponding MHC class II molecule from column 5 (set 2) in the same row of Table 2Ai.
  • the method can comprise administering to a TCR or T cell comprising a TCR that can bind to an epitope sequence from column 4 (set 2) of Table 2Ai in complex with a corresponding MHC class II molecule from column 5 (set 2) in the same row of Table 2Ai to a subject that expresses the corresponding MHC class II molecule from column 5 (set 2).
  • the method can comprise administering to the subject a TCR or T cell comprising a TCR that can bind to an epitope sequence from column on the left of Table 2Aii in complex with a corresponding MHC class II molecule from the respective column on the right in the same row of Table 2Aii.
  • a protein encoded by the corresponding allele to the right adjacent column of a peptide in any single row of Table 2Ai or Table 2Aii is an MHC protein that binds to the peptide and is presented to T cells by APCs.
  • a peptide listed on the immediate left column of an HLA allele(s) in each row is matched with the HLA in the row.
  • the viral genome comprises multiple genes encoded by multiple reading frames spanning a single polynucleotide stretch.
  • the nucleocapsid protein is an abundantly expressed protein in 2019 SARS CoV-2 virus.
  • a short protein ORF9b is encoded by another reading frame spanning the region nucleocapsid sequence. These highly expressed proteins expand the number of potential targets for T cell immunity.
  • Table 1C and Table 2B shows predicted MHC -I binding epitopes and MHC -II binding epitopes from Orf9b respectively.
  • Selected peptides may be synthetically manufactured, prepared into a pharmaceutical composition and may be administered to the subject as an immunotherapeutic vaccine, where viral epitope peptide antigens stimulate T cells in vivo.
  • T cells may be from a subject, and stimulated in vitro with the selected viral epitope peptide antigens. Following adequate activation of the T cells, the activated T cells are administered to the subject as immunotherapy.
  • antigen presenting cells may be from the subject, and the APCs are contacted with the peptides comprising viral epitope antigens in vitro.
  • the peptides comprising the viral epitope antigen may be longer peptides, comprising 20-100 amino acids, or more.
  • the longer peptides may comprise a plurality of epitope peptides presented as a concatemer.
  • the longer peptides are taken up by APCs and processed for antigen presentation in an efficient manner.
  • the viral antigen activated and viral antigen presenting APCs may be administered to the subject as personalized immunotherapy, for the APCs to activate T lymphocytes in vivo.
  • antigen presenting cells may be from the subject, and the APCs are contacted with the peptides comprising viral epitope antigens in vitro; thereafter, the activated APCs are incubated with T cells from the subj ect to activate the T cells in vitro.
  • the subj ect’ s T cells thus activated in vitro may be administered into the subject as personalized immunotherapy.
  • the invention disclosed herein also provides a large selection of viral epitope peptide and HLA pairs generated as an information library where the viral epitope : HLA pairs are ranked based on the binding affinity and presentation prediction value (PPV).
  • PSV binding affinity and presentation prediction value
  • the invention disclosed herein also provides viral antigenic peptides comprising the epitopes that have been analyzed and selected as described in the steps above, and manufactured synthetically, for shelving and later use as off-the shelf immunotherapy reagents or products for treating coronavirus infection.
  • the manufactured peptides comprising the epitopes are solubilized in a suitable solution comprising a suitable excipient and may be frozen.
  • the manufactured peptides may be lyophilized and stored.
  • the manufactured peptides comprising the epitopes may be stored in a dry powder form.
  • one or more viral antigenic peptides that can bind to the subject’s HLA are recovered from the shelved products, mixed into a pharmaceutical composition and administered to the subject in need thereof.
  • the viral genome may be analyzed to identify one or more B cell epitopes.
  • epitopes identified by analysis of the viral genome can be used for raising antibodies in a suitable host, such as a mammalian host, including but not limited to a mouse, a rat, a rabbit, sheep, pig, goat, lamb.
  • a suitable host such as a mammalian host, including but not limited to a mouse, a rat, a rabbit, sheep, pig, goat, lamb.
  • epitopes identified by analysis of the viral genome can be used for raising antibodies by recombinant technology.
  • the present invention provides a binding protein (e.g., an antibody or antigen-binding fragment thereof), or a T cell receptor (TCR), or a chimeric antigen receptor (CAR) capable of binding with a high affinity to a viral epitope peptide:human leukocyte antigen (HLA) complex.
  • a binding protein e.g., an antibody or antigen-binding fragment thereof
  • TCR T cell receptor
  • CAR chimeric antigen receptor
  • HLA human leukocyte antigen
  • the present invention provides a CAR that is capable of binding with a high affinity to a viral epitope peptide derived from the extracellular domain of a protein.
  • an antigen-specific binding protein or TCR or CAR as described herein includes variant polypeptide species that have one or more amino acid substitutions, insertions, or deletions, provided that the binding protein retains or substantially retains its specific binding function.
  • a viral epitope specific binding protein, TCR or CAR is capable of (a) specifically binding to an antigemHLA complex on a cell surface independent or in the absence of CD8.
  • a viral epitope specific binding protein is a T cell receptor (TCR), a chimeric antigen receptor or an antigen-binding fragment of a TCR, any of which can be chimeric, humanized or human.
  • an antigen-binding fragment of the TCR comprises a single chain TCR (scTCR).
  • composition comprising a viral epitope-specific binding protein or high affinity recombinant TCR according to any one of the above embodiments and a pharmaceutically acceptable carrier, diluent, or excipient.
  • Methods useful for isolating and purifying recombinantly produced soluble TCR can include obtaining supernatants from suitable host cell/vector systems that secrete the recombinant soluble TCR into culture media and then concentrating the media, for example using a commercially available filter or concentrator. Following concentration or filtration, the concentrate or filtrate, in some embodiments, can be purified, for example by application to a single suitable purification matrix or to a series of suitable matrices, such as an affinity matrix or an ion exchange resin. Alternatively or additionally, in some embodiments, one or more reverse phase HPLC steps may be employed to further purify a recombinant polypeptide.
  • Such purification methods can also be employed when isolating an immunogen from its natural environment.
  • Methods for large scale production of one or more of the isolated/recombinant soluble TCR described herein include batch cell culture, which is monitored and controlled to maintain appropriate culture conditions. Purification of the soluble TCR may be performed according to methods described herein and known in the art.
  • the viral protein may be a protein from a novel coronavirus, strain 2019 SARS-CoV 2 (available at NCBI Reference Sequence NC_045512.2), such as the proteins listed in Table 3.
  • an immunogenic composition e.g., a vaccine composition capable of raising a viral epitope-specific response (e.g., a humoral or cell-mediated immune response).
  • the immunogenic composition comprises viral epitope therapeutics (e.g., peptides, polynucleotides, TCR, CAR, cells containing TCR or CAR, dendritic cell containing polypeptide, dendritic cell containing polynucleotide, antibody, etc.) described herein corresponding to viral-specific viral epitope identified herein.
  • a person skilled in the art will be able to select viral epitope therapeutics by testing, for example, the generation of T cells in vitro as well as their efficiency and overall presence, the proliferation, affinity and expansion of certain T cells for certain peptides, and the functionality of the T cells, e.g. by analyzing the IFN-g production or cell killing by T cells.
  • the most efficient peptides can then combined as an immunogenic composition.
  • the different viral epitope peptides and/or polypeptides are selected so that one immunogenic composition comprises viral epitope peptides and/or polypeptides capable of associating with different MHC molecules, such as different MHC class I molecule.
  • an immunogenic composition comprises viral epitope peptides and/or polypeptides capable of associating with the most frequently occurring MHC class I molecules.
  • immunogenic compositions described herein comprise different peptides capable of associating with at least 2, at least 3, or at least 4 MHC class I or class P molecules.
  • an immunogenic composition described herein is capable of raising a specific cytotoxic T cells response, specific helper T cell response, or a B cell response.
  • an immunogenic composition described herein can further comprise an adjuvant and/or a carrier.
  • an adjuvant and/or a carrier examples of useful adjuvants and carriers are given herein below.
  • Polypeptides and/or polynucleotides in the composition can be associated with a carrier such as e.g. a protein or an antigen-presenting cell such as e.g. a dendritic cell (DC) capable of presenting the peptide to a T cell or a B cell.
  • DC-binding peptides are used as carriers to target the viral epitope peptides and polynucleotides encoding the viral epitope peptides to dendritic cells (Sioud et al. FASEB J 27: 3272- 3283 (2013)).
  • the viral epitope polypeptides or polynucleotides can be provided as antigen presenting cells (e.g., dendritic cells) containing such polypeptides or polynucleotides.
  • antigen presenting cells e.g., dendritic cells
  • such antigen presenting cells are used to stimulate T cells for use in patients.
  • the antigen presenting cells are dendritic cells.
  • the dendritic cells are autologous dendritic cells that are pulsed with the non-mutated protein epitope peptide or nucleic acid.
  • the viral epitope peptide can be any suitable peptide that gives rise to an appropriate T cell response.
  • the T cell is a CTL. In some embodiments, the T cell is a HTL.
  • an immunogenic composition containing at least one antigen presenting cell e.g., a dendritic cell
  • at least one antigen presenting cell e.g., a dendritic cell
  • APCs are autologous (e.g., autologous dendritic cells).
  • PBMCs peripheral blood mononuclear cells from a patient can be loaded with viral epitope peptides or polynucleotides ex vivo.
  • such APCs or PBMCs are injected back into the patient.
  • the polynucleotide can be any suitable polynucleotide that is capable of transducing the dendritic cell, thus resulting in the presentation of a viral epitope peptide and induction of immunity.
  • the polynucleotide can be naked DNA that is taken up by the cells by passive loading.
  • the polynucleotide is part of a delivery vehicle, for example, a liposome, virus like particle, plasmid, or expression vector.
  • the polynucleotide is delivered by a vector- free delivery system, for example, high performance electroporation and high-speed cell deformation).
  • such antigen presenting cells e.g., dendritic cells
  • PBMCs peripheral blood mononuclear cells
  • APCs antigen presenting cells
  • PBMCs peripheral blood mononuclear cells
  • T cell e.g., an autologous T cell
  • the T cell is a CTL.
  • the T cell is an HTL.
  • Such T cells are then injected into the patient.
  • CTL is injected into the patient.
  • HTL is injected into the patient.
  • both CTL and HTL are injected into the patient.
  • Administration of either therapeutic can be performed simultaneously or sequentially and in any order.
  • compositions for therapeutic treatment are intended for parenteral, topical, nasal, oral or local administration.
  • the pharmaceutical compositions described herein are administered parenterally, e.g., intravenously, subcutaneously, intradermally, or intramuscularly.
  • compositions for parenteral administration which comprise a solution of the viral epitope peptides and immunogenic compositions are dissolved or suspended in an acceptable carrier, for example, an aqueous carrier.
  • an aqueous carrier can be used, e.g., water, buffered water, 0.9% saline, 0.3% glycine, hyaluronic acid and the like.
  • compositions can be sterilized by conventional, well known sterilization techniques, or can be sterile filtered.
  • the resulting aqueous solutions can be packaged for use as is, or lyophilized, the lyophilized preparation being combined with a sterile solution prior to administration.
  • the compositions can contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions, such as pH adjusting and buffering agents, tonicity adjusting agents, wetting agents and the like, for example, sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chloride, sorbitan monolaurate, triethanolamine oleate, etc.
  • concentration of viral epitope peptides and polynucleotides described herein in the pharmaceutical formulations can vary widely, i.e., from less than about 0.1%, usually at or at least about 2% to as much as 20% to 50% or more by weight, and will be selected by fluid volumes, viscosities, etc., according to the particular mode of administration selected.
  • the viral epitope peptides and polynucleotides described herein can also be administered via liposomes, which target the peptides to a particular cells tissue, such as lymphoid tissue.
  • Liposomes are also useful in increasing the half-life of the peptides. Liposomes include emulsions, foams, micelles, insoluble monolayers, liquid crystals, phospholipid dispersions, lamellar layers and the like.
  • the peptide to be delivered is incorporated as part of a liposome, alone or in conjunction with a molecule which binds to, e.g., a receptor prevalent among lymphoid cells, such as monoclonal antibodies which bind to the DEC205 antigen, or with other therapeutic or immunogenic compositions.
  • a liposome fdled with a desired peptide or polynucleotide described herein can be directed to the site of lymphoid cells, where the liposomes then deliver the selected therapeutic/immunogenic polypeptide/polynucleotide compositions.
  • Liposomes can be formed from standard vesicle-forming lipids, which generally include neutral and negatively charged phospholipids and a sterol, for example, cholesterol.
  • the selection of lipids is generally guided by consideration of, e.g., liposome size, acid lability and stability of the liposomes in the blood stream.
  • a variety of methods are available for preparing liposomes, as described in, e.g., Szoka et al., Ann. Rev. Biophys. Bioeng. 9; 467 (1980), U.S. Pat. Nos. 4,235,871, 4,501,728, 4,501,728, 4,837,028, and 5,019,369.
  • a viral epitope polypeptides or polynucleotides to be incorporated into the liposome for cell surface determinants of the desired immune system cells For targeting to the immune cells, a viral epitope polypeptides or polynucleotides to be incorporated into the liposome for cell surface determinants of the desired immune system cells.
  • a liposome suspension containing a peptide can be administered intravenously, locally, topically, etc. in a dose which varies according to, inter alia, the manner of administration, the polypeptide or polynucleotide being delivered, and the stage of the disease being treated.
  • viral epitope polypeptides and polynucleotides are targeted to dendritic cells.
  • the viral epitope polypeptides and polynucleotides are target to dendritic cells using the markers DEC205, XCR1, CD197, CD80, CD86, CD123, CD209, CD273, CD283, CD289, CD184, CD85h, CD85], CD85k, CD85d, CD85g, CD85a, TSLP receptor, or CDla.
  • nontoxic solid carriers can be used which include, for example, pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharin, talcum, cellulose, glucose, sucrose, magnesium carbonate, and the like.
  • a pharmaceutically acceptable nontoxic composition is formed by incorporating any of the normally employed excipients, such as those carriers previously listed, and generally 10-95% of active ingredient, that is, one or more viral epitope polypeptides or polynucleotides described herein at a concentration of 25%-75%.
  • the viral epitope polypeptides or polynucleotides can be supplied in finely divided form along with a surfactant and propellant.
  • a surfactant and propellant are the esters or partial esters of fatty acids containing from 6 to 22 carbon atoms, such as caproic, octanoic, lauric, palmitic, stearic, linoleic, linolenic, olesteric and oleic acids with an aliphatic polyhydric alcohol or its cyclic anhydride.
  • Mixed esters, such as mixed or natural glycerides can be employed.
  • the surfactant can constitute 0.1%-20% by weight of the composition, or 0.25-5%.
  • the balance of the composition can be propellant.
  • a carrier can also be included as desired, as with, e.g., lecithin for intranasal delivery.
  • nucleic acid can be delivered directly, as “naked DNA”. This approach is described, for instance, in Wolff et al., Science 247: 1465-1468 (1990) as well asU.S. Pat. Nos. 5,580,859 and 5,589,466.
  • the nucleic acids can also be administered using ballistic delivery as described, for instance, in U.S. Pat. No. 5,204,253. Particles comprised solely of DNA can be administered. Alternatively, DNA can be adhered to particles, such as gold particles.
  • mRNA encoding the viral epitope peptides, or peptide binding agents can also be administered to the patient.
  • an mRNA encoding the viral epitope peptides, or peptide binding agents may be part of a synthetic lipid nanoparticle formulation.
  • the mRNA is self-amplifying RNA.
  • a mRNA, such as a self- amplifying RNA is a part of a synthetic lipid nanoparticle formulation (Geall et al., Proc Natl Acad Sci U S A. 109: 14604-14609 (2012)).
  • nucleic acids can also be delivered complexed to cationic compounds, such as cationic lipids.
  • nucleic acids can be encapsulated in lipid nanoparticles (e.g., comprising cationic lipid, non-cationic lipids (e.g., phospholipids and/or sterol), and/or PEG-lipids).
  • lipid nanoparticles e.g., comprising cationic lipid, non-cationic lipids (e.g., phospholipids and/or sterol), and/or PEG-lipids.
  • Lipid-mediated gene delivery methods are described, for instance, in WO 96/18372, WO 93/24640; Mannino & Gould-Fogerite, BioTechniques 6(7): 682-691 (1988); U.S. Pat. No. 5,279,833; WO 91/06309; and Feigner et al., Proc. Natl. Acad. Sci. USA
  • the viral epitope peptides and polypeptides described herein can also be expressed by attenuated viruses, such as vaccinia or fowlpox.
  • vaccinia virus as a vector to express nucleotide sequences that encode the peptide described herein.
  • the recombinant vaccinia virus Upon introduction into an acutely or chronically infected host or into a noninfected host, the recombinant vaccinia virus expresses the immunogenic peptide, and thereby elicits a host CTL response.
  • Vaccinia vectors and methods useful in immunization protocols are described in, e.g., U.S. Pat. No. 4,722,848.
  • BCG Bacillus Calmette Guerin
  • BCG vectors are described in Stover et al. (Nature 351:456-460 (1991)).
  • a wide variety of other vectors useful for therapeutic administration or immunization of the peptides described herein will be apparent to those skilled in the art from the description herein.
  • Adjuvants are any substance whose admixture into the immunogenic composition increases or otherwise modifies the immune response to the therapeutic agent.
  • Carriers are scaffold structures, for example a polypeptide or a polysaccharide, to which a viral epitope polypeptide or polynucleotide, is capable of being associated.
  • adjuvants are conjugated covalently or non-covalently to the polypeptides or polynucleotides described herein.
  • an increase in humoral immunity can be manifested by a significant increase in the titer of antibodies raised to the antigen, and an increase in T cell activity can be manifested in increased cell proliferation, or cellular cytotoxicity, or cytokine secretion.
  • An adjuvant can also alter an immune response, for example, by changing a primarily humoral or T helper 2 response into a primarily cellular, or T helper 1 response.
  • Suitable adjuvants are known in the art (see, WO 2015/095811) and include, but are not limited to poly(I:C), poly-I and poly C, STING agonist, 1018 ISS, aluminum salts, Amplivax, AS15, BCG, CP- 870,893, CpG7909, CyaA, dSLIM, GM-CSF, IC30, IC31, Imiquimod, ImuFact IMP321, IS Patch, ISS, ISCOMATRIX, Juvlmmune, LipoVac, MF59, monophosphoryl lipid A, Montanide IMS 1312, Montanide ISA 206, Montanide ISA 50V, Montanide ISA-51, OK-432, OM-174, OM-197- MP-EC, ONTAK, PepTel®.
  • PLG microparticles PLG microparticles, resiquimod, SRL172, virosomes and other virus-like particles, YF-17D, VEGF trap, R848, beta-glucan, Pam3Cys, Pam3CSK4, Aquila's QS21 stimulon (Aquila Biotech, Worcester, Mass., USA) which is derived from saponin, mycobacterial extracts and synthetic bacterial cell wall mimics, and other proprietary adjuvants such as Ribi's Detox. Quil or Superfos. Adjuvants also include incomplete Freund's or GM-CSF.
  • cytokines have been directly linked to influencing dendritic cell migration to lymphoid tissues (e.g., TNF-alpha), accelerating the maturation of dendritic cells into efficient antigen- presenting cells for T-lymphocytes (e.g., GM-CSF, PGE1, PGE2, IL-1, IL-lb, IL-4, IL-6 and CD40L) (U.S. Pat. No. 5,849,589 incorporated herein by reference in its entirety) and acting as immunoadjuvants (e.g., IL-12) (Gabrilovich D I, et al., J Immunother Emphasis Tumor Immunol. 1996 (6):414-418).
  • CpG immunostimulatory oligonucleotides have also been reported to enhance the effects of adjuvants in a vaccine setting.
  • CpG oligonucleotides act by activating the innate (non-adaptive) immune system via Toll-like receptors (TLR), mainly TLR9.
  • TLR Toll-like receptors
  • CpG triggered TLR9 activation enhances antigen-specific humoral and cellular responses to a wide variety of antigens, including peptide or protein antigens, live or killed viruses, dendritic cell vaccines, autologous cellular vaccines and polysaccharide conjugates in both prophylactic and therapeutic vaccines.
  • THl cytotoxic T- lymphocyte
  • CTL cytotoxic T- lymphocyte
  • IF A incomplete Freund's adjuvant
  • CpG oligonucleotides show even greater adjuvant activity when formulated or co-administered with other adjuvants or in formulations such as microparticles, nanoparticles, lipid emulsions or similar formulations, which are especially necessary for inducing a strong response when the antigen is relatively weak.
  • U.S. Pat. No. 6,406,705 B1 describes the combined use of CpG oligonucleotides, non-nucleic acid adjuvants and an antigen to induce an antigen-specific immune response.
  • a commercially available CpG TLR9 antagonist is dSLIM (double Stem Loop Immunomodulator) by Mologen (Berlin, GERMANY), which is a component of the pharmaceutical composition described herein.
  • Other TLR binding molecules such as RNA binding TLR 7, TLR 8 and/or TLR 9 can also be used.
  • CpGs e.g. CpR, Idera
  • Poly(I:C)(e.g. polyi:C12U) non-CpG bacterial DNA or RNA
  • ssRNA40 for TLR8 immunoactive small molecules and antibodies
  • cyclophosphamide sunitinib, bevacizumab, celebrex, NCX-4016, sildenafil, tadalafil, vardenafil, sorafmib, XL-999, CP-547632, pazopanib, ZD2171, AZD2171, ipilimumab, tremelimumab, and SC58175, which can act therapeutically and/or as an adjuvant.
  • CpGs e.g. CpR, Idera
  • Poly(I:C)(e.g. polyi:C12U) e.g. polyi:C12U
  • non-CpG bacterial DNA or RNA e
  • adjuvants and additives useful in the context of the present invention can readily be determined by the skilled artisan without undue experimentation.
  • Additional adjuvants include colony-stimulating factors, such as Granulocyte Macrophage Colony Stimulating Lactor (GM- CSL, sargramostim).
  • an immunogenic composition according to the present invention can comprise more than one different adjuvants.
  • the invention encompasses a therapeutic composition comprising any adjuvant substance including any of the above or combinations thereof. It is also contemplated that the viral epitope therapeutic can elicit or promote an immune response (e.g., a humoral or cell-mediated immune response).
  • the immunogenic composition comprises viral epitope therapeutics (e.g., peptides, polynucleotides, TCR, CAR, cells containing TCR or CAR, dendritic cell containing polypeptide, dendritic cell containing polynucleotide, antibody, etc.) and the adjuvant can be administered separately in any appropriate sequence.
  • viral epitope therapeutics e.g., peptides, polynucleotides, TCR, CAR, cells containing TCR or CAR, dendritic cell containing polypeptide, dendritic cell containing polynucleotide, antibody, etc.
  • a carrier can be present independently of an adjuvant.
  • the function of a carrier can for example be to increase the molecular weight of in particular mutant in order to increase their activity or immunogenicity, to confer stability, to increase the biological activity, or to increase serum half-life.
  • Lurthermore a carrier can aid presenting peptides to T cells.
  • the carrier can be any suitable carrier known to the person skilled in the art, for example a protein or an antigen presenting cell.
