WO2021183827A2 - Bacterial host strains - Google Patents

Bacterial host strains Download PDF

Info

Publication number
WO2021183827A2
WO2021183827A2 PCT/US2021/022002 US2021022002W WO2021183827A2 WO 2021183827 A2 WO2021183827 A2 WO 2021183827A2 US 2021022002 W US2021022002 W US 2021022002W WO 2021183827 A2 WO2021183827 A2 WO 2021183827A2
Authority
WO
WIPO (PCT)
Prior art keywords
engineered
host cell
coli host
coli
seq
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2021/022002
Other languages
English (en)
French (fr)
Other versions
WO2021183827A3 (en
Inventor
James A. Williams
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Nature Technology Corp
Original Assignee
Nature Technology Corp
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CA3170890A priority Critical patent/CA3170890A1/en
Priority to EP21768967.8A priority patent/EP4118213A4/en
Priority to AU2021233908A priority patent/AU2021233908A1/en
Priority to JP2022554786A priority patent/JP7833134B2/ja
Priority to KR1020227034771A priority patent/KR20220153606A/ko
Priority to CN202180029390.3A priority patent/CN115461463A/zh
Application filed by Nature Technology Corp filed Critical Nature Technology Corp
Publication of WO2021183827A2 publication Critical patent/WO2021183827A2/en
Publication of WO2021183827A3 publication Critical patent/WO2021183827A3/en
Priority to US17/931,000 priority patent/US20230132250A1/en
Anticipated expiration legal-status Critical
Priority to JP2025200458A priority patent/JP2026048673A/ja
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/70Vectors or expression systems specially adapted for E. coli
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/24Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Enterobacteriaceae (F), e.g. Citrobacter, Serratia, Proteus, Providencia, Morganella, Yersinia
    • C07K14/245Escherichia (G)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N1/00Microorganisms; Compositions thereof; Processes of propagating, maintaining or preserving microorganisms or compositions thereof; Processes of preparing or isolating a composition containing a microorganism; Culture media therefor
    • C12N1/20Bacteria; Culture media therefor
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/635Externally inducible repressor mediated regulation of gene expression, e.g. tetR inducible by tetracyline
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/15011Lentivirus, not HIV, e.g. FIV, SIV
    • C12N2740/15041Use of virus, viral particle or viral elements as a vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/15011Lentivirus, not HIV, e.g. FIV, SIV
    • C12N2740/15051Methods of production or purification of viral material
    • C12N2740/15052Methods of production or purification of viral material relating to complementing cells and packaging systems for producing virus or viral particles
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011Details
    • C12N2750/14011Parvoviridae
    • C12N2750/14111Dependovirus, e.g. adenoassociated viruses
    • C12N2750/14141Use of virus, viral particle or viral elements as a vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011Details
    • C12N2750/14011Parvoviridae
    • C12N2750/14111Dependovirus, e.g. adenoassociated viruses
    • C12N2750/14141Use of virus, viral particle or viral elements as a vector
    • C12N2750/14143Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011Details
    • C12N2750/14011Parvoviridae
    • C12N2750/14111Dependovirus, e.g. adenoassociated viruses
    • C12N2750/14151Methods of production or purification of viral material
    • C12N2750/14152Methods of production or purification of viral material relating to complementing cells and packaging systems for producing virus or viral particles
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2820/00Vectors comprising a special origin of replication system
    • C12N2820/55Vectors comprising a special origin of replication system from bacteria
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2830/00Vector systems having a special element relevant for transcription
    • C12N2830/50Vector systems having a special element relevant for transcription regulating RNA stability, not being an intron, e.g. poly A signal
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • Escherichia coli ( E . coli ) plasmids have long been an important source of recombinant DNA molecules used by researchers and by industry.
  • plasmid DNA is becoming increasingly important as the next generation of biotechnology products (e.g ., gene medicines and DNA vaccines) make their way into clinical trials, and eventually into the pharmaceutical marketplace.
  • Plasmid DNA vaccines may find application as preventive vaccines for viral, bacterial, or parasitic diseases; immunizing agents for the preparation of hyper immune globulin products; therapeutic vaccines for infectious diseases; or as cancer vaccines.
  • Plasmids are also utilized in gene therapy or gene replacement applications, wherein the desired gene product is expressed from the plasmid after administration to a patient. Plasmids are also utilized in non-viral transposon (e.g., Sleeping Beauty, PiggyBac, TCBuster, etc) vectors for gene therapy or gene replacement applications, wherein the desired gene product is expressed from the genome after transposition from the plasmid and genome integration. Plasmids are also utilized in Gene Editing (e.g ., Homology -Directed Repair (HDR)/CRISPR-Cas9) non-viral vectors for gene therapy or gene replacement applications, wherein the desired gene product is expressed from the genome after excision from the plasmid and genome integration.
  • HDR Homology -Directed Repair
  • CRISPR-Cas9 CRISPR-Cas9
  • Plasmids are also utilized in viral vectors (e.g., AAV, Lentiviral, retroviral vectors) for gene therapy or gene replacement applications, wherein the desired gene product is packaged in a transducing virus particle after transfection of a production cell line, and is then expressed from the virus in a target cell after viral transduction.
  • viral vectors e.g., AAV, Lentiviral, retroviral vectors
  • Non-viral and viral vector plasmids typically contain a pMBl-, ColEl- or pBR322- derived replication origin.
  • Common high copy number derivatives have mutations affecting copy number regulation, such as ROP (Repressor of primer gene) deletion and a second site mutation that increases copy number (e.g, pMBl pUC G to A point mutation, or ColEl pMMl).
  • ROP Repressor of primer gene
  • WO2014/035457 discloses minimalized vectors (NanoplasmidTM) that utilize RNA-
  • U.S. Patent No. 7,943,377 which is incorporated herein by reference in its entirety, describes methods for fed-batch fermentation, in which plasmid-containing E. coli cells were grown at a reduced temperature during part of the fed-batch phase, during which growth rate was restricted, followed by a temperature up-shift and continued growth at elevated temperature in order to accumulate plasmid; the temperature shift at restricted growth rate improved plasmid yield and purity.
  • This fermentation process is herein referred to as the HyperGRO fermentation process.
  • Other fermentation processes for plasmid production are described in Carnes A.E. 2005 BioProcess Inti 3:36-44, which is incorporated herein by reference in its entirety.
  • WO2014/035457 also discloses host strains for R6K origin vector production in the
  • Viral vectors such as AAV contain palindromic inverted terminal repeats (ITRs)
  • Palindromes and inverted repeats are inherently unstable in high yield E. coli manufacturing hosts such as DH1, DH5a, JM107, JM108, JM109, XLlBlue and the like.
  • the SURE cell line has the following genotype: F ' ⁇ proAB + lacE lacZAMIS TnlO (Tet R ] endAl glnV44 thi-1 gyrA96 relAl lac recB recJ sbcC umuC::Tn5 Kan R uvrC el4 (mcrA-) A(mcrCB-hsdSMR-mrr) 171 , where the SURE stabilizing mutations include sbcC in combination with recB recJ umuC uvrC (mcrA-) mcrBC-hsd-mrr .
  • the SRB cell line has the following genotype: F ' ⁇ proAB + lacE lacZAMIS endAl glnV44 thi-1 gyrA96 relAl lac recJ sbcC umuC::Tn5(Kan R uvrC e74-(mcrA-) A(mcrCB- hsdSMR-mrr) 171 , where the SRB stabilizing mutations include sbcC in combination with recJ umuC uvrC (mcrA-) mcrBC-hsd-mrr .
  • the SURE2 cell line has the following genotype: endAl glnV44 thi-1 gyrA96 relAl lac recB recJ sbcC umuC::Tn5 Kan R uvrC el 4- A(mcrCB-hsdSMR-mrr) 171 F'[ proAB + lacl q lacZAM l 5 TnlO (Tet R ) Amy Cm R ], where the SURE2 stabilizing mutations include sbcC in combination with recB recJ uvrC (mcrA ) mcrBC-hsd-mrr .
  • SbcCD is a nuclease that cleaves palindromic DNA sequences and contributes to palindrome instability in E. coli (Chalker AF, Leach DR, Lloyd RG. 1988 Gene 71 :201-5).
  • Palindromes such as shRNA or AAV ITRs are more stable in SbcC knockout strains such as SURE cells than DH5a as taught in Gray SJ, Choi, VW, Asokan, A, Haberman RA, McCown TJ, Samulski RJ (2011) Curr Protoc Neurosci Chapter 4:Unit 4.17 as follows “The AAV ITRs are unstable in E. coli, and plasmids that lose the ITRs have a replication advantage in transformed cells. For these reasons, bacteria containing ITR plasmids should not be grown longer than 12 14 hours, and any recovered plasmids should be assessed for retention of the
  • ITRs DH10B competent cells (or other comparable high-efficiency strain) can be used to transform ligation reactions for ITR-containing plasmid cloning. After screening positive clones for ITR integrity, a good clone should then be transformed into SURE or SURE2 cells (Agilent Technologies) for production of plasmid and glycerol stocks. SURE cells are engineered to maintain irregular DNA structures, but have lower transformation efficiency compared toDHIOB. ” Further, Siew SM, 2014 Recombinant AAV-mediated Gene Therapy Approaches to Treat Progressive Familial Intrahepatic Cholestasis Type 3.
  • SURE2 cells are a sbcC mutant strain commonly used to propagate plasmids containing palindromic AAV ITRs.
  • SURE or SURE2 sbcC mutant strains are preferred to propagate plasmids containing palindromic AAV ITRs.
  • SURE and SURE2 are kan R , so they cannot be used to produce kanamycin resistance plasmids which are typically used (rather than ampicillin resistance plasmids) in cGMP manufacturing.
  • sbcC knockout stabilization of palindromes additionally requires mutations in other genes such as recB recJ uvrC mcrA , or mcrBC-hsd-mrr .
  • recB recJ uvrC mcrA or mcrBC-hsd-mrr .
  • phage hosts appear to be those that are mcrA delta(mcrBC-hsd-mrr) combined with mutations in sbcC plus recBC or red). ”
  • PMC 103 mcrA A(mcrBC-hsdRMS-mrr) 102 recD sbcC
  • PMC 103 stabilizing mutations include sbcC in combination with recD (mcrA-) mcrBC-hsd-mrr
  • PMC 107 mcrA D ( mcrBC-hsdRMS-mrr) ⁇ 02 recB21 recC22 recJ154 sbcB15 sbcC201
  • the PMC 107 stabilizing mutations include sbcC in combination with recB recJ sbcB (mcrA-) mcrB C-hsd-mrr .
  • sbcC knockout stabilization of palindromes additionally requires mutations in sbcB, recB, recD, and recJ and, in some instances, uvrC, mcrA and/or mcrBC-hsd-mrr.
  • This teaches away from application of sbcC knockout to improve palindrome stability in standard E. coli plasmid production strains such as DH1, DH5a, JM107, JM108, JM109, XLlBlue which do not contain these additional mutations.
  • genotypes of several standard E. coli plasmid production strains are:
  • DH1 F- l- endAl recAl relAl gyrA96 thi-1 glnV44 hsdR17(rK-mK-)
  • DH5a F- cp801acZAM15 A(lacZYA-argF) U169 recAl endAl hsdR17 (rk-, mk+) gal- phoA supE44 l- thi-1 gyrA96 relAl
  • JM108 endAl recAl gyrA96 thi-1 relAl glnV44 A(lac-proAB) hsdR17 (GK ' mb)
  • JM109 endAl glnV44 thi-1 relAl gyrA96 recAl mcrB + A(lac-proAB) el4- [F 1 traD36 proAB + lacl q lacZAM l 5] hsdR17(rKmK + )
  • Standard E. coli plasmid production strains are endA, recA. However standard production strains do not contain any of the required mutations in sbcB, recB recD, and recJ and, in some instances, uvrC, mcrA, or mcrBC-hsd-mrr, so knockout of sbcC would not be expected to effectively stabilize palindromes or inverted repeats in the absence of these additional mutations.
  • Table 1 HyperGRO fermentation plasmid yields in SURE2 versus XLlBlue using ampR pUC origin plasmids *Methods for culture were the same as in the Examples below with the following temperature shifts: Sure 2: 30°C, Shift to 37°C at 60 OD600, for 4hr, 25°C Hold; XLlBlue: 30°C, Shift to 42°C at 550D600, for 7hr, 25°C Hold.
  • Stbl2, Stbl3, and Stbl4 which are used to stabilize direct repeat containing vectors such as lentiviral vectors but do not contain the SbcC knockout.
  • Stbl2, Stbl3 and Stbl4 The genotypes of Stbl2, Stbl3 and Stbl4 are shown below.
  • Stbl2 F- endAl glnV44 thi-1 recAl gyrA96 relAl A(lac-proAB) mcrA A(mcrBC- hsdRMS-mrr) l
  • Stbl2 stabilizing mutations mcrA A(mcrBC-hsdRMS-mrr) (Trinh, T., lessee, J., Bloom, F.R., and Hirsch, V. (1994) FOCUS 16 , 78.)
  • Stbl3 F- mcrB mrr hsdS20 (rB-, mB- ) recA13 supE44 ara-14 galK2 lacYl proA2 rpsL20 (Strr ) xyl-5 - leu mtl-1
  • Stbl3 stabilizing mutations mcrBC -mrr
  • Stbl4 endAl glnV44 thi-1 recAl gyrA96 relAl A(lac-proAB) mcrA A(mcrBC- hsdRMS-mrr) l gal F'[ proAB + lack 1 lacZAM15 TnlO]
  • Stbl4 stabilizing mutations mcrA A(mcrBC-hsdRMS-mrr)
  • an engineered E. coli host cell that has a knockout of SbcC, SbcD or both but without certain additional mutations.
  • a method for preparing an engineered E. coli host cell of the present disclosure is provided.
  • methods for replicating a vector in an engineered E. coli host cell of the present disclosure are provided.
  • FIG. 1 A depicts the pKD4 SbcCD targeting PCR fragment.
  • FIG. IB depicts the SbcCD locus.
  • FIG. 1C depicts the integrated pKD4 PCR product knocking out SbcCD.
  • FIG. ID depicts the scar after FRT -mediated excision of the pKD4 kanR marker.
  • the present disclosure provides bacterial host strains, methods for modifying bacterial host strains, and methods for manufacturing that can improve plasmid yield and quality.
