WO2021142153A1 - Image differentiated multiplex assays for detection of dna mutations in lung cancer - Google Patents

Image differentiated multiplex assays for detection of dna mutations in lung cancer Download PDF

Info

Publication number
WO2021142153A1
WO2021142153A1 PCT/US2021/012541 US2021012541W WO2021142153A1 WO 2021142153 A1 WO2021142153 A1 WO 2021142153A1 US 2021012541 W US2021012541 W US 2021012541W WO 2021142153 A1 WO2021142153 A1 WO 2021142153A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
probe
dna
gene
sequence
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2021/012541
Other languages
English (en)
French (fr)
Inventor
Dean TSAO
Chin-Shiou Huang
Shian Pin Hu
Fei-yu CHANG
Yi Ling Hsieh
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
PlexBio Co Ltd
Original Assignee
PlexBio Co Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by PlexBio Co Ltd filed Critical PlexBio Co Ltd
Priority to CN202180018443.1A priority Critical patent/CN115210385A/zh
Priority to EP21738790.1A priority patent/EP4087948A4/en
Priority to US17/758,511 priority patent/US20230052147A1/en
Priority to JP2022542157A priority patent/JP2023510304A/ja
Publication of WO2021142153A1 publication Critical patent/WO2021142153A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/68Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
    • C12Q1/6876Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
    • C12Q1/6883Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material
    • C12Q1/6886Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material for cancer
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/68Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
    • C12Q1/6813Hybridisation assays
    • C12Q1/6827Hybridisation assays for detection of mutation or polymorphism
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/68Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
    • C12Q1/6813Hybridisation assays
    • C12Q1/6834Enzymatic or biochemical coupling of nucleic acids to a solid phase
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q2600/00Oligonucleotides characterized by their use
    • C12Q2600/106Pharmacogenomics, i.e. genetic variability in individual responses to drugs and drug metabolism
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q2600/00Oligonucleotides characterized by their use
    • C12Q2600/112Disease subtyping, staging or classification
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q2600/00Oligonucleotides characterized by their use
    • C12Q2600/156Polymorphic or mutational markers
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q2600/00Oligonucleotides characterized by their use
    • C12Q2600/158Expression markers
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q2600/00Oligonucleotides characterized by their use
    • C12Q2600/16Primer sets for multiplex assays