  • a carrier protein could be but is not limited to keyhole limpet hemocyanin, serum proteins such as transferrin, bovine serum albumin, human serum albumin, thyroglobulin or ovalbumin, immunoglobulins, or hormones, such as insulin or palmitic acid.
  • the carrier comprises a human fibronectin type III domain (Koide et al. Methods Enzymol. 2012;503:135-56). Lor immunization of humans, the carrier must be a physiologically acceptable carrier acceptable to humans and safe. However, tetanus toxoid and/or diptheria toxoid are suitable carriers in one embodiment of the invention. Alternatively, the carrier can be dextrans for example sepharose.
  • the polypeptides can be synthesized as multiply linked peptides as an alternative to coupling a polypeptide to a carrier to increase immunogenicity.
  • Such molecules are also known as multiple antigenic peptides (MAPS).
  • the method presented herein comprises isolating and/or characterizing one or more coronavirus antigenic peptides or nucleic acids encoding characterizing one or more coronavirus antigenic peptides, wherein the coronavirus antigenic peptides are predicted to bind to one or more HLA encoded MHC class I or MHC Class II molecules expressed in a subject, wherein the subject is in need of a coronavirus immunotherapy such as a coronavirus vaccine thereof.
  • the method comprises: (a) processing amino acid information of a plurality of candidate peptide sequences using a machine learning HLA peptide presentation prediction model to generate a plurality of presentation predictions, wherein each candidate peptide sequence of the plurality of candidate peptide sequences is encoded by a genome or exome of a coronavirus, wherein the plurality of presentation predictions comprises an HLA presentation prediction for each of the plurality of candidate viral peptide sequences, wherein each HLA presentation prediction is indicative of a likelihood that one or more proteins encoded by a class II HLA allele of a cell of the subject can present a given candidate viral peptide sequence of the plurality of candidate viral peptide sequences, wherein the machine learning HLA peptide presentation prediction model is trained using training data comprising sequence information of sequences of training peptides identified by mass spectrometry to be presented by an HLA protein expressed in training cells; and (b) identifying, based at least on the plurality of presentation predictions, a viral peptide sequence of
  • a method comprising: (a) processing amino acid information of a plurality of peptide sequences of encoded by a genome or exome of a coronavirus, using a machine learning HLA peptide binding prediction model to generate a plurality of binding predictions, wherein the plurality of binding predictions comprises an HLA binding prediction for each of the plurality of candidate peptide sequences, each binding prediction indicative of a likelihood that one or more proteins encoded by a class II HLA allele of a cell of the subject binds to a given candidate peptide sequence of the plurality of candidate peptide sequences, wherein the machine learning HLA peptide binding prediction model is trained using training data comprising sequence information of sequences of peptides identified to bind to an HLA class II protein or an HLA class II protein analog; and (b) identifying, based at least on the plurality of binding predictions, a peptide sequence of the plurality of peptide sequences that has a probability greater than a threshold binding prediction
  • the machine learning HLA peptide presentation prediction model is trained using training data comprising sequence information of sequences of training peptides identified by mass spectrometry to be presented by an HLA protein expressed in training cells.
  • the method comprises ranking, based on the presentation predictions, at least two peptides identified as being presented by at least one of the one or more proteins encoded by a class II HLA allele of a cell of the subject.
  • the method comprises selecting one or more peptides of the two or more ranked peptides.
  • the method comprises selecting one or more peptides of the plurality that were identified as being presented by at least one of the one or more proteins encoded by a class II HLA allele of a cell of the subject.
  • the method comprises selecting one or more peptides of two or more peptides ranked based on the presentation predictions.
  • the machine learning HLA peptide presentation prediction model has a positive predictive value (PPV) of at least 0.07 when amino acid information of a plurality of test peptide sequences are processed to generate a plurality of test presentation predictions, each test presentation prediction indicative of a likelihood that the one or more proteins encoded by a class II HLA allele of a cell of the subject can present a given test peptide sequence of the plurality of test peptide sequences, wherein the plurality of test peptide sequences comprises at least 500 test peptide sequences comprising (i) at least one hit peptide sequence identified by mass spectrometry to be presented by an HLA protein expressed in cells and (ii) at least 499 decoy peptide sequences contained within a protein encoded by a genome of an organism, wherein the organism and the subject are the same species, wherein the plurality of test peptide sequences comprises a ratio of 1:499 of the at least one hit peptide sequence to the at least 499 de
  • the machine learning HLA peptide presentation prediction model has a positive predictive value (PPV) of at least 0.1 when amino acid information of a plurality of test peptide sequences are processed to generate a plurality of test binding predictions, each test binding prediction indicative of a likelihood that the one or more proteins encoded by a class II HLA allele of a cell of the subj ect binds to a given test peptide sequence of the plurality of test peptide sequences, wherein the plurality of test peptide sequences comprises at least 20 test peptide sequences comprising (i) at least one hit peptide sequence identified by mass spectrometry to be presented by an HLA protein expressed in cells and (ii) at least 19 decoy peptide sequences contained within a protein comprising at least one peptide sequence identified by mass spectrometry to be presented by an HLA protein expressed in cells, such as a single HLA protein expressed in cells (e.g., mono-allelic cells), wherein the plurality of test peptide sequences
  • no amino acid sequence overlap exist among the at least one hit peptide sequence and the decoy peptide sequences.
  • Immunogenic or vaccine compositions comprising the viral epitope polypeptides and polynucleotides described herein, or analogs thereof, which have immunostimulatory activity can be modified to provide desired attributes, such as improved serum half-life, or to enhance immunogenicity.
  • desired attributes such as improved serum half-life, or to enhance immunogenicity.
  • the ability of the viral epitope peptides to induce CTL activity can be enhanced by linking the peptide to a sequence which contains at least one epitope that is capable of inducing a T helper cell response.
  • CTL epitope/HTL epitope conjugates are linked by a spacer molecule.
  • the spacer is typically comprised of relatively small, neutral molecules, such as amino acids or amino acid mimetics, which are substantially uncharged under physiological conditions.
  • the spacers are typically selected from, e.g., Ala, Gly, or other neutral spacers of nonpolar amino acids or neutral polar amino acids. It will be understood that the optionally present spacer need not be comprised of the same residues and thus can be a hetero- or homo-oligomer. When present, the spacer will usually be at least one or two residues, more usually three to six residues. Alternatively, the CTL peptide can be linked to the T helper peptide without a spacer.
  • CTL peptide epitope can be linked directly to the T helper peptide epitope
  • CTL epitope/HTL epitope conjugates can be linked by a spacer molecule.
  • the spacer is typically comprised of relatively small, neutral molecules, such as amino acids or amino acid mimetics, which are substantially uncharged under physiological conditions.
  • the spacers are typically selected from, e.g., Ala, Gly, or other neutral spacers of nonpolar amino acids or neutral polar amino acids. It will be understood that the optionally present spacer need not be comprised of the same residues and thus can be a hetero- or homo- oligomer. When present, the spacer will usually be at least one or two residues, more usually three to six residues.
  • the CTL peptide epitope can be linked to the T helper peptide epitope either directly or via a spacer either at the amino or carboxy terminus of the CTL peptide.
  • the amino terminus of either the immunogenic peptide or the T helper peptide can be acylated.
  • HTL peptide epitopes can also be modified to alter their biological properties.
  • peptides comprising HTL epitopes can contain D-amino acids to increase their resistance to proteases and thus extend their serum half-life.
  • the epitope peptides can be conjugated to other molecules such as lipids, proteins or sugars, or any other synthetic compounds, to increase their biological activity.
  • the T helper peptide can be conjugated to one or more palmitic acid chains at either the amino or carboxyl termini.
  • the T helper peptide is one that is recognized by T helper cells present in the majority of the population. This can be accomplished by selecting amino acid sequences that bind to many, most, or all of the HLA class II molecules. These are known as “loosely HLA-restricted” or “promiscuous” T helper sequences.
  • amino acid sequences that are promiscuous include sequences from antigens such as tetanus toxoid at positions 830-843 (QYIKANSKFIGITE), Plasmodium falciparum CS protein at positions 378-398 (DIEKKIAKMEKASSVFNYVNS), and Streptococcus 18kD protein at positions 116 (GAVDSILGGVATYGAA).
  • antigens such as tetanus toxoid at positions 830-843 (QYIKANSKFIGITE), Plasmodium falciparum CS protein at positions 378-398 (DIEKKIAKMEKASSVFNYVNS), and Streptococcus 18kD protein at positions 116 (GAVDSILGGVATYGAA).
  • Other examples include peptides bearing a DR 1-4- 7 supermotif, or either of the DR3 motifs.
  • pan-DR-binding epitope peptide having the formula: aKXVWANTLKAAa, where “X” is either cyclohexyl alanine, phenylalanine, or tyrosine, and a is either D-alanine or L-alanine, has been found to bind to most HLA-DR alleles, and to stimulate the response of T helper lymphocytes from most individuals, regardless of their HLA type.
  • An alternative of a pan-DR binding epitope comprises all “L” natural amino acids and can be provided in the form of nucleic acids that encode the epitope.
  • a viral epitope therapeutic e.g., peptides, polynucleotides, TCR, CAR, cells containing TCR or CAR, dendritic cell containing polypeptide, dendritic cell containing polynucleotide, antibody, etc.
  • pharmaceutical compositions e.g., immunogenic compositions
  • Lipids have been identified as agents capable of priming CTL in vivo against viral antigens.
  • palmitic acid residues can be attached to the c-and a- amino groups of a lysine residue and then linked, e.g., via one or more linking residues such as Gly, Gly-Gly-, Ser, Ser-Ser, or the like, to an immunogenic viral epitope peptide.
  • the lipidated peptide can then be administered either directly in a micelle or particle, incorporated into a liposome, or emulsified in an adjuvant.
  • a particularly effective immunogenic construct comprises palmitic acid attached to c- and a- amino groups of Lys, which is attached via linkage, e.g., Ser-Ser, to the amino terminus of the immunogenic peptide.
  • E. coli lipoproteins such as tripalmitoyl- S-glycerylcysteinlyseryl- serine (P3CSS) can be used to prime virus specific CTL when covalently attached to an appropriate peptide.
  • P3CSS tripalmitoyl- S-glycerylcysteinlyseryl- serine
  • Viral epitope peptides described herein can be coupled to P3CSS, for example, and the lipopeptide administered to an individual to specifically prime a CTL response to the target antigen.
  • two such compositions can be combined to more effectively elicit both humoral and cell-mediated responses to infection.
  • additional amino acids can be added to the termini of a viral epitope peptide to provide for ease of linking peptides one to another, for coupling to a carrier support or larger peptide, for modifying the physical or chemical properties of the peptide or oligopeptide, or the like.
  • Amino acids such as tyrosine, cysteine, lysine, glutamic or aspartic acid, or the like, can be introduced at the C- or N-terminus of the peptide or oligopeptide.
  • modification at the carboxyl terminus of a T cell epitope can, in some cases, alter binding characteristics of the peptide.
  • the peptide or oligopeptide sequences can differ from the natural sequence by being modified by terminal -NH2 acylation, e.g., by alkanoyl (C1-C20) or thioglycolyl acetylation, terminal-carboxyl amidation, e.g., ammonia, methylamine, etc. In some instances, these modifications can provide sites for linking to a support or other molecule.
  • An embodiment of an immunogenic composition described herein comprises ex vivo administration of a cocktail of epitope-bearing viral epitope polypeptide or polynucleotides to PBMC, or DC therefrom, from the patient's blood.
  • a pharmaceutical to facilitate harvesting of dendritic cells (DCs) can be used, including GM-CSL, IL-4, IL-6, IL-lb, and TNLa. After pulsing the DCs with peptides or polynucleotides encoding the peptides, and prior to reinfusion into patients, the DC are washed to remove unbound peptides.
  • a vaccine or immunogenic composition comprises peptide-pulsed DCs which present the pulsed peptide epitopes complexed with HLA molecules on their surfaces. The composition is then administered to the patient.
  • pulsed DCs are used to stimulate T cells suitable for use in T cell therapy.
  • Nucleic acids encoding the viral epitope peptides described herein are a particularly useful embodiment of the invention.
  • the nucleic acid is RNA.
  • minigene constructs encoding a viral epitope peptide comprising one or multiple epitopes described herein may be used to administer nucleic acids encoding the viral epitope peptides described herein.
  • a RNA construct e.g., mRNA construct
  • encoding a viral epitope peptide comprising one or multiple epitopes described herein is administered.
  • a multi-epitope DNA plasmid encoding super motif- and/or motif-bearing antigen peptides, a universal helper T cell epitope (or multiple viral antigen HTL epitopes), and an endoplasmic reticulum-translocating signal sequence can be engineered.
  • the immunogenicity of a multi-epitopic minigene can be tested in transgenic mice to evaluate the magnitude of immune response induced against the epitopes tested. Further, the immunogenicity of DNA-encoded epitopes in vivo can be correlated with the in vitro responses of specific CTF lines against target cells transfected with the DNA plasmid. Thus, these experiments can show that the minigene serves to both: 1). generate a cell mediated and/or humoral response and 2). that the induced immune cells recognized cells expressing the encoded epitopes.
  • the amino acid sequences of the epitopes can be reverse translated.
  • a human codon usage table can be used to guide the codon choice for each amino acid.
  • These viral epitope-encoding DNA sequences can be directly adjoined, so that when translated, a continuous polypeptide sequence is created.
  • additional elements can be incorporated into the minigene design. Examples of amino acid sequences that can be reverse translated and included in the minigene sequence include: HFA class I epitopes, HFA class II epitopes, a ubiquitination signal sequence, and/or an endoplasmic reticulum targeting signal.
  • HFA presentation of CTF and HTF epitopes can be improved by including synthetic (e.g. poly-alanine) or naturally-occurring flanking sequences adjacent to the CTF or HTF epitopes; these larger peptides comprising the epitope(s) are within the scope of the invention.
  • the minigene sequence can be converted to DNA by assembling oligonucleotides that encode the plus and minus strands of the mini gene. Overlapping oligonucleotides (30-100 bases long) can be synthesized, phosphorylated, purified and annealed under appropriate conditions using well known techniques. The ends of the oligonucleotides can be joined, for example, using T4 DNA ligase. This synthetic minigene, encoding the epitope polypeptide, can then be cloned into a desired expression vector. [000287] Standard regulatory sequences well known to those of skill in the art can be included in the vector to ensure expression in the target cells.
  • E. coli origin of replication e.g. ampicillin or kanamycin resistance
  • E. coli selectable marker e.g. ampicillin or kanamycin resistance
  • Numerous promoters can be used for this purpose, e.g., the human cytomegalovirus (hCMV) promoter. See, e.g., U.S. Patent Nos. 5,580,859 and 5,589,466 for other suitable promoter sequences.
  • introns are utilized for efficient gene expression, and one or more synthetic or naturally-occurring introns could be incorporated into the transcribed region of the minigene.
  • mRNA stabilization sequences and sequences for replication in mammalian cells can also be considered for increasing minigene expression.
  • the minigene can be cloned into the polylinker region downstream of the promoter.
  • This plasmid is transformed into an appropriate E. coli strain, and DNA is prepared using standard techniques.
  • the orientation and DNA sequence of the minigene, as well as all other elements included in the vector, can be confirmed using restriction mapping and DNA sequence analysis.
  • Bacterial cells harboring the correct plasmid can be stored as a master cell bank and a working cell bank.
  • immunomodulatory sequences appear to play a role in the immunogenicity of DNA vaccines. These sequences can be included in the vector, outside the minigene coding sequence, if desired to enhance immunogenicity. In one embodiment, the sequences are immunostimulatory. In another embodiment, the sequences are ISSs or CpGs.
  • a bi-cistronic expression vector which allows production of both the minigene-encoded epitopes and a second protein (included to enhance or decrease immunogenicity) can be used.
  • proteins or polypeptides that could beneficially enhance the immune response if coexpressed include cytokines (e.g., IL-2, IL-12, GM-CSF), cytokine-inducing molecules (e.g., LelF), costimulatory molecules, or for HTL responses, pan-DR binding proteins.
  • Helper (HTL) epitopes can be joined to intracellular targeting signals and expressed separately from expressed CTL epitopes; this allows direction of the HTL epitopes to a cell compartment different than that of the CTL epitopes. If required, this could facilitate more efficient entry of HTL epitopes into the HLA class P pathway, thereby improving HTL induction.
  • immunosuppressive molecules e.g. TGF-(3) can be beneficial in certain diseases.
  • Therapeutic quantities of plasmid DNA can be produced for example, by fermentation in E. coli, followed by purification. Aliquots from the working cell bank are used to inoculate growth medium, and grown to saturation in shaker flasks or a bioreactor according to well-known techniques. Plasmid DNA can be purified using standard bioseparation technologies such as solid phase anion-exchange resins supplied by QIAGEN, Inc. (Valencia, California). If required, supercoiled DNA can be from the open circular and linear forms using gel electrophoresis or other methods.
  • Purified plasmid DNA can be prepared for inj ection using a variety of formulations. The simplest of these is reconstitution of lyophilized DNA in sterile phosphate-buffer saline (PBS). This approach, known as “naked DNA,” is currently being used for intramuscular (IM) administration in clinical trials. To maximize the immunotherapeutic effects of mini gene DNA vaccines, an alternative method for formulating purified plasmid DNA can be used. A variety of methods have been described, and new techniques can become available.
  • Cationic lipids can also be used in the formulation (see, e.g., as described by WO 93/24640; Mannino & Gould-Fogente, BioTechmques 6(7): 682 (1988); U.S. Pat No. 5,279,833; WO 91/06309; and Feigner, et al., Proc. Nat'l Acad. Sci. USA 84:7413 (1987).
  • glycolipids, fusogenic liposomes, peptides and compounds referred to collectively as protective, interactive, non condensing compounds could also be complexed to purified plasmid DNA to influence variables such as stability, intramuscular dispersion, or trafficking to specific organs or cell types.
  • the nucleic acid is introduced into cells by use of high-speed cell deformation. During high-speed deformation, cells are squeezed such that temporary disruptions occur in the cell membrane, thus allowing the nucleic acid to enter the cell.
  • protein can be produced from expression vectors — in a bacterial expression vector, for example, and the proteins can then be delivered to the cell.
  • Target cell sensitization can be used as a functional assay for expression and HLA class I presentation of minigene-encoded CTL epitopes.
  • the plasmid DNA is introduced into a mammalian cell line that is suitable as a target for standard CTL chromium release assays.
  • the transfection method used will be dependent on the final formulation. Electroporation can be used for “naked” DNA, whereas cationic lipids allow direct in vitro transfection.
  • a plasmid expressing green fluorescent protein (GFP) can be co-transfected to allow enrichment of transfected cells using fluorescence activated cell sorting (FACS).
  • FACS fluorescence activated cell sorting
  • HTL epitopes are then chromium-51 ( 51 Cr) labeled and used as target cells for epitope- specific CTL lines; cytolysis, detected by 51 Cr release, indicates both production of, and HLA presentation of, mini gene-encoded CTL epitopes. Expression of HTL epitopes can be evaluated in an analogous manner using assays to assess HTL activity.
  • In vivo immunogenicity is a second approach for functional testing of minigene DNA formulations.
  • Transgenic mice expressing appropriate human HLA proteins are immunized with the DNA product.
  • the dose and route of administration are formulation dependent (e.g., GM for DNA in PBS, intraperitoneal (IP) for lipid-complexed DNA).
  • IP intraperitoneal
  • An exemplary protocol is twenty-one days after immunization, splenocytes are harvested and restimulated for 1 week in the presence of peptides encoding each epitope being tested. Thereafter, for CTL effector cells, assays are conducted for cytolysis of peptide- loaded, 51 Cr-labeled target cells using standard techniques.
  • Lysis of target cells that were sensitized by HLA loaded with peptide epitopes, corresponding to minigene-encoded epitopes, demonstrates DNA vaccine function for in vivo induction of CTLs. Immunogenicity of HTL epitopes is evaluated in transgenic mice in an analogous manner.
  • the nucleic acids can be administered using ballistic delivery as described, for instance, in U.S. Patent No. 5,204,253. Using this technique, particles comprised solely of DNA are administered. In a further alternative embodiment, DNA can be adhered to particles, such as gold particles.
  • Cells [000298] In one aspect, the present invention also provides cells expressing a viral epitope-recognizing receptor that activates an immunoresponsive cell (e.g., T cell receptor (TCR) or chimeric antigen receptor (CAR)), and methods of using such cells for the treatment of a disease that requires an enhanced immune response.
  • TCR T cell receptor
  • CAR chimeric antigen receptor
  • Such cells include genetically modified immunoresponsive cells (e.g., T cells, Natural Killer (NK) cells, cytotoxic T lymphocytes (CTL) cells, helper T lymphocyte (HTL) cells) expressing an antigenrecognizing receptor (e.g., TCR or CAR) that binds one of the viral epitope peptides described herein, and methods of use therefore for the treatment of neoplasia and other pathologies where an increase in an antigen-specific immune response is desired.
  • T cell activation is mediated by a TCR or a CAR targeted to an antigen.
  • the present invention provides cells expressing a combination of an antigen-recognizing receptor that activates an immunoresponsive cell (e.g., TCR, CAR) and a chimeric co-stimulating receptor (CCR), and methods of using such cells for the treatment of a disease that requires an enhanced immune response.
  • an immunoresponsive cell e.g., TCR, CAR
  • CCR chimeric co-stimulating receptor
  • viral antigen-specific T cells, NK cells, CTL cells or other immunoresponsive cells are used as shuttles for the selective enrichment of one or more co-stimulatory ligands for the treatment or prevention of neoplasia.
  • Such cells are administered to a human subject in need thereof for the treatment or prevention of a particular viral infection.
  • the viral antigen-specific human lymphocytes that can be used in the methods of the invention include, without limitation, peripheral donor lymphocytes genetically modified to express chimeric antigen receptors (CARs) (Sadelain, M, et al. 2003 Nat Rev Cancer 3:35-45), peripheral donor lymphocytes genetically modified to express a full-length viral antigen-recognizing T cell receptor complex comprising the a and p heterodimer (Morgan, R. A., et al. 2006 Science 314:126-129), and selectively in vitro-expanded antigen-specific peripheral blood leukocytes employing artificial antigen- presenting cells (AAPCs) or pulsed dendritic cells (Dupont, L, et al.