  • the bacterial hosts strains and methods of the present disclosure can enable improved manufacturing of vectors such as non-viral transposon (transposase vector, Sleeping Beauty transposon vector, Sleeping Beauty transposase vector, PiggyBac transposon vector, PiggyBac transposase vector, expression vector, etc.) or Non-viral Gene Editing (e.g. Homology -Directed Repair (HDR)/CRISPR-Cas9) vectors for cell therapy, gene therapy or gene replacement applications, and viral vectors (e.g.
  • non-viral transposon transposase vector, Sleeping Beauty transposon vector, Sleeping Beauty transposase vector, PiggyBac transposon vector, PiggyBac transposase vector, expression vector, etc.
  • Non-viral Gene Editing e.g. Homology -Directed Repair (HDR)/CRISPR-Cas9 vectors for cell therapy, gene therapy or gene replacement applications
  • viral vectors
  • Improved plasmid manufacturing can include improved plasmid yield, improved plasmid stability (e.g ., reduced plasmid deletion, inversion, or other recombination products) and/or improved plasmid quality (e.g., decreased nicked, linear or dimerized products) and/or improved plasmid supercoiling (e.g, decreased reduced supercoiling topological isoforms) compared to plasmid manufacturing using an alternative host strain known in the art. It is to be understood that all references cited herein are incorporated by reference in their entirety.
  • AAV vector refers to an adeno-associated virus vector or episomal viral vector.
  • AAV vector includes self- complementary adeno-associated virus vectors (scAAV) and single-stranded adeno-associated virus vectors (ssAAV).
  • amp refers to ampicillin
  • ampR refers to an ampicillin resistance gene.
  • bacterial region refers to the region of a vector, such as a plasmid, required for prorogation and selection in a bacterial host.
  • Cat R refers to a chloramphenicol resistance gene.
  • ccc or “CCC” means “covalently closed circular” unless used in the context of a nucleotide or amino acid sequence.
  • cl means lambda repressor
  • cITs857 refers to the lambda repressor further incorporating a C to T (Ala to Thr) mutation that confers temperature sensitivity. cITs857 is a functional repressor at 28-30°C but is mostly inactive at 37-42°C. Also called cI857 or cI857ts.
  • CMV cytomegalovirus
  • copy cutter host strain refers to R6K origin production strains containing a phage cp80 attachment site chromosomally integrated copy of an arabinose inducible CI857ts gene. Addition of arabinose to plates or media ( e.g . to 0.2-0.4% final concentration) induces pARA mediated CI857ts repressor expression which reduces copy number at 30° C through CI857ts mediated downregulation of the R6K Rep protein expressing pL promoter [i.e.
  • dcm methylation refers to methylation by E. coli methyltransferase that methylates the sequences CC(A/T)GG at the C5 position of the second cytosine.
  • derived from means that a cell has been descended from a particular cell line.
  • derived from DH5a means that the cell is made from DH5a or a descendant of DH5a.
  • the derivative cell can include polymorphisms and other changes that occur to the cell line as it is cultured.
  • EGFP refers to enhanced green fluorescent protein
  • engineered E. coli strain should be understood to refer to an E. coli strain of the present disclosure that has a gene knockout (or knockdown) in SbcC, SbcD or both that was made by human intervention.
  • engineered mutation should be understood a mutation that did not naturally occur and was instead the product of direct, human intervention.
  • eukaryotic expression vector refers to a vector for expression of mRNA, protein antigens, protein therapeutics, shRNA, RNA or microRNA genes in a target eukaryotic organism using RNA Polymerase I, II or III promoters.
  • eukaryotic region refers to the region of a plasmid that encodes eukaryotic sequences and/or sequences required for plasmid function in the target organism. This includes the region of a plasmid vector required for expression of one or more transgenes in the target organism including RNA Pol II enhancers, promoters, transgenes and poly A sequences. This also includes the region of a plasmid vector required for expression of one or more transgenes in the target organism using RNA Pol I or RNA Pol III promoters, RNA Pol I or RNA Pol III expressed transgenes or RNAs.
  • the eukaryotic region may optionally include other functional sequences, such as eukaryotic transcriptional terminators, supercoiling- induced DNA duplex destabilized (SIDD) structures, S/MARs, boundary elements, and the like.
  • SIDD supercoiling- induced DNA duplex destabilized
  • the eukaryotic region contains flanking direct repeat LTRs
  • the eukaryotic region contains flanking inverted terminal repeats
  • IR/DR termini e.g, Sleeping Beauty
  • the eukaryotic region may encode homology arms to direct targeted integration.
  • expression vector refers to a vector for expression of mRNA, protein antigens, protein therapeutics, shRNA, RNA or microRNA genes in a target organism.
  • gene of interest refers to a gene to be expressed in the target organism. Includes mRNA genes that encode protein or peptide antigens, protein or peptide therapeutics, and mRNA, shRNA, RNA or microRNA that encode RNA therapeutics, and mRNA, shRNA, RNA or microRNA that encode RNA vaccines, and the like.
  • genomic as it relates to Rep proteins and promoters, RNA-IN, incuding RNA-IN regulated selectable markers, antibiotic resistance markers, and lambda repressors refers to nucleic acid sequences incorporated in the bacterial host strain.
  • high yield plasmid manufacturing host refers to recA-, endA- cell lines such as DH1, DH5a, JM107, JM108, JM109, MG1655 and XLlBlue that do not contain viability- or yield- reducing mutations in sbcB, recB, recD, and red and, optionally , uvrC, mcrA and/or mcrBC-hsd-mrr.
  • HyperGRO fermentation process refers to fed-batch fermentation, in which plasmid-containing E. coli cells are grown at a reduced temperature during part of the fed-batch phase, during which growth rate is restricted, followed by a temperature up-shift and continued growth at elevated temperature in order to accumulate plasmid; the temperature shift at restricted growth rate improved plasmid yield and purity.
  • inverted repeat refers to a single-stranded sequence of nucleotides followed downstream by its reverse complement.
  • the intervening sequence of nucleotides between the initial sequence and the reverse complement can be any length including zero. When the intervening length is zero, the composite sequence is a palindrome. It should be understood that inverted repeats can occur in double-stranded DNA and that other inverted repeats can occur within the intervening sequence.
  • IR/DR refers to inverted repeats which are directly repeated twice. For example, Sleeping Beauty transposon IR/DR repeats.
  • iteron refers to directly repeated DNA sequences in a origin of replication that are required for replication initiation.
  • R6K origin iteron repeats are 22 bp such as SEQ ID NOs 19-23 of WO 2019/183248 (aaacatgaga gcttagtacg tg, aaacatgaga gcttagtacg tt, agccatgaga gcttagtacg tt, agccatgagg gtttagttcg tt, and aaacatgaga gcttagtacg ta, respectively).
  • ITR inverted terminal repeat
  • kan refers to kanamycin.
  • kanR refers to a kanamycin resistance gene.
  • knockdown refers to disruption of a gene that results in a reduced expression of the gene product and/or reduced activity of the gene product.
  • knockout refers to disruption of a gene which results in ablation of gene expression from the gene and/or the expressed gene product is non-functional.
  • a Sail site immediately upstream of the ATG start codon (GTCGACATG) is an effective kozak sequence.
  • lentiviral vector refers to an integrative viral vector that can infect dividing and non-dividing cells. Also called a Lentiviral transfer plasmid.
  • the Plasmid encodes Lentiviral LTR flanked expression unit. Transfer plasmid is transfected into production cells along with Lentiviral envelope and packaging plasmids required to make viral particles.
  • lentiviral envelope vector refers to a plasmid encoding envelope glycoprotein.
  • lentiviral packaging vector refers to one or two plasmids that express gag, pol and Rev gene functions required to package the lentiviral transfer vector.
  • minicircle refers to covalently closed circular plasmid derivatives in which the bacterial region has been removed from the parent plasmid by in vivo or in vitro site- specific recombination or in vitro restriction digestion/ligation. Minicircle vectors are replication incompetent in bacterial cells.
  • mSEAP refers to murine secreted alkaline phosphatase.
  • NanoplasmidTM vector refers to a vector combining an RNA selectable marker with a R6K, ColE2 or ColE2 related replication origin.
  • mutation can refer to any type of mutation such as a substitution, addition, deletion.
  • non-functional with respect to the SbcCD complex refers to a SbcCD complex that cannot cleave palindromic sequences.
  • NTC8 series refers to vectors, such as NTC8385, NTC8485 and NTC8685 plasmids are antibiotic-free pUC origin vectors that contain a short RNA (RNA- OUT) selectable marker instead of an antibiotic resistance marker such as kanR.
  • RNA- OUT short RNA
  • NTC9385R refers to the NTC9385R NanoplasmidTM vector described in WO 2014/035457 and has a spacer region encoded Nhel- trpA terminator-R6K origin RNA-OUT -Kpnl bacterial region linked through the flanking Nhel and Kpnl sites to the eukaryotic region.
  • Opt refers to optical density at 600 nm.
  • PCR refers to “polymerase chain reaction.”
  • pDNA refers to plasmid DNA.
  • piggyback transposon refers to a transposon system that integrates an ITR flanked PB transposon into the genome by a simple cut and paste mechanism mediated by PB transposase.
  • the transposon vector typically contains a promoter-transgene-polyA expression cassette between the PB ITRs which is excised and integrated into the genome.
  • pINT pR pL vector refers to the pINT pR pL athoam integration expression vector is described in Luke et al., 2011 Mol Biotechnol 47:43 and included herein by reference.
  • the target gene to be expressed is cloned downstream of the pL promoter.
  • the vector encodes the temperature inducible cI857 repressor, allowing heat inducible target gene expression.
  • PL promoter refers to the lambda promoter left.
  • PL is a strong promoter that is repressed by the cl repressor binding to OL1, OL2 and OL3 repressor binding sites.
  • the temperature sensitive cI857 repressor allows control of gene expression by heat induction since at 30°C the cI857 repressor is functional and it represses gene expression, but at 37-42 °C the repressor is inactivated so expression of the gene ensues.
  • PL (OLl G to T) promoter
  • PL is a strong promoter that is repressed by the cl repressor binding to OLl, OL2 and OL3 repressor binding sites.
  • the temperature sensitive cI857 repressor allows control of gene expression by heat induction since at 30°C the cI857 repressor is functional and it represses gene expression, but at 37-42 °C the repressor is inactivated so expression of the gene ensues.
  • the cl repressor binding to OLl is reduced by the OLl G to T mutation resulting in increased promoter activity at 30°C and 37-42 °C as described in WO 2014/035457.
  • plasmid refers to an extra chromosomal DNA molecule separate from the chromosomal DNA which is capable of replicating independently from the chromosomal DNA.
  • Plasmid copy number refers to the number of copies of plasmid per cell. Increases in plasmid copy number indicate an increase in plasmid production yield.
  • Poly refers to polymerase.
  • Poly I refers to E. coli DNA Polymerase I.
  • Poly III refers to E. coli DNA Polymerase III.
  • Pol III dependent origin of replication refers to a replication origin that doesn’t require Pol I, for example the rep protein dependent R6K gamma replication origin. Numerous additional Pol III dependent replication origins are known in the art, many of which are summarized in del Solar etal, Supra , 1998 which is included herein by reference.
  • poly A refers to a polyadenylation signal or site. Polyadenylation is the addition of a poly(A) tail to an RNA molecule.
  • the polyadenylation signal contains the sequence motif recognized by the RNA cleavage complex. Most human polyadenylation signals contain an AAUAAA motif and conserved sequences 5’ and 3’ to it. Commonly utilized polyA signals are derived from the rabbit b globin, bovine growth hormone, SV40 early, or SV40 late polyA signals.
  • a “polyA repeat” refers to a consecutive sequence of adenine nucleotides as a direct repeat.
  • a “polyG repeat” refers to a consecutive sequence of guanine nucleotides as a direct repeat
  • a “polyC repeat” refers to a consecutive sequence of cytosine nucleotides as a direct repeat
  • a “polyT repeat” refers to a consecutive sequence of thymine nucleotides as a direct repeat.
  • a “mRNA vector” contains polyA repeats.
  • pUC origin refers to a pBR322-derived replication origin, with G to A transition that increases copy number at elevated temperature and deletion of the ROP negative regulator.
  • pUC free refers to a plasmid that does not contain the pUC origin.
  • pUC plasmid refers to a plasmid containing the pUC origin.
  • R6K plasmid refers to a plasmid with a R6K or R6K-derived origin of replication such as NTC9385R, NTC9685R, NTC9385R2-01, NTC9385R2-02, NTC9385R2a-01, NTC9385R2a-02, NTC9385R2b-01, NTC9385R2b-02, NTC9385Ra-01, NTC9385Ra-02, NTC9385RaF, and NTC9385RbF vectors as well as modifications and alternative vectors containing a R6K replication origin that were described in WO 2014/035457 and WO2019/183248.
  • Alternative R6K vectors known in the art including, but not limited to, pCOR vectors (Gencell), pCpGfree vectors (Invivogen), and CpG free University of Oxford vectors including pGM169.
  • R6K replication origin refers to a region which is specifically recognized by the R6K Rep protein to initiate DNA replication, including, but not limited to, R6K gamma replication origin sequence disclosed as SEQ ID NO:l, SEQ ID NO:2 SEQ ID NO:4, and SEQ ID NO:18 in WO 2019/183248 (SEQ ID NOs: 43-44, 46 and 60, respectively). Also included are CpG free versions ( e.g . SEQ ID NO:3) as described in Drocourt et al.