Definitions

  • microcarriers are encoded with an identifier and include a probe for detection of a mutation of interest.
  • Immunological and molecular diagnostic assays play a critical role both in the research and clinical fields. Often it is necessary to perform assays for a panel of multiple targets to gain a meaningful or bird’s-eye view of results to facilitate research or clinical decision-making. This is particularly true in the era of genomics and proteomics, where an abundance of genetic markers and/or biomarkers are thought to influence or be predictive of particular disease states.
  • assays of multiple targets can be accomplished by testing each target separately in parallel or sequentially in different reaction vessels (i.e., multiple smgleplexing).
  • assays adopting a singleplexing strategy often cumbersome, but they also typically required large sample volumes, especially when the targets to be analyzed are large in number.
  • a multiplex assay simultaneously measures multiple analytes (two or more) in a single assay
  • Multiplex assays are commonly used in high-throughput screening settings, where many specimens can be analyzed at once. It is the ability to assay many analytes simultaneously and many specimens in parallel that is the hallmark of multiplex assays and is the reason that such assays have become a powerful tool in fields ranging from drug discovery to functional genomics to clinical diagnostics. In contrast to singleplexing, by combining all targets in the same reaction vessel, the assay is much less cumbersome and much easier to perform, since only one reaction vessel is handled per sample.
  • test samples can thus be dramatically reduced in volume, which is especially important when samples (e.g, tumor tissues, cerebral spinal fluid, or bone marrow) are difficult and/or invasive to retrieve in large quantities. Equally important is the fact that the reagent cost can be decreased and assay throughput increased drastically.
  • agents capable of specifically capturing the target macromolecules are attached to a solid phase surface. These immobilized molecules may be used to capture the target macromolecules from a complex sample by various means, such as hybridization (e.g., in DNA, RNA based assays).
  • detection molecules are incubated with and bind to the complex of capture molecule and the target, emitting signals such as fluorescence or other electromagnetic signals. The amount of the target is then quantified by the intensity of those signals.
  • Multiplex assays may be carried out by utilizing multiple capture agents, each specific for a different target macromolecule.
  • each type of capture agent e.g., a single-stranded oligonucleotide probe
  • the amount of multiplex targets in a complex sample is determined by measuring the signal of the detection molecule at each position corresponding to a type of capture agent.
  • microparticles or microcarriers are suspended in the assay solution. These microparticles or microcarriers contain an identification element, which may be embedded, printed, or otherwise generated by one or more elements of the microparticle/microcarrier.
  • Each type of capture agent is immobilized to particles with the same ID, and the signals emitted from the detection molecules on the surface of the particles with a particular ID reflect the amount of the corresponding target.
  • multiplex assays are particularly well-suited.
  • detecting mutations associated with lung cancer can aid in early diagnosis and in identifying patients suitable for targeted therapies, depending on the genetic makeup of their cancers.
  • existing diagnostic techniques are often expensive or time-consuming.
  • Methods for detecting multiple gene mutations using serial, individual assays are time consuming and suffer from lack of uniformity if carried out using different assay types (see Schneider, M. etal (2011) Cancers 3:91-105).
  • Applying multiplex assay technologies such as analog-encoded microcarriers to this problem can provide cheaper, quicker assays with more accurate results while enabling multiplex screening for many mutations known to be correlated with tumorigenesis in a single assay.
  • microcarriers encoded with a unique identifier, that include a probe for detecting a DNA or RNA mutation, e.g. , a mutation associated with lung cancer.
  • These microcarriers may be used in multiplexed assays in which each microcarrier includes a probe for detecting a particular mutation and an identifier for correlation of the microcarrier and its associated probe.
  • the methods and kits disclosed herein may find use, e.g., in monitoring lung cancer, monitonng response to treatment of lung cancer, and/or early screening/detection of lung cancer.
  • a method for detecting the presence of DNA mutations in the KRAS, NBAS, PIK3CA, BRAF, EGFR, AKT1, MEK1, and HER2 genes comprising: (a) isolating DNA from a sample (e.g., obtained from a patient); (b) amplifying the isolated DNA by polymerase chain reaction (PCR) using primer pairs specific for the loci of one or more DNA mutations in each of the KRAS, NRAS, PIK3CA, BRAF, EGFR, AKT1, MEK1, and H R 2 genes (e.g., in vitro) (c) hybridizing the amplified DNA with at least seven probes, said at least seven probes comprising one or more probes specific for a DNA mutation in each of the KRAS, NRAS, PIK3CA, BRAF, EGFR, AKT1, MEK1, andPlER2 genes, wherein each of said at least seven probes is coupled
  • step (b) comprises amplifying the isolated DNA by PCR in the presence of at least seven blocking nucleic acids, wherein each of said at least seven blocking nucleic acids hybndizes with a wild-type DNA locus corresponding with one of the DNA mutations in the KRAS, PIK3CA, BRAF , EGFR, AKTI,MEKI , or HER2 genes and prevents amplification of the wild-type DNA locus.
  • each of said at least seven blocking nucleic acids comprises: a single-stranded oligonucleotide that hybridizes with the corresponding wild-type DNA locus; and a 3’ terminal moiety that blocks extension from the single-stranded oligonucleotide.
  • the 3’ terminal moiety comprises one or more inverted deoxythymidines.
  • each of said at least seven blocking nucleic acids comprises one or more modified nucleotides selected from the group consisting of locked nucleic acids (LNAs), peptide nucleic acids (PNAs), hexose nucleic acids (HNAs), threose nucleic acids (TNAs), glycol nucleic acids (GNAs), and cyclohexenyl nucleic acids (CeNAs).
  • LNAs locked nucleic acids
  • PNAs peptide nucleic acids
  • HNAs hexose nucleic acids
  • TAAs threose nucleic acids
  • GNAs glycol nucleic acids
  • CeNAs cyclohexenyl nucleic acids
  • the one or more DNA mutations in the KRAS gene comprise one or more DNA mutations encoding a G12D, G12V, or G12C mutated KRAS protein. In some embodiments, the one or more DNA mutations in the KRAS gene comprise DNA mutations encoding G12D, G12V, and G12C mutated KRAS proteins.
  • the probes specific for one or more DNA mutations in the KRAS gene comprise: (1) a first probe comprising a sequence selected from the group consisting of TAGTTGGAGCT (SEQ ID NO:38), TGTGGTAGTTG (SEQ ID NO:40), TGATGGCGTAG (SEQ ID NO:42), TGGAGCTGATGGC (SEQ ID NO:44), and GCGTAGGCAAG (SEQ ID NO:46); (2) a second probe comprising a sequence selected from the group consisting of CTGTTGGCGTAGG (SEQ IDNO:48), GTAGTTGGAGCTG (SEQ ID NO:50), TGGAGCTGTTGGC (SEQ ID NO:52), TT GT GGT AGTTGG (SEQ ID NO:54), and GGCGTAGGCAAGA (SEQ ID NO:56); and (3) a third probe comprising a sequence selected from the group consisting of TAGTTGGAGCTT (SEQ ID NO:58), GCGTAGGCAAGA (SEQ ID NO:60),
  • each of the three probes further comprises eight nucleotides at the 5’ end, and wherein the eight nucleotides at the 5’ end are adenine or thymine nucleotides.
  • the probes specific for one or more DNA mutations in the KRAS gene comprise: (1) a first probe comprising a sequence selected
  • step (b) comprises amplifying the isolated DNA by PCR using a primer pair comprising the sequences GT ACTGGTGGAGTATTTGAT AGTG (SEQ ID NO: 1) and
  • step (b) comprises amplifying the isolated DNA by PCR in the presence of a blocking nucleic acid that hybridizes with a wild-type KRAS DNA locus corresponding with one of the KRAS DNA mutations and prevents amplification of the wild-type KRAS DNA locus, and wherein the blocking nucleic acid comprises the sequence TACGCCACCAGCT(invdT) «, wherein n is 1. 2. or 3 (SEQ ID NO:281); TT G G A G CT G 7 G G CGT A ( i n v dT T , .
  • n is 1, 2, or 3 (SEQ ID NO:282); GCTGGTGGCGTAGGCA(invdT) «, wherein n is 1, 2, or 3 (SEQ ID NO:283); GCTGGTGGCGTAGGC(imdT)n, wherein n is 1, 2, or 3 (SEQ ID NO:284); or TTGGAGCTGGTGGCGT(invdT)n, wherein n is 1, 2, or 3 (SEQ ID NO:285); with italicized nucleic acids representing locked nucleic acids.
  • the one or more DNA mutations in the PIK3CA gene comprise one or more DNA mutations encoding an E542K or E545K mutated PIK3CA protein. In some embodiments, the one or more DNA mutations in the PIK3CA gene comprise DNA mutations encoding E542K and E545K mutated PIK3CA proteins.
  • the probes specific for one or more DNA mutations in the PIK3CA gene comprise: (1) a first probe comprising a sequence selected from the group consisting of GCTCAGTGATTTTAG (SEQ ID NO:87), TGCTCAGTGATTTT (SEQ ID NO:89), GCTCAGTGATTTTAG (SEQ ID NO: 91), CCTGCTCAGTGATTTTA (SEQ ID NO: 93), and CTCAGTGATTTTAGA (SEQ ID NO: 95); and (2) a second probe comprising a sequence selected from the group consisting of TTCTCCTGCTTA (SEQ ID NO:97), CTCCTGCTTAGT (SEQ ID NO:99), TCTCCTGCTTAG (SEQ ID NO: 101), TCCTGCTTAGTG (SEQ ID NO: 103), and CTCCTGCTTAGTGA (SEQ ID NO: 105); wherein each of the two probes is coupled to a microcarrier with a different identifier.
  • step (b) comprises amplifying the isolated DNA by PCR using a primer pair comprising the sequences CAATTTCTACAAGAGATCCTCTCTCT (SEQ ID NO: 5) and CTCCATTTTAGCACTTACCTGTGAC (SEQ ID NO:6).
  • the one or more DNA mutations in the PIK3CA gene comprise a DNA mutation encoding an H1047R mutated PIK3CA protein.
  • the probes specific for one or more DNA mutations in the PIK3CA gene comprise: (1) a first probe comprising a sequence selected from the group consisting of GATGCACGTCATG (SEQ ID NO: 107), TGAATGATGCACG (SEQ ID NO: 109), TGATGCACGTC (SEQ ID NO: 111), AATGATGCACGTCA (SEQ ID NO: 113), and AATGATGCACGTC (SEQ ID NO: 115); wherein the first probe is coupled to a microcarrier with an identifier.
  • step (b) compnses amplifying the isolated DNA by PCR using a primer pair comprising the sequences ACCCT AGC CTTAGAT AAAACT GAGC (SEQ ID NOG) and TTTGTTGTCCAGCCACCATGA (SEQ ID NO:8).
  • step (b) comprises amplifying the isolated DNA by PCR in the presence a blocking nucleic acid that hybridizes with a wild-type PIK3CA DNA locus corresponding with one of the PIK3CA DNA mutations and prevents amplification of the wild-type PIK3CA DNA locus, and wherein at least one of the at least seven blocking nucleic acids comprises the sequence
  • CACCATGATGJGCAT( ⁇ mdT)n wherein n is 1, 2, or 3 (SEQ ID NO:296); CCACC4TG47GTGCAr(invdT) civil, wherein n is 1, 2, or 3 (SEQ ID NO:297); CACCATGATGTGCATiimdT) n , wherein n is 1, 2, or 3 (SEQ ID NO:298); CCACCAAGATGAGCATCA(imdT)n, wherein n is 1, 2, or 3 (SEQ ID NO:299); or CAT GA 7 GT G( A ( i n v dT ) , ; . wherein n is 1, 2, or 3 (SEQ ID NO:300); with italicized nucleic acids representing locked nucleic acids.
  • the one or more DNA mutations in the BRA I gene comprise one or more DNA mutations encoding a V600E mutated BRAF protein.
  • the probe specific for one or more DNA mutations in the BRAF gene comprises a sequence selected from the group consisting of TTTGGTCTAGCTACAGA (SEQ ID NO:79), CTACAGAGAAATCTCGA (SEQ ID N0 81), GTGATTTTGGTCTAGCT (SEQ ID NO:83), and TCTAGCTACAGAGAAAT (SEQ ID NO: 85).
  • the probe specific for one or more DNA mutations in the BRAF gene further comprises eight nucleotides at the 5’ end, and wherein the eight nucleotides at the 5’ end are adenine or thymine nucleotides.
  • the probe specific for one or more DNA mutations in the BRAF gene comprises a sequence selected from the group consisting of TTTTTT A ATT GAGA A AT CT CGAT GGAG (SEQ ID NO: 78),
  • step (b) comprises amplifying the isolated DNA by PCR using a primer pair comprising the sequences ATAGCCTCAATTCTTACCATCCACAAAATG (SEQ ID NO:9) and CAGATATATTTCTTCATGAAGACCTCACAGTAA (SEQ ID NOTO).
  • each of the two probes is coupled to a microcarrier with a different identifier.
  • each of the two probes further comprises eight nucleotides at the 5’ end, and wherein the eight nucleotides at the 5’ end are adenine or thymine nucleotides.
  • the probes specific for one or more DNA mutations in the EGFR gene compnse: (1) a first probe comprising a sequence selected
  • TTTTTTTTTTTTTTAAAC AT CTCC GAAAGCC SEQ ID NO: 135.
  • a second probe comprising a sequence selected from the group consisting of TTTTTTTT A AT C A AGAC AT CTCC GA (SEQ ID NO: 137),
  • step (b) comprises amplify ing the isolated DNA by PCR in the presence of a blocking nucleic acid that hybridizes with a wild-type EGFR DNA locus corresponding with the EGFR DNA mutation and prevents amplification of the wild-type EGFR DNA locus, and wherein at least one of the at least seven blocking nucleic acids comprises the sequence
  • each of the seven probes specific for one or more DNA mutations in the EGFR gene further comprises eight nucleotides at the 5’ end, and wherein the eight nucleotides at the 5’ end are adenine or thymine nucleotides.
  • the probes specific for one or more DNA mutations in the EGFR gene comprise: (1) a first probe comprising a
  • TTTTTTTTTTTTTTT ATCC AGG AGGCTGC C (SEQ ID NO:466), TTTTTTTTTTTACCAGGAGGCTGCC (SEQ ID NO:468), and TTTTTTTTTTT A C AGG AGGCTGC C (SEQ ID NO:470); (3) a third probe comprising a sequence selected from the group consisting of TTTTTTTTTTT ACCAGGAGGGAGCC (SEQ ID NO:472), TTTTTTTTTTTACCAGGAGGGAGCCG (SEQ ID NO:474),
  • step (b) comprises amplifying the isolated DNA by PCR using a primer pair comprising the sequences CCTCCACCGTGCAGATCATC (SEQ ID NO: 15) and TTCCCTGATTACCTTTGCGAT
  • step (b) comprises amplifying the isolated DNA by PCR in the presence of a blocking nucleic acid that hybridizes with a wild- type EGFR DNA locus corresponding with the EGFR DNA mutation and prevents amplification of the wild-type EGFR DNA locus, and wherein at least one of the at least seven blocking nucleic acids comprises the sequence C4TC4CGC4GCTCATG(invdT) repeat, wherein n is 1, 2, or 3 (SEQ ID NO:316);
  • T GCAGC TCAT CAC GCA GC(mvdT) «, wherein n is 1, 2, or 3 (SEQ ID NO:317); TCA7UACGCAGCTC4T(invdT) endeavour, wherein ms 1.2. or 3 (SEQ ID NO:318);
  • the one or more DNA mutations in the EGFR gene comprise one or more DNA mutations encoding an L858R mutated EGFR protein.
  • the first probe further comprises eight nucleotides at the 5’ end, and wherein the eight nucleotides at the 5’ end are adenine or thymine nucleotides.
  • the probes specific for one or more DNA mutations in the EGFR gene comprise: a first probe comprising a sequence selected from the group consisting of TTTTTTT ATTTTGGGCGGGCC (SEQ ID NO: 152), TTTTTTTTAATTGGGCGGGCCAAA (SEQ ID NO: 154),
  • step (b) comprises amplifying the isolated DNA by PCR using a primer pair comprising the sequences GGAGGACCGTCGCTTGG (SEQ ID NO: 17) and TCTTTCTCTTCCGCACCCAG (SEQ ID NO: 18).
  • step (b) comprises amplifying the isolated DNA by PCR in the presence of a blocking nucleic acid that hybridizes with a wild-type EGFR DNA locus corresponding with the EGFR DNA mutation and prevents amplification of the wild-type EGFR DNA locus, and wherein at least one of the at least seven blocking nucleic acids comprises the sequence CCAGCAG77TGGCCAGCCCT(invdT)«, wherein « is 1, 2, or 3 (SEQ ID NO:321); C CA (X ⁇ G 77 T GGY ⁇ (X 'C T( in v dT) protest , wherein n is 1, 2, or 3 (SEQ ID NO: 322); C CAGCAGTTTGGC CT GC C C T(in vdT) «, wherein n is 1, 2, or 3 (SEQ ID NO:323);
  • n is 1, 2, or 3 (SEQ ID NO:324); or CG4GC4G7TTGGCC4GCCCT(mvdT>, wherein w is 1, 2, or 3 (SEQ ID NO: 325); with italicized nucleic acids representing locked nucleic acids.
  • the one or more DNA mutations in the LA77 gene comprise one or more DNA mutations encoding an E17K mutated AKT1 protein.
  • the probe specific for one or more DNA mutations in the LK ⁇ gene comprises a sequence selected from the group consisting of TGTAGGGAAGTACA (SEQ ID NO:370),
  • the probe specific for one or more DNA mutations in the AK ⁇ gene further comprises seven nucleotides at the 5’ end, and wherein the seven nucleotides at the 5’ end are adenine or thymine nucleotides.
  • the probe specific for one or more DNA mutations in th QAKTI gene comprises a sequence selected from the group consisting of TTTTTTTTTTTTTTGTAGGGAAGTACA (SEQ ID NO:371), TTTTTTTTTTTTCTGT AGGGAAGTAC (SEQ ID NO:373),
  • step (b) comprises amplifying the isolated DNA by PCR in the presence of a blocking nucleic acid that hybridizes with a wild-type AKT1 DNA locus corresponding with the AK ⁇ DNA mutation and prevents amplification of the wild -type AK ⁇ DNA locus, and wherein at least one of the at least seven blocking nucleic acids comprises the sequence XGTACTCCCCTACA (lnvdT),,.
  • n is 1, 2, or 3 (SEQ ID NO:382); GATGTACTCCCCT (invdTfy, wherein n is 1, 2, or 3 (SEQ ID N0 383); ATGTACTCCCCTAC (invdT) endeavour, wherein n is 1, 2, or 3 (SEQ ID NO:384); GTACTCCCCTACA (invdT),. wherein n is 1, 2, or 3 (SEQ ID NO:385); or GATGTACTCCCCTACA (invdTfy, wherein n is 1, 2, or 3 (SEQ ID NO:386); with italicized nucleic acids representing locked nucleic acids.
  • the one or more DNA mutations in th QMEKI gene comprise one or more DNA mutations encoding a K57N mutated MEK1 protein.
  • the probe specific for one or more DNA mutations in theMEKl gene comprises a sequence selected from the group consisting of TTACCCAGAATCAGAA (SEQ ID NO:387),
  • the probe specific for one or more DNA mutations in the MEK1 gene further comprises eight nucleotides at the 5’ end, and wherein the eight nucleotides at the 5’ end are adenine or thymine nucleotides.
  • the probe specific for one or more DNA mutations in the MEK1 gene comprises a sequence selected from the group consisting of TTTTTAAATTTACCC AGAATCAGAA (SEQ ID NO:388),
  • TTTTT A AT CC AG A AT C AGAAGGT G (SEQ ID NO:390), TTTTTAAATTTCTTACCCAGAATCA (SEQ ID NO: 392),
  • step (b) comprises amplifying the isolated DNA by PCR using a primer pair comprising the sequences CTTGATGAGCAGCAGCGAAA (SEQ ID NO:397) and CCTTCAGTTCTCCCACCTTCTG (SEQ ID NO:398).
  • step (b) comprises amplifying the isolated DNA by PCR in the presence of a blocking nucleic acid that hybridizes with a wild-type MEK1 DNA locus corresponding with the MEK1 DNA mutation and prevents amplification of the wild-type MEK1 DNA locus, and wherein at least one of the at least seven blocking nucleic acids comprises the sequence T ( 7G( 7TC TGGGTAA G (invdTfy, wherein n is 1, 2, or 3 (SEQ ID NO: 399); TTCTGCHCTGGGTAAGA (invdTfy wherein n is 1, 2, or 3 (SEQ ID NO:400); CACCnCTGCTTCTGGG (invdT) protest, wherein n is 1, 2, or 3 (SEQ ID NO:401); ACTGCTTCTGGGTA (invdTfy, wherein n is 1, 2, or 3 (SEQ ID NO:402); or CACCTTCTGCTTCTGGGAAAGA (invdTfy wherein n is
  • the one or more DNA mutations in the HER2 gene comprise one or more DNA mutations encoding an A775_G776insYVMAmutated HER2 protein.
  • the probe specific for one or more DNA mutations in the HER2 gene comprises a sequence selected from the group consisting of ATACGTGATGTCTTAC (SEQ ID NO: 404), ACGTGATGGCTTACGT (SEQ ID NO:406), AAGCATACGTGATGGCT (SEQ ID NO:408), GCATACGTGATGGCTT (SEQ ID NO:410), and
  • the probe specific for one or more DNA mutations in the HER2 gene further comprises five nucleotides at the 5’ end, and wherein the five nucleotides at the 5’ end are adenine or thymine nucleotides.
  • the probe specific for one or more DNA mutations in the HER2 gene comprises a sequence selected from the group consisting of TTTTTTTTTATACGTGATGTCTTAC embodiments
  • step (b) comprises amplifying the isolated DNA by PCR using a primer pair comprising the sequences ATGGCTGTGGTTTGTGATGGT (SEQ ID N0 414) and ACACCAGCCATCACGTAAGACA (SEQ ID NO:415).
  • the sample is a blood, serum, or plasma sample.
  • (a) comprises isolating circulating free DNA (cfDNA) from the sample, and wherein the isolated cfDNA is amplified by PCR in (b).
  • the methods further comprise amplifying a positive control DNA sequence using a primer pair specific for the positive control DNA sequence in (b); hybridizing the amplified positive control gene sequence with a probe specific for the positive control gene sequence in (c), wherein the probe specific for the positive control gene sequence is coupled to a microcarrier with an identifier corresponding to a positive control; detecting presence or absence of hybridization of the amplified positive control DNA sequence with the probe specific for the positive control gene sequence in (d); and detecting the identifier corresponding to the positive control in (e).
  • the methods further comprise detecting absence of hybridization of the amplified DNA with a microcarner having an identifier corresponding to a negative control in (d), wherein the microcarrier with the identifier corresponding to the negative control comprises a probe that does not hybridize with the amplified DNA; and detecting the identifier corresponding to the negative control in (e).
  • RNA from a sample e.g. , obtained from a patient
  • amplifying e.g.
  • RT-PCR reverse transcription-polymerase chain reaction
  • amplifying the DNA comprises: (1) generating cDNA specific for each of th eALK, ROS, RET, NTRK1, and cMET genes from the isolated RNA using a first primer specific for each of the ALK, ROS , RET, NTRK1, and cMET genes, the isolated RNA, and a reverse transcriptase, and (2) amplifying DNA specific for each of the ALK, ROS, RET, NTRK1, and cMET genes by polymerase chain reaction (PCR) using the cDNA generated in (b)(1), a DNA polymerase, the first primer, and a second primer specific for each of the ALK, ROS, RET, NTRK1 , and cMET genes that binds to a strand of the cDNA opposite the corresponding first pnmer and promotes strand extension in a direction opposite that promoted by the corresponding first primer; (c) hybrid