  • CARs chimeric antigen receptors
  • AAPCs artificial antigen- presenting cells
  • Dupont L, et al.
  • the T cells may be autologous, allogeneic, or derived in vitro from engineered progenitor or stem cells.
  • the cells of the invention are provided with at least one co-stimulatory ligand which is a non-antigen specific signal important for full activation of an immune cell.
  • Co-stimulatory ligands include, without limitation, tumor necrosis factor (TNF) ligands, cytokines (such as IL-2, IL-12, 1L-15 or IL21), and immunoglobulin (Ig) superfamily ligands.
  • TNF tumor necrosis factor
  • cytokines such as IL-2, IL-12, 1L-15 or IL21
  • Ig immunoglobulin
  • Tumor necrosis factor is a cytokine involved in systemic inflammation and stimulates the acute phase reaction. Its primary role is in the regulation of immune cells. Tumor necrosis factor (TNF) ligands share a number of common features.
  • TNF ligands include, without limitation, nerve growth factor (NGF), CD40L (CD40L)/CD154, CD137L/4-1BBL, tumor necrosis factor alpha (TNFa), CD134L/0X40L/CD252, CD27L/CD70, Fas ligand (FasL), CD30L/CD153, tumor necrosis factor b (TNF(3)/lymphotoxin-alpha (LTa), lymphotoxin-beta (ur(3), CD257/B cell-activating factor
  • immunoglobulin (Ig) superfamily is a large group of cell surface and soluble proteins that are involved in the recognition, binding, or adhesion processes of cells. These proteins share structural features with immunoglobulins, they possess an immunoglobulin domain (fold). Immunoglobulin superfamily ligands include, without limitation, CD80 and CD86, both ligands for CD28.
  • compositions comprising genetically modified immunoresponsive cells of the invention can be provided systemically or directly to a subject for the treatment of a neoplasia.
  • cells of the invention are directly injected into an organ of interest.
  • compositions comprising genetically modified immunoresponsive cells are provided indirectly to the organ of interest, for example, by administration into the circulatory system. Expansion and differentiation agents can be provided prior to, during or after administration of the cells to increase production of T cells, NK cells, or CTL cells in vitro or in vivo.
  • the modified cells can be administered in any physiologically acceptable vehicle, normally intravascularly, although they may also be introduced into bone or other convenient site where the cells may find an appropriate site for regeneration and differentiation (e.g., thymus).
  • the modified cells can be autologous or allogeneic.
  • Genetically modified immunoresponsive cells of the invention can comprise a purified population of cells. Those skilled in the art can readily determine the percentage of genetically modified immunoresponsive cells in a population using various well-known methods, such as fluorescence activated cell sorting (FACS). Dosages can be readily adjusted by those skilled in the art (e.g., a decrease in purity may require an increase in dosage).
  • the cells can be introduced by injection, catheter, or the like.
  • factors can also be included, including, but not limited to, interleukins, e.g. IL-2, IL-3, IL-6, and IL-11, as well as the other interleukins, the colony stimulating factors, such as G-, M- and GM-CSF, interferons, e.g. interferon gamma and erythropoietin.
  • interleukins e.g. IL-2, IL-3, IL-6, and IL-11
  • the colony stimulating factors such as G-, M- and GM-CSF
  • interferons e.g. interferon gamma and erythropoietin.
  • compositions of the invention include pharmaceutical compositions comprising genetically modified immunoresponsive cells or their progenitors and a pharmaceutically acceptable carrier.
  • Administration can be autologous or heterologous.
  • immunoresponsive cells, or progenitors can be obtained from one subject, and administered to the same subject or a different, compatible subject.
  • Peripheral blood derived immunoresponsive cells of the invention or their progeny e.g., in vivo, ex vivo or in vitro derived
  • can be administered via localized injection including catheter administration, systemic injection, localized injection, intravenous injection, or parenteral administration.
  • a therapeutic composition of the present invention e.g., a pharmaceutical composition containing a genetically modified immunoresponsive cell
  • it will generally be formulated in a unit dosage injectable form (solution, suspension, emulsion).
  • the viral epitope therapeutics (e.g., peptides, polynucleotides, TCR, CAR, cells containing TCR or CAR, dendritic cell containing polypeptide, dendritic cell containing polynucleotide, antibody, etc.) described herein are useful in a variety of applications including, but not limited to, therapeutic treatment methods, such as the treatment or prevention of a viral infection.
  • the therapeutic treatment methods comprise immunotherapy.
  • a viral epitope peptide is useful for activating, promoting, increasing, and/or enhancing an immune response or redirecting an existing immune response to a new target.
  • the methods of use can be in vitro, ex vivo, or in vivo methods.
  • the present invention provides methods for activating an immune response in a subject using a viral epitope therapeutic described herein. In some embodiments, the invention provides methods for promoting an immune response in a subject using a viral epitope therapeutic described herein. In some embodiments, the invention provides methods for increasing an immune response in a subject using a viral epitope peptide described herein. In some embodiments, the invention provides methods for enhancing an immune response using a viral epitope peptide. In some embodiments, the activating, promoting, increasing, and/or enhancing of an immune response comprises increasing cell-mediated immunity. In some embodiments, the activating, promoting, increasing, and/or enhancing of an immune response comprises increasing T cell activity or humoral immunity.
  • the activating, promoting, increasing, and/or enhancing of an immune response comprises increasing CTL or HTL activity. In some embodiments, the activating, promoting, increasing, and/or enhancing of an immune response comprises increasing NK cell activity. In some embodiments, the activating, promoting, increasing, and/or enhancing of an immune response comprises increasing T cell activity and increasing NK cell activity. In some embodiments, the activating, promoting, increasing, and/or enhancing of an immune response comprises increasing CTL activity and increasing NK cell activity. In some embodiments, the activating, promoting, increasing, and/or enhancing of an immune response comprises inhibiting or decreasing the suppressive activity of Tregs. In some embodiments, the immune response is a result of antigenic stimulation.
  • the invention provides methods of activating, promoting, increasing, and/or enhancing of an immune response using a viral epitope therapeutic described herein.
  • a method comprises administering to a subject in need thereof a therapeutically effective amount of a viral epitope therapeutic that delivers a viral epitope polypeptide or polynucleotide to a cell.
  • a method comprises administering to a subject in need thereof a therapeutically effective amount of a viral epitope that is internalized by a cell, and the viral epitope peptide is processed by the cell.
  • a method comprises administering to a subject in need thereof a therapeutically effective amount of a viral epitope polypeptide that is internalized by a cell, and an antigenic peptide is presented on the surface of the cell.
  • a method comprises administering to a subj ect in need thereof a therapeutically effective amount of a viral epitope polypeptide that is internalized by the cell, is processed by the cell, and an antigenic peptide is presented on the surface of the cell.
  • a method comprises administering to a subject in need thereof a therapeutically effective amount of a viral epitope polypeptide or polynucleotide described herein that delivers an exogenous polypeptide comprising at least one antigenic peptide to a cell, wherein the antigenic peptide is presented on the surface of the cell.
  • the antigenic peptide is presented on the surface of the cell in complex with a MHC class I molecule.
  • the antigenic peptide is presented on the surface of the cell in complex with a MHC class II molecule.
  • a method comprises contacting a cell with a viral epitope polypeptide or polynucleotide described herein that delivers an exogenous polypeptide comprising at least one antigenic peptide to the cell, wherein the antigenic peptide is presented on the surface of the cell.
  • the antigenic peptide is presented on the surface of the cell in complex with a MHC class I molecule.
  • the antigenic peptide is presented on the surface of the cell in complex with a MHC class II molecule.
  • a method comprises administering to a subject in need thereof a therapeutically effective amount of a viral epitope polypeptide or polynucleotide described herein that delivers an exogenous polypeptide comprising at least one antigenic peptide to a cell, wherein the antigenic peptide is presented on the surface of the cell, and an immune response against the cell is induced. In some embodiments, the immune response against the cell is increased. In some embodiments, the viral epitope polypeptide or polynucleotide delivers an exogenous polypeptide comprising at least one antigenic peptide to a cell, wherein the antigenic peptide is presented on the surface of the cell.
  • a method comprises administering to a subject in need thereof a therapeutically effective amount of a viral epitope polypeptide or polynucleotide described herein that delivers an exogenous polypeptide comprising at least one antigenic peptide to a cell, wherein the antigenic peptide is presented on the surface of the cell, and T cell killing directed against the cell is induced.
  • T cell killing directed against the cell is enhanced.
  • T cell killing directed against the cell is increased.
  • a method of increasing an immune response in a subject comprises administering to the subject a therapeutically effective amount of a viral epitope therapeutic described herein, wherein the agent is an antibody that specifically binds the viral epitope described herein.
  • a method of increasing an immune response in a subject comprises administering to the subject a therapeutically effective amount of the antibody.
  • the present invention provides methods of inducing or promoting or enhancing an immune response to a virus.
  • a method of inducing or promoting or enhancing an immune response to a virus comprises administering to a subj ect a therapeutically effective amount of a viral epitope therapeutic described herein.
  • the immune response is against a virus.
  • the existing immune response is against a coronavirus.
  • the existing immune response is against a COVID19.
  • the virus is selected from the group consisting of: measles virus, varicella-zoster virus (VZV; chickenpox virus), influenza virus, mumps virus, poliovirus, rubella virus, rotavirus, hepatitis A virus (HAV), hepatitis B virus (HBV), Epstein Barr virus (EBV), and cytomegalovirus (CMV).
  • the virus is varicella-zoster virus.
  • the virus is cytomegalovirus.
  • the virus is measles virus.
  • the immune response has been acquired after a natural viral infection.
  • the immune response has been acquired after vaccination against a virus.
  • the immune response is a cell-mediated response.
  • the existing immune response comprises cytotoxic T cells (CTLs) or HTLs.
  • a method of inducing or promoting or enhancing an immune response to a virus in a subject comprises administering a fusion protein comprising (i) an antibody that specifically binds a viral epitope and (ii) at least one viral epitope peptide described herein, wherein (a) the fusion protein is internalized by a cell after binding to the viral antigen; (b) the viral epitope peptide is processed and presented on the surface of the cell associated with a MHC class I molecule; and (c) the viral epitope peptide/MHC Class I complex is recognized by cytotoxic T cells.
  • the cytotoxic T cells are memory T cells.
  • the memory T cells are the result of a vaccination with the viral epitope peptide.
  • the present invention provides methods of increasing the immunogenicity of a virus.
  • a method of increasing the immunogenicity of a virus comprises contacting virally infected cells with an effective amount of a viral epitope therapeutic described herein.
  • a method of increasing the immunogenicity of a virus comprises administering to a subject a therapeutically effective amount of a viral epitope therapeutic described herein.
  • the subject is a human.
  • a method can comprise treating or preventing cancer in a subject in need thereof by administering to a subject a therapeutically effective amount of a viral epitope therapeutic described herein.
  • the cancer is a liquid cancer, such as a lymphoma or leukemia.
  • the cancer is a solid tumor.
  • the tumor is a tumor selected from the group consisting of: colorectal tumor, pancreatic tumor, lung tumor, ovarian tumor, liver tumor, breast tumor, kidney tumor, prostate tumor, neuroendocrine tumor, gastrointestinal tumor, melanoma, cervical tumor, bladder tumor, glioblastoma, and head and neck tumor.
  • the tumor is a colorectal tumor. In certain embodiments, the tumor is an ovarian tumor. In some embodiments, the tumor is a breast tumor. In some embodiments, the tumor is a lung tumor. In certain embodiments, the tumor is a pancreatic tumor. In certain embodiments, the tumor is a melanoma tumor. In some embodiments, the tumor is a solid tumor.
  • the present invention further provides methods for treating or preventing a viral infection in a subject comprising administering to the subject a therapeutically effective amount of a viral epitope therapeutic described herein.
  • a method of treating or preventing a viral infection comprises redirecting an existing immune response to a new target, the method comprising administering to a subject a therapeutically effective amount of viral epitope therapeutic, wherein the existing immune response is against an antigenic peptide delivered to a cell or a cell infected with a virus by the viral epitope peptide.
  • the present invention provides for methods of treating or preventing a viral infection comprising administering to a subject a therapeutically effective amount of a viral epitope therapeutic described herein (e.g., a subject in need of treatment).
  • the subject is a human.
  • the subject has a coronavirus infection or is at risk of a coronavirus infection.
  • the method or treatment further comprises administering at least one additional therapeutic agent.
  • An additional therapeutic agent can be administered prior to, concurrently with, and/or subsequently to, administration of the agent.
  • the at least one additional therapeutic agent comprises
  • the viral epitope therapeutic can be administered in combination with a biologic molecule selected from the group consisting of: adrenomedullin (AM), angiopoietin (Ang), BMPs, BDNF, EGF, erythropoietin (EPO), FGF, GDNF, granulocyte colony stimulating factor (G-CSF), granulocyte-macrophage colony stimulating factor (GM-CSF), macrophage colony stimulating factor (M- CSF), stem cell factor (SCF), GDF9, HGF, HDGF, IGF, migration-stimulating factor, myostatin (GDF-8), NGF, neurotrophins, PDGF, thrombopoietin, TGF- ⁇ , TGF TNF- ⁇ ,, VEGF, P1GF, gamma-IFN, IL-1, IL-
  • a biologic molecule selected from the group consisting of: adrenomedullin (AM), angiopoietin (
  • treatment involves the administration of a viral epitope therapeutic described herein in combination with an additional therapy.
  • the additional therapy is a therapy for another virus, for example, influenza.
  • Exemplary therapies for viruses include but are not limited to oseltamivir, oseltamivir phosphate (available as a generic version or under the trade name Tamiflu®), zanamivir (trade name Relenza®), peramivir (trade name Rapivab®), baloxavir marboxil (trade name Xofluza®), amantadine, moroxydine, rimantadine, umifenovir (trade name Arbidol®) and zanamivir (trade name Relenza®).
  • Treatment with an agent can occur prior to, concurrently with, or subsequent to administration of an additional therapy. Dosing schedules for such additional therapies can be determined by the skilled medical practitioner.
  • Combined administration can include co-administration, either in a single pharmaceutical formulation or using separate formulations, or consecutive administration in either order but generally within a time period such that all active agents can exert their biological activities simultaneously.
  • a viral epitope therapeutic described herein and at least one additional therapeutic agent can be administered in any order or concurrently.
  • the agent will be administered to patients that have previously undergone treatment with a second therapeutic agent.
  • the viral epitope therapeutic and a second therapeutic agent will be administered substantially simultaneously or concurrently.
  • a subject can be given an agent while undergoing a course of treatment with a second therapeutic agent (e.g., chemotherapy).
  • a viral epitope therapeutic will be administered within 1 year of the treatment with a second therapeutic agent.
  • the two (or more) agents or treatments can be administered to the subject within a matter of hours or minutes (i.e., substantially simultaneously).
  • the appropriate dosage of a viral epitope therapeutic described herein depends on the type of disease to be treated, the severity and course of the disease, the responsiveness of the disease, whether the agent is administered for therapeutic or preventative purposes, previous therapy, the patient's clinical history, and so on, all at the discretion of the treating physician.
  • the viral epitope therapeutic can be administered one time or over a series of treatments lasting from several days to several months, or until a cure is effected or a diminution of the disease state is achieved.
  • Optimal dosing schedules can be calculated from measurements of drug accumulation in the body of the patient and will vary depending on the relative potency of an individual agent. The administering physician can determine optimum dosages, dosing methodologies, and repetition rates.
  • a viral epitope therapeutic can be administered at an initial higher “loading” dose, followed by one or more lower doses.
  • the frequency of administration can also change.
  • a dosing regimen can comprise administering an initial dose, followed by additional doses (or “maintenance” doses) once a week, once every two weeks, once every three weeks, or once every month.
  • a dosing regimen can comprise administering an initial loading dose, followed by a weekly maintenance dose of, for example, one-half of the initial dose.
  • a dosing regimen can comprise administering an initial loading dose, followed by maintenance doses of, for example one-half of the initial dose every other week.
  • a dosing regimen can comprise administering three initial doses for 3 weeks, followed by maintenance doses of, for example, the same amount every other week.
  • administration of any therapeutic agent can lead to side effects and/or toxicities.
  • the side effects and/or toxicities are so severe as to preclude administration of the particular agent at a therapeutically effective dose.
  • therapy must be discontinued, and other agents can be tried.
  • many agents in the same therapeutic class display similar side effects and/or toxicities, meaning that the patient either has to stop therapy, or if possible, suffer from the unpleasant side effects associated with the therapeutic agent.
  • the dosing schedule can be limited to a specific number of administrations or “cycles”.
  • the agent is administered for 3, 4, 5, 6, 7, 8, or more cycles.
  • the agent is administered every 2 weeks for 6 cycles, the agent is administered every 3 weeks for 6 cycles, the agent is administered every 2 weeks for 4 cycles, the agent is administered every 3 weeks for 4 cycles, etc.
  • Dosing schedules can be decided upon and subsequently modified by those skilled in the art.
  • the present invention provides methods of administering to a subject a viral epitope therapeutic described herein comprising using an intermittent dosing strategy for administering one or more agents, which can reduce side effects and/or toxicities associated with administration of an agent, chemotherapeutic agent, etc.
  • a method for treating or preventing a viral infection in a human subject comprises administering to the subject a therapeutically effective dose of a viral epitope therapeutic in combination with a therapeutically effective dose of another therapeutic agent, such as an anti-viral agent, wherein one or both of the agents are administered according to an intermittent dosing strategy.
  • a method for treating or preventing a viral infection in a human subject comprises administering to the subject a therapeutically effective dose of a viral epitope therapeutic in combination with a therapeutically effective dose of a second viral epitope therapeutic, wherein one or both of the agents are administered according to an intermittent dosing strategy.
  • the intermittent dosing strategy comprises administering an initial dose of a viral epitope therapeutic to the subject, and administering subsequent doses of the agent about once every 2 weeks.
  • the intermittent dosing strategy comprises administering an initial dose of a viral epitope therapeutic to the subject, and administering subsequent doses of the agent about once every 3 weeks.
  • the intermittent dosing strategy comprises administering an initial dose of a viral epitope therapeutic to the subject, and administering subsequent doses of the agent about once every 4 weeks.
  • the agent is administered using an intermittent dosing strategy and the additional therapeutic agent is administered weekly.
  • the present invention provides compositions comprising the viral epitope therapeutic described herein.
  • the present invention also provides pharmaceutical compositions comprising a viral epitope therapeutic described herein and a pharmaceutically acceptable vehicle.
  • the pharmaceutical compositions find use in immunotherapy.
  • the compositions find use in inhibiting viral replication.
  • the pharmaceutical compositions find use in inhibiting viral replication in a subject (e.g., a human patient).
  • Formulations are prepared for storage and use by combining an antigen therapeutic of the present invention with a pharmaceutically acceptable vehicle (e.g., a carrier or excipient).
  • a pharmaceutically acceptable vehicle e.g., a carrier or excipient.
  • a pharmaceutically acceptable carrier, excipients, and/or stabilizers to be inactive ingredients of a formulation or pharmaceutical composition. Exemplary formulations are listed in WO 2015/095811.
  • Suitable pharmaceutically acceptable vehicles include, but are not limited to, nontoxic buffers such as phosphate, citrate, and other organic acids; salts such as sodium chloride; antioxidants including ascorbic acid and methionine; preservatives such as octadecyldimethylbenzyl ammonium chloride, hexamethonium chloride, benzalkonium chloride, benzethonium chloride, phenol, butyl or benzyl alcohol, alkyl parabens, such as methyl or propyl paraben, catechol, resorcinol, cyclohexanol, 3-pentanol, and m- cresol; low molecular weight polypeptides (e.g., less than about 10 amino acid residues); proteins such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, his
  • compositions described herein can be administered in any number of ways for either local or systemic treatment. Administration can be topical by epidermal or transdermal patches, ointments, lotions, creams, gels, drops, suppositories, sprays, liquids and powders; pulmonary by inhalation or insufflation of powders or aerosols, including by nebulizer, intratracheal, and intranasal; oral; or parenteral including intravenous, intraarterial, subcutaneous, intraperitoneal, intramuscular (e.g., injection or infusion), or intracranial (e.g., intrathecal or intraventricular).
  • parenteral including intravenous, intraarterial, subcutaneous, intraperitoneal, intramuscular (e.g., injection or infusion), or intracranial (e.g., intrathecal or intraventricular).
  • the therapeutic formulation can be in unit dosage form. Such formulations include tablets, pills, capsules, powders, granules, solutions or suspensions in water or non-aqueous media, or suppositories [000337]
  • the viral epitope peptides described herein can also be entrapped in microcapsules.
  • microcapsules are prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nanoparticles and nanocapsules) or in macroemulsions as described in Remington: The Science and Practice of Pharmacy, 22st Edition, 2012, Pharmaceutical Press, London. [000338]
  • pharmaceutical formulations include a viral epitope therapeutic described herein complexed with liposomes. Methods to produce liposomes are known to those of skill in the art.
  • liposomes can be generated by reverse phase evaporation with a lipid composition comprising phosphatidylcholine, cholesterol, and PEG-derivatized phosphatidylethanolamine (PEG-PE).
  • PEG-PE PEG-derivatized phosphatidylethanolamine