  • R6K replication origin-RNA-OUT bacterial origin contains a R6K replication origin for propagation and the RNA-OUT selectable marker (e.g. SEQ ID NO:8; SEQ ID NO: 9; SEQ ID NO: 10; SEQ ID NO: 11; SEQ ID NO: 12; SEQ ID NO: 13; SEQ ID NO: 14; SEQ ID NO: 15; SEQ ID NO: 16; SEQ ID NO: 17 disclosed in WO 2019/183248 (SEQ ID NOs: 50-59, respectively).
  • SEQ ID NO:8 SEQ ID NO: 9; SEQ ID NO: 10; SEQ ID NO: 11; SEQ ID NO: 12; SEQ ID NO: 13; SEQ ID NO: 14; SEQ ID NO: 15; SEQ ID NO: 16; SEQ ID NO: 17 disclosed in WO 2019/183248 (SEQ ID NOs: 50-59, respectively).
  • Rep protein dependent plasmid refers to a plasmid in which replication is dependent on a replication (Rep) protein provided in Trans.
  • Rep replication
  • R6K replication origin For example, R6K replication origin, ColE2-P9 replication origin and ColE2 related replication origin plasmids in which the Rep protein is expressed from the host strain genome.
  • Numerous additional Rep protein dependent plasmids are known in the art, many of which are summarized in del Solar et al, Supra , 1998, Microbiol. Mol. Biol. Rev. 62:44-464 which is incorporated herein by reference.
  • retroviral vector refers to integrative viral vector that can infect dividing cells. Also call transfer plasmid. Plasmid encodes Retroviral LTR flanked expression unit. Transfer plasmid is transfected into production cells along with envelope and packaging plasmids required to make viral particles.
  • retroviral envelope vector refers to a plasmid encoding envelope glycoprotein.
  • retroviral packaging vector refers to a plasmid that encodes retroviral gag and pol genes required to package the retroviral transfer vector.
  • RNA-IN refers to an insertion sequence 10 (IS 10) encoded RNA- IN, an RNA complementary and antisense to a portion of RNA RNA-OUT.
  • IS 10 insertion sequence 10
  • RNA-IN is cloned in the untranslated leader of a mRNA, annealing of RNA-IN to RNA-OUT reduces translation of the gene encoded downstream of RNA-IN.
  • RNA-IN regulated selectable marker refers to a genomically expressed RNA-IN regulated selectable marker.
  • plasmid borne RNA-OUT antisense repressor RNA e.g. SEQ ID NO: 6 disclosed in WO 2019/183248 (SEQ ID NO:
  • RNA-IN regulated selectable marker is configured such that RNA-IN regulates either 1) a protein that is lethal or toxic to said cell per se or by generating a toxic substance (e.g, SacB), or 2) a repressor protein that is lethal or toxic to said bacterial cell by repressing the transcription of a gene that is essential for growth of said cell (e.g. murA essential gene regulated by RNA-IN tetR repressor gene).
  • a toxic substance e.g, SacB
  • a repressor protein that is lethal or toxic to said bacterial cell by repressing the transcription of a gene that is essential for growth of said cell
  • murA essential gene regulated by RNA-IN tetR repressor gene
  • RNA-OUT refers to an insertion sequence 10 (IS 10) encoded RNA-OUT, an antisense RNA that hybridizes to, and reduces translation of, the transposon gene expressed downstream of RNA-IN.
  • the sequence of the RNA-OUT RNA (SEQ ID NO: 6 disclosed in WO 2019/183248 (SEQ ID NO: 48)) and complementary RNA-IN SacB genomically expressed RNA-IN-SacB cell lines can be modified to incorporate alternative functional RNA-IN/RNA-OUT binding pairs such as those described in Mutalik et al, 2012 Nat Chem Biol 8:447, including, but not limited to, the RNA-OUT A08/RNA-IN S49 pair, the RNA-OUT A08/RNA-IN S08 pair, and CpG free modifications of RNA-OUT A08 that modify the CG in the RNA-OUT 5’ TTCGC sequence to a non-CpG sequence.
  • a multitude of alternative substitutions to remove the two CpG motifs may be utilized to make a CpG free RNA-OUT.
  • RNA-OUT selectable marker refers to an RNA-OUT selectable marker DNA fragment including E. coli transcription promoter and terminator sequences flanking an RNA-OUT RNA.
  • An RNA-OUT selectable marker utilizing the RNA-OUT promoter and terminator sequences, that is flanked by Dralll and Kpnl restriction enzyme sites, and designer genomically expressed RNA-IN-SacB cell lines for RNA-OUT plasmid propagation, are described in WO 2008/153733 and included herein by reference.
  • the RNA- OUT promoter and terminator sequences that flank the RNA-OUT RNA may be replaced with heterologous promoter and terminator sequences.
  • RNA-OUT promoter may be substituted with a CpG free promoter known in the art, for example the I-EC2K promoter or the P5/6 5/6 or P5/66/6 promoters described in WO 2008/153733 and included herein by reference.
  • a 2 CpG RNA-OUT selectable marker in which the two CpG motifs in the RNA- OUT promoter are removed was given as SEQ ID NO: 7 in WO 2019/183248 (SEQ ID NO: 49).
  • Vectors incorporating CpG free RNA-OUT selectable marker may be selected for sucrose resistance using the RNA-IN-SacB cell lines for RNA-OUT plasmid propagation described in WO 2008/153733 or any cell line with RNA-IN-SacB as described in WO 2008/153733.
  • the RNA-IN sequence in these cell lines can be modified to incorporate the 1 bp change needed to perfectly match the CpG free RNA-OUT region complementary to RNA-IN.
  • RNA selectable marker refers to a plasmid borne expressed non- translated RNA that regulates a chromosomally expressed target gene to afford selection. This may be a plasmid borne nonsense suppressing tRNA that regulates a nonsense suppressible selectable chromosomal target as described by Crouzet J and Soubrier F 2005 US Patent 6,977,174 included herein by reference.
  • This may also be a plasmid borne antisense repressor RNA, a non limiting list included herein by reference includes RNA-OUT that represses RNA- IN regulated targets (WO 2008/153733), pMBl plasmid origin encoded RNAI that represses RNAII regulated targets (Grabherr R, Pfaffenzeller I. 2006 US patent application US20060063232; Cranenburgh RM. 2009; US Patent 7,611,883), IncB plasmid pMU720 origin encoded RNAI that represses RNA II regulated targets (Wilson IW, Siemering KR, Praszkier J, Pittard AJ. 1997.
  • RNA selectable marker may be another natural antisense repressor RNAs known in the art such as those described in Wagner EGH, Alluvia S, Romby P. 2002. Adv Genet 46:361-98 and Franch T, and Gerdes K. 2000. Current Opin Microbiol 3:159-64.
  • RNA selectable marker may also be an engineered repressor RNAs such as synthetic small RNAs expressed SgrS, MicC or MicF scaffolds as described in Na D, Yoo SM, Chung H, Park H, Park JH, Lee SY. 2013. Nat Biotechnol 31 : 170-4.
  • An RNA selectable marker may also be an engineered repressor RNA as part of a selectable marker that represses a target RNA fused to a target gene to be regulated such as SacB as described in US 2015/0275221.
  • SacB refers to the structural gene encoding Bacillus subtilus levansucrase. Expression of SacB in gram negative bacteria is toxic in the presence of sucrose.
  • SEAP secreted alkaline phosphatase
  • selectable marker or “selection marker” refer to a selectable marker, for example, a kanamycin resistance gene or a RNA selectable marker.
  • sequence identity refers to the degree of identity between any given query sequence and a subject sequence.
  • a subject sequence may, for example, have at least 90%, at least 95%, at least 98%, at least 99% or 100% sequence identity to a given query sequence.
  • a query sequence e.g . a nucleic acid sequence
  • ClustalW version 1.83, default parameters
  • the sequence alignment program calculates the best match between a query and one or more subject sequences, and aligns them so that identities, similarities, and differences can be determined. Gaps of one or more nucleotides can be inserted into a query sequence, a subject sequence, or both, to maximize sequence alignments. For fast pair-wise alignments of nucleic acid sequences, suitable default parameters can be selected that are appropriate for the particular alignment program.
  • the output is a sequence alignment that reflects the relationship between sequences.
  • the sequences are aligned using the alignment program, the number of identical matches in the alignment is divided by the length of the query sequence, and the result is multiplied by 100. It is noted that the percent identity value can be rounded to the nearest tenth. For example, 78.11, 78.12, 78.13, and 78.14 are rounded down to 78.1, while 78.15, 78.16, 78.17, 78.18, and 78.19 are rounded up to 78.2.
  • RNA refers to short hairpin RNA.
  • S/MAR refers to scaffold/matrix attached region which includes eukaryotic sequences that mediate DNA attachment to the nuclear matrix.
  • “Sleeping Beauty Transposon” refers to a transposon system that integrates an IR/DR flanked SB transposon into the genome by a simple cut and paste mechanism mediated by SB transposase.
  • the transposon vector typically contains a promoter- transgene-polyA expression cassette between the IR/DRs which is excised and integrated into the genome.
  • spacer region refers to the region linking the 5’ and 3’ ends of the eukaryotic region sequences.
  • the eukaryotic region 5’ and 3’ ends are typically separated by the bacterial replication origin and bacterial selectable marker in plasmid vectors (bacterial region) so many spacer regions consist of the bacterial region.
  • this spacer region preferably is less than 1000 bp.
  • structured DNA sequence refers to a DNA sequence that is capable of forming replication inhibiting secondary structures (Mirkin and Mirkin, 2007. Microbiology and Molecular Biology Reviews 71:13-35). This includes but is not limited to inverted repeats, palindromes, direct repeats, IR/DRs, homopolymeric repeats or repeat containing eukaryotic promoter enhancers, or repeat containing eukaryotic origin of replications.
  • SV40 origin refers to Simian Virus 40 genomic DNA that contains the origin of replication.
  • SV40 enhancer refers to Simian Virus 40 genomic DNA that contains the 72 bp and optionally the 21 bp enhancer repeats.
  • TE Buffer refers to a solution containing approximately lOmM Tris pH 8 and 1 mM EDTA.
  • TetR refers to a tetracycline resistance gene.
  • transcription terminator refers to (1) in the bacterial context, a DNA sequence that marks the end of a gene or operon for transcription. This may be an intrinsic transcription terminator or a Rho-dependent transcriptional terminator. For an intrinsic terminator, such as the trpA terminator, a hairpin structure forms within the transcript that disrupts the mRNA-DNA-RNA polymerase ternary complex.
  • Rho-dependent transcriptional terminators require Rho factor, an RNA helicase protein complex, to disrupt the nascent mRNA-DNA-RNA polymerase ternary complex; or (2) in the eukaryotic context, PolyA signals are not ‘terminators’, instead internal cleavage at PolyA sites leaves an uncapped 5’end on the 3’UTR RNA for nuclease digestion. Nuclease catches up to RNA Pol II and causes termination. Termination can be promoted within a short region of the poly A site by introduction of RNA Pol II pause sites (eukaryotic transcription terminator).
  • RNA Pol II Pausing of RNA Pol II allows the nuclease introduced into the 3’ UTR mRNA after PolyA cleavage to catch up to RNA Pol II at the pause site.
  • a nonlimiting list of eukaryotic transcription terminators know in the art include the C2x4 and the gastrin terminator. Eukaryotic transcription terminators may elevate mRNA levels by enhancing proper 3'-end processing of mRNA.
  • transfection refers to a method to deliver nucleic acids into cells [e.g. poly(lactide-co-glycolide) (PLGA), ISCOMs, liposomes, niosomes, virosomes, block copolymers, Pluronic block copolymers, chitosan, and other biodegradable polymers, microparticles, microspheres, calcium phosphate nanoparticles, nanoparticles, nanocapsules, nanospheres, poloxamine nanospheres, electroporation, nucleofection, piezoelectric permeabilization, sonoporation, iontophoresis, ultrasound, SQZ high speed cell deformation mediated membrane disruption, corona plasma, plasma facilitated delivery, tissue tolerable plasma, laser microporation, shock wave energy, magnetic fields, contactless magneto- permeabilization, gene gun, microneedles, microdermabrasion, hydrodynamic delivery, high pressure tail vein injection, etc] as known in the art and included
  • transgene refers to a gene of interest that is cloned into a vector for expression in a target organism.
  • transposase vector refers to a vector which encodes a transposase.
  • transposon vector refers to a vector which encodes a transposon which is a substrate for transposase-mediated gene integration.
  • ts means temperature-sensitive.
  • UTR refers to an untranslated region of mRNA (5’ or 3’ to the coding region).
  • vector refers to a gene delivery vehicle, including viral (e.g . Alphavirus, Poxvirus, Lentivirus, Retrovirus, Adenovirus, Adenovirus related virus, etc.) and non-viral (e.g. plasmid, MIDGE, transcriptionally active PCR fragment, minicircles, bacteriophage, NanoplasmidTM, etc.) vectors.
  • viral e.g . Alphavirus, Poxvirus, Lentivirus, Retrovirus, Adenovirus, Adenovirus related virus, etc.
  • non-viral e.g. plasmid, MIDGE, transcriptionally active PCR fragment, minicircles, bacteriophage, NanoplasmidTM, etc.
  • vector backbone refers to the eukaryotic and bacterial region of a vector, without the transgene or target antigen coding region.
  • an engineered Escherichia coli (E. coli ) host cell wherein the engineered E. coli host cell comprises a gene knockout of at least one gene selected from the group consisting of SbcC and SbcD, and wherein the engineered E.
  • coli host cell does not include an engineered viability- or yield-reducing mutation in any of sbcB, recB, recD, and red and, optionally, at least one of uvrC, mcrA, mcrBC-hsd-mrr and combinations thereof.
  • the engineered E. coli host cell does not include any engineered mutations in any of sbcB, recB, recD, and red and, optionally, at least one of uvrC, mcrA, mcrBC-hsd- mrr and combinations thereof.