  • the ALK, ROS, RET, NTRK1, and cMET genes are human genes.
  • one or more of the mutations in th eALK, ROS, RET, and NTRKl genes comprises a fusion gene.
  • each of the mutations in the A IK. ROS, RET, and NTRKl genes comprises a fusion gene.
  • the one or more mutations in the ALK gene comprise an EML4-ALK fusion gene.
  • the first primer is specific for a region of the EML4 locus
  • the second primer is specific for a region of the ALK locus.
  • the second primer is specific for a region of the EML4 locus
  • the first primer is specific for a region of the ALK locus.
  • the one or more mutations in the ALK gene comprise one or more of EML E13:ALK E20, EML E20:ALK E20, and EML E6: ALK E20 EML4-ALK fusion genes.
  • the one or more mutations in the ALK gene comprise EML E13:ALK E20, EML E20:ALK E20, and EML E6:ALK E20 EML4-ALK fusion genes.
  • the probes specific for one or more mutations in th eALK gene comprise: (1) a first probe comprising a sequence selected from the group consisting of AAAGGACCTAAAGTGT (SEQ ID NO: 161), CCTAAAGTGTACCGC (SEQ ID NO: 163), GGGA A AGGAC CT A A AG (SEQ ID NO: 165), AGTGTACCGCCGGAA (SEQ ID NO: 167), and TACCGCCGGAAGCACC (SEQ ID NO: 169); (2) a second probe comprising a sequence selected from the group consisting of GACTATGAAATATTGTAC (SEQ ID NO: 171), GAAATATTGTACTTGTAC (SEQ ID NO: 173), TATTGTACTTGTACCGCC (SEQ ID NO:
  • each of the four probes further comprises eight nucleotides at the 5’ end, and wherein the eight nucleotides at the 5’ end are adenine or thymine nucleotides.
  • the probes specific for one or more mutations in th eALK gene comprise: (1) a first probe comprising a sequence selected
  • TTTTTTTTTTCCTAAAGTGTACCGC (SEQ ID NO 164), TTTTTTTTTTGGGAAAGGACCTAAAG (SEQ ID NO: 166), TTTTTTTTTTAGTGTACCGCCGGAA (SEQ ID NO: 168), and
  • TTTTTTTTTTTACCGCCGGAAGCACC (SEQ ID NO: 170); (2) a second probe comprising a sequence selected from the group consisting of TTTTTTTTTTTTGACTATGAAATATTGTAC (SEQ ID NO: 172), TTTTTTTTTTTTGAAATATTGTACTTGTAC (SEQ ID NO: 174), TTTTTTTTTTTTTATTGTACTTGTACCGCC (SEQ ID NO:176),
  • TTTTTTTTTTTTTTGT AC CGC C GGA AGC AC SEQ ID NO: 178
  • TTTTTTTTTTTTCCGCCGGAAGCACCAGGA SEQ ID NO: 180
  • a third probe comprising a sequence selected from the group consisting of TTTTTTTTTTTTTTTGTCATCATCAACCAA (SEQ ID NO: 182)
  • TTTTTTTTTTTTTTTTTTTTTTTT GTGT AC C GC C GGA AGC SEQ ID NO: 186
  • TTTTTTTTTTTTTCAACCAAGTGTACCG SEQ ID NO: 188
  • TTTTTTTTTTTTTTTACCGCCGGAAGCACCA SEQ ID NO: 190
  • a fourth probe comprising a sequence selected from the group consisting of
  • TTTTTTTTTTTTTCGAAAAAAACAGCCAA SEQ ID NO: 192
  • TTTTTTTTTTTT C GCGAAAAAAAC AGC
  • TTTTTTTTTTTGTGTACCGCCGGAAGC SEQ ID NO: 196
  • the first pnmer specific for one or more mutations in the AIK gene comprises the sequence AGTTGGGGTT GT AGTC GGT CAT (SEQ ID NO:363) or GAAGCCTCCCTGGATCTCC (SEQ ID NO:364).
  • the second primer specific for one or more mutations in the ALK gene comprises a sequence selected from the group consisting of TATGGAGCAAAACTACTGTAGAGCC (SEQ ID N0 357), CCAGCTACATCACACACCTTGACT (SEQ ID NO:358), and TAATACCAAAAGTTACCAAAACTGCA (SEQ ID NO:359).
  • the one or more mutations in the ROS gene comprise an ROS fusion gene selected from the group consisting of CD74-ROS, and SLC34A2-ROS.
  • the first primer is specific for a region of the CD74, or SLC34A2
  • the second pnmer is specific for a region of the / ⁇ TAY locus.
  • the second primer is specific for a region of the CD 74, or SLC34A2 , locus
  • the first primer is specific for a region of the ROS locus.
  • the first primer is specific for a region of the CD74 or SLC34A2 locus
  • the second primer is specific for a region of the ROS locus; or wherein the second primer is specific for a region of the CD74 or SLC34A2 locus, and the first pnmer is specific for a region of the ROS locus.
  • the one or more mutations in the ROS gene comprise one or more of CD74 E6:ROS E32, CD74 E6:ROS E34, SLC34A2 E4:ROS E32, and SLC34A2 E4:ROS E34 fusion genes.
  • the one or more mutations in the ROS gene comprise CD74 E6:ROS E32, CD74 E6:ROS E34, SLC34A2 E4:ROS E32, and SLC34A2 E4:ROS E34 fusion genes.
  • the probes specific for one or more mutations in the ROS gene comprise: (1) a first probe comprising a sequence selected from the group consisting of ACTGACGCTCCACCGAAA (SEQ ID NO:201), CCACTGACGCTCCACCGA (SEQ ID NO:203), GCTGGAGTCCCAAATAAAC (SEQ ID NO:205), GGAGTCCCAAATAAACCAG (SEQ ID NO: 207), and CACCGAAAGCTGGAGTCCC (SEQ ID NO:209); (2) a second probe comprising a sequence selected from the group consisting of CCGAAAGATGATTTT (SEQ ID NO:211), GACGCTCCACCGAAA (SEQ ID NO:213), ACTGACGCTCCACCGA (SEQ ID NO:215), GATGATTTTTGGATA (SEQ ID NO:217), and TGATTTTTGGATACCA (SEQ ID NO:219); (3) a third probe comprising a sequence selected from the group consisting of AGCGCCTTCCAGCT
  • each of the four probes is coupled to a microcarrier with a different identifier.
  • each of the four probes further comprises eight nucleotides at the 5’ end, and wherein the eight nucleotides at the 5’ end are adenine or thymine nucleotides.
  • the probes specific for one or more mutations in the ROS gene comprise: (1) a first probe comprising a sequence selected from the group consisting of TTTTTTTTTTT ACT GAC GCT CC ACCGAAA (SEQ ID NO:202),
  • TTTTTTTTTTTTTTTGG AGT C C C A A AT A A AC C AG (SEQ ID NO:208), and TTTTTTTTTTTCACCGAAAGCTGGAGTCCC (SEQ ID NO:210); (2) a second probe comprising a sequence selected from the group consisting of TTTTTTTTTTCCGAAAGATGATTTT (SEQ ID NO:212), TTTTTTTTTTTTGACGCTCCACCGAAA (SEQ ID NO:214),
  • TTTTTTTTTTTTTTTTTGATTTTTGGATACCA (SEQ IDNO:220); (3) a third probe comprising a sequence selected from the group consisting of TTTTTTTTTTAGCGCCTTCCAGCTGGTTGGA (SEQ ID N0 222), TTTTTTTTTTCTGGTTGGAGCTGGAGTCCC (SEQ ID NO:224),
  • TTTTTTTTTTTTTT GCT GG AGT CCC A A ATA A ACC A (SEQ ID NO:228), and TTTTTTTTTTTTGGAGTCCCAAATAAACCAGG (SEQ ID NO:230); and (4) a fourth probe comprising a sequence selected from the group consisting of TTTTTTTTTTGCGCCTTCCAGCTGGTTG (SEQ ID NO:232),
  • the first primer specific for one or more mutations in the ROS gene comprises the sequence AATTCAATACATACTATCAGCTTTCTCCCACTGTATTGAA (SEQ ID NO:21) or A AT ATTT C T GGT ACGAGT GGGATT GT A AC A AC C AGA A AT A (SEQ ID NO: 22).
  • the second primer specific for one or more mutations in the ROS gene composes the sequence GGAGTGCCATCGCTGTTTGAAATGAGCAGGCACT (SEQ ID NO: 19) or TACAGCCCTGGATATTCTTAGTAGCGC (SEQ ID NO:20).
  • the one or more mutations in the RET gene comprise a RET fusion gene selected from the group consisting of KIF5B-RET.
  • the first primer is specific for a region of the KIF5B, or CCDC6 locus
  • the second primer is specific for a region of the RET locus.
  • the second primer is specific for a region of the KIF5B, or CCDC6 locus
  • the first primer is specific for a region of the RET locus.
  • the first primer is specific for a region of the KIF5B locus
  • the second primer is specific for a region of the RET locus; or wherein the second primer is specific for a region of the KIF5B locus, and the first primer is specific for a region of the RET locus.
  • the one or more mutations in the RET gene comprise one or more of KIF5B E15:RET El l, KIF5B E15:RET E12, KIF5B E16:RET E12, KIF5B E22:RET E12, KIF5B E23:RET E12, and CCDC6 ETRET E12 fusion genes.
  • the one or more mutations in the RET gene comprise KIF5B E15:RET El l, KIF5B E15:RET E12, KIF5B E16:RET E12, KIF5B E22:RET E12, and KIF5B E23:RET E12 fusion genes.
  • the probes specific for one or more mutations in the RIO ' gene comprise: (1) a first probe comprising a sequence selected from the group consisting of GTGGGAAATAATGATGTAAA (SEQ ID NO:241), CTGTGGGAAATAATGATGTA (SEQ ID NO:243), GATCCACTGTGCGACGAGCT (SEQ ID NO:245), TGATGTAAAGATCCACTGTG (SEQ ID NO:247), and TCCACTGTGCGACGAGCTGT (SEQ ID NO:249); (2) a second probe comprising a sequence selected from the group consisting of TGGGAAATAATGATGTAAA (SEQ ID NO:251), CTGTGGGAAATAATGATGTA (SEQ ID N0 253), GGAGGATCCAAAGTGGGAAT (SEQ ID N0 255), GGATCCAAAGTGGGAATT (SEQ ID N0 257), and ATGATGTAAAGGAGGATCC (SEQ ID NO:259); (3) a third probe
  • each of the four probes further comprises eight nucleotides at the 5’ end, and wherein the eight nucleotides at the 5’ end are adenine or thymine nucleotides.
  • the probes specific for one or more mutations in ⁇ he RET gene comprise: (1) a first probe comprising a sequence selected from the group consisting of TTTTTTTTTT GT GGGA A AT A AT G ATGT AAA (SEQ ID NO:242), TTTTTTTTTTCTGTGGGAAATAATGATGTA (SEQ ID NO:244),
  • TTTTTTTTTT G A T C C A C T GT GC G A C G A GC T (SEQ ID N0 246), TTTTTTTTTTTGATGTAAAGATCCACTGTG (SEQ ID NO:248), and TTTTTTTTTCCACTGTGCGACGAGCTGT (SEQ ID NO:250); (2) a second probe comprising a sequence selected from the group consisting of TTTTTTTTTT GGGA AAT A AT GAT GT AAA (SEQ ID NO:252),
  • TTTTTTTTTTT GGAT CCA A AGTGGGA ATT (SEQ ID NO:258), and TTTTTTTTT ATGATGTAAAGGAGGATCC (SEQ ID NO:260); (3) a third probe comprising a sequence selected from the group consisting of TTTTTTTTTCTTCGTATCTCTCAAGAGGAT (SEQ ID NO:482), TTTTTTTTTGTATCTCTCAAGAGGATCCAA (SEQ ID NO: 484),
  • TTTTTTTT A AGGAGGAT CCA A AGT G (SEQ ID NO:500); and (5) a fifth probe compnsing a sequence selected from the group consisting of TTTTTTTT AAACAGGAGGATCCAAA (SEQ ID NO 502), TTTTTATTAAGTGCACAAACAGGAGG (SEQ ID NO:504), TATTATTATGTGCACAAACAGGAGGATC (SEQ ID NO:506),
  • the first primer specific for one or more mutations in th eRET gene comprises the sequence GTGATCGCACAGTAGGACAGCGGCTGCGATC (SEQ ID NO: 26) or CTCTAGGAGATATCATTCCAAATTCGCCTTCTCCTAG (SEQ ID NO:27).
  • the second primer specific for one or more mutations in the RET gene comprises a sequence selected from the group consisting of
  • AACTTC AGACTTT AC AC AAC CT GC (SEQ ID NO:520), and ATTGATTCTGATGACACCGGA (SEQ ID NO:521)
  • the one or more mutations in the NTRK1 gene comprise a CD74-NTRK1 fusion gene.
  • the first primer is specific for a region of the CD74 locus
  • the second primer is specific for a region of the NTRK1 locus.
  • the second primer is specific for a region of the CD74 locus
  • the first primer is specific for a region of the NTRK1 locus.
  • the one or more mutations in the NTRK1 gene comprise a CD74 E8:NTRK1 E12 fusion gene.
  • the probe specific for one or more mutations in the NTRK1 gene comprises a sequence selected from the group consisting of CAGGATCTGGGCCCAGACA (SEQ ID NO:261), GATCTGGGCCCAGACACTA (SEQ ID NO:263), CCAGACACTAACAGCACAT (SEQ ID NO:265), GGGCCCAGACACTAACAGC (SEQ ID NO:267), and
  • the probe specific for one or more mutations in the NTRK1 gene further comprises eight nucleotides at the 5’ end, and wherein the eight nucleotides at the 5’ end are adenine or thymine nucleotides.
  • the probe specific for one or more mutations in the NTRK1 gene comprises a sequence selected from the group consisting of TTTTTTTTTTACAGGATCTGGGCCCAGACA (SEQ ID NO:262),
  • the first primer specific for one or more mutations in the NTRK1 gene comprises the sequence GGAC GAA AAT C C AGAC CC C A A A AGGT GTTT C GT (SEQ ID NO:32).
  • the second primer specific for one or more mutations in the NTRK1 gene comprises the sequence AGAAGACGTGACAGGAACTGGAGGACCCGTCTT (SEQ ID NO: 30).
  • the one or more mutations in the cMET gene results in exon skipping. In some embodiments, the one or more mutations in the cMET gene results in skipping of exon 14.
  • the probe specific for one or more mutations in the cMET gene comprises a sequence selected from the group consisting of AGAAAGCAAATTAAAGAT (SEQ ID NO:271), AGCAAATTAAAGATCAG (SEQ ID NO: 273), AAATTAAAGATCAGTTTC (SEQ ID NO:275), AGATCAGTTTCCTAATTC (SEQ ID NO:277), and AAGATCAGTTTCCTAATT (SEQ ID NO:279).
  • the probe specific for one or more mutations in the cMET gene further comprises eight nucleotides at the 5’ end, and wherein the eight nucleotides at the 5’ end are adenine or thymine nucleotides.
  • the probe specific for one or more mutations in the cMET gene comprises a sequence selected from the group consisting of TTTTTTTTTTTT AGAAAGCAAATTAAAGAT (SEQ ID NO 272),
  • the first primer specific for one or more mutations in the cMET gene comprises the sequence GACAGTATTTTGCAGTAATGGACTGGATATATCAGA (SEQ ID NO:29).
  • the second primer specific for one or more mutations in the cMET gene comprises the sequence GAATTTCACAGGATTGATTGCTGGTGTTGTCTC (SEQ ID NO:28).
  • the sample is a blood, serum, or plasma sample.
  • isolating RNA from the sample in (a) comprises isolating RNA from one or more of tumor-conditioned platelets, tumor exosomes, and circulating tumor cells (CTCs).
  • the methods further comprise amplifying a positive control DNA sequence from the isolated RNA by reverse transcription-polymerase chain reaction (RT-PCR) in (b), wherein amplifying the positive control DNA sequence comprises: (1) generating cDNA specific for the positive control sequence from the isolated RNA using a first primer specific for the positive control sequence, the isolated RNA, and a reverse transcriptase, and (2) amplifying DNA specific for the positive control sequence by polymerase chain reaction (PCR) using the cDNA specific for the positive control sequence generated in (1), a DNA polymerase, the first primer, and a second primer specific for the positive control sequence that binds to a strand of the cDNA opposite the corresponding first primer and promotes strand extension in a direction opposite that promoted by the corresponding first primer; hybridizing the amplified positive control gene sequence with a probe specific for the positive control gene sequence in (c), wherein the probe specific for the positive control gene sequence is coupled to a microcarrier with an identifier corresponding to a positive control; detecting presence
  • the methods further comprise detecting absence of hybridization of the amplified DNA with a microcarrier having an identifier corresponding to a negative control in (d), wherein the microcarrier with the identifier corresponding to the negative control comprises a probe that does not hybridize with the amplified DNA; and detecting the identifier corresponding to the negative control in (e).
  • a method for detecting the presence of mutations in the genes comprising: (a) isolating DNA and RNA from a sample; (b) amplifying the isolated DNA by polymerase chain reaction (PCR) using primer pairs specific for the loci of one or more DNA mutations in each of the KRAS, NRAS, PIK3CA, BRAF, EGFR, AKT1, MEK1, andHER2 genes; (c) amplifying DNA from the isolated RNA by reverse transcription-polymerase chain reaction (RT-PCR), wherein amplifying the DNA from the isolated RNA comprises: (1) generating cDNA specific for each of the AI.K.
  • PCR polymerase chain reaction
  • ROS, RET, NTRK1, and cMET genes from the isolated RNA using a first primer specific for each of the A IK. ROS, RET, NTRK1, and cMET genes, the isolated RNA, and a reverse transcriptase, and (2) amplifying DNA specific for each of the AI.K. ROS, RET, NTRK1, and cMET genes by polymerase chain reaction (PCR) using the cDNA generated in (c)(1), a DNA polymerase, the first primer, and a second primer specific for each of the AI.K.
  • PCR polymerase chain reaction
  • ROS, RET, NTRK1, and cMET genes that binds to a strand of the cDNA opposite the corresponding first primer and promotes strand extension in a direction opposite that promoted by the corresponding first primer; (d) hybridizing the DNA amplified by PCR in (b) with at least seven probes, said at least seven probes comprising one or more probes specific for a mutation in each of the KRAS.
  • each of said at least seven probes is coupled to a microcarrier, and wherein each of the microcarriers compnses an identifier corresponding to the probe coupled thereto; (e) detecting presence or absence of hybridization of the DNA amplified by PCR in (b) with said at least seven probes, wherein hybridization between the amplified DNA and one of the probes indicates the presence of the mutation corresponding to the probe; (f) hybridizing the DNA amplified by RT-PCR in (c) with at least five probes, said at least five probes comprising one or more probes specific for a mutation in each of ⁇ sALK, ROS , RET, NTRK1 , and cMET genes, wherein each of said at least five probes is coupled to a microcarrier, and wherein each of the microcarriers comprises an identifier corresponding to the probe coupled thereto; (g) detecting presence
  • (a) comprises: isolating total RNA-nch plasma (TRRP) by centrifuging the sample, wherein the sample comprises whole blood or plasma; subjecting the TRRP to one or more centrifugation steps to generate an RNA fraction and a cell-free DNA (cfDNA) fraction, wherein the RNA fraction compnses one or more of: platelets, white blood cells, exosomes, circulating tumor cells, and free RNA; isolating DNA from the cfDNA fraction; and isolating RNA from the RNA fraction.
  • TRRP total RNA-nch plasma
  • each of the primer pairs compnses a primer coupled to a detection reagent.
  • the detection reagent comprises a fluorescent detection reagent, and wherein detecting the presence or absence of hybridization of the amplified DNA with said probes in (d) comprises fluorescence imaging of the fluorescent detection reagent.
  • the detection reagent comprises biotin
  • detecting the presence or absence of hybridization of the amplified DNA with said probes in step (d) comprises: (1) after hybridization in (c), contacting the microcarriers with streptavidin conjugated to a signal-emitting entity; and (2) detecting a signal from the signal-emitting entity in association with the microcarriers.
  • the signal-emitting entity comprises phycoerythrin (PE).
  • PE phycoerythrin
  • detecting the identifiers of the microcarriers in (e) comprises bright field imaging of the identifiers.
  • the identifiers of the micocarriers comprise digital barcodes.
  • each of the microcarners comprises: (i) a substantially transparent polymer layer having a first surface and a second surface, the first and the second surfaces being parallel to each other; (ii) a substantially non-transparent layer that constitutes a two-dimensional shape, wherein the substantially non-transparent layer is affixed to the first surface of the substantially transparent polymer layer and encloses a center portion of the substantially transparent polymer layer, wherein the two-dimensional shape of the substantially non-transparent layer represents an analog code, and wherein the analog code corresponds to the identifier; and (iii) the probe specific for the mutation, wherein the probe is coupled to at least one of the first surface and the second surface of the substantially transparent polymer layer in at least the center portion of the substantially transparent polymer layer.
  • kits comprising at least seven microcarriers, wherein each of said at least seven microcarriers comprises: (i) a probe coupled to the microcarrier, wherein the probe is specific for a DNA mutation in the KRAS, PIK3CA BRAF, EGFR, AKTI,MEKI, or HER2 gene; and (ii) an identifier corresponding to the probe coupled thereto; wherein the kit comprises at least one microcarrier comprising a probe specific for a DNA mutation in the KRAS gene, at least one microcamer comprising a probe specific for a DNA mutation in the PIK3CA gene, at least one microcamer comprising a probe specific for a DNA mutation in the BRAF gene, at least one microcamer comprising a probe specific for a DNA mutation in the EGFR gene, at least one microcarrier comprising a probe specific for a DNA mutation in the AK ⁇ gene, at least one microcarrier comprising a probe specific for a DNA mutation
  • the kit further comprises at least seven blocking nucleic acids, wherein each of said at least seven blocking nucleic acids hybridizes with a wild-type DNA locus corresponding with one of the DNA mutations in the KRAS, PIK3CA, BRAF,
  • EGFR EGFR, AKTI,MEKI, or HER2 genes and prevents amplification of the wild-type DNA locus.
  • each of said at least seven blocking nucleic acids comprises: a single- stranded oligonucleotide that hybridizes with the corresponding wild-type DNA locus; and a 3’ terminal moiety that blocks extension from the single-stranded oligonucleotide.
  • the 3’ terminal moiety comprises one or more inverted deoxythymidines.
  • each of said at least seven blocking nucleic acids comprises one or more modified nucleotides selected from the group consisting of locked nucleic acids (LNAs), peptide nucleic acids (PNAs), hexose nucleic acids (HNAs), threose nucleic acids (TNAs), glycol nucleic acids (GNAs), and cyclohexenyl nucleic acids (CeNAs).
  • LNAs locked nucleic acids
  • PNAs peptide nucleic acids
  • HNAs hexose nucleic acids
  • TAAs threose nucleic acids
  • GNAs glycol nucleic acids
  • CeNAs cyclohexenyl nucleic acids
  • the DNA mutation in the KRAS gene comprises one or more DNA mutations encoding a G12D, G12V, or G12C mutated KRAS protein. In some embodiments, the DNA mutation in the KRAS gene comprises DNA mutations encoding G12D, G12V, and G12C mutated KRAS proteins.
  • the probes specific for the DNA mutation in the KRAS gene comprise: (1) a first probe comprising a sequence selected from the group consisting of TAGTTGGAGCT (SEQ ID NO:38), TGTGGTAGTTG (SEQ ID NO:40), TGATGGCGTAG (SEQ ID N042), TGGAGCTGATGGC (SEQ ID NO:44), and GCGTAGGCAAG (SEQ ID NO:46); (2) a second probe comprising a sequence selected from the group consisting of CTGTTGGCGTAGG (SEQ ID NO:48), GTAGTTGGAGCTG (SEQ ID NO:50), TGGAGCTGTTGGC (SEQ ID NO:52), TTGTGGTAGTTGG (SEQ ID NO:54), and GGCGTAGGCAAGA (SEQ ID NO:56); and (3) a third probe comprising a sequence selected from the group consisting of TAGTTGGAGCTT (SEQ ID NO:58), GCGTAGGCAAGA (SEQ ID NO:60), GGAGCT