  • sustained-release preparations comprising the viral epitope peptides described herein can be produced.
  • Suitable examples of sustained-release preparations include semi- permeable matrices of solid hydrophobic polymers containing an agent, where the matrices are in the form of shaped articles (e.g., films or microcapsules).
  • sustained-release matrices include polyesters, hydrogels such as poly(2-hydroxyethyl-methacrylate) or poly(vinyl alcohol), polylactides, copolymers of L-glutamic acid and 7 ethyl-L-glutamate, nondegradable ethylene- vinyl acetate, degradable lactic acid- glycolic acid copolymers such as the LUPRON DEPOTTM (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), sucrose acetate isobutyrate, and poly-D-(-)-3- hydroxybutyric acid.
  • polyesters such as poly(2-hydroxyethyl-methacrylate) or poly(vinyl alcohol)
  • polylactides copolymers of L-glutamic acid and 7 ethyl-L-glutamate
  • nondegradable ethylene- vinyl acetate nondegradable ethylene- vinyl acetate
  • compositions and methods for augmenting, inducing, promoting, enhancing or improving an immune response against 2019 SARS CoV-2 virus are designed to augmen, induce, promote, enhance or improve immunological memory against 2019 SARS CoV-2 virus.
  • the composition and methods described here are designed to act as immunological boost to a primary vaccine, such as a vaccine directed to a spike protein of the 2019 SARS CoV-2 virus.
  • the composition comprises one or more polynucleotide constructs (designated herein as “Strings”) that encode one or more SARS COV-2 epitopes. Both coding and non-coding strands are contemplated herein.
  • the strings refer to polynucleotide chains that encode a plurality of SARS COV-2 epitopes in tandem. In some embodiments there are about 2 to about 100, about 2 to about 1000 or about 2 to about 10,000 epitopes encoded in one string. In some embodiments about 2- 5000 SARS COV-2 epitopes are encoded in one polynucleotide string. In some embodiments about 2- 4000 SARS COV-2 epitopes are encoded in one polynucleotide string. In some embodiments about 2- 3000 SARS COV-2 epitopes are encoded in one polynucleotide string. In some embodiments about 2- 2000 SARS COV-2 epitopes are encoded in one polynucleotide string.
  • about 2- 1000 SARS COV-2 epitopes are encoded in one polynucleotide string. In some embodiments about 10- 500 SARS COV-2 epitopes are encoded in one polynucleotide string. In some embodiments about 10- 200 SARS COV-2 epitopes are encoded in one polynucleotide string. In some embodiments about 20 - 100 SARS COV-2 epitopes are encoded in one polynucleotide string.
  • the SARS COV-2 epitopes encoded by the string constructs comprise epitopes that are predicted by a HLA binding and presentation prediction software to be of high likelihood to be presented by a protein encoded by an HLA to a T cell for eliciting immune response.
  • the SARS COV-2 epitopes encoded by the string constructs that are predicted to have a high likelihood to be presented by a protein encoded by an HLA are selected from any one of the proteins or peptides described in Tables 1-12, 14A, 14B and 15.
  • the SARS CoV-2 epitopes encoded by the string constructs comprise epitopes that are predicted to have a high likelihood to be presented by a protein encoded by an HLA, and the epitope is selected from any one of the proteins described in Table 1A, Table IB, Table 1C, Table 2Ai, Table 2Aii, Table 2B, Table 9, Table 10, Table 11, Table 12, Table 14A, Table 14B and/or Table 15.
  • the epitopes in a string construct comprise nucleocapsid epitopes.
  • the epitopes in a string construct comprise spike (S) epitopes.
  • the epitopes in a string construct comprise membrane protein epitopes.
  • the epitopes in a string construct comprise NSP 1, NSP2, NSP3, or NSP 4 epitopes.
  • the string constructs comprise a multitude of epitopes that are from 2, 3, 4, or more proteins in the virus.
  • the string constructs comprise the features described in Tables 9-12, and 15.
  • the String constructs comprise a sequence as depicted in SEQ ID RS Cln, RS C2n, RS C3n, RS C4n, SEQ ID RS C5n, RS C6n, RS C7n, RS C8n or a sequence that has at least 70% sequence identity to any one of the sequences depicted in SEQ ID RS Cln, RS C2n, RS C3n, RS C4n, SEQ ID RS C5n, RS C6n, RS C7n, RS C8n.
  • the string constructs comprise additional sequences such as linkers, and sequences encoding peptide autocleavage sequences, for example, T2A, or P2A sequences.
  • the string constructs comprises two or more overlapping epitope sequences.
  • a String construct comprise a sequence that is 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to any one of the sequences SEQ ID RS Cln, RS C2n, RS C3n, RS C4n, SEQ ID RS C5n, RS C6n, RS C7n, RS C8n.
  • the epitopes are arranged on a string to maximize immunogenicity of the string, for example by maximizing recognition by HLA allele repertoire of a subject.
  • the same string encodes epitopes that can bind to or are predicted to bind to different HLA alleles.
  • a string may encode epitope(s) that comprise: (a) a first epitope that binds to or is predicted to bind to a first MHC peptide encoded by a first HLA allele; (b) a second epitope that binds to or is predicted to bind to a second MHC peptide encoded by a second HLA allele; (c) a third epitope that binds to or is predicted to bind to a third MHC peptide encoded by a third HLA allele - and more such epitopes can be added, as in for example in sting sequences of RS- Cl , or RS-C2 etc.; wherein the first, second and third epitopes are epitopes from the same viral protein, or from different viral proteins.
  • the epitope distribution encoded by a single string is maximized for hitting the different MHC based presentation to T cells, thereby maximizing the probability of generating an antiviral response from a wider range of patients in the given population and the robustness of the response of each patent.
  • the epitopes are selected on the basis of high scoring prediction for binding to an HLA by a reliable prediction algorithm or system, such as the RECON prediction algorithm.
  • the present disclosure provides an insight that particularly successful strings can be provided by selecting epitopes based on highly reliable and efficient prediction algorithm, in the layout of the epitopes encoded by the string, with or without non-epitope sequences or sequences flanking the epitopes, and is such that the immunogenicity of the string is validated in an ex vivo cell culture model, or in an animal model, specifically in showing T cell induction following vaccination with a string construct or a polypeptide encoded by a string construct with the finding of epitope specific T cell response.
  • the validation may be from using in human patients, and with a finding that T cells obtained from a patient post vaccination shows epitope specific efficient and lasting T cell response.
  • the efficiency of a string as a vaccine is influenced by its design, that in part depends on strength of the bioinformatic information used in the thoughtful execution of the design, the reliability of the MHC presentation prediction model, the efficiency of epitope processing when a string vaccine is expressed in a cell, among others.
  • the epitope-coding sequences in a string construct are flanked by one or more sequences selected for higher immunogenicity, better cleavability for peptide presentation to MHCs, better expression, and/or improved translation in a cell in a subject.
  • the flanking sequences may comprise a linker with a specific cleavable sequences.
  • the epitope-coding sequences in a string construct are flanked by a secretory protein sequence.
  • a string sequence encodes an epitope that may comprise or otherwise be linked to a secretory sequence such as MFVFLVLLPLVSSQCVNLT, or at least a sequence having 1, 2, 3, 4, or at the most 5 amino acid differences relative thereto.
  • a string sequence encodes an epitope that may be linked at the N-terminal end by a sequence MFVFLVLLPLVSSQCVNLT or a sequence having 1, 2, 3, 4, or at the most 5 amino acid differences relative thereto.
  • the linked sequences may comprise a linker with a specific cleavable sequences.
  • the string construct is linked to a transmembrane domain (TM).
  • TM domain sequence encodes an epitope that may be linked at the C terminal sequence by a TM domain sequence
  • one or more linker sequences may comprise cleavage sequences.
  • a linker may have a length of 2, 3, 4, 5, 6, 7, 8, 9, 10 or more amino acid.
  • a linker of not more than about 30, 25, 20, 15, 10 or fewer amino acids is used. In general, any amino acid may be present as a linker sequence.
  • a linker or cleavage sequence contains a lysine (K).
  • a linker or cleavage sequence contains an arginine (R). In some embodiments, a linker or cleavage sequence contains a methionine (M). In some embodiments, a linker or cleavage sequence contains a tyrosine (Y). In some embodiments, a linker is designed to comprise amino acids based on a cleavage predictor to generate highly-cleavable sequences peptide sequences, and is a novel and effective way of delivering immunogenic T cell epitopes in a T cell vaccine setting.
  • the epitope distribution and their juxtaposition encoded in a string construct are so designed to facilitate cleavage sequences contributed by the amino acid sequences of the epitopes and/or the flanking or linking residues and thereby using minimal linker sequences.
  • Some exemplary cleavage sequences may be one or more of FRAC, KRCF, KKRY, ARMA, RRSG, MRAC, KMCG, ARC A, KKQG, YRSY, SFMN, FKAA, KRNG, YNSF, KKNG, RRRG, KRYS, and ARYA.
  • MS data included herein demonstrates that the epitopes that are highly predicted for binding ended up being presented to T cells, and immunogenic.
  • the string constructs may be mRNA.
  • a pharmaceutical composition may comprise one or more mRNA string construct, each comprising a sequence encoding a plurality of SARS CoV-2 epitopes.
  • the one or more mRNA may comprise a plurality of epitopes from the SARS-CoV2 spike protein, wherein each of the plurality of epitopes is predicted by an HLA binding and presentation prediction algorithm to be of high likelihood to be presented by a protein encoded by an HLA to a T cell for eliciting immune response.
  • the one or more mRNA may comprise a plurality of epitopes from the SARS-CoV2 nucleocapsid protein, wherein each of the plurality of epitopes is predicted by an HLA binding and presentation prediction algorithm to be of high likelihood to be presented by a protein encoded by an HLA to a T cell for eliciting immune response.
  • the one or more mRNA may comprise a plurality of epitopes from the SARS-CoV2 spike, or nucleocapsid protein, or membrane protein or any other protein wherein each of the plurality of epitopes is predicted by an HLA binding and presentation prediction algorithm to be of high likelihood to be presented by a protein encoded by an HLA to a T cell for eliciting immune response.
  • the plurality of epitopes may comprise epitopes from a single 2019 SARS CoV-2 protein.
  • the plurality of epitopes may comprise epitopes from multiple 2019 SARS CoV-2 protein.
  • the plurality of epitopes may comprise epitopes from 2019 SARS CoV-2 nucleocapsid protein.
  • the mRNA may comprise a 5’UTR and a 3’UTR.
  • the UTR may comprise a poly A sequence.
  • a poly A sequence may be between 50-200 nucleotides long.
  • the 2019 SARS CoV-2 viral epitopes may be flanked by a signal peptide sequence, e.g., SP1 sequence to enhance epitope processing and presentation.
  • the 2019 SARS CoV-2 viral epitopes are flanked with an MITD sequence to enhance epitope processing and presentation.
  • the polynucleotide comprises a dEarl-hAg sequence.
  • the poly A tail comprises a specific number of Adenosines, such as about 50 or more, about 60 or more, about 70 or more, about 80 or more, about 90 or more, about 100 or more, about 120, or about 150 or about 200.
  • a poly A tail of a string construct may comprise 200 A residues or less.
  • a poly A tail of a string construct may comprise about 200 A residues.
  • a poly A tail of a string construct may comprise 180 A residues or less.
  • a poly A tail of a string construct may comprise about 180 A residues.
  • the poly A tail may comprise 150 residues or less. In some embodiments a poly A tail of a string construct may comprise about 150 A residues. In some embodiments, the poly A tail may comprise 120 residues or less. In some embodiments a poly A tail of a string construct may comprise about 120 A residues.
  • the nucleotide sequence of the string constructs, encoding the plurality of epitopes may be codon optimized.
  • An example of a codon optimized sequence may be a sequence optimized for expression in a eukaryote, e.g., humans (i.e. being optimized for expression in humans), or for another eukaryote, animal or mammal. Codon optimization for a host species other than human, or for codon optimization for specific organs is known.
  • the coding sequence encoding a protein may be codon optimized for expression in eukaryotic cells, such as human cells.
  • Codon optimization refers to a process of modifying a nucleic acid sequence for enhanced expression in the host cells of interest by replacing at least one codon (e.g., about or more than about 1, 2, 3, 4, 5, 10, 15, 20, 25, 50, or more codons) of the native sequence with codons that are more frequently or most frequently used in the genes of that host cell while maintaining the native amino acid sequence.
  • codons e.g., about or more than about 1, 2, 3, 4, 5, 10, 15, 20, 25, 50, or more codons
  • Codon bias differs in codon usage between organisms
  • mRNA messenger RNA
  • tRNA transfer RNA
  • the predominance of selected tRNAs in a cell may generally be a reflection of the codons used most frequently in peptide synthesis. Accordingly, genes may be tailored for optimal gene expression in a given organism based on codon optimization. Codon usage tables are readily available, for example, at the "Codon Usage Database" available at www.kazusa.orjp/codon/ and these tables may be adapted in a number of ways. Computer algorithms for codon optimizing a particular sequence for expression in a particular host cell are also available, such as Gene Forge (Aptagen; Jacobus, PA), are also available.
  • the stability and translation efficiency of RNA may incorporate one or more elements established to contribute to stability and/or translation efficiency of RNA; exemplary such elements are described, for example, in PCT/EP2006/009448 incorporated herein by reference.
  • the RNA used according to the present invention it may be modified within the coding region, i.e. the sequence encoding the expressed peptide or protein, without altering the sequence of the expressed peptide or protein, so as to increase the GC-content to increase mRNA stability and to perform a codon optimization and, thus, enhance translation in cells.
  • the string construct may comprise an F element.
  • the F element sequence is a 3 UTR of amino-terminal enhancer of split (AES).
  • a String mRNA construct as described above may comprise 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or more epitopes.
  • the pharmaceutical composition comprises 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more strings.
  • the pharmaceutical composition comprises 6 strings.
  • the pharmaceutical composition comprises 7 strings.
  • the pharmaceutical composition comprises 8 strings.
  • the pharmaceutical composition comprises 9 strings.
  • the pharmaceutical composition comprises 10 strings.
  • a string construct may be a polynucleotide, wherein the polynucleotide is DNA.
  • the pharmaceutical composition comprising one or more String mRNA construct as described above may be encapsulated in a lipid nanoparticle.
  • a lipid nanoparticle (LNP) may be 100-250 nm in diameter.
  • a plurality of lipid nanoparticles may have an average particle size of less than 200 nm, less than 150 nm, less than 100 nm, less than 80 nm, less than 75 nm, or lower.
  • a plurality of lipid nanoparticles may have an average particle size of at least 30 nm, at least 50 nm, at least 60 nm, at least 70 nm, at least 80 nm, at least 90 nm, at least 100 nm, at least 125 nm, at least 150 nm, or more. Combinations of the above-mentioned ranges are also possible. In some embodiments, a plurality of lipid nanoparticles may have an average particle size of 30 nm to 200 nm, or 30 nm to 100 nm or 50 nm to 80 nm, or 50 nm to less than 80 nm. In some embodiments, an LNP may comprise a cationic lipid.
  • An LNP may comprise a non-cationic lipid.
  • An LNP may comprise a PEG- modified lipid.
  • An LNP may comprise a sterol or a steroidal lipid.
  • the pharmaceutical composition comprising one or more String mRNA construct as described above may be administered with another 2019 SARS COV-2 vaccine, which can be in some embodiments, e.g., protein-based, RNA-based, DNA-based, viral vector-based vaccines, and may be administered either before, after, or simultaneously with.
  • a pharmaceutical composition comprising one or more String mRNA construct as described above may be administered to a subject in need thereof such that the subject receives a combination of the pharmaceutical composition described herein and an another 2019 SARS CoV-2 vaccine (e.g., a vaccine that induces production of antibodies to SARS CoV-2 protein such as S protein or an immunogenic fragment thereof).
  • an another 2019 SARS CoV-2 vaccine e.g., a vaccine that induces production of antibodies to SARS CoV-2 protein such as S protein or an immunogenic fragment thereof.
  • a pharmaceutical composition comprising one or more String mRNA construct as described above may be administered to a subject who is receiving or has received another 2019 SARS CoV-2 vaccine (e.g., a vaccine that induces production of antibodies to 2019 SARS CoV-2 protein such as S protein or an immunogenic fragment thereof).
  • the pharmaceutical composition comprising one or more String mRNA construct as described above may be co-administered with a vaccine directed against SARS COV-2 spike protein.
  • the vaccine comprises a SARS-CoV-2 spike protein of 2019 SARS COV- 2 or a nucleic acid sequence encoding the same, for example which may have any of the following specifications:
  • S1S2 protein Encoded antigen Viral spike protein (S1S2 protein) of the SARS CoV-2 (S1S2 full-length protein, sequence variant)
  • UUCAAGAUCU ACAGCAAGCA CACCCCUAUC AACCUCGUGC GGGAUCUGCC UCAGGGCUUC
  • a pharmaceutical composition comprising one or more polynucleotides encoding a polypeptide encoded by a string construct may be co-administered with another vaccine for treating a viral disease, e.g., COVID.
  • a viral disease e.g., COVID
  • the pharmaceutical composition comprising a string construct may be co-administered, for example, with an antibody, such as a neutralizing antibody that can bind to a SARS COV-2 protein, e.g., orflab polyprotein, orfla polyprotein, surface glycoprotein (S), nucleocapsid phosphoprotein (N), ORF3a protein, membrane glycoprotein (M), ORF7a protein, ORF8 protein, envelope protein (E), ORF6 protein, ORF7b protein or ORFIO protein.
  • the pharmaceutical composition may be co-administered with an antibody directed to the SARS spike protein.
  • the pharmaceutical composition comprising one or more polynucleotides encoding a polypeptide encoded by a string construct may be administered before, after or simultaneously with a therapeutic regime comprising another vaccine described above.
  • a polypeptide encoded by a string construct especially comprising SARS COV- 2 nucleocapsid protein epitopes are designed to boost the immunogenicity and immune memory against the virus.
  • Certain of the present day vaccines in trial comprise vaccines directed to the viral spike proteins, that are likely to confer an immunogenic response, but do not appear to elicit or promote a T cell response.
  • vaccines comprising a string construct or a polypeptide encoded by a string construct described herein can elicit or promote a T cell response and/or elicit or promote a lasting immunological memory.
  • a vaccine against SARS CoV-2 may be accompanied by one or more string vaccine compositions described herein, e.g., as part of an administration regimen, such as for a boost after priming.
  • a vaccine against SARS CoV-2 may be mRNA-based, viral vector-based (e.g., replicating and/or non-replicating), DNA-based, protein-based (e.g., protein subunit and/or virus like particles), and/or inactivated/attenuated virus-based.
  • such a vaccine is directed to a spike protein or an immunogenic fragment thereof.
  • such a SARS CoV-2 vaccine may be or comprise an mRNA-based vaccine against SARs-CoV-2, e.g., in some embodiments a mRNA-based vaccine (mRNA-1273) developed by Modema that encodes a prefusion stabilized form of SARS CoV-2 Spike protein.
  • mRNA-1273 mRNA-based vaccine developed by Modema that encodes a prefusion stabilized form of SARS CoV-2 Spike protein.
  • such a SARS CoV-2 vaccine may be or comprise aviral vector based vaccine against SARS-CoV-2, e.g., in some embodiments an adenovirus vaccine vector-based vaccine (AZD1222) developed by AstraZeneca that is made from a virus (e.g., ChAdOxl), which is a weakened version of an adenovirus, and encodes a SARS CoV-2 spike protein.
  • adenovirus vaccine vector-based vaccine (AZD1222) developed by AstraZeneca that is made from a virus (e.g., ChAdOxl), which is a weakened version of an adenovirus, and encodes a SARS CoV-2 spike protein.
  • Pharmaceutical composition comprising String constructs or a polypeptide encoded by a string construct
  • a pharmaceutical composition comprising the string vaccines may be administered to a patient alone or in combination with other drugs or vaccines.
  • the pharmaceutical composition comprising the string vaccine may be administered before, simultaneously or after an initial administration of another vaccine or drug for SARS CoV-2 viral infection.
  • the pharmaceutical composition comprising the string vaccine may be administered 7 days, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 7 weeks, 8 weeks, 9 weeks, 10 weeks, 11 weeks, 12 weeks, 14 weeks, 16 weeks, 18 weeks, or 20 weeks or more before administering another vaccine or drug for SARS CoV-2 viral infection.
  • the pharmaceutical composition comprising the string vaccine may be administered prophylactically, or as a preventive vaccine, similar to for example, the flu vaccine at the onset of annual flu season.
  • the pharmaceutical composition comprising the string vaccine may be administered 7 days, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 7 weeks, 8 weeks, 9 weeks, 10 weeks,
  • the pharmaceutical composition comprising the string vaccine may be administered 3 months after another 2019 SARS-CoV2 vaccine therapy. In some embodiments, the pharmaceutical composition comprising the string vaccine may be administered 6 months after another 2019 SARS-CoV2 vaccine therapy. In some embodiments, the pharmaceutical composition comprising the string vaccine may be administered 8 months after another 2019 SARS-CoV2 vaccine therapy. In some embodiments, the pharmaceutical composition comprising the string vaccine may be administered 9 months after another 2019 SARS-CoV2 vaccine therapy. In some embodiments, the pharmaceutical composition comprising the string vaccine may be administered 10 months after another SARS-CoV2 vaccine therapy. In some embodiments, the pharmaceutical composition comprising the string vaccine may be administered 12 months after another 2019 SARS-CoV2 vaccine therapy.
  • the pharmaceutical composition comprising the string vaccine may be administered once every 2 days, 7 days, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 7 weeks, 8 weeks, 9 weeks, 10 weeks, 12 weeks or more.
  • the pharmaceutical composition comprising a string vaccine (e.g., as described herein) may be administered once every 20 days, 21 days, 22 days, 23 days, 24 days, 25 days, 26 days, 27 days, 28 days, 29 days, 30 days, or more.
  • the pharmaceutical composition comprising a string vaccine (e.g., as described herein) may be administered once every 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months,
  • a subject may be administered at least two doses of the pharmaceutical composition comprising a string vaccine (e.g., as described herein), and the at least two doses of the pharmaceutical composition comprising the string vaccine may be administered at an interval of 20 days. In some embodiments, two such doses may be administered at an interval of 21 days. In some embodiments, two such doses may be administered at an interval of 22 days. In some embodiments, two such doses may be administered at an interval of 23 days. In some embodiments, two such doses may be administered at an interval of 24 days. In some embodiments, two such doses may be administered at an interval of 25 days. In some embodiments, two such doses may be administered at an interval of 26 days.
  • two such doses may be administered at an interval of 27 days. In some embodiments, two such doses may be administered at an interval of 28 days.
  • the pharmaceutical composition comprising the string vaccine may be administered as a boost (or maintenance) once every 6 months, or once 8 month or once every 12 months after an initial phase of priming dose comprising more frequent dosing.
  • the priming dose may comprise 2, 3, 4, 5, 6, 7, 8, 9, 10 or more doses.