  • coli host cell does not include any mutations in any of sbcB, recB, recD, and red and, optionally, at least one of uvrC, mcrA, mcrBC-hsd-mrr and combinations thereof.
  • engineered E. coli host cells comprising a gene knockout (or knockdown) of at least one gene selected from the group consisting of SbcC and SbcD, where the engineered E. coli host cells do not include an engineered viability- or yield-reducing mutation, or in some embodiments an engineered mutation or any mutation, in at least one of sbcB, recB, recD, red, uvrC, mcrA and mcrBC-hsd-mrr. It should also be understood that, within the scope of the present disclosure are engineered E.
  • an engineered E. coli host cell comprising a gene knockout of at least one gene selected from the group consisting of SbcC and SbcD, where the engineered E. coli host cells do not include an engineered viability- or yield-reducing mutation, or in some embodiments an engineered mutation or any mutation, in at least one of sbcB, recB, recD, and red.
  • an engineered E. coli host cell comprises a gene knockout of at least one gene selected from the group consisting of SbcC and SbcD, but does not include a viability- or yield-reducing mutation, or in some embodiments an engineered or any mutation, in mcrA.
  • coli host cell comprises a gene knockout of at least one gene selected from the group consisting of SbcC and SbcD, wherein the engineered E. coli host cell does not include an engineered viability- or yield-reducing mutation, or in some other embodiments an engineered or any mutation, in any of sbcB, recB, recD, and red.
  • the engineered E. coli host cell comprises a gene knockout of at least one gene selected from the group consisting of SbcC and SbcD, and does not include any engineered viability- or yield-reducing mutations in at least one of sbcB, recB, recD, recJ, uvrC, mcrA and mcrBC-hsd-mrr.
  • the coli host cell comprises a gene knockout of at least one gene selected from the group consisting of SbcC and SbcD, and does not include any engineered mutations in at least one of sbcB, recB, recD, recJ, uvrC, mcrA and mcrBC-hsd-mrr.
  • the engineered E. coli host cell comprises a gene knockout of at least one gene selected from the group consisting of SbcC and SbcD, and does not include any mutations in at least one of sbcB, recB, recD, recJ, uvrC, mcrA and mcrBC-hsd-mrr.
  • the coli host cell comprises a gene knockout of at least one gene selected from the group consisting of SbcC and SbcD, and does not include any mutations in sbcB, recB, recD, recJ and uvrC.
  • the engineered E. coli host cell comprises a gene knockout of at least one gene selected from the group consisting of SbcC and SbcD, and does not include any mutation in mcrA.
  • an engineered E. coli host cell that includes a gene knockout of at least on gene selected from the group consisting of SbcC and SbcD, where the engineered E. coli host cell does not include an engineered viability- or yield-reducing mutation in any of sbcB, recB, recD, and recJ.
  • the engineered E. coli host cell can not include any engineered mutations in sbcB, recB, recD, and recJ.
  • the engineered E. coli host cell can not include any mutations in any of sbcB, recB, recD, and recJ.
  • an engineered A is provided that includes a gene knockout of at least on gene selected from the group consisting of SbcC and SbcD, where the engineered E. coli host cell does not include an engineered viability- or yield-reducing mutation in any of sbcB, recB, recD, and recJ.
  • the engineered E. coli host cell can not include any engineered mutations in
  • coli host cell that includes a gene knockout of at least one gene selected from the group consisting of SbC and SbcD and the E. coli host cell is isogenic to the strain from which it is derived, the strain from which it is derived being selected from the group consisting of DH5a, DH1, JM107, JM108, JM109, MG1655 and XLlBlue.
  • an engineered E. coli host cell is provided that includes a gene knockout of at least one gene selected from the group consisting of SbC and SbcD and the E.
  • the engineered E. coli host cell is isogenic to the strain from which it is derived, the strain from which it is derived being selected from the group consisting of DH5a (dcm-), NTC4862, NTC4862-HF, NTC1050811, NTC 1050811-HF, NTC 1050811-HF (dcm-), HB 101, TGI, and NEB Turbo.
  • the engineered E. coli host cell can further not include an engineered viability- or yield-reducing mutation in at least one of uvrC, mcrA, mcrBC-hsd-mrr, and combinations thereof.
  • the coli host cell can further not include any engineered mutations in at least one of uvrC, mcrA, mrBC-hsd-mrr, and combinations thereof.
  • the engineered E. coli host cell can further not include any mutations in at least one of uvrC, mcrA, mrBC-hsd-mrr, and combinations thereof.
  • the engineered E. coli host cell further does not include an engineered viability- or yield-reducing mutation, engineered mutation, or any mutation in uvrC.
  • coli host cell further does not include an engineered viability - or yield-reducing mutation, engineered mutation, or any mutation in mcrA.
  • the engineered E. coli host cell further does not include an engineered viability - or yield-reducing mutation, engineered mutation, or any mutation in mcrBC-hsd-mrr.
  • the engineered E. coli host cell further does not include an engineered viability- or yield-reducing mutation, engineered mutation, or any mutation in mcrA and mrBC-hsd-mrr. It should be understood that throughout this disclosure mrBC-hsd-mrr refers to a sequence that includes the sequences of SEQ ID NOs: 16-21.
  • the engineered E. coli host cell can include a non-functional SbcCD complex or, in other words, can not include a functional SbcCD complex.
  • the engineered A. coli host cell can not include a SbcCD complex.
  • the gene knockout of the engineered E. coli host cell can be a knockout of SbcC.
  • the gene knockout of the engineered E. coli host cell can be a knockout of SbcD.
  • the gene knockout of the engineered E. coli host cell can be a knockout of both SbcC and SbcD.
  • the engineered E. coli host cell can be derived from a cell line selected from the group consisting of DH5a, DH1, JM107, JM108, JM109, MG1655 and XLlBlue. In any of the foregoing embodiments, the engineered E. coli host cell can be derived from DH5a (dcm-), NTC4862, NTC4862-HF, NTC 1050811, NTC 1050811-HF, or NTC 1050811-HF (dcm-). In some of the foregoing embodiments, the engineered E. coli host cell can be derived from a cell line selected from the group consisting of HB101, TGI, and NEB Turbo. The genotypes for these cells lines are as follows:
  • NTC4862 DH5a att,::: P c -RNA-IN-SacB, catR
  • NTC4862-HF DH5a att /. :: Pc-RNA-IN-SacB, catR; attoxo::pARA-CT857ts Pc-RNA-IN- SacB, tetR
  • NTC1050811 DH5a att /. :: Pc-RNA-IN-SacB, catR; attHK022::pL (OLl-Gto T) P42L- P106I-F107S P113S (P3-), SpecR StrepR; att ⁇ p8 o::pARA-CI857ts, tetR
  • NTC 1050811-HF DH5a att /. :: Pc-RNA-IN- SacB, catR; attHK022::pL (OLl-Gto T) P42L-P 106I-F 107 S P113S (P3-), SpecR StrepR; att ⁇ p8 o::pARA-CI857ts P C -RNA-IN- SacB, tetR
  • NEB Turbo V pro A lacl ⁇ 1 ⁇ lacZMl5 jhiiA2 A(lac-proAB) glnV galK 16 galE15 R(zgb-210::Tnl0)Tet s endAl thi-1 A(hsdS-mcrB)5
  • the engineered E. coli host cell can further include a genomic antibiotic resistance marker.
  • the genomic antibiotic resistance marker can be kanR comprising a sequence having at least 90%, at least 95%, at least 95%, at least 98%, at least 99% or 100% sequence identity to SEQ ID NO: 23 (kanR, 795 bp).
  • the genomic antibiotic resistance marker can be kanR comprising a sequence encoding a protein having at least 90%, at least 95%, at least 98%, at least 99% or 100% sequence identity to SEQ ID NO: 36 (kanR).
  • the genomic antibiotic resistance marker can be a chloramphenicol resitance marker, gentamicin resitance marker, kanamycin resistance marker, spectinomycin and streptomycin resistance marker, trimethoprim resistance marker, or a tetracycline resistance marker.
  • the E. coli host cell can not include a genomic antibiotic resistance marker.
  • the engineered E. coli host cell can further include a Rep protein suitable for culturing a Rep protein dependent plasmid.
  • the engineered E. coli host cell can include a genomic nucleic acid sequence having at least 90%, at least 95%, at least 98%, at least 99% or 100% sequence identity to a sequence selected from the group consisting of SEQ ID NO: 26 (P42L-P106I- F107S-P113S, 918 bp), SEQ ID NO: 27 (P42L-A106-107-P113S, 912 bp), SEQ ID NO: 28 (P42L-P 106L-F 107 S, 918 bp), and SEQ ID NO: 29 (P42L-P113S, 918 bp).
  • the engineered E. coli host cell can include a genomic nucleic acid sequence encoding a Rep protein having at least 90%, at least 95%, at least 98%, at least 99% or 100% identity to an amino acid sequence selected from the group consisting of SEQ ID NO: 39 (P42L-P106I-F107S-P113S), SEQ ID NO: 40 (P42L-A106-107-P113S), SEQ ID NO: 42 (P42L-P 106L-F107S), SEQ ID NO: 41 (P42L-P113S), SEQ ID NO: 34 (ColE2 wild-type), SEQ ID NO: 35 (ColE2 mutant G194D).
  • SEQ ID NO: 39 P42L-P106I-F107S-P113S
  • SEQ ID NO: 40 P42L-A106-107-P113S
  • SEQ ID NO: 42 P42L-P 106L-F107S
  • SEQ ID NO: 41 P42L-P113S
  • SEQ ID NO: 34
  • the engineered E. coli host cell can include a Rep protein having at least 90%, at least 95%, at least 98%, at least 99% or 100% identity to an amino acid sequence selected from the group consisting of SEQ ID NO: 39 (P42L-P106I-F107S-P113S), SEQ ID NO: 40 (P42L-A106-107- P113S), SEQ ID NO: 42 (P42L-P106L-F107S, 305aa), SEQ ID NO: 41 (P42L-P113S, 305aa), SEQ ID NO: 34 (ColE2 wild-type), SEQ ID NO: 35 (ColE2 mutant G194D).
  • a Rep protein having at least 90%, at least 95%, at least 98%, at least 99% or 100% identity to an amino acid sequence selected from the group consisting of SEQ ID NO: 39 (P42L-P106I-F107S-P113S), SEQ ID NO: 40 (P42L-A106-107- P113S), SEQ ID NO:
  • nucleic acid sequences encoding the Rep protein in any of the foregoing embodiments can be under the control of a PL promoter and that such PL promoter can enable temperature-sensitive expression of the Rep protein if there is a lambda repressor present in the genome, such as cITs857.
  • the PL promoter can have a sequence having at least 95%, at least 98%, at least 99% or 100% sequence identity to ttgacataaa taccactggc ggtgatact (PL promoter (-35 to -10)), ttgacataaa taccactggc gtgatact (PL promoter OLl-G (-35 to -10)), or ttgacataaa taccactggc gttgatact (PL promoter OLl-G to T (-35 to -10)).
  • Rep protein is a R6K Rep protein such as SEQ ID NOs: 39-42
  • a vector that is transfected into the engineered E. coli host cell can contain a R6K origin of replication and, alternatively, where the Rep protein is a ColE2 Rep protein, a vector that is transfected into the engineered E. coli host cell can contain a ColE2 origin of replication.
  • the engineered E. coli host cell can further include a genomic nucleic acid sequence encoding a genomically expressed RNA-IN regulated selectable marker.
  • the engineered E. coli host cell can include a genomic nucleic acid sequence (which encodes the selectable marker) that has at least 90%, at least 95%, at least 98%, at least 99% or 100% sequence identity to SEQ ID NO: 25 (SacB, 1422 bp).
  • SEQ ID NO: 25 SacB, 1422 bp
  • the coli host cell can include a genomic nucleic acid sequence that encodes the selectable marker which has an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99% or 100% sequence identity to SEQ ID NO: 38 (SacB).
  • the engineered E. coli host cell can include a RNA-IN regulated selectable marker having an amino acid sequence having at least 90%, at least 95%, at least 98%, at least 99% or 100% sequence identity to SEQ ID NO: 38 (SacB).
  • the RNA-IN regulated selectable marker can be downstream of an RNA-IN having the sequence gccaaaaatcaataatcagacaacaagatg; in embodiments where this RNA-IN is used, the corresponding RNA-OUT in a vector can be that of SEQ ID NO: 6 of WO 2019/183248 (SEQ ID NO: 48).
  • the RNA-IN SacB sequence can be gccaaaaatcaataatcagacaacaagatgaacatcaaaaagtttgcaaacaagcaacagtattaacctttactaccgcactgctggca ggaggcgcaactcaagcgtttgcgaaagaaacgaaccaaaagccatataaggaaacatacggcatttcccatattacacgccatgatat gctgcaaatccctgaacagcaaaaaaatgaaaaatatcaagttcctgaattcgattcgtccacaattaaaaatatctcttctgcaaaaggcct ggacgtttggactggacttggacttggacgttggacttggacgttggacttggacgtttggacg
  • the engineered E. coli host cell can further include a genomic nucleic acid sequence encoding a temperature-sensitive lambda repressor.
  • the temperature-sensitive lambda repressor can be cITs857.
  • the engineered E. coli host cell can include a genomic nucleic acid sequence (which encodes the temperature-sensitive lambda repressor) that has at least 90%, at least 95%, at least 98%, at least 99% or 100% sequence identity to SEQ ID NO: 24 (cITs857, 714 bp).
  • coli host cell can further include a genomic nucleic acid sequence encoding cITs857 having an amino acid sequence with at least 90%, at least 95%, at least 98%, at least 99% or 100% sequence identity to SEQ ID NO: 37 (cITs857).
  • the engineered E. coli host cell can further include a temperature-sensitive lambda repressor having an amino acid sequence with at least 90%, at least 95%, at least 98%, at least 99% or 100% sequence identity to SEQ ID NO: 37 (cITs857).
  • coli host cell further includes a genomic nucleic acid sequence encoding a temperature-sensitive lambda repressor, the temperature-sensitive lambda repressor can be a phage cp80 attachment site chromosomally integrated copy of an arabinose inducible CITs857 gene.
  • the cITs857 gene can be under the control of the pBAD promoter to provide arabinose inducibility (pB AD promoter, ctgcataatgtgcctgtcaaatggacgaagcagggattctgcaaaccctatgctactccgtcaagccgtcaattgtctgattcgttaccaatt atgacaacttgacggctacatcattcactttttcttcacaaccggcacggaactcgctcgggctggccccggtgcattttttaaatacccgcg agaaatagagttgatcgtcaaaaccaacattgcgaccgacggtggcgataggcatccgggtggtgctcaaaagcagcttctggctg atacgttggtcctc