  • each of the three probes further comprises eight nucleotides at the 5’ end, and wherein the eight nucleotides at the 5’ end are adenine or thymine nucleotides.
  • the probes specific for the DNA mutation in the KRAS gene comprise: (1) a first probe comprising a sequence selected from the group consisting of TTTTTTTTTTTT A AT AGTT GGAGCT (SEQ ID NO:39), TTTTTTTTTTTTAATGTGGTAGTTG (SEQ ID NO:41),
  • TTTTTTTTTTTTTATGGAGCTGTTGGC SEQ ID NO:53
  • TTTTTTTTTTTATTGTGGTAGTTGG SEQ ID NO: 55
  • TTTTTTTTTTTTT AGGCGTAGGC A AGA (SEQ ID NO:57); and (3) a third probe comprising a sequence selected from the group consisting of TTTTTTTTTTT AATAGTTGGAGCTT (SEQ ID NO:59), TTTTTTTTTTTTT A AGC GT AGGC A AGA (SEQ ID NO:61),
  • the kit further composes a primer pair comprising the sequences GTACTGGTGGAGTATTTGATAGTG (SEQ ID NO:l) and CGTCAAGGCACTCTTGCCTAC (SEQ ID NO:2).
  • the kit further comprises a blocking nucleic acid that hybridizes with a wild-type KRAS DNA locus corresponding with the KRAS DNA mutation and prevents amplification of the wild-type KRAS DNA locus, and wherein the blocking nucleic acid comprises the sequence TACGCCACCAGCT(mvdT) endeavour, wherein n is 1, 2, or 3 (SEQ ID NO:281); TTGGAGCTGG7GGCGTA(invdT) arise, wherein n is 1, 2, or 3 (SEQ ID NO:282); GCTGGTGGCGTAGGCA(invdT) possibly, wherein n is 1, 2, or 3 (SEQ ID NO:283); GC7GG7GGCG7AGGC(invdT) meaning, wherein n is 1, 2, or 3 (SEQ ID NO:284); or TTGGAGCTGGTGGCGT(mvdT) «, wherein n is 1, 2, or 3 (SEQ ID NO:285); with italicized nucleic
  • the DNA mutation in the PIK3CA gene comprises one or more DNA mutations encoding an E542K or E545K mutated PIK3CA protein. In some embodiments, the DNA mutation in the PIK3CA gene comprises DNA mutations encoding E542K and E545K mutated PIK3CA proteins.
  • each of the two probes is coupled to a microcarrier with a different identifier.
  • each of the two probes further comprises eight nucleotides at the 5’ end, and wherein the eight nucleotides at the 5’ end are adenine or thymine nucleotides.
  • the kit further comprises a pnmer pair comprising the sequences CAATTTCTACAAGAGATCCTCTCTCT (SEQ ID NO: 5) and CTCCATTTTAGCACTTACCTGTGAC (SEQ ID NO:6).
  • the kit further comprises a blocking nucleic acid that hybridizes with a wild-type PIK3CA DNA locus corresponding with the PIK3CA DNA mutation and prevents amplification of the wild-type PIK3CA DNA locus, and the blocking nucleic acid comprises the sequence CJGAAATCACTGAGCAGG(imdJ)n, wherein n is 1, 2, or 3 (SEQ ID NO:291); TCTC7GzLT4TCAC7GAGCAGG(mvdT) possibly, wherein n is 1, 2, or 3 (SEQ ID NO: 292); TCTCTGAA4TCACTGAGCAGG(invdT) «, wherein n is 1, 2, or 3 (SEQ ID NO:293); TCTCrGT4ATCACTG4GCAGG(invdT) n , wherein n is 1, 2, or 3 (SEQ IDNO:294); or TCTCTGAATTCACTGAGCAGGimvdT) favour, wherein n is
  • the DNA mutation in the PIK3CA gene comprises a DNA mutation encoding an E11047R mutated PIK3CA protein.
  • the probe specific for the DNA mutation in the PIK3CA gene comprises a sequence selected from the group consisting of GATGCACGTCATG (SEQ ID NO: 107), TGAATGATGCACG (SEQ ID NO: 109), TGATGCACGTC (SEQ ID NO: 111), AATGATGCACGTCA (SEQ ID NO: 113), and AATGATGCACGTC (SEQ ID NO: 115).
  • the probe further comprises eight nucleotides at the 5’ end, and wherein the eight nucleotides at the 5’ end are adenine or thymine nucleotides .
  • the DNA mutation in the BRAF gene comprises a DNA mutation encoding a V600E mutated BRAF protein.
  • the probe specific for the DNA mutation in the BRAF gene comprises a sequence selected from the group consisting of TTTGGTCTAGCTACAGA (SEQ ID NO: 79), CTACAGAGAAATCTCGA (SEQ ID N0 81), GTGATTTTGGTCTAGCT (SEQ ID NO:83), and TCTAGCTACAGAGAAAT (SEQ ID NO: 85).
  • the probe specific for one or more DNA mutations in the BRAF gene further comprises eight nucleotides at the 5’ end, and wherein the eight nucleotides at the 5’ end are adenine or thymme nucleotides.
  • the probe specific for the DNA mutation in the BRAF gene comprises a sequence selected from the group consisting of TTTTTTAATTGAGAAATCTCGATGGAG (SEQ ID NO 78), TTTTTTAATTTTTGGTCTAGCTACAGA (SEQ ID NO: 80), TTTTTTAATTCTACAGAGAAATCTCGA (SEQ ID NO: 82), TTTTTTAATTGTGATTTTGGTCTAGCT (SEQ ID NO: 84), and
  • the blocking nucleic acid comprises the sequence CL4GATT7UAC7G ⁇ 4GC(invdT)n, wherein n is 1, 2, or 3 (SEQ ID NO:301); GAGATTTCACTGTAGC ⁇ imdT) n , wherein n is 1, 2, or 3 (SEQ ID NO:302); GAGATTTCACTGTAGC(imdT)n, wherein n is 1, 2, or 3 (SEQ ID NO:303); GAGATYTCACTGTAGCiimTT) «, wherein n is 1, 2, or 3 (SEQ ID NO:304); or GAG ATTIC A ( TG ' / ' Af X '(i n vdT) wherein n is 1, 2, or 3 (SEQ ID NO:305); with italicized nucleic acids representing locked nucleic acids.
  • the probe specific for the DNA mutation in the EGFR gene comprises a sequence selected from the group consisting of TC AAAGTGCTGGC CTC (SEQ ID NO: 117), AGATCAAAGTGCTGGCCTCCG (SEQ ID NO: 119), AAAGTGCTGGCCT (SEQ ID NO: 121), AGTGCTGGCCT (SEQ ID NO: 123), and AAGTGCTGGCCTC (SEQ ID NO: 125).
  • the probe specific for the DNA mutation in the EGFR gene further comprises eight nucleotides at the 5’ end, and wherein the eight nucleotides at the 5’ end are adenine or thymine nucleotides.
  • the probe specific for the DNA mutation in the EGFR gene comprises a sequence selected from the group consisting of TTTTTTTTTTC AAAGTGCTGGCCTC (SEQ ID NO: 118), TTTTTTAGATCAAAGTGCTGGCCTCCG (SEQ ID NO: 120),
  • TTTTTTTTTTTTTTT AAAGTGCTGGCCT (SEQ ID NO: 122), TTTTTTTTTTTTTAGTGCTGGCCT (SEQ ID NO: 124), and
  • the DNA mutation in the EGFR gene comprises a DNA mutation encoding an E746_A750del mutated EGFR protein.
  • the probe specific for the DNA mutation in the EGFR gene comprises: (1) a first probe comprising a sequence selected from the group consisting of AATCAAAACATCTCCGAAAG (SEQ ID NO: 128), CAAAACATCTCCG (SEQ ID NO: 128), CAAAACATCTCCG (SEQ ID NO: 129.
  • AACATCTCCG SEQ ID NO:132
  • AAACATCTCCGAAAGCC SEQ ID NO: 134
  • a second probe comprising a sequence selected from the group consisting of AAT C AAGAC AT CT CCGA (SEQ ID NO: 136), GCAATCAAGACATCTCCGA (SEQ ID NO: 138), AATCAAGACATCTC (SEQ ID NO: 140), AATCAAGACATCTCCGAAAGC (SEQ ID NO: 142), and C AAGAC ATCTCCGA (SEQ ID NO: 144); wherein each of the two probes is coupled to a microcarrier with a different identifier.
  • TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT A AC ATCTC'C G (SEQ ID NO:133), and composing a sequence selected from the group consisting of TTTTTTTT AAT C AAGAC AT CTCC GA (SEQ ID NO: 137),
  • the DNA mutation in the EGFR gene comprises DNA mutations encoding T790M, C797S, S768I, V769 D770insASV, H773 V774insH, D770_N771insG, and D770_N771insSVD mutated EGFR proteins.
  • the probe specific for the DNA mutation in the EGFR gene comprises: (1) a first probe comprising a sequence selected from the group consisting of GAGATGCATGATGA (SEQ ID NO: 146), TGAGATGCATGATGAG (SEQ ID NO:147), ATGAGATGCATGATGAG (SEQ ID NO: 148), TGAGCTGCATGATGA (SEQ ID NO: 149), and CAT GAGATGC AT GAT GA (SEQ ID NO: 150); (2) a second probe comprising a sequence selected from the group consisting of CCAGGAGGCTGCCG (SEQ ID NO:461), CAGGAGGCTGCCGA (SEQ ID NO: 463), TCCAGGAGGCTGCC (SEQ ID NO:465), CCAGGAGGCTGCC (SEQ ID NO:467), and CAGGAGGCTGCC (SEQ ID NO:469); (3) a third probe comprising a sequence selected from the group consisting of CCAGGAGGGAGCC (SEQ ID NO:471),
  • TTTTTTTTTTTTT GAGCTGC AT GATGA SEQ ID NO:355
  • TTTTTTTTC AT GAGAT GC AT GATGA SEQ ID NO:356
  • a second probe comprising a sequence selected from the group consisting of TTTTTTTTTTT ACCAGGAGGCTGCCG
  • TTTTTTTTTTTTTTT ATCC AGG AGGCTGC C (SEQ ID NO:466), TTTTTTTTTTTACCAGGAGGCTGCC (SEQ ID NO:468), and TTTTTTTTTTT A C AGG AGGCTGC C (SEQ ID NO:470); (3) a third probe comprising a sequence selected from the group consisting of TTTTTTTTTTT ACCAGGAGGGAGCC (SEQ ID NO:472), TTTTTTTTTTTACCAGGAGGGAGCCG (SEQ ID NO:474),
  • TTTTTTTTGGACAACCCCCATCAC SEQ ID NO: 450
  • a seventh probe comprising a sequence selected from the group consisting of TTTTTTTTTTTGCCAGCGTGGACGG (SEQ ID N0 452), TTTTTTTTTTTCGTGGACGGTAACC (SEQ IDN0454), TTTTTTTTTTTGACGGTAACCCCC (SEQ ID NO:456), TTTTTTTTTTCCAGCGTGGACGGT (SEQ ID NO:458), and
  • GCACACGTAGGGGTTGTCCAAGA (SEQ ID NO:512); a primer pair comprising the sequences CC AC ACT GACGTGC CT CT (SEQ ID NO: 513) and
  • the kit further comprises a blocking nucleic acid that hybridizes with a wild-type EGFR DNA locus corresponding with the EGFR DNA mutation and prevents amplification of the wild- type EGFR DNA locus, and wherein the blocking nucleic acid comprises the sequence ( ⁇ ⁇ ( ⁇ ( Y i( ⁇ GCTC ATG( i n v d T) repeat .
  • n is 1, 2, or 3 (SEQ ID N0:316); TGC4GCTG4TCACGC4GC(invdT) endeavour, wherein n is 1, 2, or 3 (SEQ ID NO:317); TCATCACGCAGCTCTTOnvdT ⁇ , wherein n is 1, 2, or 3 (SEQ ID NO:318);
  • the DNA mutation in the EGFR gene comprises a DNA mutation encoding an L858R mutated EGFR protein.
  • the probe specific for the DNA mutation in the EGFR gene comprises a sequence selected from the group consisting of ATTTTGGGCGGGCC (SEQ ID NOT51), TTGGGCGGGCCAAA (SEQ ID NOT53), GCGGGCCAAACT (SEQ ID NO: 155), GGGCGGGCCAAACT (SEQ ID NO: 157), and TGGGCGGGCCA (SEQ ID NO: 159).
  • the probe further comprises eight nucleotides at the 5’ end, and wherein the eight nucleotides at the 5’ end are adenine or thymine nucleotides.
  • the probe specific for the DNA mutation in the EGFR gene comprises a sequence selected from the group consisting of TTTTTTT ATTTTGGGCGGGCC (SEQ ID NO: 152), TTTTTTTTAATTGGGCGGGCCAAA (SEQ ID NO: 154),
  • the kit further comprises a primer pair comprising the sequences GGAGGACCGTCGCTTGG (SEQ ID NO: 17) and TCTTTCTCTTCCGCACCCAG (SEQ ID NO: 18).
  • the DNA mutation in the AK ⁇ gene comprises a DNA mutation encoding an E17K mutated AKTI protein.
  • the probe specific for the DNA mutation in the AK ⁇ gene comprises a sequence selected from the group consisting of TGTAGGGAAGTACA (SEQ ID NO: 370), T CT GTAGGGAAGT AC (SEQ ID NO: 372), GTCTGTAGGGAAGTACAT (SEQ ID NO:374), CCGCACGTCTGTAGGGA (SEQ ID NO:376), and
  • the probe specific for the DNA mutation in the AKTI gene further comprises seven nucleotides at the 5’ end, and wherein the seven nucleotides at the 5’ end are adenine or thymine nucleotides.
  • the probe specific for the DNA mutation in the AKTI gene comprises a sequence selected from the group consisting ofTTTTTTTTTTTTTTGTAGGGAAGTACA (SEQ ID NO: 371), TTTTTTTTTTTTCTGTAGGGAAGTAC (SEQ ID NO:373),
  • n 1, 2, or 3 (SEQ IDNO:383);
  • ATGIACICCCCYAC (invdT) (invdT) cohesive, wherein n is 1, 2, or 3 (SEQ ID NO:384);
  • the kit further comprises a blocking nucleic acid that hybridizes with a wild-type MEK1 DNA locus corresponding with the MEK1 DNA mutation and prevents amplification of the wild-type Z3 ⁇ 4T DNA locus, and wherein the blocking nucleic acid comprises the sequence T CTG( 7TC TGGGl'AA G (invdT)», wherein n is 1. 2. or 3 (SEQ ID NO:399); TTCTGCTYCTGGGTAAGA (invdT)», wherein n is 1, 2, or 3 (SEQ ID NO:400);
  • the probe specific for the DNA mutation in the HER 2 gene comprises a sequence selected from the group consisting of ATACGTGATGTCTTAC (SEQ ID NO:404), AC GTGATGGCTT ACGT (SEQ ID NO: 406), AAGC AT ACGTGAT GGCT (SEQ ID NO:408), GC AT AC GTGATGGCTT (SEQ ID NO:410), and GCATACGTGATGGCTTA (SEQ ID NO:412).
  • the probe specific for the DNA mutation in the HER2 gene further comprises five nucleotides at the 5’ end, and wherein the five nucleotides at the 5’ end are adenine or thymine nucleotides.
  • kits comprising at least five microcarriers, wherein each of said at least five microcarriers comprises: (i) a probe coupled to the microcarrier, wherein the probe is specific for an RNA mutation in the ALK, ROS, RET, NTRK1, or cMET gene; and (ii) an identifier corresponding to the probe coupled thereto; wherein the kit comprises at least one microcam er comprising a probe specific for an RNA mutation in the ALK gene, at least one microcarrier comprising a probe specific for an RNA mutation in the ROS gene, at least one microcarrier comprising a probe specific for an RNA mutation in the RET gene, at least one microcarrier comprising a probe specific for an RNA mutation in the NTRK1 gene, and at least one microcarrier comprising a probe specific for an RNA mutation in the cMET gene; and wherein th ALK, ROS , RET, NTRK1, and cMET genes are human genes.
  • each of the four probes further comprises eight nucleotides at the 5’ end, and wherein the eight nucleotides at the 5’ end are adenine or thymine nucleotides.
  • the probe specific for the mutation in th QALK gene comprises: (1) a first probe comprising a sequence selected from the group consisting of TTTTTTTTTTAAAGGACCTAAAGTGT (SEQ ID NO: 162), TTTTTTTTTTCCTAAAGTGTACCGC (SEQ ID NO: 164),
  • TTTTTTTTTTTTTTGT AC CGC C GGAAGC AC SEQ ID NO: 178
  • TTTTTTTTTTTT C C GC C GG A A GC A C C A GGA SEQ ID NO: 180
  • a third probe comprising a sequence selected from the group consisting of TTTTTTTTTTTTTTTGTCATCATCAACCAA (SEQ ID NO: 182),
  • TTTTTTTTTTTTTTTTTTTT GT GT AC CGC C GGAAGC SEQ ID NO: 186
  • TTTTTTTTTTTTTCAACCAAGTGTACCG SEQ ID NO: 188
  • TTTTTTTTTTTTTTTACCGCCGGAAGCACCA SEQ ID NO: 190
  • a fourth probe comprising a sequence selected from the group consisting of TTTTTTTTTTTCGAAAAAAACAGCCAA (SEQ ID NO: 192)
  • TTTTTTTTTTTTTTTTTT C GCGAAAAAAAC AGC
  • TTTTTTTTTTTTTGTGTACCGCCGGAAGC SEQ ID NO: 196
  • each of the four probes further comprises eight nucleotides at the 5’ end, and wherein the eight nucleotides at the 5’ end are adenine or thymine nucleotides.
  • the probe specific for the mutation in the ROS gene comprises: (1) a first probe comprising a sequence selected from the group consisting of TTTTTTTTTTT ACTGACGCTCCACCGAAA (SEQ ID NO: 1)
  • TTTTTTTTTTTTTTTTT GATTTTT GGAT AC C A (SEQ IDNO:220); (3) a third probe comprising a sequence selected from the group consisting of
  • TTTTTTTTTT GT AGC GC CTTCC AGCT GGT (SEQ ID NO:234), TTTTTTTTTTTGGTTGGAGATGATTTTT (SEQ IDN0 236),
  • a fourth probe comprising a sequence selected from the group consisting of GTTAAAAAGGAGGATCCAA (SEQ ID NO 491), AC A AGAGTT A A A AAGG AGGA (SEQ ID NO:493), AAGAGTTAAAAAGGAGGATC (SEQ ID NO:495), AAAAGGAGGATCCAAAG (SEQ ID NO:497), and AAGGAGGATCCAAAGTG (SEQ ID NO: 499); and (5) a fifth probe comprising a sequence selected from the group consisting of AAACAGGAGGATCCAAA (SEQ IDNO 501), AAGTGCACAAACAGGAGG (SEQ ID NO: 503), GTGCACAAACAGGAGGATC (SEQ ID NO: 505), C AC AAAC AGGAGGAT (SEQ ID NO:507), and AACAGGAGGATCCAAA (SEQ ID NO:509); wherein each of the five probes is coupled to a lnicrocarrier with a different identifier.
  • TTTTTTTTTTTTT CGT ATCTCT C AAGAG (SEQ ID NO:486), TTTTTTTTTTCAAGAGGATCCAAA (SEQ ID N0 488), and
  • TTTTTTTT A AGGAGGAT CCA A AGT G (SEQ ID NO:500); and (5) a fifth probe composing a sequence selected from the group consisting of TTTTTTTT AAACAGGAGGATCCAAA
  • the mutation in the NTRK1 gene comprises a CD74-NTRK1 fusion gene. In some embodiments, the mutation in the NTRK1 gene comprises a CD74 E8:NTRK1 E12 fusion gene. In some embodiments, the probe specific for the mutation in the NTRK1 gene comprises a sequence selected from the group consisting of CAGGATCTGGGCCCAGACA (SEQ IDNO:261), GATCTGGGCCCAGACACTA (SEQ ID NO:263), CCAGACACTAACAGCACAT (SEQ ID NO:265), GGGCCCAGACACTAACAGC (SEQ ID NO:267), and
  • the probe specific for the mutation in the NTRK1 gene further comprises eight nucleotides at the 5’ end, and wherein the eight nucleotides at the 5’ end are adenine or thymine nucleotides.
  • the probe specific for the mutation in the NTRK1 gene comprises a sequence selected from the group consisting of TTTTTTTTACAGGATCTGGGCCCAGACA (SEQ ID NO:262), TTTTTTTTTTAGATCTGGGCCCAGACACTA (SEQ ID NO:264), TTTTTTTTTTACCAGACACTAACAGCACAT (SEQ ID NO:266), TTTTTTTTAGGGCCCAGACACTAACAGC (SEQ ID NO:268), and TTTTTTTTTT ACT AAC AGC AC AT CT GG AG A (SEQ ID NO: 270).
  • the kit further comprises a first primer that is suitable for generating cDNA specific for the mutation in the NTRK1 gene, wherein the first primer comprises the sequence GGACGAAAATCCAGACCCCAAAAGGTGTTTCGT (SEQ ID NO: 32); and a second primer specific for the mutation in the NTRK1 gene that comprises the sequence AGAAGACGTGACAGGAACTGGAGGACCCGTCTT (SEQ ID NO:30).
  • the mutation in the cMET gene results in exon skipping.
  • the mutation in the cMET gene results in skipping of exon 14.
  • the probe specific for the mutation in the cMET gene comprises a sequence selected from the group consisting of AGAAAGCAAATTAAAGAT (SEQ ID NO:271), AGCAAATTAAAGATCAG (SEQ ID NO:273), A AATT A A AGAT C AGTTT C (SEQ ID NO:275), AGATCAGTTTCCTAATTC (SEQ ID NO:277), and AAGATCAGTTTCCTAATT (SEQ ID NO:279).
  • the probe specific for one or more mutations in the cMET gene further comprises eight nucleotides at the 5’ end. and wherein the eight nucleotides at the 5’ end are adenine or thymine nucleotides.
  • the probe specific for the mutation in the cMET gene comprises a sequence selected from the group consisting of TTTTTTTT AGAAAGCAAATTAAAGAT (SEQ ID NO 272),
  • the kit futher comprises a first pnmer that is suitable for generating cDNA specific for the mutation in the cMET gene, wherein the first primer comprises the sequence
  • GACAGTATTTTGCAGTAATGGACTGGATATATCAGA (SEQ ID NO:29); and a second pnmer specific for the mutation in the cMET gene that comprises the sequence GAATTTCACAGGATTGATTGCTGGTGTTGTCTC (SEQ ID NO:28).
  • the identifiers of the micocarriers comprise digital barcodes.
  • each of the microcamers comprises: (i) a first photopolymer layer; (ii) a second photopolymer layer; and (iii) an intermediate layer between the first layer and the second layer, the intermediate layer having an encoded pattern representing the identifier defined thereon, wherein the intermediate layer is partially substantially transmissive and partially substantially opaque to light, representing a code corresponding to the microcarrier, wherein the outermost surface of the microcarrier comprises a photoresist photopolymer, and said photoresist photopolymer is functionalized with the probe specific for the DNA mutation, and wherein said microcarrier has about the same density as water.
  • each of the microcarriers comprises: (i) a substantially transparent polymer layer having a first surface and a second surface, the first and the second surfaces being parallel to each other; (ii) a substantially non-transparent layer that constitutes a two-dimensional shape, wherein the substantially non-transparent layer is affixed to the first surface of the substantially transparent polymer layer and encloses a center portion of the substantially transparent polymer layer, wherein the two-dimensional shape of the substantially non-transparent layer represents an analog code, and wherein the analog code corresponds to the identifier; and (iii) the probe specific for the mutation, wherein the probe is coupled to at least one of the first surface and the second surface of the substantially transparent polymer layer in at least the center portion of the substantially transparent polymer layer.
  • each of the microcarriers further comprises an orientation indicator for orienting the analog code of the substantially non-transparent polymer layer.
  • the polymer of the substantially transparent polymer layer composes an epoxy-based polymer.
  • the epoxy-based polymer is SU-8.
  • kits comprising: (a) a plurality of probes, wherein each probe of the plurality is coupled to a microcarrier that has a unique identifier corresponding to the probe coupled thereto, the plurality of probes comprising a first probe twelfth probe comprising the sequence TTTTTTTTTACAGGAGGCTGCCGA (SEQ ID NO: 464); a thirteenth probe comprising the sequence TTTTTTTTTACAGGAGGGAGCCG (SEQ ID NO:478); a fourteenth probe comprising the sequence TTTTTTT A GATGGC C ATCTTG (SEQ ID NO:426); a fifteenth probe comprising the
  • TTTTTTTTTTTTTTTTTTTTTTTT GT AGGGAAGT AC A (SEQ ID NO: 371); a twentieth probe comprising the sequence TTTTTAAATCAGAATCAGAAGGTGG (SEQ ID NO:396); a twentieth probe comprising the sequence TTTTT AAAT C AGAATC AGAAGGT GG (SEQ ID NO:396); a twenty-first probe comprising the sequence TTTTTTTTTACGTGATGGCTTACGT (SEQ ID NO:407); a twenty-second probe comprising the sequence
  • TTTTTTTTTTAGTGTACCGCCGGAA (SEQ ID NO: 168); a twenty-third probe comprising the sequence TTTTTTTTTTTTGACT AT GA A AT ATT GT AC (SEQ ID NO: 172); a twenty- a plurality of primer pairs, the plurality of primer pairs comprising a first primer pair comprising the sequences GT ACT GGT GG AGT ATTTGAT AGTG (SEQ ID NO: 1) and CGTCAAGGCACTCTTGCCTAC (SEQ ID NO:2); a second primer pair comprising the sequences CAATTTCTACAAGAGATCCTCTCTCT (SEQ ID NO:5) and
  • ATCGAGGATTTCCTTGTTGGCTT (SEQ ID NO: 14); a seventh primer pair comprising the sequences CCTCCACCGTGCAGATCATC (SEQ ID NO: 15) and TTCCCTGATTACCTTTGCGAT (SEQ ID NO: 16); an eighth pnmer pair comprising the sequences CC AC ACT GACGTGC CT CT (SEQ ID N0:511) and
  • GCACACGTAGGGGTTGTCCAAGA (SEQ ID N0:512); a ninth primer pair comprising the sequences CC AC ACT GACGTGC CT CT (SEQ ID NO: 513) and GTACACGCTGGCCACGCCG (SEQ ID NO:514); a tenth primer pair comprising the sequences CCACACTGACGTGCCTCT (SEQ ID NO: 515) and CAGGCGGCACACGTGAT (SEQ ID NO:516); an eleventh pnmer pair comprising the sequences CCACACTGACGTGCCTCT (SEQ ID NO: 517) and AGGCGGCACACGTGCGGGTTAC (SEQ ID NO:518); atwelfth primer pair comprising the sequences GGAGGACCGTCGCTTGG (SEQ ID NO: 17) and T CTTT CTCTTCCGCACC C AG (SEQ ID NO: 18); a thirteenth primer pair comprising the sequences GAGGGTCTGACGGGTAGAGTG (SEQ ID NO:380) and TGGCCGCCAGG
  • GGAGT GCC AT CGCTGTTT GAAAT GAGC AGGC ACT (SEQ ID NO: 19); a twenty-first pnmer pair comprising the sequences TACAGCCCTGGATATTCTTAGTAGCGC (SEQ ID NO: 20); a twenty -second primer pair comprising the sequences TACAGCCCTGGATATTCTTAGTAGCGC (SEQ ID NO:20); a twenty-third primer pair compnsmg the sequences GTGATCGCACAGTAGGACAGCGGCTGCGATC (SEQ ID NO:26) and TTTCTGGTGCTATGAGGAAATGACCAACCACCAGA (SEQ ID NO:23); a twenty-fourth primer pair comprising the sequences