  • the string vaccine compositions may be used at a dose between 1-1000 microgram per dose per person. In some embodiments, the string vaccine composition may be administered at a dose of 1-600 micrograms per dose, per person. In some embodiments, the string vaccine composition may be administered at a dose of 1-500 micrograms per dose, per person. In some embodiments, the string vaccine composition may be administered at a dose of 1-400 micrograms per dose, per person. In some embodiments, the string vaccine composition may be administered at a dose of 1-300 micrograms per dose, per person. In some embodiments, the string vaccine composition may be administered at a dose of 1-200 micrograms per dose, per person.
  • the string vaccine composition may be administered at a dose of 10-300 micrograms per dose, per person. In some embodiments, the string vaccine composition may be administered at a dose of 10-200 micrograms per dose, per person. In some embodiments, the string vaccine composition may be administered at a dose of 10-100 micrograms per dose, per person. In some embodiments, the string vaccine composition may be administered at a dose of 10 micrograms per dose, per person. In some embodiments, the string vaccine composition may be administered at a dose of 20 micrograms per dose, per person. In some embodiments, the string vaccine composition may be administered at a dose of 30 micrograms per dose, per person. In some embodiments, the string vaccine composition may be administered at a dose of 40 micrograms per dose, per person.
  • the string vaccine composition may be administered at a dose of 50 micrograms per dose, per person. In some embodiments, the string vaccine composition may be administered at a dose of 60 micrograms per dose, per person. In some embodiments, the string vaccine composition may be administered at a dose of 70 micrograms per dose, per person. In some embodiments, the string vaccine composition may be administered at a dose of 80 micrograms per dose, per person. In some embodiments, the string vaccine composition may be administered at a dose of 90 micrograms per dose, per person. In some embodiments, the string vaccine composition may be administered at a dose of 100 micrograms per dose, per person. In some embodiments, the string vaccine composition may be administered at a dose of 120 micrograms per dose, per person.
  • the string vaccine composition may be administered at a dose of 150 micrograms per dose, per person.
  • a string vaccine composition e.g., as described herein
  • a BNT RNA vaccine composition e.g., a composition comprising an RNA (e.g., mRNA) encoding a viral spike protein (e.g., a SARS CoV-2 S protein or an immunogenic fragment thereof (e.g., RBD)), which in some embodiments may be encapsulated in a lipid nanoparticle
  • a BNT RNA vaccine composition may be administered at a dose ranging from 0.1 micrograms to 100 micrograms, 1 to 60 micrograms, 3 to 50 micrograms, 3- 30 micrograms, or 10-30 micrograms.
  • a BNT RNA vaccine composition may be administered at a dose of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30 micrograms or more.
  • a BNT RNA vaccine comprises an RNA (e.g., mRNA) construct encoding a SARS CoV-2 S protein, which can have a structure represented as m 2 7,3’-O Gppp(m 1 2’-O )ApG)-hAg-Kozak-S1S2-PP-FI-A30L70.
  • a BNT RNA vaccine composition (e.g., as described herein) to be administered in combination with a string vaccine composition (e.g., as described herein) may comprise an initial dose, e.g., the priming dose; and a follow up dose, e.g., a booster dose.
  • the priming dose and the booster dose are administered at an interval of 20 days.
  • such BNT RNA vaccine composition doses may be administered at an interval of 21 days.
  • such BNT RNA vaccine composition doses may be administered at an interval of 22 days.
  • such BNT RNA vaccine composition doses may be administered at an interval of 23 days.
  • such BNT RNA vaccine composition may be administered at an interval of 24 days. In some embodiments, such BNT RNA vaccine composition doses may be administered at an interval of 25 days. In some embodiments, such BNT RNA vaccine composition doses may be administered at an interval of 26 days. In some embodiments, such BNT RNA vaccine composition doses may be administered at an interval of 27 days. In some embodiments, such BNT RNA vaccine composition doses may be administered at an interval of 28 days.
  • such BNT RNA vaccine composition may be administered at an interval of longer than 28 days, e.g., including, e.g., every 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, 12 months, or longer.
  • a BNT RNA vaccine composition (e.g., as described herein) to be administered in combination with a string vaccine composition (e.g., as described herein)may comprise a modified RNA encoding a viral spike protein (e.g., a SARS CoV-2 S protein or an immunogenic fragment thereof (e.g., RBD)), in which one or more uridine nucleotide residues is replaced with a modified uridine nucleotide (e.g., 1-methylpseudouridine).
  • a viral spike protein e.g., a SARS CoV-2 S protein or an immunogenic fragment thereof (e.g., RBD)
  • uridine nucleotide residues e.g., 1-methylpseudouridine
  • the vaccine comprising a nucleotide sequence encoding a spike protein may be co-administered with an RNA vaccine comprising a string construct.
  • the vaccine comprising a nucleotide sequence encoding a spike protein vaccine is administered as an initial dose, followed by an RNA vaccine comprising a string construct comprising sequences encoding 2, 3, 4, 5, 6, 7, 8, 9, 10 or more epitopes from 2 or more viral proteins, as a follow up dose, a maintenance dose, a second dose, a third dose or as one or more booster doses.
  • a vaccine comprising a nucleotide sequence encoding a spike protein is administered as an initial dose, followed by an RNA vaccine comprising a string construct comprising sequences encoding 2, 3, 4, 5, 6, 7, 8, 9, 10 or more epitopes from 2 or more viral proteins as a follow up dose, a maintenance dose, a second dose, a third dose or as one or more booster doses.
  • an RNA vaccine comprising a string construct comprising sequences encoding 2, 3, 4, 5, 6, 7, 8, 9, 10 or more epitopes from 2 or more viral proteins is administered to a subject as an initial dose, followed by a vaccine comprising a nucleotide sequence encoding a spike protein as a follow up dose, a maintenance dose, a second dose, a third dose or as one or more booster doses.
  • the pharmaceutical composition comprising a string construct may comprise a coformulation vaccine.
  • the coformulation vaccine composition may comprise a first string vaccine at a first concentration, and a second string vaccine at a second concentration, and third string vaccine at a third concentration and so on.
  • a first string vaccine may comprise a vaccine comprising a nucleotide sequence encoding a spike protein.
  • a coformulation composition may comprise a first polynucleotide composition, comprising a nucleotide vaccine encoding a spike protein or fragment thereof.
  • the coformulation may comprise a first nucleotide sequence, having a structure m 2 7,3’- O Gppp(m 1 2’-O )ApG)-hAg-Kozak-S1S2-PP-FI-A30L70, as described above.
  • the coformulation may comprise a second composition comprising a RS C5, RS C6, RS C7, and RS C8 or a combination thereof. In some embodiments, the coformulation may comprise a second composition comprising a RS C1, RS C2, RS C3, and RS C4 or a combination thereof.
  • a first nucleotide sequence having a structure m 2 7,3’-O Gppp(m 1 2’-O )ApG)-hAg-Kozak-S1S2-PP-FI-A30L70 and a second nucleotide sequence having a RS C1, RS C2, RS C3, RS C4, RS C5, RS C6, RS C7, or RS C8 may be present at a ratio of 20:1, 19:1, 18:1, 17:1, 16:1, 15:1, 14:1, 13:1, 12:1, 11:1, 10:1, 9:1, 8:1, 7:1, 6:1, 5:1, 4:1, 3:1, 2:1 or 1:1.
  • the coformulation may comprise a second composition comprising a RS C1, RS C2, RS C3, and RS C4 or a combination thereof.
  • a first nucleotide sequence having a structure m 2 7,3’-OGppp(m 1 2’-O)ApG)-hAg-Kozak-S1S2-PP-FI-A30L70 and a second nucleotide sequence having a RS C1, RS C2, RS C3, RS C4, RS C5, RS C6, RS C7, or RS C8 may be present at a ratio of 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:11, 1:12, 1:13, 1:14, 1:15, 1:16, 1:17, 1:18, 1:19 or 1:20.
  • polynucleotides described herein may be encapsulated in lipid nanoparticles.
  • lipid nanoparticle may comprise one or more cationic or ionizable lipids.
  • such lipid nanoparticle may optionally comprise neutral lipids (e.g., phospholipids and/or sterols such as, e.g., cholesterol), and/or polymer-conjugated lipids, such as PEGylated lipids.
  • neutral lipids e.g., phospholipids and/or sterols such as, e.g., cholesterol
  • polymer-conjugated lipids such as PEGylated lipids.
  • a pharmaceutical composition comprising subject specific T cells may be generated ex vivo, where the subject specific T cell population may be responsive to at least one of the epitopes in Table 1A, Table IB, Table 1C, Table 2Ai, Table 2Aii, Table 2B, Table 9, Table 10, Table 11, Table 12, Table 14A, Table 14B, Table 15 or Table 16, or any antigen disclosed in the specification corresponding to a viral antigen.
  • PBMC from a subject may be isolated (e.g., from a leukapheresis sample), and incubated in the presence of one or more epitopes that are disclosed in any one of the tables (Table 1A, Table IB, Table 1C, Table 2Ai, Table 2Aii, Table 2B, Table 9, Table 10, Table 11, Table 12, Table 14A, Table 14B, Table 15 or Table 16)
  • the antigen may be selected based on the MHC peptides present in the subject, such that the antigen peptides have high affinity and presentation prediction score in combination with the MHC, based on the peptide: MHC pairs disclosed in Table 1A, Table IB, Table 1C, Table 2Ai, Table 2Aii, Table 2B, Table 9, Table 10, Table 11, Table 12, Table 14A, Table 14B, Table 15 or Table 16.
  • a pharmaceutical composition comprises: (i) a peptide comprising an epitope sequence selected from: NYNYFYRFF; KWPWYIWLGF; QYIKWPWYI; FPFNDGVYF; QPTESIVRF; IPFAMQMAY; YLQPRTFLL; and/or RLQSLQTYV; (h) a polynucleotide encoding the peptide; (iii) a T cell receptor (TCR) or a T cell comprising the TCR, wherein the TCR binds to the epitope sequence in complex with a corresponding MHC class I or class II molecule; (iv) an antigen presenting cell comprising (i) or (ii); or (v) an antibody or B cell comprising the antibody, wherein the antibody binds to the epitope sequence.
  • TCR T cell receptor
  • an antigen presenting cell comprising (i) or (ii); or (v) an antibody or B cell comprising the antibody, wherein the
  • a pharmaceutical composition comprising T cells may be generated ex vivo wherein the T cells may be responsive to an epitope sequence comprising or consisting of NYNYFYRFF, wherein in some embodiments the subject expresses an MHC protein encoded by HFA- A*2402.
  • a pharmaceutical composition comprising subject specific T cells may be generated ex vivo wherein the T cells may be responsive to an epitope sequence comprising or consisting of, KYIKWPWYI, wherein in some embodiments the subject expresses an MHC protein encoded by HLAA A*2402.
  • a pharmaceutical composition comprising subject specific T cells may be generated ex vivo wherein the T cells may be responsive to an epitope sequence comprising or consisting of KWPWYIWFGF, wherein in some embodiments the subject expresses an MHC protein encoded by HFA-A*2402.
  • a pharmaceutical composition comprising subject specific T cells may be generated ex vivo wherein the T cells may be responsive to an epitope sequence comprising or consisting of QYIKWPWYI, wherein in some embodiments the subject expresses an MHC protein encoded by HLA-A*2402.
  • a pharmaceutical composition comprising T cells may be generated ex vivo wherein the T cells may be responsive to an epitope sequence comprising or consisting of LPFNDGVYF, wherein in some embodiments the subject expresses an MHC protein encoded by HLA- B*3501.
  • a pharmaceutical composition comprising T cells may be generated ex vivo wherein the T cells may be responsive to an epitope sequence comprising or consisting of QPTESIVRF, wherein in some embodiments the subject expresses an MHC protein encoded by HLA- B*3501.
  • a pharmaceutical composition comprising T cells may be generated ex vivo wherein the T cells may be responsive to an epitope sequence comprising or consisting of, IPFAMQMAY, wherein in some embodiments the subject expresses an MHC protein encoded by HLA- B*3501.
  • a pharmaceutical composition comprising T cells may be generated ex vivo wherein the T cells may be responsive to an epitope sequence comprising or consisting of YLQPRTFLL, wherein in some embodiments the subject expresses an MHC protein encoded by HLA- A*0201.
  • a pharmaceutical composition comprising T cells may be generated ex vivo wherein the T cells may be responsive to an epitope sequence comprising or consisting of RLQSLQTYV, wherein in some embodiments the subject expresses an MHC protein encoded by HLA- A*0201.
  • a string vaccine may be formulated to be delivered in an aqueous solution systemically by injection to a subject.
  • the string vaccine may comprise one or more polynucleotides, such as RNA, such as mRNA.
  • the mRNA may be associated with one or more lipids.
  • the string vaccine may be co-formulated to comprise one or more strings, one or more spike mRNA vaccines and one or more strings comprising epitope sequences covering one or more of the other viral proteins, ORFlab, nucleocapsid, membrane protein or a combination thereof.
  • the vaccine is formulated for systemic injection, such as intramuscular, subcutaneous, intravenous, intraocular.
  • the string mRNA is contacted to a cell population, comprising antigen presenting cells and T cells.
  • the string mRNA is electroporated in a cell, such as an APC.
  • T cells are generated as described elsewhere within the application, that are primed with APCs expressing one or more strings.
  • any vaccine composition comprising the spike mRNA vaccine or a string vaccine or a string vaccine in combination with other therapeutics may be administered to a selected patient group, depending on the age, health condition, gender, medical histories, ethnicity in relation to disease propensity and outcome and so forth.
  • patient population may be categorized as high risk based on age, health condition, gender, medical histories, ethnicity in relation to disease propensity and outcome and so forth.
  • a therapeutic comprising a string vaccine or a string vaccine in combination with a second therapeutic may be administered to a patient population only if the patient population has been categorized as high risk.
  • a therapeutic comprising a string vaccine or a string vaccine in combination with a second therapeutic may be administered to a patient population only if the patient population has been categorized as low risk.
  • the vaccine composition, alone or in combination may be to patients of 19-55 years of age.
  • the vaccine composition, alone or in combination may be to patients of 12-65 years of age.
  • the vaccine composition, alone or in combination may be to patients of 12-35 years of age.
  • the vaccine composition, alone or in combination may be to patients of 19-35 years of age.
  • the vaccine composition, alone or in combination may be to patients of 35-55 years of age.
  • the vaccine composition, alone or in combination may be to patients of 40-65 years of age. In some embodiments, the vaccine composition, alone or in combination may be to patients of 65- 85 years of age. In some embodiments, the vaccine composition, alone or in combination may be to patients of age 12 or younger. In some embodiments, the vaccine composition, alone or in combination may be to patients of age 10 or younger. In some embodiments, the vaccine composition, alone or in combination may be to adolescent populations (e.g., individuals approximately 12 to approximately 17 years of age). In some embodiments, the vaccine composition, alone or in combination may be to a pediatric population.
  • the pediatric population comprises or consists of subjects under 18 years, e.g., 5 to less than 18 years of age, 12 to less than 18 years of age, 16 to less than 18 years of age, 12 to less than 16 years of age, or 5 to less than 12 years of age. In various embodiments, the pediatric population comprises or consists of subjects under 5 years, e.g., 2 to less than 5 years of age, 12 to less than 24 months of age, 7 to less than 12 months of age, or less than 6 months of age.
  • a therapeutic comprising a string vaccine or a string vaccine in combination with a second therapeutic may be administered to a patient who has one or more comorbidities, such as a chronic illness, e.g., cancer, diabetes, kidney disease or CFTR.
  • a therapeutic comprising a string vaccine or a string vaccine in combination with a second therapeutic may not be administered to a patient who has one or more comorbidities, such as a chronic illnesses.
  • a therapeutic comprising a string vaccine or a string vaccine in combination with a second therapeutic may be administered to subjects whose profession and/or environmental exposure may dramatically increase their risk of getting SARS CoV-2 infection (including, e.g., but not limited to mass transportation, prisoners, grocery store workers, residents in long-term care facilities, butchers or other meat processing workers, healthcare workers, and/or first responders, e.g., emergency responders).
  • a therapeutic comprising a string vaccine or a string vaccine in combination with a second therapeutic may be administered to healthcare workers and/or first responders, e.g., emergency responders.
  • a therapeutic comprising a string vaccine or a string vaccine in combination with a second therapeutic may be administered to those with a history of smoking or vaping (e.g., within 6 months, 12 months or more, including a history of chronic smoking or vaping).
  • a therapeutic comprising a string vaccine or a string vaccine in combination with a second therapeutic may be administered to certain ethnic groups that have been determined to be more susceptible to SARS CoV-2 infection.
  • a therapeutic comprising a string vaccine or a string vaccine in combination with a second therapeutic may be administered to certain populations with a blood type that may have been determined to more susceptible to SARS CoV-2 infection.
  • a therapeutic comprising a string vaccine or a string vaccine in combination with a second therapeutic may be administered to immunocompromised subjects (e.g., those with HIV/AIDS; cancer and transplant patients who are taking certain immunosuppressive drugs; autoimmune diseases or other physiological conditions expected to warrant immunosuppressive therapy (e.g., within 3 months, within 6 months, or more); and those with inherited diseases that affect the immune system (e.g., congenital agammaglobulinemia, congenital IgA deficiency)).
  • a therapeutic comprising a string vaccine or a string vaccine in combination with a second therapeutic may be administered to those with an infectious disease.
  • a therapeutic comprising a string vaccine or a string vaccine in combination with a second therapeutic may be administered to those infected with human immunodeficiency virus (HIV) and/or a hepatitis virus (e.g., HBV, HCV).
  • HBV human immunodeficiency virus
  • a hepatitis virus e.g., HBV, HCV
  • a therapeutic comprising a string vaccine or a string vaccine in combination with a second therapeutic may be administered to those with underlying medical conditions.
  • Examples of such underlying medical conditions may include, but are not limited to hypertension, cardiovascular disease, diabetes, chronic respiratory disease, e.g., chronic pulmonary disease, asthma, etc., cancer, and other chronic diseases such as, e.g., lupus, rheumatoid arthritis, chronic liver diseases, chronic kidney diseases (e.g., Stage 3 or worse such as in some embodiments as characterized by a glomerular filtration rate (GFR) of less than 60 mL/min/1.73m2).
  • GFR glomerular filtration rate
  • a therapeutic comprising a string vaccine or a string vaccine in combination with a second therapeutic may be administered to overweight or obese subjects, e.g., specifically including those with a body mass index (BMI) above about 30 kg/m2.
  • BMI body mass index
  • a therapeutic comprising a string vaccine or a string vaccine in combination with a second therapeutic may be administered to subjects who have prior diagnosis of COVID-19 or evidence of current or prior SARS CoV-2 infection, e.g., based on serology or nasal swab.
  • the string vaccine described herein may confer resistance, cross protection and generate immunogenicity against other SARS viruses or to a variety of viral strains having similarity to the 2019 SARS-Cov 2.
  • kits [000378] The viral epitope therapeutic described herein can be provided in kit form together with instructions for administration. Typically, the kit would include the desired antigen therapeutic in a container, in unit dosage form and instructions for administration. Additional therapeutics, for example, cytokines, lymphokines, checkpoint inhibitors, antibodies, can also be included in the kit. Other kit components that can also be desirable include, for example, a sterile syringe, booster dosages, and other desired excipients.
  • a polypeptide comprising at least two of the following (a) a sequence comprising an epitope sequence from ORFlab, (b) a sequence comprising an epitope sequence from membrane glycoprotein (M) and (c) a sequence comprising an epitope sequence from nucleocapsid phosphoprotein (N);
  • TCR T cell receptor
  • an antigen presenting cell comprising (i) or (ii); or
  • an antibody or B cell comprising the antibody, wherein the antibody binds to an epitope sequence of the polypeptide; and a pharmaceutically acceptable excipient.
  • composition in one embodiment comprises (a) a sequence comprising an epitope sequence from ORFlab, (b) a sequence comprising an epitope sequence from membrane glycoprotein (M) and (c) a sequence comprising an epitope sequence from nucleocapsid phosphoprotein (N).
  • composition of the embodiment, wherein the sequence comprising an epitope sequence from ORFlab is C-terminal to the sequence comprising an epitope sequence from nucleocapsid phosphoprotein (N).
  • composition of the embodiment, wherein the sequence comprising an epitope sequence from ORFlab is N-terminal to the sequence comprising an epitope sequence from membrane glycoprotein (M).
  • composition of the embodiment wherein the sequence comprising an epitope sequence from nucleocapsid phosphoprotein (N) is N-terminal to the sequence comprising an epitope sequence from membrane glycoprotein (M). 6. The composition of the embodiment, wherein the composition comprises (a) 2, 3, 4, 5, 6, 7, 8, 9 or 10 or more epitope sequence from ORFlab, (b) a sequence comprising an epitope sequence from membrane glycoprotein (M) and (c) a sequence comprising an epitope sequence from nucleocapsid phosphoprotein (N).
  • composition of the embodiments above, wherein the epitope sequence from ORFlab is an epitope sequence from a non-structural protein.
  • composition of the embodiments above, wherein the non-structural protein is selected from the group consisting of NSP1, NSP2, NSP3, NSP4 and combinations thereof.
  • composition of the embodiments above, wherein the polypeptide comprises a sequence comprising an epitope sequence from NSP1, a sequence comprising an epitope sequence from NSP2, a sequence comprising an epitope sequence from NSP3 and a sequence comprising an epitope sequence from NSP4.
  • composition of the embodiments above, wherein the epitope sequence from ORFlab is selected from the group consisting of YLFDESGEFKL, YLFDESGEF, FGDDTVIEV, QLMCQPILL, TTDPSFLGRY, PTDNYITTY, PSFLGRY, AEAELAKNV, KTIQPRVEK and any combination thereof.
  • composition of the embodiments above, wherein the epitope sequence from nucleocapsid glycoprotein (N) is LLLDRLNQL.
  • composition of the embodiments above, wherein the epitope sequence from membrane phosphoprotein (M) is VATSRTLSY.
  • composition of the embodiments above, wherein the polypeptide comprises an epitope sequence from nucleocapsid glycoprotein (N) that is LLLDRLNQL and an epitope sequence from membrane phosphoprotein (M) that is VATSRTLSY.
  • composition of the embodiments above, wherein the polypeptide comprises (a) each of the following epitope sequences from ORFlab: YLFDESGEFKL, YLFDESGEF, FGDDTVIEV, QLMCQPILL, TTDPSFLGRY, PTDNYITTY, PSFLGRY, AEAELAKNV, KTIQPRVEK; (b) an epitope sequence from nucleocapsid glycoprotein (N) that is LLLDRLNQL; and (c) an epitope sequence from membrane phosphoprotein (M) that is VATSRTLSY.
  • ORFlab YLFDESGEFKL, YLFDESGEF, FGDDTVIEV, QLMCQPILL, TTDPSFLGRY, PTDNYITTY, PSFLGRY, AEAELAKNV, KTIQPRVEK
  • N nucleocapsid glycoprotein
  • M membrane phosphoprotein
  • composition of the embodiments above, wherein the sequence comprising an epitope sequence from ORFlab is selected from the group consisting of the following sequences or fragments thereof: MVTNNTFTLKVPHVGEIPVAYRKVLLKTIQPRVEKYLFDESGEFKLSEVGPEHSLAEYYIFFASFYY; MVTNNTFTLKVPHVGEIPVAYRKVLLKTIQPRVEKYLFDESGEFKLSEVGPEHSLAEY; APKEIIFLEGETLFGDDTVIEVAIILASFSAST;
  • composition of the embodiments above, wherein the sequence comprising an epitope sequence from membrane glycoprotein (M) is selected from the group consisting of the following sequences or fragments thereof: ADSNGTITVEELKKLLEQWNLVIGFLFLTWICLLQFAYANRNRFLYIIKLIFLWLLWPVTLACFVLAA VYRINWITGGIAIAMACLVGLMWLSYFIASFRLFARTRSMWSFNPETNILLNVPLHGTILTRPLLESEL VIGAVILRGHLRIAGHHLGRCDIKDLPKEITVATSRTLSYYKLGASQRVAGDSGFAAYSRYRIGNYKL NTDHS S S S DNI ALL V Q ;