  • an engineered E. coli host cell having the following genotype: F- cp801acZAM15 A(lacZYA-argF) U169 recAl endAl hsdR17 (rk-, mk+) gal- phoA supE44 l- thi-1 gyrA96 relAl ASbcDC::kanR.
  • an engineered E. coli host cell having the following genotype: F- cp801acZAM15 A(lacZYA-argF) U169 recAl endAl hsdR17 (rk-, mk+) gal- phoA supE44 l- thi-1 gyrA96 relAl ASbcDC.
  • an engineered E. coli host cell having the following genotype: DH5a att HK 022::pL (OL1-G to T) P42L-P106I-F107S PI 13S (P3-), SpecR StrepR; ASbcDC::kanR.
  • an engineered E. coli host cell having the following genotype: DH5a att HK 022::pL (OL1-G to T) P42L-P106I-F107S PI 13S (P3-), SpecR StrepR; ASbcDC.
  • an engineered E. coli host cell having the following genotype: F- cp801acZAM15 A(lacZYA-argF) U169 recAl endAl hsdR17 (rk-, mk+) gal- phoA supE44 l- thi-1 gyrA96 relAl; ASbcDC::kanR.
  • an engineered E. coli host cell is provided having the following genotype: DH5a dcm-; ASbcDC.
  • an engineered E. coli host cell having the following genotype: DH5a dcm-; ASbcDC: :kanR.
  • an engineered E. coli host cell having the following genotype: DH5a att :: Pc-RNA-IN-SacB, catR; ASbcDC.
  • an engineered E. coli host cell having the following genotype: DH5a att :: Pc-RNA-IN-SacB, catR; ASbcDC: :kanR.
  • an engineered E. coli host cell having the following genotype: DH5a att :: Pc-RNA-IN-SacB, catR; attoxo::pARA-CI857ts P C -RNA-IN- SacB, tetR; ASbcDC.
  • an engineered E. coli host cell having the following genotype: DH5a att :: Pc-RNA-IN-SacB, catR; attoxo::pARA-CI857ts P C -RNA-IN- SacB, tetR; ASbcDC: :kanR.
  • an engineered E. coli host cell having the following genotype: DH5a att :: Pc-RNA-IN-SacB, catR; attHK022::pL (OL1-G to T) P42L- P106I-F107S P113S (P3-), SpecR StrepR; att ⁇ p8 o::pARA-CI857ts, tetR; ASbcDC.
  • an engineered E. coli host cell having the following genotype: DH5a att :: Pc-RNA-IN-SacB, catR; attHK022::pL (OL1-G to T) P42L- P106I-F107S P113S (P3-), SpecR StrepR; att ⁇ p8 o::pARA-CI857ts, tetR; ASbcDC::kanR.
  • an engineered E. coli host cell having the following genotype: DH5a att :: Pc-RNA-IN- SacB, catR; attHK022::pL (OLl-Gto T) P42L- P106I-F107S P113S (P3-), SpecR StrepR; att ⁇ p8 o::pARA-CI857ts Pc-RNA-IN- SacB, tetR; ASbcDC.
  • coli host cell having the following genotype: DH5a att :: Pc-RNA-IN- SacB, catR; attHK022::pL (OLl-Gto T) P42L- P106I-F107S P113S (P3-), SpecR StrepR; attoxo::pARA-CI857ts Pc-RNA-IN- SacB, tetR; ASbcDC::kanR.
  • an engineered E. coli host cell having the following genotype: DH5a dcm- att :: Pc-RNA-IN- SacB, catR; attHK022::pL (OL1-G to T) P42L-P 106I-F 107 S P113S (P3-), SpecR StrepR; att ⁇ p8 o::pARA-CI857ts Pc-RNA-IN- SacB, tetR; ASbcDC.
  • an engineered E. coli host cell having the following genotype: DH5a dcm- att :: Pc-RNA-IN- SacB, catR; attHK022::pL (OL1-G to T) P42L-P 106I-F 107 S P113S (P3-), SpecR StrepR; att ⁇ p8 o::pARA-CI857ts Pc-RNA-IN- SacB, tetR; ASbcDC: :kanR.
  • the SbcC gene can include a sequence having at least 90%, at least 95%, at least 98%, at least 99% or 100% sequence identity to SEQ ID NO: 9.
  • the SbcD gene can include a sequence having at least 90%, at least 95%, at least 98%, at least 99% or 100% sequence identity to SEQ ID NO: 10. It should be understood that this can apply to the gene prior to knockout or knockdown or after, i.e. in the engineered E. coli host cell.
  • a wild-type sequence of SbcC from NCBI Reference Sequence: WP 206061808.1
  • coli K12 is given by Mkilslrlknlnslkgewkidftrepfasnglfaitgptgagkttlldaiclalyhetprlsnvsqsqndlmtrdtaeclaevefevkgea yrafwsqnrarnqpdgnlqvprvelarcadgkiladkvkdkleltatltgldygrftrsmllsqgqfaaflnakpkeraelleeltgteiy gqisamvfeqhksarteleklqaqasgvtlltpeqvqsltaslqvltdeekqlitaqqqeqqslnwltrqdelqqeasrrqqalqqalae eekaqpqlaalslaqparnlrphweriaehsaalahir
  • the sbcB gene can include a sequence having at least 95%, at least 98%, at least 99% or 100% sequence identity to SEQ ID NO: 11.
  • the recB gene can include a sequence having at least 95%, at least 98%, at least 99% or 100% sequence identity to SEQ ID NO: 12.
  • the recD gene can include a sequence having at least 95%, at least 98%, at least 99% or 100% sequence identity to SEQ ID NO: 13.
  • the red gene can include a sequence having at least 95%, at least 98%, at least 99% or 100% sequence identity to SEQ ID NO: 65.
  • the uvrC gene can include a sequence having at least 95%, at least 98%, at least 99% or 100% sequence identity to SEQ ID NO: 14.
  • the mcrA gene can include a sequence having at least 95%, at least 98%, at least 99% or 100% sequence identity to SEQ ID NO: 15.
  • the mcrBC-hsd-mrr gene can include a sequence having at least 95%, at least 98%, at least 99% or 100% sequence identity to SEQ ID NO: 16-21.
  • the engineered E. coli host cell can further include a vector.
  • the vector can be a non-viral transposon vector such as a transposase vector, a Sleeping Beauty transposon vector, a Sleeping Beauty transposase vector, a PiggyBac transposon vector, a PiggyBac transposase vector, an expression vector, and the like, a non-viral gene editing vector such as Homology- Directed Repair (HDR)/CRISPR-Cas9 vectors or a viral vector such as an AAV vector, an AAV rep cap vector, an AAV helper vector, an Ad helper vector, a Lentivirus vector, a Lentiviral envelope vector, a Lentiviral packaging vector, a Retroviral vector, a Retroviral envelope vector, a Retroviral packaging vector, a mRNA vector, or the like.
  • HDR Homology- Directed Repair
  • CRISPR-Cas9 vectors or a viral vector
  • the vector can include a nucleic acid sequence having a palindrome.
  • a palindrome can be understood as a nucleic acid sequence in a double-stranded DNA molecule wherein reading in a certain direction on one strand matches the sequence reading in the opposite direction on the complementary strand, such that there are complementary portions along the one strand, where there is no intervening sequence between the complementary portions.
  • the complementary sequences of the palindrome can each include about 10 to about 200 basepairs, about 15 and to about 200 basepairs, about 20 to about 200 basepairs, about 25 to about 200 basepairs, about 30 to about 200 basepairs, about 40 to about 200 basepairs, about 50 to about 200 basepairs, about 75 to about 200 basepairs, about 100 to about 200 base pairs, about 15 to about 200 basepairs, about 10 to about 150 basepairs, about 15 to about 150 basepairs, about 20 to about 150 base pairs, about 25 to about 150 basepairs, about 30 to about 150 basepairs, about 30 to about 150 basepairs, about 40 to about 150 basepairs, about 50 to about 150 basepairs, about 100 to about 150 base pairs, about 10 to about 140 basepairs, about 15 to about 140 basepairs, about 20 to about 140 basepairs, about 25 to about 140 basepairs, about 30 to about 140 basepairs, about 40 to about 150 basep
  • the vector can include a nucleic acid sequence having at least one direct repeat.
  • the at least one direct repeat can include about 40 to 150 nucleotides, about 60 to about 120 nucleotides or about 90 nucleotides.
  • the at least one direct repeat can be a simple repeat including a short sequence of DNA consisting of multiple repetitions of a single base, such as a polyA repeat, a polyT repeat, a polyC repeat or a polyG repeat, where the simple repeat includes about 40 to about 150 consecutive repeats of the same base, about 60 to about 120 consecutive repeats of the same base, or about 90 consecutive repeats of the same base.
  • the polyA repeat can include 40 to 150 consecutive adenine nucleotides, 60 to 120 consecutive adenine nucleotides, or about 90 adenine nucleotides.
  • the vector can include an inverted repeat sequence, a direct repeat sequence, a homopolymeric repeat sequence, an eukaryotic origin of replication, and a eukaryotic promoter enhancer sequence.
  • the vector can include a sequence selected from the group consisting of a polyA repeat, a SV40 origin of replication, a viral LTR, a Lentiviral LTR, a Retroviral LTR, a transposon IR/DR repeat, a Sleeping Beauty transposon IR/DR repeat, an AAV ITR, a CMV enhancer, and a SV40 enhancer.
  • an AAV vector can contain an AAV ITR.
  • the vector can include a nucleic acid sequence having at least one inverted repeat sequence, which can also be an inverted terminal repeat such as, by way of example, but not limitation, an AAV ITR.
  • the vector can include an AAV ITR.
  • an inverted repeat sequence is a single stranded sequence of nucleotides followed downstream by its reverse complement. It should be further understood that the single stranded sequence can be part of a double-stranded vector.
  • the intervening sequence of nucleotides between the initial sequence and the reverse complement can be any length including zero.
  • the intervening sequence can be 1 to about 2000 basepairs.
  • the inverted repeat which can also be an inverted terminal repeat, can be separated by an intervening sequence comprising about 1 to about 2000 basepairs, about 5 to about 2000 basepairs, about 10 to about 2000 basepairs, about 25 to about 2000 basepairs, about 50 to about 2000 basepairs, about 100 to about 2000 basepairs, about 250 to about 2000 basepairs, about 500 to about 2000 basepairs, about 750 to about 2000 basepairs, about 1000 to about 2000 basepairs, about 1250 to about 2000 basepairs, about 1500 to about 2000 basepairs, about 1750 to about 2000 basepairs, about 1 to about 100 basepairs, about 1 to about 50 basepairs, about 1 to about 25 base
  • the complementary portions of the inverted repeat can each include about 10 to about 200 basepairs, about 15 and to about 200 basepairs, about 20 to about 200 basepairs, about 25 to about 200 basepairs, about 30 to about 200 basepairs, about 40 to about 200 basepairs, about 50 to about 200 basepairs, about 75 to about 200 basepairs, about 100 to about 200 base pairs, about 15 to about 200 basepairs, about 10 to about 150 basepairs, about 15 to about 150 basepairs, about 20 to about 150 base pairs, about 25 to about 150 basepairs, about 30 to about 150 basepairs, about 30 to about 150 basepairs, about 40 to about 150 basepairs, about 50 to about 150 basepairs, about 100 to about 150 base pairs, about 10 to about 140 basepairs, about 15 to about 140 basepairs, about 20 to about 140 basepairs, about 25 to about 140 basepairs, about 30 to about 140 basepairs, about 40 to about 150 basepair
  • the at least one inverted repeat can include an AAV ITR repeat that comprises sequences having at least 95%, at least 95%, at least 98%, at least 99% or 100% sequence identity to ttggccactccctctctgcgcgctcgctcactgaggccgggcgaccaaaggtcgcccgacgcccgggctttgcccgggcggcct cagtgagcgagcgcgcagagagggagtggccaactccatcactaggggttcct (5’ AAV ITR) and aggaacccctagtgatggagttggccactccctctctgcgcgcgcgcgcgcgcactgaggggccactctgcgcgcgcgcgcgcactgaggggccact 5’ AAV ITR) and aggaacccctagtgat
  • the vector can be an AAV vector.
  • the AAV vector comprises an AAV ITR.
  • the vector can be a lentiviral vector, lentiviral envelope vector or lentiviral packaging vector.
  • the vector can be a retroviral vector, retroviral envelope vector or a retroviral packaging vector.
  • the vector can be a transposase vector or a transposon vector.
  • the vector can be a mRNA vector.
  • the mRNA vector can include a polyA repeat as described in the present disclosure.
  • the vector can be a plasmid. In any of the foregoing embodiments, the vector can be a Rep protein dependent plasmid.
  • the vector can further include a RNA selectable marker.
  • the RNA selectable marker can be a RNA-OUT.
  • the RNA-OUT can have at least 95%, at least 98%, at least 99% or 100% sequence identity to a sequence selected from the group consisting of SEQ ID NO: 5 (gtagaattgg taaagagagt cgtgtaaaat atcgagttcg cacatcttgt tgtctgatta ttgatttttg gcgaaaccat ttgatcatat gacaagatgt gtatctacct taacttaatg attttgataaaaatcatta) and SEQ ID NO: 7 (gtagaattgg taaagagagt tgtgtaaat attgagttcg ca
  • the vector can further include a RNA-OUT antisense repressor RNA.
  • the RNA-OUT antisense repressor RNA can have a sequence having at least 90%, at least 95%, at least 98%, at least 99% or 100% sequence identity to SEQ ID NO: 6 of WO 2019/183248 (SEQ ID NO: 48).
  • the vector can further include a bacterial origin of replication.
  • the bacterial origin of replication can be selected from the group consisting of R6K, pUC and ColE2.
  • the bacterial origin of replication can be a R6K gamma replication origin with at least 90%, at least 95%, at least 98%, at least 99% or 100% sequence identity to a sequence selected from the group consisting of SEQ ID NO: 1 (ggcttgttgt ccacaaccgt taaaccttaa aagctttaaa agccttatat attctttttttttcttataaa acttaaaacc ttagaggcta tttaagttgc tgatttatat taattttatt gtcaaacat gagagcttag tacgtgaaac atgagagctt agtacgttag ccatgagagc ttagtacgttt agccatgagg gtttagttcg taaacatga gagcttagt
  • the engineered E. cob host cell can further include a eukaryotic pUC-free mini circle expression vector that can include: (i) a eukaryotic region sequence encoding a gene of interest and having 5’ and 3’ ends; and (ii) a spacer region having a length of less than 1000, preferably less than 500, basepairs that links the 5’ and 3’ ends of the eukaryotic region sequence and that comprises a R6K bacterial replication origin and a RNA selectable marker.
  • the R6K bacterial replication origin and RNA selectable marker can have sequences as described in the present disclosure and as known in the art.
  • the engineered E. coli cell can further include a covalently closed circular plasmid having a backbone including a Pol Ill-dependent R6K origin of replication and an RNA-OUT selectable marker, where the backbone is less than 1000 bp, preferably less than 500 bp, and an insert including a structured DNA sequence.
  • the structured DNA sequence can include a sequence selected from the group consisting of an inverted repeat sequence, a direct repeat sequence, a homopolymeric repeat sequence, an eukaryotic origin of replication, and a euakaryotic promoter enhancer sequence.
  • the structured DNA sequence can include a sequence selected from the group consisting of a polyA repeat, a SV40 origin of replication, a viral LTR, a Lentiviral LTR, a Retroviral LTR, a transposon IR/DR repeat, a Sleeping Beauty transposon IR/DR repeat, an AAV ITR, a CMV enhancer, and a SV40 enhancer.