  • ATTGATTCTGATGACACCGGA (SEQ ID NO: 521); a twenty-eighth pnmer pair comprising the sequences GGACGAAAAT CC AGACCC C AAAAGGT GTTT CGT (SEQ ID NO:32) and AGAAGACGTGACAGGAACTGGAGGACCCGTCTT (SEQ ID NO 30); a twenty-ninth primer pair comprising the sequences
  • GACAGTATTTTGCAGTAATGGACTGGATATATCAGA (SEQ ID NO:29) and GAATTTCACAGGATTGATTGCTGGTGTTGTCTC (SEQ ID NO:28); and (c) a plurality of blocking nucleic acids, the plurality of blocking nucleic acids comprising a first blocking nucleic acid compnsmgthe sequence TTGGAGCTGGTGGCGT(mvdT)«, wherein n is 1. 2. or 3 (SEQ ID NO:285); a second blocking nucleic acid comprising the sequence C T GAAA 7 C AC T GA G( GGi i n vdT ) «. wherein « is 1. 2.
  • n is 1, 2, or 3 (SEQ ID NO:310); a sixth blocking nucleic acid comprising the sequence C GGA ATGJTGCrrcrCT(invdT) «, wherein n is 1. 2. or 3 (SEQ ID NO: 312); a seventh blocking nucleic acid comprising the sequence TGC-t GC ' iCATC'ACGCA GC(in vdT) endeavour. wherein n is 1, 2, or 3 (SEQ ID NO:317); an eighth blocking nucleic acid comprising the sequence CCAGCA G77T GG( 'CAG( X 'CTrinvdT),,.
  • n is 1, 2, or 3 (SEQ ID NO: 322); a ninth blocking nucleic acid comprising the sequence GATGTACTCCCCT (invdT) «, wherein n is 1, 2, or 3 (SEQ ID NO:383); a tenth blocking nucleic acid comprising the sequence CL4CC7TC7GC7TC7GGGTA4GA (lnvdTty wherein n is 1, 2, or 3 (SEQ ID NO:403).
  • kits comprising: (a) a plurality of probes, wherein each probe of the plurality is coupled to a microcarrier that has a unique identifier corresponding to the probe coupled thereto, the plurality of probes comprising a first probe d third probe comprising the sequence TTTTTTTTTTTAATT GT GGCGTAGG (SEQ ID NO:65); a fourth probe comprising the sequence TTTTTTTTTAGCTCAGTGATTTTAG (SEQ ID a tenth probe comprising the sequence TTTTTTTTTCAAGACATCTCCGA (SEQ ID NO: 145); an eleventh probe comprising the sequence TTTTTTTTTTTGAGATGCATGATGA (SEQ ID NO:352); a twelfth probe comprising the sequence
  • a seventeenth probe comprising the sequence TTTTTTTTTTTGACGGTAACCCCC
  • TTTTTTT ATTTT GGGC GGGC C (SEQ ID NO: 152); a nineteenth probe comprising the a twenty-fourth probe comprising the sequence
  • TTTTTTTTTTTTTTTTTTTTTT GTGT AC C GC C GGA AGC (SEQ ID NO: 186); a twenty-fifth probe twenty-sixth probe comprising the sequence TTTTTTTTTACTGACGCTCCACCGAAA (SEQ ID NO:202); a twenty-seventh probe comprising the sequence TTTTTTTTTTTTGACGCTCCACCGAAA (SEQ ID NO:214); a twenty-eighth probe
  • a twenty -ninth probe comprising the sequence probe comprising the sequence TTTTTTTTTGGATCCAAAGTGGGAATT (SEQ ID NO:258); a thirty-second probe comprising the sequence TTTTTTTTTTCAAGAGGATCCAAA (SEQ ID NO:488); a thirty-third probe comprising the sequence
  • TTTTTTTTACAAGAGTTAAAAAGGAGGA SEQ ID NO:494; a thirty-fourth probe comprising the sequence TTTTT ATT A AGT GC AC A A AC AGGAGG (SEQ ID NO:504); a
  • TTTTTTTTTTAG ATC A GTTTCC T A ATTC (SEQ IDNO:278); (b) a plurality of primer pairs, the plurality of primer pairs comprising a first primer pair comprising the sequences GT ACTGGTGGAGTATTTGAT AGTG (SEQ ID NO: 1) and
  • CGTCAAGGCACTCTTGCCTAC (SEQ ID NO:2); a second primer pair comprising the sequences CAATTTCTACAAGAGATCCTCTCTCT (SEQ ID NO:5) and CTCCATTTTAGCACTTACCTGTGAC (SEQ ID NO:6); a third primer pair comprising the sequences ACC CT AGCCTT AGAT AAAACT GAGC (SEQ ID NO:7) and TTTGTTGTCCAGCCACCATGA (SEQ ID NO: 8); a fourth primer pair comprising the sequences ATAGCCTCAATTCTTACCATCCACAAAATG (SEQ ID NO:9) and CAGATATATTTCTTCATGAAGACCTCACAGTAA (SEQ ID NO: 10); a fifth primer pair compnsing the sequences CTTGTGGAGCCTCTTACACCC (SEQ ID NO:l 1) and TGCCGAACGCACCGGA (SEQ ID NO: 12); a sixth primer pair comprising the sequences GCCAGTTAACGTCTTCCTTCTC (SEQ ID NO: 13)
  • ATCGAGGATTTCCTTGTTGGCTT (SEQ ID NO: 14); a seventh primer pair comprising the sequences CCTCCACCGTGCAGATCATC (SEQ ID NO: 15) and TTCCCTGATTACCTTTGCGAT (SEQ ID NO: 16); an eighth primer pair comprising the sequences CC AC ACT GACGTGC CT CT (SEQ ID NO:511) and
  • GCACACGTAGGGGTTGTCCAAGA (SEQ ID NO:512); a ninth primer pair comprising the sequences CCACACTGACGTGCCTCT (SEQ ID NO: 513) and GTACACGCTGGCCACGCCG (SEQ ID NO:514); a tenth primer pair comprising the sequences CCACACTGACGTGCCTCT (SEQ ID NO: 515) and CAGGCGGCACACGTGAT (SEQ ID NO:516); an eleventh primer pair comprising the sequences CCACACTGACGTGCCTCT (SEQ ID NO: 517) and AGGCGGCACACGTGCGGGTTAC (SEQ ID NO:518); atwelfth primer pair comprising the sequences GGAGGACCGTCGCTTGG (SEQ ID NO: 17) and TCTTTCTCTTCCGCACCCAG (SEQ ID NO: 18); a thirteenth primer pair comprising the sequences GAGGGTCTGACGGGTAGAGTG (SEQ ID NO:380) and TGGCCGCCAGGTCTTGATGTA
  • GGAGT GCC AT CGCTGTTT GAAAT GAGC AGGC ACT (SEQ ID NO: 19); a twenty-first pnmer pair comprising the sequences TACAGCCCTGGATATTCTTAGTAGCGC (SEQ ID NO: 20); a twenty -second primer pair comprising the sequences TACAGCCCTGGATATTCTTAGTAGCGC (SEQ ID NO:20); a twenty -third pnmer pair comprising the sequences GTGATCGCACAGTAGGACAGCGGCTGCGATC (SEQ ID NO:26) and TTT CT GGTGCT ATGAGGAAAT GAC C AAC C ACC AGA (SEQ ID NO:23); a twenty-fourth pnmer pair comprising the sequences
  • GACAGTATTTTGCAGTAATGGACTGGATATATCAGA SEQ ID NO:29
  • GAATTTCACAGGATTGATTGCTGGTGTTGTCTC SEQ ID NO:28
  • a plurality' of blocking nucleic acids comprising a first blocking nucleic acid comprising the sequence TTGGAGCTGG7GGCGTA(invdT) «, wherein n is 1.
  • n is 1, 2, or 3 (SEQ ID NO:320); an eighth blocking nucleic acid comprising the sequence CCAGCA G7TT GGCCA GC(XT(invdT) « , wherein n is 1, 2, or 3 (SEQ ID NO: 325); a ninth blocking nucleic acid comprising the sequence; GATGTACTCCCCTACA (invdT),,. wherein n is 1, 2, or 3 (SEQ ID NO:386); a tenth blocking nucleic acid comprising the sequence CACCnCTGCnCTGGG (mvdT),, wherein n is 1, 2, or 3 (SEQ ID NO:401).
  • kits comprising: (a) a plurality of probes, wherein each probe of the plurality is coupled to a microcarrier that has a unique identifier corresponding to the probe coupled thereto, the plurality of probes comprising a first probe d third probe comprising the sequence TTTTTTTTTAAGGAGCTTGTGGC (SEQ ID NO: 63); a fourth probe comprising the sequence TTTTTTTTTTTCTCAGTGATTTTAGA (SEQ ID NO:96); a fifth probe comprising the sequence
  • TTTTTTTTTTTTTCTCCTGCTTAGT (SEQ ID NO: 100); a sixth probe compnsing the eighth probe comprising the sequence TTTTTTTTCAAAGTGCTGGCCTC (SEQ ID NO: 118); a ninth probe comprising the sequence TTTTTTTTTAATCAAAACATCTCCG (SEQ ID NO: 127); a tenth probe comprising the sequence
  • TTTTTTTTAATCAAGACATCTCCGA (SEQ ID NO: 137); an eleventh probe comprising the thirteenth probe comprising the sequence TTTTTTTTTACCAGGAGGGAGCC (SEQ ID NO: 472); a fourteenth probe comprising the sequence TTTTTTTTTTAGGCCATCTTGGA (SEQ ID NO:424); a fifteenth probe comprising the sequence
  • TTTTTTTTACGTCTGTAGGGAAGTA SEQ ID NO:379); a twentieth probe comprising the sequence TTTTT AAATTT ACCC AGAAT C AGAA (SEQ ID NO:388); a twenty -first probe twenty-eighth probe comprising the sequence
  • TTTTTTTTTTTTTTTT CTGGTT GG AGCT GG AGT C CC (SEQ ID NO :224); a twenty-ninth probe thirtieth probe comprising the sequence TTTTTTTTTGATGTAAAGATCCACTGTG (SEQ ID NO:248); a thirty-first probe comprising the sequence TTTTTTTTTATGATGTAAAGGAGGATCC (SEQ ID NO:260); a thirty-second probe comprising the sequence TTTTTTTTTTT GT ATCTCTC AAGAGGATCC AA (SEQ ID NO:484); a thirty -third probe comprising the sequence TTATTATTAAGAGTTAAAAAGGAGGATC (SEQ ID NO:811); a thirty -fourth probe comprising the sequence TATTATTATGTGCACAAACAGGAGGATC (SEQ ID NO: 506); a thirty-fifth probe comprising the sequence TTTTTTTTAGGGCCCAGACACTAACAGC (SEQ ID NO:268); a thirty-sixth
  • ATCGAGGATTTCCTTGTTGGCTT (SEQ ID NO: 14); a seventh primer pair comprising the sequences CCTCCACCGTGCAGATCATC (SEQ ID NO: 15) and TTCCCTGATTACCTTTGCGAT (SEQ ID NO: 16); an eighth primer pair comprising the sequences CC AC ACT GACGTGC CT CT (SEQ ID NO:511) and
  • GCACACGTAGGGGTTGTCCAAGA (SEQ ID NO:512); a ninth primer pair comprising the sequences CC AC ACT GACGTGC CT CT (SEQ ID NO: 513) and GTACACGCTGGCCACGCCG (SEQ ID NO:514); a tenth primer pair comprising the sequences CCACACTGACGTGCCTCT (SEQ ID NO: 515) and CAGGCGGCACACGTGAT (SEQ ID NO:516); an eleventh primer pair comprising the sequences CCACACTGACGTGCCTCT (SEQ ID NO: 517) and AGGCGGCACACGTGCGGGTTAC (SEQ ID N0 518); atwelfth primer pair comprising the sequences GGAGGACCGTCGCTTGG (SEQ ID NO: 17) and T CTTT CTCTTCC GC ACC C AG (SEQ ID NO: 18); a thirteenth primer pair comprising the sequences GAGGGTCTGACGGGTAGAGTG (SEQ ID NO:380) and TGGCCGCCAGGTCTT
  • GGAGTGCCATCGCTGTTTGAAATGAGCAGGCACT (SEQ ID NO: 19); a twenty-first primer pair comprising the sequences TACAGCCCTGGATATTCTTAGTAGCGC (SEQ ID NO: 20); a twenty -second primer pair comprising the sequences TACAGCCCTGGATATTCTTAGTAGCGC (SEQ ID NO:20); a twenty-third primer pair comprising the sequences GTGATCGCACAGTAGGACAGCGGCTGCGATC (SEQ ID NO:26) and TTT CT GGTGCT ATGAGGAAAT GAC C AAC C ACC AGA (SEQ ID NO:23); a twenty-fourth primer pair comprising the sequences
  • GACAGTATTTTGCAGTAATGGACTGGATATATCAGA SEQ ID NO:29
  • GAATTTCACAGGATTGATTGCTGGTGTTGTCTC SEQ ID NO:28
  • a plurality of blocking nucleic acids comprising a first blocking nucleic acid comprising the sequence TACGCCACCAGCT(invdT)n, wherein n is 1.
  • a second blocking nucleic acid comprising the sequence TCTCfGriA4TCACTG4GCAGG(invdT) radical, wherein n is 1, 2, or 3 (SEQ ID NO:293); a third blocking nucleic acid comprising the sequence CACCAJGATGlGCAT(imdT) «, wherein n is 1, 2, or 3 (SEQ ID NO:296); a fourth blocking nucleic acid comprising the sequence GA GA ⁇ T 7 ' ( ( T G ⁇ ⁇ GY Yi n v dT wherein n is 1, 2, or 3 (SEQ ID NO:303); a fifth blocking nucleic acid comprising the sequence GL4GCCC4GCAC (invdTty, wherein n is 1.
  • a sixth blocking nucleic acid compnsmg the sequence CGGAGATGTTGCTTCTCnAATTCC(imdT)n, wherein n is 1, 2, or 3 (SEQ ID NO:311); a seventh blocking nucleic acid comprising the sequence G47C4CGC4GCTCATG(invdT) «, wherein n is 1, 2, or 3 (SEQ ID NO:316); an eighth blocking nucleic acid comprising the sequence C CAG( G777GGY '( A GGCCT (i n vdT )-,.
  • n is 1, 2, or 3 (SEQ ID NO:321); a ninth blocking nucleic acid comprising the sequence TGTACTCCCCTACA (invdT) endeavour, wherein n is 1, 2, or 3 (SEQ ID NO: 382); a tenth blocking nucleic acid comprising the sequence T CTGCl T C 7 ' G GG 7 ' Ari G (invdTty, wherein n is 1. 2. or 3 (SEQ ID NO:399).
  • FIGS. 1A & IB show two views of an exemplar ⁇ microcamer.
  • FIGS. 1C & ID show an exemplary assay for DNA detection using an exemplary microcamer.
  • FIG. 2A shows three examples of microcarriers, each having a unique analog code.
  • FIG. 2B shows examples of microcarriers with a unique analog code, in accordance with some embodiments.
  • FIG. 2C shows an example of a microcarrier with a unique analog code, in accordance with some embodiments.
  • FIG. 3 shows a flowchart illustrating an exemplary method for detecting the presence of DNA mutation(s) and RNA vanant(s), in accordance with some embodiments.
  • FIGS. 4 & 5 illustrate an exemplar ⁇ ' scheme for preferentially amplifying and detecting mutant (FIG. 5) over wild-type (FIG. 4) loci corresponding to a DNA mutation of interest, in accordance with some embodiments.
  • Solid horizontal lines indicate amplified DNA sequences
  • dashed horizontal lines indicate pnmer/probe/blocking nucleic acid (NA) sequences
  • vertical lines indicate Watson-Crick base pairing.
  • FIG. 6 shows a flowchart illustrating an exemplary protocol for isolating RNA and cell-free DNA (cfDNA) from a blood sample.
  • FIGS. 7A-7C show the results of multiplex detection of DNA mutations. Values reflect the fluorescence signal (in arbitrary units, AU) obtained for each pairwise combination of amplified DNA specific for each indicated DNA mutation (columns) and microcarrier- coupled probe specific for each indicated DNA mutation (rows).
  • FIGS. 8A & 8B show the results of multiplex detection of RNA variants. Values reflect the fluorescence signal (in arbitrary units, AU) obtained for each pairwise combination of RNA sample specific for each indicated RNA variant (columns) and microcarrier-coupled probe specific for each indicated RNA variant (rows).
  • FIGS. 9A & 9B show the results of multiplex detection of RNA and DNA mutations from patient samples.
  • RNA was obtained from formalm-fixed, paraffin-embedded (FFPE) samples, and selected mutations were detected by next-generation sequencing (NGS), as compared to the microcarrier approach described herein (LCP).
  • NGS next-generation sequencing
  • LCP microcarrier approach described herein
  • FIGS. 10A-10C show comparisons between the microcarrier approach described herein (LCP) and other mutation detection techniques in detecting DNA or RNA mutations in tissue samples or liquid biopsies (blood samples) obtained from patients with stage I or II lung cancer. Shown are the results obtained using DNA or RNA from liquid biopsies (FIG. 10A), DNA from tissue samples (FIG. 10B), or RNA from tissue samples (FIG. IOC). These results demonstrate the versatility of the LCP approach in detecting a variety of cancer-associated mutations from different samples in DNA or RNA.
  • LCP microcarrier approach described herein
  • NRAS, PIK3CA, BRAF, EGFR, AKTI,MEKI, and HER2 genes and/or RNA mutations in th eALK, ROS, RET, NTRK1, and cMET genes are provided herein.
  • the methods include isolating RNA from a sample; amplifying DNA from the isolated RNA by reverse transcription-polymerase chain reaction (RT-PCR), wherein amplifying the DNA comprises: generating cDNA specific for each of the ALK, ROS, RET, NTRKI, and cMET genes from the isolated RNA using a first primer specific for each of the ALK, ROS, RET, NTRKI, and cMET genes, the isolated RNA, and a reverse transcriptase, and amplifying DNA specific for each of th QALK, ROS, RET, NTRKI, and cMET genes by polymerase chain reaction (PCR) using the cDNA, a DNA polymerase, the first primer, and a second primer specific for each of the ALK.
  • RT-PCR reverse transcription-polymerase chain reaction
  • ROS, RET, NTRKI, and cMET genes that binds to a strand of the cDNA opposite the corresponding first primer and promotes strand extension in a direction opposite that promoted by the corresponding first primer; hybridizing the amplified DNA with at least five probes, said at least five probes comprising one or more probes specific for a mutation in each of the ALK, ROS, RET, NTRKI, and cMET genes, wherein each of said at least five probes is coupled to a microcarrier, and wherein each of the microcarriers comprises an identifier corresponding to the probe coupled thereto; detecting presence or absence of hybridization of the amplified DNA with said at least five probes, wherein hybridization between the amplified DNA and one of the probes indicates the presence of the mutation corresponding to the probe; detecting the identifiers of the microcarners; and correlating the detected identifiers of the microcarriers with the detected presence or absence of hybridization of the amplified DNA to the corresponding probes of
  • the methods include isolating DNA and RNA from a sample; amplifying the isolated DNA by polymerase chain reaction (PCR) using primer pairs specific for the loci of one or more DNA mutations in each of the KRAS, NRAS, PIK3CA, BRAF, EGER, AKT1, MEK1, and HER2 genes; amplifying DNA from the isolated RNA by reverse transcription-polymerase chain reaction (RT-PCR), wherein amplifying the DNA from the isolated RNA comprises: generating cDNA specific for each of the ALK. ROS, RET, NTRKI, and cMET genes from the isolated RNA using a first primer specific for each of the ALK.
  • PCR polymerase chain reaction
  • RT-PCR reverse transcription-polymerase chain reaction
  • ROS, RET, NTRKI, and cMET genes the isolated RNA, and a reverse transcriptase, and amplifying DNA specific for each of the ALK, ROS, RET, NTRKI, and cMET genes by polymerase chain reaction (PCR) using the cDNA, a DNA polymerase, the first primer, and a second primer specific for each of th QALK, ROS, RET, NTRKI, and cMET genes that binds to a strand of the cDNA opposite the corresponding first primer and promotes strand extension in a direction opposite that promoted by the corresponding first primer; hybridizing the DNA amplified by PCR from the isolated DNA with at least seven probes, said at least seven probes comprising one or more probes specific for a mutation in each of the KRAS, NRAS, PIK3CA, BRAF, EGFR, AKT1, MEK1, and HER2 genes, wherein each of said at least seven probes is coupled to a microcarner, and wherein each of the
  • kits for performing any of the methods described herein include microcarriers, probe sequences, pnmers, and/or blocking nucleic acids, e.g., as described herein.
  • microcarrier may refer to a physical substrate onto which a capture agent or probe may be coupled.
  • a microcarrier of the present disclosure may take any suitable geometric form or shape.
  • the microcarrier may be disc shaped.
  • the form or shape of a microcarrier will include at least one dimension on the order of 10 to 10 7 m (hence the prefix “micro”).
  • polymer as used herein may refer to any macromolecular structure comprising repeated monomers.
  • a polymer may be natural (e.g., found in nature) or synthetic (e.g., man-made, such as a polymer composed of non-natural monomer(s) and/or polymerized in a configuration or combination not found in nature).
  • substantially transparent and substantially non-transparent may refer to the ability of light (e.g., of a particular wavelength, such as infrared, visible, UV, and so forth) to pass through a substrate, such as a polymer layer.
  • a substantially transparent polymer may refer to one that is transparent, translucent, and/or pervious to light, whereas a substantially non-transparent polymer may refer to one that reflects and/or absorbs light. It is to be appreciated that whether a matenal is substantially transparent or substantially non-transparent may depend upon the wavelength and/or intensity of light illuminating the material, as well as the means detecting the light traveling through the matenal (or a decrease or absence thereof).
  • a substantially non-transparent material causes a perceptible decrease in transmitted light as compared to the surrounding material or image field, e.g., as imaged by light microscopy (e.g., bnght field, dark field, phase contrast, differential interference contrast (DIC), Nomarski interference contrast (NIC), Nomarski, Hoffman modulation contrast (HMC), or fluorescence microscopy).
  • light microscopy e.g., bnght field, dark field, phase contrast, differential interference contrast (DIC), Nomarski interference contrast (NIC), Nomarski, Hoffman modulation contrast (HMC), or fluorescence microscopy.
  • a substantially transparent material allows a perceptible amount of transmitted light to pass through the material, e.g., as imaged by light microscopy (e.g., bnght field, dark field, phase contrast, differential interference contrast (DIC), Nomarski interference contrast (NIC), Nomarski, Hoffman modulation contrast (HMC), or fluorescence microscopy).
  • light microscopy e.g., bnght field, dark field, phase contrast, differential interference contrast (DIC), Nomarski interference contrast (NIC), Nomarski, Hoffman modulation contrast (HMC), or fluorescence microscopy.
  • analog code may refer to any code in which the encoded information is represented in a non-quantized and/or non-discrete manner, e.g., as opposed to a digital code.
  • a digital code is sampled at discrete positions for a limited set of values (e.g., 0/1 type values), whereas an analog code may be sampled at a greater range of positions (or as a continuous whole) and/or may contain a wider set of values (e.g., shapes).
  • an analog code may be read or decoded using one or more analog shape recognition techniques.
  • sample refers to a composition containing a material, such as a molecule, to be detected.
  • the sample is a "biological sample” (i.e., any material obtained from a living source (e g human, animal, plant, bacteria, fungi, protist, vims)).
  • the biological sample can be in any form, including solid materials (e.g tissue, cell pellets, biopsies, FFPE samples, etc.) and biological fluids (e.g. urine, blood or plasma, stool, saliva, lymph, tears, sweat, prostatic fluid, seminal fluid, semen, bile, mucus, pleural effusion, amniotic fluid and mouth wash (containing buccal cells)).
  • Solid materials typically are mixed with a fluid.
  • Sample can also refer to an environmental sample such as water, air, soil, or any other environmental source.
  • Certain aspects of the present disclosure relate to methods for detecting the presence of DNA mutations (e.g. , one or more mutations in the KRAS, NRAS, PIK3CA, BRAF, EGFR, AKT1, MEK1, and/or FIERI genes) and/or RNA mutations (e.g., one or more mutations in th QALK, ROS, RET, NTRK1, and/or cMET genes) by using microcarriers, e.g., an encoded microcarrier described herein, or any of the microcarriers described in International Publication No. WO2016198954.
  • DNA mutations e.g. , one or more mutations in the KRAS, NRAS, PIK3CA, BRAF, EGFR, AKT1, MEK1, and/or FIERI genes
  • RNA mutations e.g., one or more mutations in th QALK, ROS, RET, NTRK1, and/or cMET genes
  • the methods of the present disclosure employ encoded microcarrier(s) with some or all of the microcarrier features and aspects described herein, e.g., in sections IV, V, and VI.
  • these encoded microcarriers allow for detection of DNA and/or RNA mutations in improved multiplex assays with a large number of potential unique microcarriers and reduced recognition error, as compared to traditional multiplex assays.
  • a flowchart described an exemplary method for detection of mutations is provided in FIGS. 3 & 6, and exemplary PCR techniques are illustrated in FIGS. 4 & 5.