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Virology (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Organic Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Immunology (AREA)
  • Communicable Diseases (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Epidemiology (AREA)
  • Microbiology (AREA)
  • Molecular Biology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Mycology (AREA)
  • Oncology (AREA)
  • Pulmonology (AREA)
  • Genetics & Genomics (AREA)
  • Zoology (AREA)
  • Biochemistry (AREA)
  • Wood Science & Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Peptides Or Proteins (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicinal Preparation (AREA)
PCT/US2021/023267 2020-03-20 2021-03-19 Coronavirus vaccines and methods of use Ceased WO2021188969A2 (en)

Priority Applications (11)

Application Number Priority Date Filing Date Title
EP21772515.9A EP4121104A4 (en) 2020-03-20 2021-03-19 CORONAVIRUS VACCINES AND METHOD OF USE
CN202180034574.9A CN116710126A (zh) 2020-03-20 2021-03-19 冠状病毒疫苗和使用方法
BR112022018819A BR112022018819A2 (pt) 2020-03-20 2021-03-19 Vacinas contra coronavírus e métodos de uso
AU2021237720A AU2021237720A1 (en) 2020-03-20 2021-03-19 Coronavirus vaccines and methods of use
US17/912,841 US20230141371A1 (en) 2020-03-20 2021-03-19 Coronavirus vaccines and methods of use
MX2022011671A MX2022011671A (es) 2020-03-20 2021-03-19 Vacunas contra el coronavirus y metodos de uso.
CA3172315A CA3172315A1 (en) 2020-03-20 2021-03-19 Coronavirus vaccines and methods of use
JP2022557136A JP2023518821A (ja) 2020-03-20 2021-03-19 コロナウイルスのワクチンと使用方法
IL296617A IL296617A (en) 2020-03-20 2021-03-19 Vaccines against the corona virus and methods of use
KR1020227036217A KR20230004508A (ko) 2020-03-20 2021-03-19 코로나바이러스 백신 및 사용 방법
US17/481,781 US20230083931A1 (en) 2020-03-20 2021-09-22 Coronavirus vaccines and methods of use