  • the insert can be a transposase vector, an AAV vector, or a lentiviral vector.
  • the Pol Ill-dependent R6K origin of replication can have a sequence having at least 90%, at least 95%, at least 98%, at least 99% or 100% sequence identity to a sequence selected from the group consisting of SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, SEQ ID NO: 46, and SEQ ID NO: 60 (from SEQ ID Nos: 1-4 and 18 of WO2019/183248).
  • the RNA-OUT selectable marker can be an RNA-IN regulating RNA-OUT functional variant with at least 95%, at least 98%, at least 99% or 100% sequence identity to SEQ ID NO: 47 or SEQ ID NO: 49 (from SEQ ID Nos: 5 and 7 of WO 2019/183248).
  • the RNA-OUT selectable marker can be a RNA- OUT antisense repressor RNA.
  • the RNA-OUT antisense repressor RNA can have a sequence having at least 90%, at least 95%, at least 98%, at least 99% or 100% sequence identity to SEQ ID NO: 6 of WO 2019/183248 (SEQ ID NO: 48).
  • a viability- or yield-reducing mutation refers to a mutation which reduces the viability or yield, respectively, of a cell line with respect to the cell line from which the mutated cell line is derived under the same culture conditions. It should be understood that such mutations can be engineered or naturally-occurring.
  • a gene knockout can result in either abolished expression of a protein or expression of a non-functional protein.
  • the SbcCD complex may or may not be present in the bacterial host strains of the present disclosure, however, if present it is non-functional in the case of a knockout or has reduced activity as a nuclease in the case of a knockdown.
  • embodiments of the disclosure can include a knockout or knockdown of SbcC, SbcD or both.
  • an engineered E. coli host cell can include a vector as described herein.
  • Vectors can include any suitable vector, including those described in those references incorporated herein by reference.
  • the vectors can include a structured DNA sequence.
  • the vectors can not include a structured DNA sequence.
  • the engineered E. coli host cell can further include a vector as understood in the present disclosure.
  • a vector as understood in the present disclosure.
  • Such vectors can be naturally-occurring or engineered.
  • the vectors included in the engineered E. coli host cells of the present disclosure can include any of the features discussed herein and in the documents incorporated by reference.
  • the vectors included in the engineered E. coli host cells of the present disclosure can, for example, include at least one inverted repeat, such as an inverted terminal repeat or palindrome, direct repeat or none of the foregoing structured DNA sequences.
  • a method for producing an engineered E. coli host cell includes the step of knocking out at least one gene selected from the group consisting of SbcC and SbcD in a starting E. coli cell that does not include an engineered viability- or yield-reducing mutation in any of sbcB, recB, recD, and red to yield the engineered E. coli host cell.
  • a method for producing an engineered E. coli host cell includes the step of knocking out at least one gene selected from the group consisting of SbcC and SbcD in a starting E.
  • a method for producing an engineered E. coli host cell includes the step of knocking out at least one gene selected from the group consisting of SbcC and SbcD in a starting E. coli cell that does not include any mutations in any of sbcB, recB, recD, and red to yield the engineered E. coli host cell.
  • the starting E. coli cell can not include any engineered viability- or yield-reducing mutations in at least one of uvrC, mcrA, mcrBC-hsd- mrr, and combinations thereof. In any of the foregoing embodiments, the starting E. coli cell can not include any mutations in at least one of uvrC, mcrA, mcrBC-hsd-mrr, and combinations thereof. In any of the foregoing embodiments, the starting E. coli cell can not include any mutations in at least one of uvrC, mcrA, mcrBC-hsd-mrr, and combinations thereof.
  • the step of knocking out the at least one gene can not result in any mutation of sbcB, recB, recD and red. In any of the foregoing embodiments, the step of knocking out the at least one gene can not result in any mutations in at least one of uvrC, mcRA, mcrBC-hsd-mrr, and combinations thereof.
  • the engineered E. coli host cell can not include an engineered viability- or yield reducing mutation in at least one of uvrC, mcrA, mcrBC-hsd- mrr, and combinations thereof.
  • the engineered E. coli host cell can not include an engineered mutation in at least one of uvrC, mcrA, mcrBC-hsd- mrr, and combinations thereof. In any of the foregoing embodiments, the engineered E. coli host cell can not include any mutation in at least one of uvrC, mcrA, mcrBC-hsd-mrr, and combinations thereof.
  • the engineered E. coli host cell can not include an engineered viability- or yield reducing mutation in sbcB, recB, recD and red. In any of the foregoing embodiments, the engineered E. coli host cell can not include an engineered mutation in sbcB, recB, recD and red. In any of the foregoing embodiments, the engineered E. coli host cell can not include any mutation in sbcB, recB, recD and red.
  • the engineered E. coli host cell does not include a functional SbcCD complex. In any of the foregoing embodiments, the engineered E. coli host cell does not produce a SbcCD complex. Alternatively, in some embodiments, the engineered E. coli host cell produces a non-functional SbcCD complex.
  • the engineered E. coli host cell can be any E. coli host cell of the present disclosure.
  • the SbcC gene can include a sequence having at least 90%, at least 95%, at least 98%, at least 99% or 100% sequence identity to SEQ ID NO: 9.
  • the SbcD gene can include a sequence having at least 90%, at least 95%, at least 98%, at least 99% or 100% sequence identity to SEQ ID NO: 10. It should be understood that this can apply to the gene prior to knockout or knockdown or after, i.e. in the engineered E. coli host cell.
  • the sbcB gene can include a sequence having at least 95%, at least 98%, at least 99% or 100% sequence identity to SEQ ID NO: 11.
  • the recB gene can include a sequence having at least 95%, at least 98%, at least 99% or 100% sequence identity to SEQ ID NO: 12.
  • the recD gene can include a sequence having at least 95%, at least 98%, at least 99% or 100% sequence identity to SEQ ID NO: 13.
  • the red gene can include a sequence having at least 95%, at least 98%, at least 99% or 100% sequence identity to SEQ ID NO: 65.
  • the uvrC gene can include a sequence having at least 95%, at least 98%, at least 99% or 100% sequence identity to SEQ ID NO: 14.
  • the mcrA gene can include a sequence having at least 95%, at least 98%, at least 99% or 100% sequence identity to SEQ ID NO: 15.
  • the mcrBC-hsd-mrr gene can include a sequence having at least 95%, at least 98%, at least 99% or 100% sequence identity to SEQ ID NOs: 16-21.
  • a method for improved vector production includes the step of transfecting an engineered E. coli host cell with a vector yield a transfected host cell and incubating the transfected host cell under conditions sufficient to replicate the vector, where the E. coli host cell does not include an engineered viability- or yield-reducing mutation in any of sbcB, recB, recD, and red.
  • the vector used to transfect the engineered E. coli host cell can be any vector as described in the present disclosure, including the embodiments disclosed where an engineered E. coli host cell of the present disclosure includes a vector.
  • a method for improved vector production includes the step of incubating a transfected host cell that is an engineered E. coli host cell that includes a vector and that does not include an engineered viability- or yield-reducing mutation in any of sbcB, recB, recD, and red, that includes a vector, and incubating the transfected host cell under conditions sufficient to replicate the vector.
  • the engineered E. coli host cell can be any engineered E. coli host cell of the present disclosure.
  • the methods can further include isolating the vector from the transfected host cell.
  • the step of incubating the transfected host cell, whether transfected or after transfection with a vector can be performed by a fed-batch fermentation, where the fed-batch fermentation comprises growing the engineered if coli host cells at a reduced temperature during a first portion of the fed-batch phase, which can be under growth-restrictive conditions, followed by a temperature up-shift to a higher temperature during a second portion of the fed-batch phase.
  • the reduced temperature can be about 28-30°C and the higher temperature can be about 37-42°C.
  • the first portion can be about 12 hours and the second portion can be about 8 hours.
  • the engineered E. coli host cell can have a lambda repressor and Rep protein that is under the control of a PL promoter that can be regulated by the lambda repressor, which can be temperature-sensitive.
  • the plasmid yield after incubating the transfected host cell under conditions sufficient to replicate the vector can be higher than for the cell line from which the engineered E. coli host cell was derived treated under the same conditions. In any of the foregoing embodiments, the plasmid yield after incubating the transfected host cell under conditions sufficient to replicate the vector can be higher than for SURE2, SURE, Stbl2, Stbl3, or Stbl4 cells treated under the same conditions.
  • the SbcC gene can include a sequence having at least 90%, at least 95%, at least 98%, at least 99% or 100% sequence identity to SEQ ID NO: 9.
  • the SbcD gene can include a sequence having at least 90%, at least 95%, at least 98%, at least 99% or 100% sequence identity to SEQ ID NO: 10. It should be understood that this can apply to the gene prior to knockout or knockdown or after, i.e. in the engineered E. coli host cell.
  • the sbcB gene can include a sequence having at least 95%, at least 98%, at least 99% or 100% sequence identity to SEQ ID NO: 11.
  • the recB gene can include a sequence having at least 95%, at least 98%, at least 99% or 100% sequence identity to SEQ ID NO: 12.
  • the recD gene can include a sequence having at least 95%, at least 98%, at least 99% or 100% sequence identity to SEQ ID NO: 13.
  • the red gene can include a sequence having at least 95%, at least 98%, at least 99% or 100% sequence identity to SEQ ID NO: 65.
  • the uvrC gene can include a sequence having at least 95%, at least 98%, at least 99% or 100% sequence identity to SEQ ID NO: 14.
  • the mcrA gene can include a sequence having at least 95%, at least 98%, at least 99% or 100% sequence identity to SEQ ID NO: 15.
  • the mcrBC-hsd-mrr gene can include a sequence having at least 95%, at least 98%, at least 99% or 100% sequence identity to SEQ ID NOs: 16-21.
  • the vector that is transfected into the engineered E. coli host cell can be any vector as described herein.
  • the engineered E. coli host cell can include a knockdown of SbcC, SbcD, or both, rather than a knockout.
  • the knockdown can result in reduced expression and/or reduced activity of the SbcCD complex.
  • the reduction can be by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98%, at least 99% or more.
  • the majority of therapeutic plasmids use the pUC origin which is a high copy derivative of the pMBl origin (closely related to the ColEl origin).
  • plasmid DNA synthesis is unidirectional and does not require a plasmid borne initiator protein.
  • the pUC origin is a copy up derivative of the pMBl origin that deletes the accessory ROP (rom) protein and has an additional temperature sensitive mutation that destabilizes the RNAI/RNAII interaction. Shifting of a culture containing these origins from 30 to 42°C leads to an increase in plasmid copy number.
  • pUC plasmids can be produced in a multitude of E. coli cell lines.
  • Plasmid+ shake culture medium for shake flask production proprietary Plasmid+ shake culture medium was used.
  • the seed cultures were started from glycerol stocks or colonies and streaked onto LB medium agar plates containing 50 pg/mL antibiotic (for ampR or kanR selection plasmids) or 6% sucrose (for RNA-OUT selection plasmids).
  • the plates were grown at 30-32°C; cells were resuspended in media and used to provide approximately 2.5 O ⁇ oo inoculums for the 500 mL Plasmid+ shake flasks that contained 50 pg/mL antibiotic for ampR or kanR selection plasmids or 0.5% sucrose to select for RNA-OUT plasmids. Flask were grown with shaking to saturation at the growth temperatures as indicated.
  • HyperGRO fermentations were performed using proprietary fed-batch media (NTC3019, HyperGRO media) in New Brunswick BioFlo 110 bioreactors as described (U.S. Patent No. 7,943,377, which is incorporated herein by reference in its entirety).
  • the seed cultures were started from glycerol stocks or colonies and streaked onto LB medium agar plates containing 50 pg/mL antibiotic (for ampR or kanR selection plasmids) or 6% sucrose (for RNA-OUT selection plasmids).
  • the plates were grown at 30- 32°C; cells were resuspended in media and used to provide approximately 0.1% inoculums for the fermentations that contained 50 pg/mL antibiotic for ampR or kanR selection plasmids or 0.5% sucrose for RNA-OUT plasmids. HyperGRO temperature shifts were as indicated.
  • culture samples were taken at key points and regular intervals during all fermentations. Samples were analyzed immediately for biomass (O ⁇ oo) and for plasmid yield. Where plasmid yield was determined, the analysis was performed by quantification of plasmid obtained from Qiagen Spin Miniprep Kit preparations as described in U.S. Patent No. 7,943,377. Briefly, cells were alkaline lysed, clarified, plasmid was column purified, and eluted prior to quantification. Plasmid quality was determined by agarose gel electrophoresis analysis (AGE) and was performed on 0.8-1% Tris/acetate/EDTA (TAE) gels as described in Ei.S. Patent No. 7,943,377.