  • the detection methods used herein may be performed in any suitable assay vessel known in the art, for example a microplate, petri dish, or any number of other well-known assay vessels.
  • the methods of the present disclosure include isolating DNA and/or RNA from a sample.
  • Standard molecular techniques known in the art allow for the isolation of DNA or RNA from a variety of different ty pes of samples.
  • DNA and RNA isolation kits suitable for a variety' of samples are commercially available.
  • the methods include isolating DNA and RNA from the same sample, e.g., a whole blood or plasma sample.
  • An exemplary protocol for isolating DNA e.g., circulating free or cell-free DNA, cfDNA
  • RNA e.g, from one or more of platelets, white blood cells, exosomes, circulating tumor cells, and free RNA
  • FIG. 6 see also Best, M.G. et al. (2015) Cancer Cell 28:666-676.
  • the methods include isolating total RNA-rich plasma (TRRP) by centrifuging a whole blood or plasma sample (e.g., by centrifuging whole blood at 200xg for 20 minutes and removing the TRRP), subjecting the TRRP to one or more centrifugation steps to generate an RNA fraction and a cell-free DNA (cfDNA) fraction (e.g., by centrifuging TRRP at lOOxg for 20 minutes, removing the upper fraction, then centrifuging again for 360xg for 20 minutes), isolating DNA from the cfDNA fraction, and isolating RNA from the RNA fraction.
  • TRRP total RNA-rich plasma
  • cfDNA cell-free DNA
  • An exemplary' protocol is also provided in Example 2.
  • the methods of the present disclosure use DNA from a sample at a concentration of between about 0.3 ng/pL to about 1 ng/pL. In some embodiments, the methods of the present disclosure use DNA from a sample at a concentration of at least about 0.3 ng/pL.
  • the methods of the present disclosure use RNA from a sample at a concentration of between about 2 ng/pL to about 30 ng/pL. In some embodiments, the methods of the present disclosure use RNA from a sample at a concentration of at least about 2 ng/pL.
  • lung cancer can refer to various types of lung cancers, including without limitation non-small cell lung cancer (e.g., including subtypes such as adenocarcinoma, squamous cell carcinoma, and large cell carcinoma), small cell or oat cell cancer, and lung carcinoid tumors (e.g., bronchial carcinoids).
  • non-small cell lung cancer e.g., including subtypes such as adenocarcinoma, squamous cell carcinoma, and large cell carcinoma
  • small cell or oat cell cancer e.g., bronchial carcinoids
  • a large body of research has implicated specific mutations in critical genes in many lung cancers.
  • mutations in KRAS, PIK3CA, BRAF, or EGFR are thought to be present in at least 40% of non-small-cell lung cancers (Rosell, R. etal. (2009) N. Engl J. Med. 361:958-967). Mutational screening is thought to improve patient outcomes, e.g., by identifying patients who are more likely to respond to targeted treatments, such as tyrosine kinase inhibitors.
  • the methods of the present disclosure can be used to detect analytes (e.g., DNA and/or RNA mutations) in any suitable solution.
  • the solution comprises a biological sample.
  • the solution comprises DNA or RNA isolated from a biological sample and, optionally, a buffer. Suitable buffers for DNA/RNA isolation are well-known in the art.
  • biological samples include without limitation stool, blood, serum, plasma, urine, sputum, pleural effusion, bile, cerebrospinal fluid, interstitial fluid of skin or adipose tissue, saliva, tears, bronchial-alveolar lavage, oropharyngeal secretions, intestinal fluids, cervico-vaginal or uterine secretions, and seminal fluid.
  • the biological sample may be from a human.
  • the solution comprises a sample that is not a biological sample, such as an environmental sample, a sample prepared in a laboratory (e.g., a sample containing one or more analytes that have been prepared, isolated, purified, and/or synthesized), a fixed sample (e.g., a formalin-fixed, paraffin-embedded or FFPE sample), and so forth.
  • a biological sample such as an environmental sample, a sample prepared in a laboratory (e.g., a sample containing one or more analytes that have been prepared, isolated, purified, and/or synthesized), a fixed sample (e.g., a formalin-fixed, paraffin-embedded or FFPE sample), and so forth.
  • a sample prepared in a laboratory e.g., a sample containing one or more analytes that have been prepared, isolated, purified, and/or synthesized
  • a fixed sample e.g., a formalin-fixed, paraffin-em
  • the methods of the present disclosure include amplifying DNA (e.g., DNA isolated from a sample as descnbed supra ) by polymerase chain reaction (PCR).
  • PCR polymerase chain reaction
  • PCR techniques are well-known in the art. Briefly, a thermostable DNA polymerase is used to amplify copies of a DNA sequence of interest using template DNA strands (e.g., isolated from a sample and denatured) and a pair of oligonucleotide primers that are complementary to the 3’ ends of the sense and anti-sense strands (respectively) of the DNA template.
  • the DNA polymerase is mixed in a reaction with both primers, all four deoxynucleotides (dNTPs), a buffer, magnesium ions (e.g., MgCh). and potassium ions (e.g, KC1), and optionally other ingredients.
  • the reaction mixture is then subjected to multiple cycles (e.g., 20-40) of temperature changes that allow for denaturation of the DNA template, annealing of the primers to the denatured, single-stranded template, and primer extension by the DNA polymerase.
  • Various DNA polymerases with different properties of interest e.g., ability to amplify long or repetitive templates, high fidelity, hot start, etc.
  • properties of interest e.g., ability to amplify long or repetitive templates, high fidelity, hot start, etc.
  • the methods of the present disclosure include amplifying DNA from RNA (e.g, RNA isolated from a sample as described supra) by reverse transcription-polymerase chain reaction (RT-PCR).
  • RT-PCR techniques are well-known in the art. Briefly, a reverse transcriptase and a primer complimentary to the 3’ end of an RNA molecule of interest are used for synthesizing first strand cDNA, which is then used as a template for PCR as described above using a DNA polymerase and a second primer for amplifying the strand opposite that amplified by the first primer.
  • the first primer comprises a 5’ label or modification, such as biotin.
  • Various reverse transcriptases with different properties of interest e.g., increased thermostability, modified RNase H activity, etc.
  • the methods of the present disclosure include amplifying (e.g. , by PCR or RT-PCR) from isolated DNA or RNA the loci of one or more mutations in one or more specific genes of interest.
  • a “locus” of a DNA or RNA mutation comprises the mutation itself and sufficient adjacent sequence on one or both sides of the mutation for PCR amplification of, and/or probe hybridization to, the mutated DNA sequence (or, in the case of RNA, for PCR amplification of cDNA generated from the RNA).
  • the minimum sequence length sufficient for PCR amplification can be influenced by several factors, including without limitation the polymerase, the melting temperature of the primers, the propensity of the primers to form primer dimers, the ratio of the template to primers, etc.
  • the locus of a mutation comprises at least about 100 base pairs of adjacent sequence (i.e.. including adjacent sequence both 5’ and 3’ to the mutation). In some embodiments, the locus of a mutation comprises less than or equal to about 200 base pairs of adjacent sequence (i.e., including adjacent sequence both 5’ and 3’ to the mutation).
  • the locus of a DNA mutation can be amplified using a pair of primers specific to the locus, using the locus as the DNA or cDNA template.
  • each PCR reaction can include multiple primer pairs, each specific for a DNA mutation of interest.
  • amplifying the locus of a DNA or RNA mutation encompasses amplifying the mutant locus and/or the corresponding wild-type locus. It will be appreciated that m most instances, while many mutations can be screened in a multiplex assay, any individual sample will typically include one or very few of the mutations being screened.
  • a DNA mutation of the present disclosure refers to a mutation that is detected using DNA from a sample
  • an RNA mutation of the present disclosure refers to a mutation that is detected using RNA from a sample (e.g, by generating cDNA and, subsequently, DNA from the RNA).
  • mutations such as point mutations, deletions, insertions, and translocations/rearrangements may be present in both DNA and RNA from a sample (e.g., comprising tumor cells and/or nontumor cells)
  • the methods of the present disclosure include amplifying the loci of one or more mutations (e.g., DNA mutations) in a KRAS gene.
  • KRAS encodes the KRAS proto-oncogene, a small GTPase frequently mutated in human cancers, also known as the Kirsten rag sarcoma viral oncogene homolog, PR310 c-K-ras oncogene, c-Ki-ras, c- Kirsten-ras, K-Ras2, K-ras p21, GTPase KRas, cellular c-Ki-ras2 proto-oncogene, cellular transforming proto-oncogene, oncogene KRAS2, transforming protein p21, and v-Ki-ras2 Kirsten rat sarcoma 2 viral oncogene homolog.
  • the KRAS gene is a human KRAS gene.
  • a human KRAS gene refers to the gene described by NCBI Entrez Gene ID No. 3845, including mutants and variants thereof.
  • the T S gene is from one of the following organisms: mouse (see. e.g., NCBI Entrez Gene ID No. 16653), rat (see, e.g., NCBI Entrez Gene ID No. 24525), cynomolgus monkey (see, e.g., NCBI Entrez Gene ID No. 102131483), fish (see, e.g., NCBI Entrez Gene ID No. 445289), dog (see, e.g., NCBI Entrez Gene ID No.
  • NCBI Entrez Gene ID No. 541140 see, e.g., NCBI Entrez Gene ID No. 541140
  • horse see, e.g., NCBI Entrez Gene ID No. 100064473
  • chicken see, e.g., NCBI Entrez Gene ID No. 418207
  • chimpanzee see, e.g., NCBI Entrez Gene ID No. 473387
  • rhesus monkey see, e.g., NCBI Entrez Gene ID No. 707977
  • cat see, e.g., NCBI Entrez Gene ID No. 751104.
  • KRAS mutations associated with cancer may be suitably detected by the methods described herein; see, e.g., Lovly, C., L. Horn, W. Pao. 2015. KRAS in Non-Small Cell Lung Cancer (NSCLC). My Cancer Genome at www.mycancergenome.org/content/disease/lung-cancer/kras/ (Updated June 18). Point mutations in KRASare found in 10-25% of lung cancers. KRAS mutations are seldom seen together with EGFR or ALK alterations in lung cancer and are more frequently observed in former or current smokers compared to never smokers.
  • KRAS mutations are generally associated with poor prognosis in NSCLC. However, a recent large retrospective study found no difference in prognosis by KRAS exon 12 mutation in patients with early stage NSCLC, calling into question the role of KRAS mutations a prognostic biomarker. Testing for KRAS mutations can be useful in determining a patient’s sensitivity to tyrosine kinase inhibitors, such as MEK inhibitors.
  • RAS mutations such as in NSCLC, are associated with resistance to EGFR inhibitors, such as cetuximab, panitumumab, and erlotmib.
  • FDA approved drugs sensitive to KRAS include sorafenib, regorafenib, palbociclib, cobimetinib, and trametinib.
  • a KRAS mutation is named based on the resulting amino acid substitution/deletion/frameshift according to a human KRAS protein, e.g., as set forth in
  • a DNA mutation results in the mutation of G12 according to SEQ ID NO: 326 or
  • a DNA mutation in a KRAS gene encodes or results in a G12C, G12D, or G12V mutated KRAS protein (numbering according to SEQ ID NO: 326). These DNA mutations are also described by their nucleotide positions (rather than mutated polypeptide codons) in Table A1 infra.
  • a DNA mutation in &KRAS gene results in a c.34G>C, c.34G>T, c.35G>A, mutation in the corresponding cDNA sequence of SEQ ID NO: 339.
  • a primer pair for amplifying the locus of a KRAS mutation comprises the sequences GTACTGGTGGAGTATTTGATAGTG (SEQ ID NO:l) and CGTCAAGGCACTCTTGCCTAC (SEQ ID NO:2), respectively.
  • the methods of the present disclosure include amplifying the loci of one or more mutations (e.g. , DNA mutations) in a BRAF gene.
  • BRAF encodes the BRAF proto-oncogene, a serine/threonine kinase frequently mutated in human cancers, also known as B-Raf, BRAF1, B-RAF1, RAFB1, NS7, 94kDa B-raf protein, p94, murine sarcoma viral (v-raf) oncogene homolog Bl, v-raf murine sarcoma viral oncogene homolog B, and v-raf murine sarcoma viral oncogene homolog Bl.
  • the BRAF gene is a human BRAF gene.
  • a human BRAF gene refers to the gene described by NCBI Entrez Gene ID No. 673, including mutants and variants thereof.
  • the BRAF gene is from one of the following organisms: mouse (see, e.g., NCBI Entrez Gene ID No. 109880), rat (see, e.g., NCBI Entrez Gene ID No. 114486), cynomolgus monkey (see, e.g., NCBI Entrez Gene ID No. 101866436), fish (see, e.g., NCBI Entrez Gene ID No. 403065), dog (see, e.g., NCBI Entrez Gene ID No.
  • NCBI Entrez Gene ID No. 536051 cattle (see, e.g., NCBI Entrez Gene ID No. 536051), horse (see, e.g.. NCBI Entrez Gene ID No. 100065760), chicken (see, e.g., NCBI Entrez Gene ID No. 396239), chimpanzee (see, e.g., NCBI Entrez Gene ID No. 463781), rhesus monkey (see, e.g., NCBI Entrez Gene ID No. 693554), or cat (see, e.g., NCBI Entrez Gene ID No. 101092346).
  • BRAF mutations associated with cancer may be suitably detected by the methods described herein; see, e.g., Lovly, C., L. Horn, W. Pao. 2015. BRAF in Non-Small Cell Lung Cancer (NSCLC). My Cancer Genome at www.mycancergenome.org/content/disease/lung-cancer/braf/ (Updated June 18). The majonty of the BRAF gain of function mutations alter residues in the kinase domain, most notably V600E, detectable by molecular testing. BRAF mutations and EGFR mutations are believed to be mutually exclusive.
  • BRAF rearrangements detectable by FISH, such as BRAF- KIAA1549, are also reported in some cancers. Amplifications are observed in certain cancers. Constitutive activation of BRAF has been observed in multiple cancers, including lung, where it leads to activation of the RAF/MEK/ERKpathway. Point mutations (1-4%) and copy number gam (1.43%) in BRAF are found in NSCLC. Prognosis associated with BRAFfusions is neutral in NSCLC when treated with chemotherapy. BRAF and MEK1/2 inhibitors are approved or under clinical evaluation as single agents or in combination for the treatment of BRAF mutant cancers. Some patients with V600E mutations have increased sensitivity to the BRAF inhibitors vemurafenib and dabrafimb.
  • BRAF inhibition may ultimately result in resistance to BRAF or MEK inhibitors.
  • BRAF V600E mutations are resistant to EGFR therapies, such as cetuximab or panitumumab, as well as imatinib and sumtmib. While specific mutations and fusions, such as BRAF D594A/V and K483M, are insensitive to RAF inhibitors they are sensitive to MEK inhibitors.
  • BRAF fusions like BRAF- KIAA1549, are resistant to first generation BRAF inhibitors, such as vemurafenib, but second generation BRAF inhibitors are being investigated.
  • a BRAF mutation is named based on the resulting amino acid substitution/deletion/frameshift according to a human BRAF protein, e.g., as set forth in
  • VH (SEQ ID NO:329).
  • An exemplary human BRAF cDNA sequence is set forth in
  • a DNA mutation results in the mutation of V600 according to SEQ ID NO: 329 or SEQ ID NO: 342.
  • a DNA mutation in a BRAF gene encodes or results in a V600E mutated BRAF protein (numbering according to SEQ ID NO:329). These DNA mutations are also described by their nucleotide positions (rather than mutated polypeptide codons) in Table A1 infra. It is to be appreciated that some references to the V600E BRAF mutation refer to it as V599E due to an early, incorrect BRAF protein sequence that was missing a codon at approximately amino acid 31 (see Garnett, M.J. and Marais, R (2004) Cancer Cell 6:313-9 for description).
  • a DNA mutation in a BRAF gene results in a c.1799T>A mutation in the corresponding cDNA sequence of SEQ ID NO: 342.
  • a primer pair for amplifying the locus of a BRAF mutation comprises the sequences ATAGCCTCAATTCTTACCATCCACAAAATG (SEQ ID NO:9) and CAGATATATTTCTTCATGAAGACCTCACAGTAA (SEQ ID NOTO), respectively.
  • the methods of the present disclosure include amplifying the loci of one or more mutations (e.g. , DNA mutations) in an NBAS gene.
  • NRAS encodes the NRAS proto-oncogene, a small GTPase frequently mutated in human cancers, also known as the Neuroblastoma RAS viral oncogene homolog, NCMS, NS6, ALPS4, CMNS, and NCMS.
  • the NRAS gene is a human NRAS gene.
  • a human NRAS gene refers to the gene described by NCBI Entrez Gene ID No. 4893, including mutants and variants thereof.
  • the NRAS gene is from one of the following organisms: mouse (see, e.g., NCBI Entrez Gene ID No. 18176), rat (see, e.g., NCBI Entrez Gene ID No. 24605), fish (see, e.g., NCBI Entrez Gene ID No. 30380), dog (see, e.g, NCBI Entrez Gene ID No. 403872), cattle (see, e.g, NCBI Entrez Gene ID No. 506322), horse (see, e.g., NCBI Entrez Gene ID No. 100059469), or chimpanzee (see, e.g., NCBI Entrez Gene ID No. 742713).
  • NRAS mutations associated with cancer are known and may be suitably detected by the methods described herein; see, e.g., Lovly, C., L. Horn, W. Pao. 2015. NRAS in Non-Small Cell Lung Cancer (NSCLC). My Cancer Genome at www.mycancergenome.org/content/disease/lung-cancer/nras/ (Updated lune 18).
  • NRAS alterations observed in cancer are mutations at codons 12, 13, and 61 (90%), and within the phosphate binding loop/Gl motif (residues 10-17), the switch II region (residues 59-67), and the G5 motif (residues 145-147). Somatic mutations in NRAS is rarely (0.2-1%) reported in primary NSCLC, but their role in carcinogenesis has been proven. Smoking and environmental carcinogens are associated with the etiolog of NRAS mutated lung cancer. NRAS mutations have been correlated with metastases ofNSCLC (1.5%).
  • Somatic mutations in NRAS are generally associated with poor response to standard therapies
  • MEK inhibitors such as selumetinib
  • NRAS mutations such as E63K0
  • anti- EGFR therapies such as cetuximab and panitumumab
  • anti-BRAF therapies such as vemurafenib and dabrafenib
  • ALK TKIs and radiotherapy.
  • an NRAS mutation is named based on the resulting amino acid substitution/deletion/frameshift according to a human NRAS protein, e.g., as set forth in MTEYKLVVV GAGGY GKSALTIQLIQNHF VDEYDPTIEDSYRKQVVIDGETCLLDILDT AGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVG NKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNS SDDGTQGCMGLPCVVM (SEQ ID NO: 327).
  • An exemplary human NRAS cDNA sequence is set forth in
  • a DNA mutation results in the mutation of Q61 according to SEQ ID NO:327 or SEQ ID NO:340.
  • a DNA mutation in an NRAS gene encodes or results in a Q61L mutated NRAS protein (numbering according to SEQ ID NO: 327). These DNA mutations are also described by their nucleotide positions (rather than mutated polypeptide codons) in Table A1 infra.
  • a DNA mutation in an NRAS gene results in a c. l82A>T mutation in the corresponding cDNA sequence of SEQ ID NO:340.
  • a primer pair for amplifying the locus of an NRAS mutation comprises the sequences CCACACCCCCAGGATTCTT (SEQ ID NO:3) and TTGGTCTCTCATGGCACTGTACTC (SEQ ID NO:4), respectively.
  • the methods of the present disclosure include amplifying the loci of one or more mutations (e.g., DNA mutations) in aPIK3CA gene.
  • PIK3CA encodes the class I phosphatidylinositol-4,5-bisphosphate (PI) 3-kinase catalytic subunit, also known as the pllOa protein, CLOVE, CWS5, MCM, MCAP, PI3K, CLAPO, MCMTC, and PI3K-alpha.
  • the PIK3CA gene is a human PIK3CA gene.
  • a human PIK3CA gene refers to the gene described by NCBI Entrez Gene ID No.
  • the PIK3CA gene is from one of the following organisms: mouse (see, e.g., NCBI Entrez Gene ID No. 18706), rat (see, e.g., NCBI Entrez Gene ID No. 170911), fish (see, e.g., NCBI Entrez Gene ID No. 561737), dog (see, e.g., NCBI Entrez Gene ID No. 488084), cattle (see, e.g., NCBI Entrez Gene ID No. 282306), horse (see, e.g., NCBI Entrez Gene ID No. 100058141), chimpanzee (see, e.g., NCBI Entrez Gene ID No. 460858), or rhesus monkey (see, e.g., NCBI Entrez Gene ID No. 709959).
  • mouse see, e.g., NCBI Entrez Gene ID No. 18706
  • rat see, e.g., NCBI Entrez Gene ID No. 170911
  • fish see,
  • PIK3CA mutations associated with cancer are known and may be suitably detected by the methods described herein; see, e.g., Lovly, C.. L. Horn, W. Pao. 2015. PIK3CA in Non-Small Cell Lung Cancer (NSCLC).
  • NSCLC Non-Small Cell Lung Cancer
  • Activating mutations or amplification in PIK3CA result in constitutively active PI3K.
  • PIK3CA gain of function mutations occur within the kinase (particularly residues 1043, 1047, and H1049R), alpha-helical (particularly residues E542K, E545K, and 546), and C- (particularly residues 345 and 420) domains. Other key domains that are less frequently mutated are the adaptor and linker domains.
  • the PIK/AKT/mTOR pathway is dysregulated in 50-70% of NSCLC and PIK3CA mutations are detected in 1-5% of NSCLC. Copy number gain in PIK3CA is observed in lung cancer (16-20%), more frequently in sqNSCLC, and less frequently in SCLC (4.7%).
  • HGGWTTKMDWIFHTIKQHALN (SEQ ID NO: 328).
  • An exemplary human PIK3CA cDNA sequence is set forth in
  • a DNA mutation results in the mutation of E542, E545, or Ell 047 according to SEQ ID NO: 328 or SEQ ID NO:341.
  • a DNA mutation in a PJK3CA gene encodes or results in an E542K, E545K, or H1047R mutated PIK3CA protein (numbering according to SEQ ID NO:328). These DNA mutations are also described by their nucleotide positions (rather than mutated polypeptide codons) in Table A1 infra.
  • a DNA mutation in a PIK3CA gene results in a c 1624G>A, c 1633G>A, or c 3140 A>G mutation in the corresponding cDNA sequence of SEQ ID NO:341.