Applications Claiming Priority (10)

Application Number Priority Date Filing Date Title
US202062992666P 2020-03-20 2020-03-20
US62/992,666 2020-03-20
US202063026559P 2020-05-18 2020-05-18
US63/026,559 2020-05-18
US202063059582P 2020-07-31 2020-07-31
US63/059,582 2020-07-31
US202063086519P 2020-10-01 2020-10-01
US63/086,519 2020-10-01
US202063122904P 2020-12-08 2020-12-08
US63/122,904 2020-12-08

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US17/481,781 Continuation-In-Part US20230083931A1 (en) 2020-03-20 2021-09-22 Coronavirus vaccines and methods of use

Publications (2)

Publication Number Publication Date
WO2021188969A2 true WO2021188969A2 (en) 2021-09-23
WO2021188969A3 WO2021188969A3 (en) 2021-11-25

Family

ID=77771752

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2021/023267 Ceased WO2021188969A2 (en) 2020-03-20 2021-03-19 Coronavirus vaccines and methods of use

Country Status (11)

Country Link
US (2) US20230141371A1 (https=)
EP (1) EP4121104A4 (https=)
JP (1) JP2023518821A (https=)
KR (1) KR20230004508A (https=)
AU (1) AU2021237720A1 (https=)
BR (1) BR112022018819A2 (https=)
CA (1) CA3172315A1 (https=)
IL (1) IL296617A (https=)
MX (1) MX2022011671A (https=)
TW (1) TW202200199A (https=)
WO (1) WO2021188969A2 (https=)

Cited By (48)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN112029781A (zh) * 2020-08-14 2020-12-04 中山大学 一种新型冠状病毒SARS-CoV-2的安全型复制子系统及其应用
CN113981140A (zh) * 2021-10-09 2022-01-28 广州达安基因股份有限公司 新型冠状病毒德尔塔突变株的检测方法及核酸检测试剂盒
JPWO2022025264A1 (https=) * 2020-07-31 2022-02-03
US20220042992A1 (en) * 2020-08-05 2022-02-10 The Translational Genomics Research Institute Compositions and methods for detection and treatment of coronavirus infection
US20220047696A1 (en) * 2020-08-11 2022-02-17 Zoetis Services Llc Anti-coronavirus vaccines
US20220088180A1 (en) * 2020-08-31 2022-03-24 The Broad Institute, Inc. Immunogenic compositions and use thereof
CN114686620A (zh) * 2022-01-21 2022-07-01 生物岛实验室 新型冠状病毒多种变异株核酸质谱检测的引物组合、试剂盒及检测方法
CN114729373A (zh) * 2022-01-27 2022-07-08 深圳市瑞吉生物科技有限公司 一种新型冠状病毒mRNA疫苗及其制备方法与应用
US20220242916A1 (en) * 2021-01-29 2022-08-04 Toagosei Co., Ltd. Amino Acid Sequence Derived from Sars-Cov-2 and Use Thereof
CN114907453A (zh) * 2022-04-08 2022-08-16 国科宁波生命与健康产业研究院 一种用于治疗SARS-CoV-2病毒感染的S蛋白多肽
WO2022178591A1 (en) * 2021-02-24 2022-09-01 Biotome Pty Ltd Peptides and their use in diagnosis of sars-cov-2 infection
US20220273820A1 (en) * 2020-04-22 2022-09-01 BioNTech SE Rna constructs and uses thereof
WO2022214595A1 (en) * 2021-04-07 2022-10-13 Iama France Sars-cov-2 polypeptides and uses thereof
WO2022268916A3 (en) * 2021-06-23 2023-03-02 Ose Immunotherapeutics Pan-coronavirus peptide vaccine
WO2023044542A1 (en) * 2021-09-24 2023-03-30 The University Of Adelaide Sars cov-2 vaccine
WO2023049983A1 (en) * 2021-09-28 2023-04-06 Medicago Inc. Cpmv vlps displaying sars-cov-2 epitopes
WO2023067193A2 (en) 2021-10-22 2023-04-27 BioNTech SE Compositions for administration of different doses of rna
WO2023069498A1 (en) 2021-10-22 2023-04-27 Senda Biosciences, Inc. Mrna vaccine composition
WO2023066496A1 (en) * 2021-10-21 2023-04-27 BioNTech SE Coronavirus vaccine
WO2023096858A1 (en) 2021-11-23 2023-06-01 Senda Biosciences, Inc. A bacteria-derived lipid composition and use thereof
WO2023104154A1 (zh) * 2021-12-08 2023-06-15 安达生物药物开发(深圳)有限公司 抗原性多肽及其用途
WO2023122080A1 (en) 2021-12-20 2023-06-29 Senda Biosciences, Inc. Compositions comprising mrna and lipid reconstructed plant messenger packs
WO2023144779A1 (en) * 2022-01-28 2023-08-03 Pfizer Inc. Coronavirus antigen variants
WO2023147091A1 (en) * 2022-01-28 2023-08-03 BioNTech SE Coronavirus vaccine
WO2023152513A1 (en) * 2022-02-11 2023-08-17 Virax Biolabs (UK) Limited Peptides for use in assessing the status of the immune system
WO2023096896A3 (en) * 2021-11-23 2023-08-17 nference, inc. Detection of covid-19 associated cardiac injury and vaccine-associated myocarditis
WO2023166061A1 (en) * 2022-03-02 2023-09-07 ISR Immune System Regulation Holding AB (publ) Vaccine composition comprising an antigen and a tlr3 agonist
US20230287090A1 (en) * 2020-09-02 2023-09-14 The Feinstein Institutes For Medical Research USE OF SARS-CoV-2 RECEPTOR BINDING MOTIF (RBM)-REACTIVE MONOCLONAL ANTIBODIES TO TREAT COVID-19
WO2023169506A1 (zh) * 2022-03-09 2023-09-14 中生复诺健生物科技(上海)有限公司 编码新型冠状病毒S蛋白的mRNA疫苗
WO2023213990A1 (en) 2022-05-05 2023-11-09 Etherna Immunotherapies Nv Multi-epitope construct
WO2023154734A3 (en) * 2022-02-08 2023-12-14 Iowa State University Research Foundation, Inc. Mrna expression and delivery systems
WO2024002985A1 (en) 2022-06-26 2024-01-04 BioNTech SE Coronavirus vaccine
AU2022204350B2 (en) * 2020-11-12 2024-05-16 Ahs Hospital Corp. SARS-CoV-2 immunodominant peptide constructs and uses thereof
US12005114B2 (en) 2021-04-08 2024-06-11 Vaxthera Sas Coronavirus vaccine comprising a mosaic protein
WO2024123139A1 (ko) * 2022-12-09 2024-06-13 주식회사 나이벡 타겟 세포 내로 올리고뉴클레오티드를 전달하기 위한 펩타이드 기반 결합체를 포함하는 나노입자 및 이를 포함하는 약학적 조성물
WO2024123134A1 (ko) * 2022-12-09 2024-06-13 서울대학교산학협력단 B 세포 및 t 세포 내로 mrna를 전달하기 위한 펩타이드 기반 결합체를 포함하는 나노입자 및 이의 용도
WO2024130254A3 (en) * 2022-12-16 2024-07-18 Geneius Biotechnology, Inc. A multi-antigenic rna sars-cov-2 vaccine and associated methods
LU103079B1 (en) * 2023-02-28 2024-08-28 PMCR GmbH IMMUNIZATION AGAINST VIRAL INFECTIONS DISEASE(S)
WO2024176192A1 (en) 2023-02-24 2024-08-29 BioNTech SE Immunogenic compositions
WO2024177525A3 (en) * 2023-02-22 2024-09-19 Instytut Immunologii I Terapii Pan An epitope originating from sars-cov-2 n protein, an antigen containing the epitope, uses thereof and a method for detecting disease caused by coronavirus
WO2024186803A3 (en) * 2023-03-06 2024-10-24 Akston Biosciences Corporation Nucleocapsid antigen immunotherapy for covid-19 fusion proteins and methods of use
CN119144611A (zh) * 2024-09-19 2024-12-17 宁夏农林科学院枸杞科学研究所 黑果枸杞LrCHS2基因及其编码蛋白在促进枸杞花青素生物合成中的应用
WO2024263826A1 (en) * 2023-06-22 2024-12-26 Modernatx, Inc. Sars-cov-2 t cell vaccines
US12186387B2 (en) 2021-11-29 2025-01-07 BioNTech SE Coronavirus vaccine
WO2025106738A1 (en) 2023-11-15 2025-05-22 BioNTech SE Sars-cov-2 immunogenic compositions
WO2025106754A1 (en) 2023-11-15 2025-05-22 BioNTech SE Coronavirus vaccine
EP4322995A4 (en) * 2021-04-12 2025-09-24 La Jolla Inst For Immunology CORONAVIRUS T-CELL EPITOPES AND RELATED USES
US12577589B2 (en) 2020-02-14 2026-03-17 Geovax, Inc. Vaccines and uses thereof to induce an immune response to SARS-CoV2