  • AGE agarose gel electrophoresis analysis
  • TAE Tris/acetate/EDTA
  • RNA-QUT antibiotic free selectable marker background Antibiotic-free selection is performed in E. coli strains containing phage lambda attachment site chromosomally integrated pCAH63-CAT RNA-IN-SacB (P5/66/6) for example NTC4862 as described in WO 2008/153733.
  • SacB Bacillus subtilis levansucrase
  • SacB Bacillus subtilis levansucrase
  • SacB Bacillus subtilis levansucrase
  • Translation of SacB from the RNA-IN-SacB transcript is inhibited by plasmid encoded RNA-OUT. This facilitates plasmid selection in the presence of sucrose, by inhibition of SacB mediated lethality.
  • R6K origin vector replication background The R6K gamma plasmid replication origin requires a single plasmid replication protein 77 that binds as a replication initiating monomer to multiple repeated ‘iteron’ sites (seven core repeats containing TGAGNG consensus) and as a replication inhibiting dimer to repressive sites (TGAGNG) and to iterons with reduced affinity. Replication requires multiple host factors including IHF, DnaA, and primosomal assembly proteins DnaB, DnaC, DnaG (Abhyankar etal ., 2003 J Biol Chem 278:45476-45484). The R6K core origin contains binding sites for DnaA and IHF that affect plasmid replication since 77, IHF and DnaA interact to initiate replication.
  • R6K gamma replication origin has been utilized in various eukaryotic expression vectors, for example pCOR vectors (Soubrier et al ., 1999, Gene Therapy 6:1482-88) and a CpG free version in pCpGfree vectors (Invivogen, San Diego CA), and pGM169 (University of Oxford).
  • pCOR vectors Sudbrier et al ., 1999, Gene Therapy 6:1482-88
  • CpG free version in pCpGfree vectors Invivogen, San Diego CA
  • pGM169 Universality of Oxford
  • a highly minimalized 6 iteron R6K gamma derived replication origin that contains core sequences required for replication (including the DnaA box and stb 1-3 sites; Wu etal, 1995. J Bacteriol.
  • This R6K origin contains 6 tandem direct repeat iterons.
  • the NTC9385R NanoplasmidTM vector including this minimalized R6K origin and the RNA-OUT AF (antibiotic-free) selectable marker in the spacer region was described in WO 2014/035457 and included herein by reference.
  • An R6K origin containing 7 tandem direct repeat iterons and an R6K origin contains 6 tandem direct repeat iterons and a single CpG residue were described in WO 2019183248 and included herein by reference.
  • Use of a conditional replication origin such as R6K gamma that requires a specialized cell line for propagation adds a safety margin since the vector will not replicate if transferred to a patient’s endogenous flora.
  • Typical R6K production strains express from the genome the 77 protein derivative PIR116 that contains a P106L substitution that increases copy number (by reducing 77 dimerization; 77 monomers activate while 77 dimers repress). Fermentation results with pCOR (Soubrier et al, Supra, 1999) and pCpG plasmids (Hebei HL, Cai Y, Davies LA, Hyde SC, Pringle IA, Gill DR. 2008. Mol Ther 16: SI 10) were low, around 100 mg/L in PIR116 cell lines.
  • TEX2pir42 strain contains a combination of P106L and P42L.
  • the P42L mutation interferes with DNA looping replication repression.
  • the TEX2pir42 cell line improved copy number and fermentation yield with pCOR plasmids with reported yields of 205 mg/L (Soubrier F. 2004. International Patent Application W02004/033664).
  • WO 2014/035457 describes host strains expressing phage HK022 attachment site integrated pL promoter heat inducible 77 P42L, P106L and F107S high copy mutant replication (Rep) protein for selection and propagation of R6K origin NanoplasmidTM vectors.
  • NTC1050811 DH5a att :: Pc-RNA-IN-SacB, catR; attHK022::pL (OLl-Gto T) P42L- P106I-F107S P113S (P3-), SpecR StrepR; att ⁇ p8 o::pARA-CI857ts, tetR pARA-CI857ts derivative of NTC940211.
  • This ’copy cutter’ host strain contains a phage cp80 attachment site chromosomally integrated copy of a arabinose inducible CI857ts gene. Addition of arabinose to plates or media ( e.g .
  • NTC 1050811-HF is a derivative of the NTC 1050811 cell line that includes a second copy of the RNA-IN-SacB expression cassette, and that does not have mutations in sbcB, recB, recD, red, uvrC, mcrA or mcrBC-hsd-mrr.
  • both strains (NTC 1050811 and NTC 1050811-HF) contain a phage cp80 attachment site chromosomally integrated copy of a arabinose inducible CI857ts gene.
  • NanoplasmidTM production yields are improved with the quadruple mutant heat inducible pL (OLl-Gto T) P42L-P106I-F107S P113S (P3-) described in WO 2019/183248 compared to the triple mutant heat inducible pL (OL1-G to T) P42L-P106L-F107S (P3-) described in WO 2014/035457. Yields in excess of 2 g/L NanoplasmidTM have been obtained with the quadruple mutant NTC 1050811 cell line (WO 2019/183248).
  • conditional replication origin such as these R6K origins that requires a specialized cell line for propagation adds a safety margin since the vector will not replicate if transferred to a patient’s endogenous flora.
  • RNA-OUT production hosts described in WO 2019/183248 were modified to create HF hosts.
  • SacB Bacillus subtilis levansucrase
  • SacB Bacillus subtilis levansucrase
  • Translation of SacB from the RNA-IN-SacB transcript is inhibited by plasmid encoded RNA-OUT. This facilitates plasmid selection in the presence of sucrose, by inhibition of SacB mediated lethality.
  • Mutation of the chromosomal copy of the RNA-IN-SacB expression cassette that eliminate SacB expression are sucrose resistant (in the absence of plasmid).
  • RNA-IN-SacB expression cassette dramatically reduces the numbers of sucrose resistant (in the absence of plasmid) colonies, since each individual RNA-IN-SacB expression cassette copy mediates sucrose lethality in the absence of plasmid very rare mutations to both chromosomal copies of RNA-IN-SacB expression cassettes is necessary to obtain sucrose resistant in the absence of plasmid.
  • NTC1011592 Stbl4 attk Pc-RNA-IN-SacB, catR (WO 2019/183248) was also used.
  • EXAMPLE 1 Preparation of SbcCD Knockout Strains [00223] SbcCD knockout strains were produced using Red Gam recombination cloning as described in Datsenko and Wanner, PNAS USA 97:6640-6645 (2000). The pKD4 plasmid (Datsenko and Wanner, 2000) was PCR amplified with the following primers to introduce SbcC and SbcD targeting homology arms.
  • the host strain in which the SbcCD genes were to be knocked out was transformed with pKD46-RecApa recombineering plasmid (WO 2008/153731, which is incorporated by reference herein in its entirety) and transformants selected for ampicillin resistance.
  • Electrocompetent cells of the transformed cell line were made by growth in LB medium including 50 pg/mL ampicillin, at approximately 0.05 O ⁇ oo, arabinose was added to 0.2% to induce recombineering gene expression, the cells were grown to mid-log phase and electrocompetent cells made by centrifugation and resuspension in 10% glycerol at 1/200 original volume.
  • SEQ ID NO 3 SEQ ID NO 3 (SbcDF primer): cgtctcgccatgatttgccctg SEQ ID NO 4 (SbcCR primer): cgttatgcgccagctccgtgag
  • the temperature-sensitive pKD46-recApa plasmid was cured from the cell lines by growing at 37-42°C. Ampicillin sensitivity of the individual kanR colonies was also verified.
  • kanR chromosomal marker was removed from ASbcDC::kanR using FRT recombination as described (Datsenko and Wanner, Supra , 2000). Briefly the ASbcDC::kanR cell line was transformed with pCP20 FRT plasmid (Datsenko and Wanner, Supra , 2000) and transformants grown at 30°C and selected for ampicillin resistance. Individual colonies were streaked for single colonies on LB medium plates (without ampicillin) and grown at 43 °C to cure the temperature sensitive pCP20 plasmid.
  • antibiotic resistance plasmids e.g. pUC replication origin; antibiotic selection; R6K replication origin; antibiotic selection
  • the kanR chromosomal marker was removed from ASbcDC::kanR using FRT recombination as described (Datsenko and Wanner, Supra , 2000). Briefly the ASbcDC::kanR cell line was transformed with pCP20 FRT plasmid (Datsenko and Wanner
  • the starting strain had the following genotype: F- cp801acZAM15 A(lacZYA-argF) U169 recAl endAl hsdR17 (rk-, mk+) gal- phoA supE44 l- thi-1 gyrA96 relAl.
  • the knockout strain (DH5a [SbcCD- ]) has the following genotype: F- cp801acZAM15 A(lacZYA-argF) U169 recAl endAl hsdR17 (rk-, mk+) gal- phoA supE44 l- thi-1 gyrA96 relAl ASbcDC.
  • An additional strain will be produced from DH5a [SbcCD-] by integrating a heat- inducible R6K rep protein cassette (attHK022::pL (OL1-G to T) P42L-P106I-F107S PI 13S (P3-), SpecR StrepR) into the host genome as described in WO 2014/035457 to yield a new strain, DH5a R6K Rep [SbcCD-], which will have the genotype: DH5a attHK022::pL (OL1-G to T) P42L-P106I-F107S PI 13S (P3-), SpecR StrepR; ASbcDC.
  • This strain can be used for the production of plasmids having a R6K bacterial origin of replication.
  • NTC 1050811 which has the genotype DH5a att :: Pc-RNA-IN-SacB, catR; attHK022::pL (OL1-G to T) P42L- P106I-F107S PI 13S (P3-), SpecR StrepR; att ⁇ p8 o::pARA-CI857ts, tetR as diclosed in WO 2019/183248 was also treated via the same method to knockout SbcDC but without kanR excision to yield NTC1300441 (DH5a ASbcDC) which has a genotype of DH5a att :: Pc-RNA- IN-SacB, catR; att HK 022::pL (OLl-Gto T) P42L-P106I-F107S P113S (P3-), SpecR StrepR; attoxo::p
  • NTC 1050811-HF which is a derivative of NTC 1050811 that includes a second copy of the RNA-IN-SacB expression cassette, without mutations in sbcB, recB, recD, red, uvrC and mcrA was also used to generate a knockout strain by the same method to yield NTC 1050811-HF [SbcCD-] which does not have kanR excised.
  • NTC4862-HF which is a derivative of NTC4862 as disclosed in WO 2008/153733 that includes a second copy of the RNA-IN-SacB expression cassette and which does not have mutations in sbcB, recB, recD, recJ, uvrC and mcrA was used to generate a knockout strain by the same method to yield NTC4862-HF [SbcCD-] which does not have kanR excised.
  • SbcCD knockout strains were evaluated for their performance with large palindrome vectors, including evaluation of shake flask and HyperGRO production.
  • NTC1011641 (Genotype: Stbl4 att,:: Pc-RNA-IN-SacB, catR; attH K 022::pL P42L- P106L-F107S (P3-) SpecR StrepR, as disclosed in WO 2019/183248) and NTC1300441 (Genotype: DH5a att /.
  • pAAV-GFP MIP was recoverable in a DH5a ASbcDC host strain and had excellent shake flask production yields (see Table 2).
  • the AAV ITR had a 26 bp palindromic sequence separated by 43 bp.
  • Table 2 DH5a SbcCD host strain enables viability of 140 bp inverted repeat vector
  • Production conditions 500 m Plasmid+ culture, 30°C 12 hrs, shift to 37°C for 8 hrs. aNanoplasmid vector with spacer region R6K origin and RNA-OUT selection. bNanoplasmid vector with intronic R6K origin and RNA-OUT selection.
  • EXAMPLE 3 SbcCD knockout strain performance with AAV ITR Vectors: ITR Stability and Shake Flask Production
  • AAV ITRs are very difficult sequence using conventional sequencing (Doherty et al, Supra , 1993) but can be accurately sequenced using Next Generation Sequencing (Saveliev A Liu J, Li M, Hirata L, Latshaw C, Zhang J, Wilson JM. 2018. Accurate and rapid sequence analysis of Adeno- Associated virus plasmid by IlluminaNext Generation Sequencing. Hum Gene Ther Methods 29:201-211).
  • Table 7 pAAV-GFP Nanoplasmid (3.3 kb) (R6K origin, RNA-OUT selection) shake flask evaluation a Flask A contains 500 mL Plasmid+, 5 mLs 50% sucrose Flask B contains 500 mL Plasmid+, 5 mLs 50% sucrose, 5 mLs 20% Arabinose b Production conditions: 30C 12 hrs, shift to 37C for 8 hrs
  • Table 9 pAAV-GFP Nanoplasmid (3.3 kb) (R6K origin, RNA-OUT selection) HyperGRO fermentation evaluation b 30°C, Shift to 42°C at 550D600, for 9 hr, 25°C Hold; 0.2% Arabinose in medium
  • Table 10 pAAV vector (12 kb pUC origin-kanR) HyperGRO fermentation evaluation b 30— >37°C ramp 24-36h c 30°C, Shift to 37°C at 550D600 until OD drops or lysis, 25°C Hold d 30°C, Shift to 37°C at 30 h until OD drops or lysis, 25°C Hold [00242] Summary: The DH5a SbcCD host showed improved plasmid production and/or plasmid quality compared to the Stbl3 or Stbl4 host with AAV ITR vectors, especially with larger therapeutic transgene encoding AAV ITR vectors (Table 10).
  • DH5a [SbcCD-] was evaluated versus DH5a for production yield of a standard vector (12 kb pHelper vector, pUC origin-kanR selection). The results indicated that DH5a [SbcCD-] is superior to DH5a for production of standard plasmids.
  • EXAMPLE 6 Improved Plasmid poly A Repeat Stability in DH5a TSbcCD-l Compared to Stbl4
  • a pUC-AmpR plasmid vector encoding a A90 repeat was transformed into Stbl4 or DH5a [SbcCD-] and the stability of the A90 repeat in 4 individual colonies from each transformation were determined by sequencing. All 4 of the Stbl4 colonies had deleted at least 20 bps of the A90 repeat (i.e. all 4 colonies were ⁇ A70) while all 4 of the DH5a [SbcCD-] colonies were >A70 and 2/4 had intact A90 repeats.
  • Plasmid vectors encoding an A117 repeat were transformed into DH5a [SbcCD-] and NTC 1050811-HF [SbcCD-] and the stability of the A117 repeat was determined by sequencing.
  • the cells were cultured at 30°C for 12 hours and ramped to 37°C at 24 EFT until the OD dropped or lysis was observed, after which the cells were held at 25°C, under HyperGro conditions as in Example 4. All of the transformed cells lines (2 DH5a [SbcCD-], 2 NTC1050811-HF [SbcCD-]) had intact A117 repeats and high yield as shown in Table 12 below. This was unexpected since SbcCD knockout would not be expected to stabilize simple repeats.
  • Table 12 A117 Repeat stability and production in engineered E. coli host cells
  • Table 13 polyA Repeat stability and production in engineered E. coli host cells
  • DH1 JM107, JM108, JM109, MG1655, XLlBlue and like cell lines and may use SLiRE, SEIRE2, Stbl2, Stbl3, Stbl4 and non-SbcC, SbcD and/or SbcCD knockout strains.