  • a primer pair for amplifying the locus of a PIK3CA mutation is a primer pair for amplifying the locus of a PIK3CA mutation
  • a primer pair for amplifying the locus of a PIK3CA mutation comprises the sequences ACCCTAGCCTTAGATAAAACTGAGC (SEQ ID NO:7) and TTTGTTGTCCAGCCACCATGA (SEQ ID NO: 8), respectively .
  • the methods of the present disclosure include amplifying the loci of one or more mutations (e.g. , DNA mutations) in an EGFR gene.
  • EGFR encodes the epidermal growth factor receptor, a receptor tyrosine kinase frequently mutated in human cancers, also known as ERBB, ERBB1, HER1, NISBD2, PIG61, and mENA.
  • the EGFR gene is a human EGFR gene.
  • a human EGFR gene refers to the gene described by NCBI Entrez Gene ID No. 1956, including mutants and variants thereof.
  • the EGFR gene is from one of the following organisms: mouse (see, e.g., NCBI Entrez Gene ID No. 13649), rat (see, e.g., NCBI Entrez Gene ID No. 24329), dog (see, e.g., NCBI Entrez Gene ID No. 404306), cattle (see, e.g., NCBI Entrez Gene ID No. 407217), horse (see, e.g., NCBI Entrez Gene ID No. 100067755), chicken (see, e.g., NCBI Entrez Gene ID No. 396494), or cat (see, e.g., NCBI Entrez Gene ID No. 100510799).
  • EGFR mutations associated with cancer are known and may be suitably detected by the methods described herein; see, e.g, Lovly, C. L. Horn, W. Pao. 2015. EGFR in Non-Small Cell Lung Cancer (NSCLC).
  • NSCLC Non-Small Cell Lung Cancer
  • EGFR alterations including overexpression, amplification, and mutation, are involved in development of numerous solid tumors.
  • the most frequent EGFR mutations in cancer are in the kinase domain, including indels between residues 739-757 and mutations of L858, leading to constitutive activation.
  • Lung cancer point mutations in EGFR occur 28.94% of the time, while copy number gain is found in 5.06% of lung cancers.
  • EGFR mutations in lung cancer are associated with adenocarcinoma in female nonsmokers of Asian ethnicity. Specific point mutations are frequently encountered in NSCLC: G719, T790M, C797S, and L861, and have distinct therapeutic relevance.
  • Lung cancer patients with mutations in exons 18, 19, and 21 may be sensitive to EGFR inhibitors, such as erlotinib and gefitinib.
  • Acquired mutations in exon 20, such as T790M are known to be resistant to first generation EGFR TKIs.
  • Later generation EGFR TKIs, such as afatimb and osimertinib were developed to counter resistant variants, including T790M.
  • Other mutations, such as C797S, L844V, and L718Q may be responsible for resistance to third generation TKIs.
  • EGFR alterations may also drive resistance to ALK-targeted therapy.
  • FDA approved EGFR inhibitors include osimertinib, gefitinib, erlotinib, necitumumab, and afatinib.
  • Osimertinib is approved for the treatment of T790M lung cancer.
  • Gefitinib is approved for metastatic NSCLC with EGFR exon 19 deletions or exon 21 (L858R) substitution mutations as detected by an FDA-approved test.
  • Other FDA approved drugs sensitive to EGFR include lapatinib, vandetanib, cetuximab, and panitumumab.
  • an EGFR mutation is named based on the resulting amino acid substitution/deletion/frameshift according to a human EGFR protein, e.g. , as set forth in MRPSGTAGAALLALLAALCPASRALEEKKYCQGTSNKLTQLGTFEDHFLSLQRMFNN CEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENS YALAVLSNYDANKTGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSDFLS NMSMDFQNHLGSCQKCDPSCPNGSCWGAGEENCQKLTKIICAQQCSGRCRGKSPSDC CHNQCAAGCTGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFG ATCVKKCPRNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGE FKDSLSINATNIKHF
  • a DNA mutation in an EGFR gene results in a c.2156G>C, c.2235_2249dell5, c.2236_2250dell5, C.23690T, c.2389T>A, c.2390G>C, c.2303G>T, c.2307_2308ins9GCCAGCGTG, c.2319_2320msCAC, c.2310_2311msGGT, c.231 l_2312ins9GCGTGGACA, c.2309_2310AC>CCAGCGTGGAT, or c.2573T>G mutation in the corresponding cDNA sequence of SEQ ID NO:343.
  • a primer pair for amplifying the locus of an EGFR mutation comprises the sequences CTTGTGGAGCCTCTTACACCC (SEQ ID NO: 11) and TGCCGAACGCACCGGA (SEQ ID NO: 12), respectively.
  • a primer pair for amplifying the locus of an EGFR mutation comprises the sequences GCC AGTT AACGT CTTC CTTCTC (SEQ ID NO: 13) and ATCGAGGATTTCCTTGTTGGCTT (SEQ ID NO: 14), respectively.
  • a pnmer pair for amplifying the locus of an EGFR mutation comprises the sequences CCTCCACCGTGCAGATCATC (SEQ ID NO: 15) and TTCCCTGATTACCTTTGCGAT (SEQ ID NO: 16), respectively.
  • a primer pair for amplifying the locus of an EGFR mutation e.g., encoding or resulting in a T790M, C797S, S768I,
  • V769_D770insASV, H773_V774msH, D770_N771insG, D770_N771insSVD, or V769_D770insASV mutated EGFR protein comprises the sequences CCTCCACCGTGCAGATCATC (SEQ ID NO: 15) and TTCCCTGATTACCTTTGCGAT (SEQ ID NO: 16), respectively.
  • a primer pair for amplifying the locus of an EGFR mutation comprises the sequences CCACACTGACGTGCCTCT (SEQ ID NO:511) and GCACACGTAGGGGTTGTCCAAGA (SEQ ID NO:512), respectively.
  • a primer pair for amplifying the locus of an EGFR mutation comprises the sequences CCACACTGACGTGCCTCT (SEQ ID NO: 513) and GTACACGCTGGCCACGCCG (SEQ ID NO:514), respectively.
  • a primer pair for amplifying the locus of an EGFR mutation (e.g., encoding or resulting in an H773_V774insH mutated EGFR protein) composes the sequences CCACACTGACGTGCCTCT (SEQ ID NO:515) and CAGGCGGCACACGTGAT (SEQ ID NO:516), respectively.
  • a primer pair for amplifying the locus of an EGFR mutation comprises the sequences CCACACTGACGTGCCTCT (SEQ ID NO: 517) and AGGCGGCACACGTGCGGGTTAC (SEQ ID NO:518), respectively.
  • a primer pair for amplifying the locus of an EGFR mutation comprises the sequences GGAGGACCGTCGCTTGG (SEQ ID NO: 17).
  • the methods of the present disclosure include amplifying the loci of one or more mutations (e.g., DNA mutations) in an AKTl gene.
  • AKTl encodes the RAC-alpha serine/threonine protein kinase frequently mutated in human cancers, also known as AKT, CWS6, PKB, PKB-ALPHA, PRKBA, RAC, and RAC-ALPHA.
  • the AKTl gene is a human AKTl gene.
  • a human AK ⁇ gene refers to the gene described by NCBI Entrez Gene ID No. 207, including mutants and vanants thereof.
  • the AKTl gene is from one of the following organisms: mouse (see, e.g., NCBI Entrez Gene ID No. 11651), rat (see, e.g., NCBI Entrez Gene ID No. 24185), fish (see, e.g., NCBI Entrez Gene ID No. 101910198), dog (see, e.g., NCBI Entrez Gene ID No. 490878), cattle (see, e.g., NCBI Entrez Gene ID No. 280991), chicken (see, e.g., NCBI Entrez Gene ID No. 395928), or chimpanzee (see, e.g, NCBI Entrez Gene ID No. 740898).
  • mouse see, e.g., NCBI Entrez Gene ID No. 11651
  • rat see, e.g., NCBI Entrez Gene ID No. 24185
  • fish see, e.g., NCBI Entrez Gene ID No. 101910198
  • dog see, e.g., NCBI
  • AKTl mutations associated with cancer are known and may be suitably detected by the methods described herein; see, e.g., Lovly, C., L. Horn, W. Pao. 2015. AKT1 in Non-Small Cell Lung Cancer (NSCLC).
  • NSCLC Non-Small Cell Lung Cancer
  • the AKT1 proto-oncogene on chromosome 14, encodes a serine-threonine protein kinase (PKB) and a downstream effector of PI3K that plays a role in cell proliferation, survival, apoptosis, cell growth, glucose metabolism, genome stability, transcription, and neovascularization.
  • PKT1 serine-threonine protein kinase
  • AKT1 promotes constitutive activation of the mTOR signaling pathway and the glycolytic phenotype in multiple cancers.
  • the most frequent AKTl alteration observed in cancer is E17K in the pleckstrin homology domain.
  • Amplification and overexpression of AKTl have also been observed in certain cancers. Point mutations in AKTl occur in lung cancer (0.6%), but more frequently in sqNSCLC (2-5%).
  • AKTl In lung cancer, 1.01% have copy number gain in AKTl.
  • Testing for AKTl mutations can be useful for determining sensitivity to various drugs, such as PI3K/AKT/mTOR inhibitors, including everolimus.
  • Constitutive activation of AKTl is associated with resistance to chemotherapy or radiation therapy in a variety of cancers, including EGFR-TKIs in lung cancer. While no direct AKT inhibitor has been yet approved for cancer, FDA approved drugs sensitive to AKTl include everolimus and temsirolimus.
  • Prechmcal data report inhibition of certain AKTl mutations, including E17K, by AKT inhibitors.
  • Various allosteric and ATP-competitive AKT inhibitors are currently in clinical trials.
  • an AK ⁇ I mutation is named based on the resulting amino acid substituti on/del etion/frameshift according to a human AKTl protein, e.g. , as set forth in MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVA QCQLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEM DFRSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYY AMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGE LFFHLSRERVFSEDRARFY GAEIV S ALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDF GLCKEGIKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGL
  • An exemplary human AKTl cDNA sequence is set forth in ATGAGCGACGTGGCTATTGTGAAGGAGGGTTGGCTGCACAAACGAGGGGAGTACAT CAAGACCTGGCGGCCACGCTACTTCCTCCTCAAGAATGATGGCACCTTCATTGGCTA CAAGGAGCGGCCGCAGGATGTGGACCAACGTGAGGCTCCCCTCAACAACTTCTCTG TGGCGCAGTGCCAGCTGATGAAGACGGAGCGGCCCCGGCCCAACACCTTCATCATC
  • a DNA mutation results in the mutation of E17 according to SEQ ID NO:331 or
  • a DNA mutation in an AKT1 gene encodes or results in an E17K mutated AKT1 protein (numbering according to SEQ ID NO:331).
  • This DNA mutation is also described by its nucleotide positions (rather than mutated polypeptide codons) in Table A1 infra.
  • a DNA mutation in an AKT1 gene results in a c.49G>A mutation in the corresponding cDNA sequence of SEQ ID NO:344.
  • a primer pair for amplifying the locus of an AKT1 mutation comprises the sequences GAGGGT CT GAC GGGT AGAGT G (SEQ ID NO 380) and TGGCCGCCAGGTCTTGATGTA (SEQ ID NO:381), respectively.
  • the methods of the present disclosure include amplifying the loci of one or more mutations (e.g., DNA mutations) in a MEK1 gene.
  • MEK1 encodes the dual specificity mitogen-activated protein kinase kinase 1 frequently mutated in human cancers, also known as MAP2K1, CFC3, MAPKK1, MKK1, and PRKMK1.
  • the MEK1 gene is a human MEK1 gene.
  • a human MEK1 gene refers to the gene described by NCBI Entrez Gene ID No. 5604, including mutants and variants thereof.
  • the MEK1 gene is from one of the following organisms: mouse (see, e.g., NCBI Entrez Gene ID No. 26395), rat (see, e g., NCBI Entrez Gene ID No. 170851), fish (see, e g., NCBI Entrez Gene ID No. 406728), dog (see, e g., NCBI Entrez Gene ID No. 478347), cattle (see, e.g., NCBI Entrez Gene ID No. 533199), horse (see, e.g., NCBI Entrez Gene ID No. 100065996), chimpanzee (see, e.g., NCBI Entrez Gene ID No. 450188), or rhesus monkey (see, e.g., NCBI Entrez Gene ID No. 710415).
  • mouse see, e.g., NCBI Entrez Gene ID No. 26395
  • rat see, e g., NCBI Entrez Gene ID No. 170851
  • fish see, e
  • a variety oiMEKl mutations associated with cancer are known and may be suitably detected by the methods described herein; see, e.g., Lovly, C., L. Horn, W. Pao. 2015. MEK1 (MAP2K1) in Non-Small Cell Lung Cancer (NSCLC).
  • NSCLC Non-Small Cell Lung Cancer
  • a MEK1 mutation is named based on the resulting amino acid substitution/deletion/frameshift according to a human MEK1 protein, e.g., as set forth in MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQK VGELKDDDFEKISELGAGNGGYYFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQYLH ECNSPYIVGFY GAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKV SIAVIKGLTYL REKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTH YSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLS SYGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAE
  • a DNA mutation results in the mutation of Q56 or
  • DNA mutation in a MEK1 gene encodes or results in a K57N mutated MEK1 protein (numbering according to SEQ ID N0 332) These DNA mutations are also described by their nucleotide positions (rather than mutated polypeptide codons) in Table A1 infra.
  • a DNA mutation in a Ml ' K 1 gene results in a c.171G>T mutation in the corresponding cDNA sequence of SEQ ID NO:345.
  • a primer pair for amplifying the locus of &MEK1 mutation comprises the sequences CCTTCAGTTCTCCCACCTTCTG (SEQ ID NO:398).
  • the methods of the present disclosure include amplifying the loci of one or more mutations (e.g., DNA mutations) in a HER2 gene.
  • HER2 encodes the HER2/neu proto-oncogene, a receptor tyrosine kinase frequently mutated in human cancers, also known as ERBB2, HER-2, CD340, MLN19, NEU, NGL, and TKR1.
  • the HER2 gene is a human HER2 gene.
  • a human HER2 gene refers to the gene described by NCBI Entrez Gene ID No. 2064, including mutants and variants thereof.
  • the HER2 gene is from one of the following organisms: mouse (see, e.g., NCBI Entrez Gene ID No. 13866), rat (see, e.g, NCBI Entrez Gene ID No. 24337), fish (see, e.g., NCBI Entrez Gene ID No. 30300), dog (see, e.g., NCBI Entrez Gene ID No. 403883), horse (see, e.g., NCBI Entrez Gene ID No. 100054739), chimpanzee (see, e.g., NCBI Entrez Gene ID No. 454636), or cat (see, e.g., NCBI Entrez Gene ID No. 751824).
  • mouse see, e.g., NCBI Entrez Gene ID No. 13866
  • rat see, e.g, NCBI Entrez Gene ID No. 24337
  • fish see, e.g., NCBI Entrez Gene ID No. 30300
  • dog see, e.g., NCBI Entrez Gene ID No
  • HER2 mutations associated with cancer are known and may be suitably detected by the methods described herein; see, e.g., Lovly, C., L. Horn, W. Pao. 2015. HER2 (ERBB2) in Non-Small Cell Lung Cancer (NSCLC). My Cancer Genome at www.mycancergenome.org/content/disease/lung-cancer/erbb2/ (Updated June 18). Alterations in ERBB2 found in cancer also include insertions in the kinase domain or deletions in the extracellular domain. Large deletions in the extracellular domain of ERBB2 result in mutant products p95HER2 and A16HER2.
  • E1ER2 activation is associated with poor prognosis in a number of cancer types, including NSCLC with co-expression of EGFR.
  • NSCLC NSCLC with co-expression of EGFR.
  • HER2 and MET amplifications are the most common findings of acquired resistance (10-20%) under first- generation EGFR TKIs in NSLCs.
  • FDA approved drugs sensitive to ERBB2 include trastuzumab, afatinib, lapatinib, and pertuzumab. The ratio of T790M/activating-mutations may predict the patients who will remain sensitive to third-generation TKIs longer.
  • HER2+ status is associated with resistance to endocrine and chemotherapy regimens. Alterations, including 95HER2, A16HER2, L726, L755, P780, and small insertions in exon 20 are resistant to trastuzumab or lapatinib.
  • the second- generation EGFR HER-TKIs including afatinib, dacomitmib, and neratimb, irreversibly block enzymatic activation of EGFR, HER2, andHER4.
  • a HER2 mutation is named based on the resulting amino acid substitution/deletion/frameshift according to a human E1ER2 protein, e.g., as set forth in
  • a DNA mutation results in the mutation of
  • a DNA mutation in a HER2 gene encodes or results in a A775_G776insYVMA mutated HER2 protein (numbering according to SEQ ID NO:333). These DNA mutations are also described by their nucleotide positions (rather than mutated polypeptide codons) in Table
  • a DNA mutation in a HER2 gene results in a c.2324_2325insl2 mutation in the corresponding cDNA sequence of SEQ ID NO:346.
  • a primer pair for amplifying the locus of a HER2 mutation comprises the sequences ATGGCTGTGGTTTGTGATGGT (SEQ ID NO:414) and ACACCAGCCATCACGTAAGACA (SEQ ID NO:415), respectively.
  • the methods of the present disclosure include amplifying the loci of one or more mutations (e.g., RNA mutations) in an ALK gene.
  • ALK encodes the anaplastic lymphoma kinase, a receptor tyrosine kinase frequently mutated in human cancers, also known as CD246, NBLST3, or the ALK tyrosine kinase receptor.
  • the ALK gene is a human ALK gene.
  • a human ALK gene refers to the gene described by NCBI Entrez Gene ID No. 238, including mutants and variants thereof.
  • the ALK gene is from one of the following organisms: mouse (see, e.g., NCBI Entrez Gene ID No. 11682), rat (see, e.g, NCBI Entrez Gene ID No. 266802), fish (see, e.g., NCBI Entrez Gene ID No. 563509), cattle (see, e.g., NCBI Entrez Gene ID No. 536642), chicken (see, e.g., NCBI Entrez Gene ID No. 421297), or chimpanzee (see, e.g., NCBI Entrez Gene ID No. 459127)
  • a variety of ALK mutations associated with cancer are known and may be suitably detected by the methods described herein; see, e.g., Lovly, C., L. Horn, W. Pao. 2015. ALK in Non-Small Cell Lung Cancer (NSCLC).
  • NSCLC Non-Small Cell Lung Cancer
  • the ALK gene on chromosome 2, encodes a receptor tyrosine kinase involved in cell growth, transformation, and differentiation. Alterations in ALK constitutively activate the kinase regulating the JAK-STAT3, PI3K-AKT and RAS-MAPK pathways and driving tumorigenesis in various tissues. The most common ALK alterations are gene rearrangements detectable by fluorescence in situ hybridization (FISH). In addition to fusions, various cancers harbor gain of function mutations in ALK, such as F1174L, D1091N, I1250T, and R1275. ALK-rearranged NSCLC represents 3-7% of all NSCLC.
  • ALK-rearranged NSCLC Eight percent of ALK-rearranged NSCLC are also EGFR+ or KRAS+ mutated. ALK rearrangements are associated with response to crizotmib in approximately 60-70% of ALK+ patients.
  • a number of point mutations, such as the F1174L, are known to be associated with resistance to ALK inhibitor therapy. Additionally, ALK copy number gain as well as activating mutations in other driver genes such as EGFR may be acquired resistance mechanisms in patients undergoing ALK inhibitor therapy.
  • FDA approved drugs sensitive to ALK against NSCLC include ceritinib, alectinib, and cnzotinib. Evidence suggests differential primary response to crizotinib depending on the ALK fusion partner in NSCLC.
  • Heat shock protein 90 (HSP90) inhibitors present a potential line of treatment due to dependence of ALK fusions, such as EML4-ALK, on HSP90 for stability.
  • Next-generation agents such as alectinib may salvage CNS metastasis in ALK+ patients treated with both crizotinib and ceritinib.
  • an ALK mutation is named based on the resulting amino acid substitution/deletion/frameshift/translocation according to a human ALK protein, e.g , as set forth in
  • an RNA mutation results in a translocation, gene rearrangement, or fusion gene at the ALK locus. In some embodiments, an
  • RNA mutation results in a fusion between the ALK and EML4 genes.
  • an RNA mutation in an ALK gene encodes or results in an E13;A20, E20;A20,
  • E6a;A20, E6b;A20 ALK fusion protein As used herein, nomenclature for a fusion gene (e.g., any of the RNA mutations involving fusion genes described herein) can use the following formats interchangeably: GENE1 E#: GENE2 E# (e.g., EML El 3: ALK E20) and
  • GENE1#;GENE2# e.g., E13;A20
  • GENE1#;GENE2# e.g., E13;A20
  • a primer pair for amplifying the locus of an ALK mutation is a primer pair for amplifying the locus of an ALK mutation
  • EML4:ALK fusion protein comprises one sequence (e.g., that hybridizes with an EML4-specific locus of the fusion gene) selected from the group consisting of TATGGAGCAAAACTACTGTAGAGCC (SEQ ID N0 357), CCAGCTACATCACACACCTTGACT (SEQ ID N0 358), TAATACCAAAAGTTACCAAAACTGCA (SEQ ID NO:359), CAATCTCTGAAGATCATGTGGCC (SEQ ID NO: 360), CAAGTGGCACAGTGGTGGC (SEQ ID N0 361), and TAACTGGAGGAGGGAAAGACAGA (SEQ ID NO:362); and another sequence (e.g., that hybridizes with an ALK-specific locus of the fusion gene) selected from the group consisting of AGTTGGGGTTGTAGTCGGTCAT (SEQ ID NO:363) and GAAGCCTCCCTGGATCTCC (SEQ ID N0 364).
  • AGTTGGGGTTGTAGTCGGTCAT
  • the methods of the present disclosure include amplifying the loci of one or more mutations (e.g. , RNA mutations) in an ROS gene.
  • ROS encodes the c-ros proto-oncogene, a receptor tyrosine kinase frequently mutated in human cancers, also known as ROS1, MCF3, and c-ros- 1.
  • the ROS gene is a human ROS gene.
  • a human ROS gene refers to the gene described by NCBI Entrez Gene ID No.
  • the ROS gene is from one of the following organisms: mouse (see, e.g., NCBI Entrez Gene ID No. 19886), rat (see, e.g., NCBI Entrez Gene ID No. 25346), fish (see, e.g., NCBI Entrez Gene ID No. 245951), cattle (see, e.g., NCBI Entrez Gene ID No. 100336768), chicken (see, e.g., NCBI Entrez Gene ID No. 396192), or chimpanzee (see, e.g., NCBI Entrez Gene ID No. 472108).
  • ROS mutations associated with cancer are known and may be suitably detected by the methods described herein; see, e.g., Lovly, C., L. Horn, W. Pao. 2015. ROS1 in Non-Small Cell Lung Cancer (NSCLC).
  • NSCLC Non-Small Cell Lung Cancer
  • My Cancer Genome at www.mycancergenome.org/contenEdisease/lung-cancer/rosl/ (Updated November 17).
  • a number of ROS 1 fusions, detectable by FISH, have been identified in 1-2% of NSCLC: FIG- ROS1, SLC34A2-ROS1, CD74-ROS1, LRIG3-ROS1, KDELR2-ROS1, and CCDC6- ROS1.
  • ROS1 rearrangements share clinical and histological characteristics: never- or lightsmoking history, female, younger age, and adenocarcinoma with signet ring cell histology.
  • ALK and ROS1 fusion tumors have a significantly shorter disease free survival, which does not translate into a short overall survival, since patients respond to targeted therapy, such as crizotinib.
  • Two thirds of ROS 1+ patients respond to crizotmib, approved in the first-line for NSCLC.
  • Crizotinib resistant ROS1G2032R mutants are sensitive to foretmib and cabozantinib. Patients ultimately develop secondary' resistance to crizotinib and later generation therapies.
  • an ROS mutation is named based on the resulting amino acid substitution/deletion/frameshift/translocation according to a human ROS protein, e.g., as set forth in MKNIYCLIPKLVNFATLGCLWISVVQCTVLNSCLKSCVTNLGQQLDLGTPHNLSEPCIQG