Families Citing this family (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20230184764A1 (en) * 2020-04-06 2023-06-15 The Trustees Of Columbia University In The City Of New York Peptide sequences for detection and differentiation of antibody responses to sars-cov-2 and other human corona viruses
US12558415B2 (en) * 2020-04-14 2026-02-24 The Regents Of The University Of California Broad-spectrum multi-antigen pan-coronavirus vaccine
US20230241202A1 (en) * 2020-05-29 2023-08-03 University Of Pittsburgh - Of The Commonwealth System Of Higher Education Adenovirus-Based SARS-CoV-2 Vaccine
US20230263883A1 (en) * 2020-07-08 2023-08-24 The Brigham And Women`S Hospital, Inc. Severe Acute Respiratory Syndrome Coronavirus 2 (SARS CoV-2) Peptide Epitopes
US20220356212A1 (en) * 2021-03-26 2022-11-10 Nanogen Pharmaceutical Biotechnology JSC Modified spike protein and method of treatment
CN114907452B (zh) * 2022-04-08 2023-07-25 国科宁波生命与健康产业研究院 一种用于治疗SARS-CoV-2病毒感染的M蛋白多肽
CN114907454A (zh) * 2022-04-08 2022-08-16 国科宁波生命与健康产业研究院 一种用于治疗SARS-CoV-2病毒感染的N蛋白多肽
WO2025101631A2 (en) * 2023-11-07 2025-05-15 BioNTech SE Compositions and methods for preparing vaccines
CN118955657B (zh) * 2024-01-09 2025-03-04 中山大学 一种特异性表位多肽及其试剂盒和应用
WO2025164815A1 (ko) * 2024-01-29 2025-08-07 주식회사 나이벡 안지오텐신전환효소 2(ace2)에 대한 결합능이 있는 신규한 펩타이드 및 이의 용도
CN120081914A (zh) * 2025-01-03 2025-06-03 中国人民解放军军事科学院军事医学研究院 一种HLA-C限制性SARS-CoV-2淋巴细胞抗原表位肽及其应用

Family Cites Families (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2005012337A2 (en) * 2003-07-15 2005-02-10 Crucell Holland B.V. Antigenic peptides of sars coronavirus and uses thereof
US20050106563A1 (en) * 2003-09-08 2005-05-19 Genesis Biotech Inc. Epitope profiles of SARS coronavirus
CN100408595C (zh) * 2003-12-31 2008-08-06 第二军医大学免疫学研究所 Sars病毒hla-a2限制性表位多肽及其应用
CN101085812B (zh) * 2006-06-08 2010-12-01 中国科学院上海生命科学研究院 一种sars冠状病毒多肽抗原及其应用
JP5686370B2 (ja) * 2008-11-28 2015-03-18 日油株式会社 Sarsコロナウイルスの細胞傷害性t細胞エピトープペプチド及びその用途
BR112014013745B1 (pt) * 2011-12-09 2022-06-14 Institut Pasteur Método de teste in vitro, kit de detecção e seu uso, método in vitro de diagnóstico, método de fabricação de kit, e teste de imunosseleção multiplex
EP3325646B1 (en) * 2015-07-22 2020-08-19 F.Hoffmann-La Roche Ag Identification of antigen epitopes and immune sequences recognizing the antigens

Cited By (63)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12577589B2 (en) 2020-02-14 2026-03-17 Geovax, Inc. Vaccines and uses thereof to induce an immune response to SARS-CoV2
US11925694B2 (en) 2020-04-22 2024-03-12 BioNTech SE Coronavirus vaccine
US11951185B2 (en) 2020-04-22 2024-04-09 BioNTech SE RNA constructs and uses thereof
US11547673B1 (en) 2020-04-22 2023-01-10 BioNTech SE Coronavirus vaccine
US12133899B2 (en) 2020-04-22 2024-11-05 BioNTech SE Coronavirus vaccine
US11779659B2 (en) 2020-04-22 2023-10-10 BioNTech SE RNA constructs and uses thereof
US20220273820A1 (en) * 2020-04-22 2022-09-01 BioNTech SE Rna constructs and uses thereof
JPWO2022025264A1 (https=) * 2020-07-31 2022-02-03
US20220042992A1 (en) * 2020-08-05 2022-02-10 The Translational Genomics Research Institute Compositions and methods for detection and treatment of coronavirus infection
US12247978B2 (en) * 2020-08-05 2025-03-11 Arizona Board Of Regents On Behalf Of Northern Arizona University Compositions and methods for detection and treatment of coronavirus infection
US20220047696A1 (en) * 2020-08-11 2022-02-17 Zoetis Services Llc Anti-coronavirus vaccines
US12285479B2 (en) * 2020-08-11 2025-04-29 Zoetis Services Llc Anti-coronavirus vaccines
CN112029781A (zh) * 2020-08-14 2020-12-04 中山大学 一种新型冠状病毒SARS-CoV-2的安全型复制子系统及其应用
US12419948B2 (en) * 2020-08-31 2025-09-23 The Broad Institute, Inc. Immunogenic compositions and use thereof
US20220088180A1 (en) * 2020-08-31 2022-03-24 The Broad Institute, Inc. Immunogenic compositions and use thereof
US20230287090A1 (en) * 2020-09-02 2023-09-14 The Feinstein Institutes For Medical Research USE OF SARS-CoV-2 RECEPTOR BINDING MOTIF (RBM)-REACTIVE MONOCLONAL ANTIBODIES TO TREAT COVID-19
AU2022204350B2 (en) * 2020-11-12 2024-05-16 Ahs Hospital Corp. SARS-CoV-2 immunodominant peptide constructs and uses thereof
US12285476B2 (en) * 2021-01-29 2025-04-29 Toagosei Co., Ltd. Amino acid sequence derived from S protein of SARS-CoV2 for generating an anti-SARS-CoV-2 antibody
US20220242916A1 (en) * 2021-01-29 2022-08-04 Toagosei Co., Ltd. Amino Acid Sequence Derived from Sars-Cov-2 and Use Thereof
WO2022178591A1 (en) * 2021-02-24 2022-09-01 Biotome Pty Ltd Peptides and their use in diagnosis of sars-cov-2 infection
WO2022214595A1 (en) * 2021-04-07 2022-10-13 Iama France Sars-cov-2 polypeptides and uses thereof
US12005114B2 (en) 2021-04-08 2024-06-11 Vaxthera Sas Coronavirus vaccine comprising a mosaic protein
EP4322995A4 (en) * 2021-04-12 2025-09-24 La Jolla Inst For Immunology CORONAVIRUS T-CELL EPITOPES AND RELATED USES
WO2022268916A3 (en) * 2021-06-23 2023-03-02 Ose Immunotherapeutics Pan-coronavirus peptide vaccine
WO2023044542A1 (en) * 2021-09-24 2023-03-30 The University Of Adelaide Sars cov-2 vaccine
WO2023049983A1 (en) * 2021-09-28 2023-04-06 Medicago Inc. Cpmv vlps displaying sars-cov-2 epitopes
CN113981140B (zh) * 2021-10-09 2024-02-27 广州达安基因股份有限公司 新型冠状病毒德尔塔突变株的检测方法及核酸检测试剂盒
CN113981140A (zh) * 2021-10-09 2022-01-28 广州达安基因股份有限公司 新型冠状病毒德尔塔突变株的检测方法及核酸检测试剂盒
WO2023066496A1 (en) * 2021-10-21 2023-04-27 BioNTech SE Coronavirus vaccine
EP4238577A2 (en) 2021-10-22 2023-09-06 BioNTech SE Compositions for administration of different doses of rna
WO2023069498A1 (en) 2021-10-22 2023-04-27 Senda Biosciences, Inc. Mrna vaccine composition
WO2023067193A2 (en) 2021-10-22 2023-04-27 BioNTech SE Compositions for administration of different doses of rna
WO2023096896A3 (en) * 2021-11-23 2023-08-17 nference, inc. Detection of covid-19 associated cardiac injury and vaccine-associated myocarditis
WO2023096858A1 (en) 2021-11-23 2023-06-01 Senda Biosciences, Inc. A bacteria-derived lipid composition and use thereof
US12208136B2 (en) 2021-11-29 2025-01-28 BioNTech SE Coronavirus vaccine
US12186387B2 (en) 2021-11-29 2025-01-07 BioNTech SE Coronavirus vaccine
WO2023104154A1 (zh) * 2021-12-08 2023-06-15 安达生物药物开发(深圳)有限公司 抗原性多肽及其用途
WO2023122080A1 (en) 2021-12-20 2023-06-29 Senda Biosciences, Inc. Compositions comprising mrna and lipid reconstructed plant messenger packs
CN114686620A (zh) * 2022-01-21 2022-07-01 生物岛实验室 新型冠状病毒多种变异株核酸质谱检测的引物组合、试剂盒及检测方法
CN114686620B (zh) * 2022-01-21 2024-05-07 生物岛实验室 新型冠状病毒多种变异株核酸质谱检测的引物组合、试剂盒及检测方法
CN114729373A (zh) * 2022-01-27 2022-07-08 深圳市瑞吉生物科技有限公司 一种新型冠状病毒mRNA疫苗及其制备方法与应用
WO2023147092A3 (en) * 2022-01-28 2023-08-31 BioNTech SE Coronavirus vaccine
WO2023147091A1 (en) * 2022-01-28 2023-08-03 BioNTech SE Coronavirus vaccine
WO2023144779A1 (en) * 2022-01-28 2023-08-03 Pfizer Inc. Coronavirus antigen variants
WO2023154734A3 (en) * 2022-02-08 2023-12-14 Iowa State University Research Foundation, Inc. Mrna expression and delivery systems
WO2023152513A1 (en) * 2022-02-11 2023-08-17 Virax Biolabs (UK) Limited Peptides for use in assessing the status of the immune system
WO2023166061A1 (en) * 2022-03-02 2023-09-07 ISR Immune System Regulation Holding AB (publ) Vaccine composition comprising an antigen and a tlr3 agonist
WO2023169506A1 (zh) * 2022-03-09 2023-09-14 中生复诺健生物科技(上海)有限公司 编码新型冠状病毒S蛋白的mRNA疫苗
CN114907453A (zh) * 2022-04-08 2022-08-16 国科宁波生命与健康产业研究院 一种用于治疗SARS-CoV-2病毒感染的S蛋白多肽
WO2023213990A1 (en) 2022-05-05 2023-11-09 Etherna Immunotherapies Nv Multi-epitope construct
WO2024002985A1 (en) 2022-06-26 2024-01-04 BioNTech SE Coronavirus vaccine
US11878055B1 (en) 2022-06-26 2024-01-23 BioNTech SE Coronavirus vaccine
WO2024123134A1 (ko) * 2022-12-09 2024-06-13 서울대학교산학협력단 B 세포 및 t 세포 내로 mrna를 전달하기 위한 펩타이드 기반 결합체를 포함하는 나노입자 및 이의 용도
WO2024123139A1 (ko) * 2022-12-09 2024-06-13 주식회사 나이벡 타겟 세포 내로 올리고뉴클레오티드를 전달하기 위한 펩타이드 기반 결합체를 포함하는 나노입자 및 이를 포함하는 약학적 조성물
WO2024130254A3 (en) * 2022-12-16 2024-07-18 Geneius Biotechnology, Inc. A multi-antigenic rna sars-cov-2 vaccine and associated methods
WO2024177525A3 (en) * 2023-02-22 2024-09-19 Instytut Immunologii I Terapii Pan An epitope originating from sars-cov-2 n protein, an antigen containing the epitope, uses thereof and a method for detecting disease caused by coronavirus
WO2024176192A1 (en) 2023-02-24 2024-08-29 BioNTech SE Immunogenic compositions
LU103079B1 (en) * 2023-02-28 2024-08-28 PMCR GmbH IMMUNIZATION AGAINST VIRAL INFECTIONS DISEASE(S)
WO2024186803A3 (en) * 2023-03-06 2024-10-24 Akston Biosciences Corporation Nucleocapsid antigen immunotherapy for covid-19 fusion proteins and methods of use
WO2024263826A1 (en) * 2023-06-22 2024-12-26 Modernatx, Inc. Sars-cov-2 t cell vaccines
WO2025106754A1 (en) 2023-11-15 2025-05-22 BioNTech SE Coronavirus vaccine
WO2025106738A1 (en) 2023-11-15 2025-05-22 BioNTech SE Sars-cov-2 immunogenic compositions
CN119144611A (zh) * 2024-09-19 2024-12-17 宁夏农林科学院枸杞科学研究所 黑果枸杞LrCHS2基因及其编码蛋白在促进枸杞花青素生物合成中的应用

Also Published As

Publication number Publication date
KR20230004508A (ko) 2023-01-06
MX2022011671A (es) 2023-01-24
CA3172315A1 (en) 2021-09-23
EP4121104A4 (en) 2025-12-17
BR112022018819A2 (pt) 2022-11-29
EP4121104A2 (en) 2023-01-25
US20230083931A1 (en) 2023-03-16
JP2023518821A (ja) 2023-05-08
US20230141371A1 (en) 2023-05-11
IL296617A (en) 2022-11-01
AU2021237720A1 (en) 2022-11-17
WO2021188969A3 (en) 2021-11-25
TW202200199A (zh) 2022-01-01

Similar Documents

Publication Publication Date Title
AU2021237720A1 (en) Coronavirus vaccines and methods of use
US20230405102A1 (en) Neoantigens and methods of their use
JP7754971B2 (ja) ネオ抗原およびそれらの使用
US12303561B2 (en) Protein antigens and uses thereof
JP6780852B2 (ja) B型肝炎ウイルス感染に対する治療ワクチン接種のための合成長鎖ペプチド(slp)
WO2023049272A1 (en) Coronavirus vaccines and methods of use
KR20240163165A (ko) 에피토프의 조합과 그의 용도, 백신 구조물, 면역 반응의 유도 방법 에피토프의 식별 방법
CN116710126A (zh) 冠状病毒疫苗和使用方法
US20200197439A1 (en) Immunotherapy for polyomaviruses
WO2020145901A1 (en) Use of hla-a*11:01-restricted hepatitis b virus (hbv) peptides for identifying hbv-specific cd8+ t cells
WO2023240085A1 (en) Viral peptides and uses thereof
NL2034658B1 (en) TIMP3-derived TEIPP neoantigens and uses thereof
NL2034657B1 (en) RCN1-derived TEIPP neoantigens and uses thereof
WO2025136809A2 (en) Foxp3 peptides and uses thereof
KR20240110821A (ko) SARS-CoV-2로 인한 질병의 예방적 및 치료적 처치에 사용하기 위한 면역원성 작제물 및 백신
RU2773273C2 (ru) Неоантигены и способы их использования
CN118742321A (zh) 用于预防性和治疗性治疗由SARS-CoV-2引起的疾病的免疫原性构建体和疫苗

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21772515

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 3172315

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2022557136

Country of ref document: JP

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112022018819

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: 2021772515

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2021772515

Country of ref document: EP

Effective date: 20221020

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 202180034574.9

Country of ref document: CN

ENP Entry into the national phase

Ref document number: 2021237720

Country of ref document: AU

Date of ref document: 20210319

Kind code of ref document: A

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21772515

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 112022018819

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20220920

WWW Wipo information: withdrawn in national office

Ref document number: 2022127117

Country of ref document: RU

WWW Wipo information: withdrawn in national office

Ref document number: 2021772515

Country of ref document: EP