Landscapes

  • Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • Biotechnology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Biomedical Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Microbiology (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Medicinal Chemistry (AREA)
  • Virology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
PCT/US2021/022002 2020-03-11 2021-03-11 Bacterial host strains Ceased WO2021183827A2 (en)

Priority Applications (8)

Application Number Priority Date Filing Date Title
EP21768967.8A EP4118213A4 (en) 2020-03-11 2021-03-11 BACTERIAL HOST STRAINS
AU2021233908A AU2021233908A1 (en) 2020-03-11 2021-03-11 Bacterial host strains
JP2022554786A JP7833134B2 (ja) 2020-03-11 2021-03-11 細菌宿主株
KR1020227034771A KR20220153606A (ko) 2020-03-11 2021-03-11 박테리아 숙주 균주
CN202180029390.3A CN115461463A (zh) 2020-03-11 2021-03-11 细菌宿主菌株
CA3170890A CA3170890A1 (en) 2020-03-11 2021-03-11 Bacterial host strains
US17/931,000 US20230132250A1 (en) 2020-03-11 2022-09-09 Bacterial host strains
JP2025200458A JP2026048673A (ja) 2020-03-11 2025-11-20 細菌宿主株

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US202062988223P 2020-03-11 2020-03-11
US62/988,223 2020-03-11

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US17/931,000 Continuation US20230132250A1 (en) 2020-03-11 2022-09-09 Bacterial host strains

Publications (2)

Publication Number Publication Date
WO2021183827A2 true WO2021183827A2 (en) 2021-09-16
WO2021183827A3 WO2021183827A3 (en) 2021-10-14

Family

ID=77670966

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2021/022002 Ceased WO2021183827A2 (en) 2020-03-11 2021-03-11 Bacterial host strains

Country Status (8)

Country Link
US (1) US20230132250A1 (https=)
EP (1) EP4118213A4 (https=)
JP (2) JP7833134B2 (https=)
KR (1) KR20220153606A (https=)
CN (1) CN115461463A (https=)
AU (1) AU2021233908A1 (https=)
CA (1) CA3170890A1 (https=)
WO (1) WO2021183827A2 (https=)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2023122625A3 (en) * 2021-12-20 2023-10-26 Intergalactic Therapeutics, Inc. Production of gene therapy vector in engineered bacteria
WO2024263541A1 (en) * 2023-06-21 2024-12-26 Aldevron, Llc Gene therapy vectors and methods of production and use thereof
WO2025231315A2 (en) 2024-05-03 2025-11-06 Aldevron, L.L.C. Bacterial host strains

Families Citing this family (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN115851795B (zh) * 2022-07-19 2023-09-01 广州派真生物技术有限公司 一种高产质粒、其构建方法及其应用
EP4692314A1 (en) * 2023-03-24 2026-02-11 Nanjing GenScript Biotech Co., Ltd. Host cell for improving stability of plasmid
WO2025041806A1 (ja) * 2023-08-22 2025-02-27 株式会社シンプロジェン リボ核酸生産技術
DE102023134327A1 (de) * 2023-12-07 2025-06-12 Universität Bielefeld, Körperschaft des öffentlichen Rechts Vermehrung von Plasmiden, die mindestens einen Inverted Repeat enthalten
WO2025122955A1 (en) * 2023-12-08 2025-06-12 University Of Massachusetts Delivery of oncolytic viruses with engineered salmonella

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE19633698A1 (de) * 1996-08-21 1998-02-26 Lubitz Werner Prof Dr Neue Systeme zur Regulation der Genexpression
AU2002306849A1 (en) * 2001-03-21 2002-10-08 Elitra Pharmaceuticals, Inc. Identification of essential genes in microorganisms
MX2007001889A (es) * 2004-08-19 2007-05-09 Nature Technology Corp Proceso para la fermentacion de adn de plasmido.
US9550998B2 (en) * 2012-08-29 2017-01-24 Nature Technology Corporation DNA plasmids with improved expression
WO2019183248A1 (en) * 2018-03-21 2019-09-26 Nature Technology Corporation Viral and non-viral nanoplasmid vectors with improved production
CN110016459B (zh) * 2019-04-29 2021-03-19 江南大学 一种生产β-丙氨酸的重组大肠杆菌及其厌氧发酵的方法

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2023122625A3 (en) * 2021-12-20 2023-10-26 Intergalactic Therapeutics, Inc. Production of gene therapy vector in engineered bacteria
EP4453181A4 (en) * 2021-12-20 2025-12-24 Aldevron Llc GENE THERAPY VECTOR PRODUCTION IN MODIFIED BACTERIA
WO2024263541A1 (en) * 2023-06-21 2024-12-26 Aldevron, Llc Gene therapy vectors and methods of production and use thereof
WO2025231315A2 (en) 2024-05-03 2025-11-06 Aldevron, L.L.C. Bacterial host strains
WO2025231315A3 (en) * 2024-05-03 2026-01-02 Aldevron, L.L.C. Bacterial host strains

Also Published As

Publication number Publication date
AU2021233908A1 (en) 2022-09-29
US20230132250A1 (en) 2023-04-27
JP7833134B2 (ja) 2026-03-19
JP2026048673A (ja) 2026-03-17
KR20220153606A (ko) 2022-11-18
EP4118213A2 (en) 2023-01-18
EP4118213A4 (en) 2024-04-17
WO2021183827A3 (en) 2021-10-14
CA3170890A1 (en) 2021-09-16
CN115461463A (zh) 2022-12-09
JP2023517682A (ja) 2023-04-26

Similar Documents

Publication Publication Date Title
US20230132250A1 (en) Bacterial host strains
CN112154208B (zh) 产生改进的病毒和非病毒纳米质粒载体
US20230242924A1 (en) DNA Plasmids with Improved Expression
US9988637B2 (en) Cas9 plasmid, genome editing system and method of Escherichia coli
CN112805386B (zh) 含有编码具有节段多聚(A)尾的mRNA的序列的质粒
US10167478B2 (en) Replicative minicircle vectors with improved expression
JP7189943B2 (ja) 細胞の遺伝子修飾のための非組込みdnaベクター
Williams et al. Generic plasmid DNA production platform incorporating low metabolic burden seed‐stock and fed‐batch fermentation processes
JP7688155B2 (ja) 選択マーカーのないプラスミドシステム及びその生産方法
WO2025231315A2 (en) Bacterial host strains
HK40129088A (zh) 产生改进的病毒和非病毒纳米质粒载体
WO2025160245A1 (en) Viral and non-viral nanoplasmid vectors with improved production
WO2026076187A1 (en) Compositions and methods for microbial production of antibiotic-free closed-ended linear dna
WO2025175381A1 (en) Plasmid and method for production of dna vaccines and dna products

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21768967

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 3170890

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2022554786

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2021233908

Country of ref document: AU

Date of ref document: 20210311

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20227034771

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 202217057390

Country of ref document: IN

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021768967

Country of ref document: EP

Effective date: 20221011