Landscapes

  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Health & Medical Sciences (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Engineering & Computer Science (AREA)
  • Immunology (AREA)
  • Analytical Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Biotechnology (AREA)
  • Physics & Mathematics (AREA)
  • Biophysics (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Microbiology (AREA)
  • Pathology (AREA)
  • Hospice & Palliative Care (AREA)
  • Oncology (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
PCT/US2021/012541 2020-01-08 2021-01-07 Image differentiated multiplex assays for detection of dna mutations in lung cancer Ceased WO2021142153A1 (en)

Priority Applications (4)

Application Number Priority Date Filing Date Title
CN202180018443.1A CN115210385A (zh) 2020-01-08 2021-01-07 用于检测肺癌中的dna突变的图像区分多重测定
EP21738790.1A EP4087948A4 (en) 2020-01-08 2021-01-07 IMAGE-DIFFERENTIATED MULTIPLEX ASSAYS FOR DETECTION OF DNA MUTATIONS IN LUNG CANCER
US17/758,511 US20230052147A1 (en) 2020-01-08 2021-01-07 Image differentiated multiplex assays for detection of dna mutations in lung cancer
JP2022542157A JP2023510304A (ja) 2020-01-08 2021-01-07 肺癌におけるdna変異の検出のための画像識別多重アッセイ

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US202062958599P 2020-01-08 2020-01-08
US62/958,599 2020-01-08

Publications (1)

Publication Number Publication Date
WO2021142153A1 true WO2021142153A1 (en) 2021-07-15

Family

ID=76788349

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2021/012541 Ceased WO2021142153A1 (en) 2020-01-08 2021-01-07 Image differentiated multiplex assays for detection of dna mutations in lung cancer

Country Status (5)

Country Link
US (1) US20230052147A1 (https=)
EP (1) EP4087948A4 (https=)
JP (1) JP2023510304A (https=)
CN (1) CN115210385A (https=)
WO (1) WO2021142153A1 (https=)

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2014144121A2 (en) * 2013-03-15 2014-09-18 Life Technologies Corporation Classification and actionability indices for lung cancer
CN107881232A (zh) * 2017-10-26 2018-04-06 上海仁东医学检验所有限公司 探针组合物及基于ngs方法检测肺癌和结直肠癌基因的应用
WO2018107183A1 (en) * 2016-12-09 2018-06-14 Plexbio Co., Ltd. Image differentiated multiplex assays for multiplex detection of dna mutations

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2014144121A2 (en) * 2013-03-15 2014-09-18 Life Technologies Corporation Classification and actionability indices for lung cancer
WO2018107183A1 (en) * 2016-12-09 2018-06-14 Plexbio Co., Ltd. Image differentiated multiplex assays for multiplex detection of dna mutations
CN107881232A (zh) * 2017-10-26 2018-04-06 上海仁东医学检验所有限公司 探针组合物及基于ngs方法检测肺癌和结直肠癌基因的应用

Non-Patent Citations (5)

* Cited by examiner, † Cited by third party
Title
HOSGOOD III, H DEAN; PAO WILLIAM; ROTHMAN NATHANIEL; HU WEI; PAN YUMEI HELEN; KUCHINSKY KYLE; JONES KIRK D; XU JUN; VERMEULEN ROEL: "Driver mutations among never smoking female lung cancer tissues in China identify unique EGFR and KRAS mutation pattern associated with household coal burning", RESPIRATORY MEDICINE, vol. 107, no. 11, 2013, pages 1755 - 1762, XP028759718, DOI: 10.1016/j.rmed.2013.08.018 *
KARLSSON, ANNA, CIRENAJWIS HELENA, ERICSON-LINDQUIST KAJSA, BRUNNSTRÖM HANS, REUTERSWÄRD CHRISTEL, JÖNSSON MATS, ORTIZ-VILLALÓN CR: "A combined gene expression tool for parallel histological prediction and gene fusion detection in non-small cell lung cancer", SCIENTIFIC REPORTS, vol. 9, no. 5207, December 2019 (2019-12-01), pages 1 - 13, XP055840515, DOI: 10.1038/s41598-019-41585-4 *
KRIS, MARK G., JOHNSON BRUCE E., BERRY LYNNE D., KWIATKOWSKI DAVID J., IAFRATE A. JOHN, WISTUBA IGNACIO I., VARELLA-GARCIA MARILEI: "Using multiplexed assays of oncogenic drivers in lung cancers to select targeted drugs", JAMA, vol. 311, no. 19, 21 May 2014 (2014-05-21), pages 1998 - 2006, XP055840507, DOI: 10.1001/jama.2014.3741 *
See also references of EP4087948A4 *
SU, Z. ET AL.: "A platform for rapid detection of multiple oncogenic mutations with relevance to targeted therapy in non-small- cell lung cancer", THE JOURNAL OF MOLECULAR DIAGNOSTICS, vol. 13, no. 1, 2011, pages 74 - 84, XP055183521, DOI: 10.1016/j.jmoldx.2010.11.010 *

Also Published As

Publication number Publication date
EP4087948A4 (en) 2024-05-01
US20230052147A1 (en) 2023-02-16
JP2023510304A (ja) 2023-03-13
EP4087948A1 (en) 2022-11-16
CN115210385A (zh) 2022-10-18

Similar Documents

Publication Publication Date Title
JP6970205B2 (ja) Dnaおよびrnaの同時濃縮を含むプライマー伸長標的濃縮およびそれに対する向上
JP5986572B2 (ja) 固定化プライマーを使用した標的dnaの直接的な捕捉、増幅、および配列決定
US11053542B2 (en) Compositions and methods for screening mutations in thyroid cancer
CN110520542A (zh) 用于靶向核酸序列富集的方法及在错误纠正的核酸测序中的应用
CN105849264A (zh) 用于鉴别重复测序读数的组合物和方法
EP3551767B1 (en) Image differentiated multiplex assays for multiplex detection of dna mutations
CA2957633A1 (en) Digital measurements from targeted sequencing
JP2020532970A (ja) 核酸の正確な超並列定量化
JP2015521472A (ja) 核酸分子における高感度変異検出のための組成物および方法
CN110719957B (zh) 用于核酸靶向富集的方法和试剂盒
WO2015183837A1 (en) Compositions, methods, and uses related to ntrk2-tert fusions
EP3494236B1 (en) Method for conducting early detection of colon cancer and/or of colon cancer precursor cells and for monitoring colon cancer recurrence
WO2015183836A1 (en) Compositions, methods, and uses related to ntrk2-tert fusions
CN102639714A (zh) 靶核酸的检测方法
US10894975B2 (en) Image differentiated multiplex assays for multiplex detection of DNA mutations
ES3060893T3 (en) Strand-specific detection of bisulfite-converted duplexes
ES2712941T3 (es) Método para la detección de mutaciones en BRAF y PI3K
US8377657B1 (en) Primers for analyzing methylated sequences and methods of use thereof
JP7618208B2 (ja) 単一標的遺伝子の遺伝的変異のリアルタイム検出用の一本鎖核酸及びこれを用いた検出方法
TW202129008A (zh) 檢測異檸檬酸脫氫酶突變的套組及方法
EP4087948A1 (en) Image differentiated multiplex assays for detection of dna mutations in lung cancer
JP6153758B2 (ja) 多型検出用プローブ、多型検出方法、薬効判定方法及び多型検出用キット
TWI609968B (zh) 癌症檢測套組
JP6205216B2 (ja) 変異検出用プローブ、変異検出方法、薬効判定方法及び変異検出用キット
CN110678557A (zh) 通过管内杂交与通用标签-微阵列的组合的突变的基因分型

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21738790

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2022542157

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021738790

Country of ref document: EP

Effective date: 20220808