WO2021062244A1 - Anti-il-27 antibodies and uses thereof - Google Patents
Anti-il-27 antibodies and uses thereof Download PDFInfo
- Publication number
- WO2021062244A1 WO2021062244A1 PCT/US2020/052849 US2020052849W WO2021062244A1 WO 2021062244 A1 WO2021062244 A1 WO 2021062244A1 US 2020052849 W US2020052849 W US 2020052849W WO 2021062244 A1 WO2021062244 A1 WO 2021062244A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- antigen binding
- seq
- binding portion
- cell
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/24—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
- C07K16/244—Interleukins [IL]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2818—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
- C12Q1/6876—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
- C12Q1/6883—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material
- C12Q1/6886—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material for cancer
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/575—Immunoassay; Biospecific binding assay; Materials therefor for cancer
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6854—Immunoglobulins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/52—Assays involving cytokines
- G01N2333/525—Tumor necrosis factor [TNF]
Definitions
- the present disclosure relates generally to compositions and methods for modulating IL-27 signaling. More particularly, the present disclosure relates to immunogenic compositions (e.g., antibodies, antibody fragments, and the like) that bind to IL-27 and modulate IL-27 signaling.
- immunogenic compositions e.g., antibodies, antibody fragments, and the like
- T cells such as T cells, macrophages, and natural killer cells
- Tumor-specific or -associated antigens can induce immune cells to recognize and eliminate malignancies (Chen & Mellman, (2013) Immunity 39(1): 1-10).
- IL-27 is a heterodimeric cytokine, composed of two subunits (EBI3 and IL-27p28).
- IL-27 is structurally related to both the IL-12 and IL-6 cytokine families. IL-27 binds to and mediates signaling through a heterodimer receptor consisting of IL-27Ra (WSX1) and gpl30 chains, which mediate signaling predominantly through STAT1 and STAT3.
- WSX1 IL-27Ra
- gpl30 chains which mediate signaling predominantly through STAT1 and STAT3.
- Initial reports characterized IL-27 as an immune-enhancing cytokine that supports CD4+ T cell proliferation, T helper (Th)l cell differentiation, and IFN-g production, often acting in concert with IL-12. Subsequent studies have shown that IL-27 displays complex immunomodulatory functions, resulting in either proinflammatory or anti-inflammatory effects depending on the biological context and experimental models being used.
- IL-27 may drive the expression of different immune- regulatory molecules in human cancer cells, which may support local derangement of the immune response in vivo (Fabbi et al., (2017) Mediators Inflamm 3958069. Published online 2017 Feb 1. doi:10.1155/2017/3958069, and references contained therein).
- IL-27 and specifically bind to an epitope comprising one or more amino acids of (i) amino acids 37 to 56 corresponding to SEQ ID NO: 2 (IL-27p28), (ii) amino acids 142 to 164 corresponding to SEQ ID NO: 2 (IL-27p28), or (iii) both (i) and (ii).
- the antibody, or antigen binding portion thereof specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leul62, Prol63, or Glut 64 of SEQ ID NO: 2 (IL-27p28).
- the antibody, or antigen binding portion thereof, of the present disclosure specifically binds to an epitope comprising Aspl46, Argl49, and/or Phel53 of SEQ ID NO: 2 (IL-27p28).
- the epitope further comprises Hisl50 and/or Leul56 of SEQ ID NO: 2 (IL-27p28).
- the epitope further comprises Gln37, Leu38, Glu42, Leul42, and/or Glul64 of SEQ ID NO: 2 (IL-27p28).
- the epitope further comprises Glu46, Val49, Ser50, and/or Leul62 of SEQ ID NO: 2 (IL-27p28).
- the epitope further comprises one or more amino acids of Leu53, Lys56, Aspl43, Argl45, Leul47, Argl52, Alai 57, Glyl59, Phel60, Asnl61, or Prol63 of SEQ ID NO: 2 (IL-27p28).
- the antibody, or antigen binding portion thereof, of the present disclosure specifically binds to an epitope consisting or consisting essentially of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leul42, Aspl46, Argl49, Hisl50, Phel53, Leul56, Leul62, and Glu 164 of SEQ ID NO: 2 (IL-27p28).
- the antibody, or antigen binding portion thereof, of the present disclosure specifically binds to an epitope consisting or consisting essentially of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leul62, Prol63, and Glul64 of SEQ ID NO: 2 (IL-27p28).
- the antibody, or antigen binding portion thereof, that specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leu 156, Alal57, Glyl59, Phel60, Asnl61, Leul62, Prol63, and Glul64 of SEQ ID NO: 2 (IL-27p28) does not comprise heavy and light chain CDRs selected from the group consisting of: (i) heavy chain CDR1, CDR2 and CDR3 sequences set forth in SEQ ID NOs: 9, 10 and 11, respectively, and light chain CDR1, CDR2 and CDR3 sequences set forth in SEQ ID NOs: , 18 and 19, respectively;(ii) heavy chain CDR1, CDR2 and CDR3 sequences set forth in
- the antibody, or antigen binding portion thereof, that specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leu 156, Alal57, Glyl59, Phel60, Asnl61, Leul62, Prol63, and Glul64 of SEQ ID NO: 2 (IL-27p28) does not comprise heavy and light chain CDRs selected from the group consisting of: (i) heavy chain CDR1, CDR2 and CDR3 sequences set forth in SEQ ID NOs: 12, 13 and 14, respectively, and light chain CDR1, CDR2 and CDR3 sequences set forth in SEQ ID NOs: 20, 21 and 22, respectively; (ii) heavy chain CDR1, CDR2 and CDR
- the heavy chain CDR1 of the antibody, or antigen binding portion thereof does not consist of of of N-GFTF[S/A/R][S/R][T/Y][G/S]-C (SEQ ID NO: 144) and/or the heavy chain CDR2 does not consist of N-ISSS[S/G][S/A]YI-C (SEQ ID NO: 146).
- the heavy chain CDR1 of the antibody, or antigen binding portion thereof does not consist of N-FTF[S/A/R][S/R][T/Y][G/S]MN-C (SEQ ID NO: 148) and/or the heavy chain CDR2 does not consist of N-[G/S]ISSS[S/G][S/A]YI[L/Y]YADSVKG-C (SEQ ID NO: 149).
- the antibody, or antigen binding portion thereof, that specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leu 156, Alal57, Glyl59, Phel60, Asnl61, Leul62, Prol63, and Glul64 of SEQ ID NO: 2 (IL-27p28) does not comprise: (i) heavy chain CDR1 consisting of N-GFTFXXXX-C (SEQ ID NO: 145), heavy chain CDR2 consisting of N-ISSSXXYI-C (SEQ ID NO: 147), and heavy chain CDR3 sequence set forth in SEQ ID NO: 121; and light chain CDR1, CDR2 and CDR3 sequences set forth in SEQ ID NO:
- antibodies, or antigen binding portions thereof that exhibit at least one or more of the following properties: (i) binds to human IL-27 with an equilibrium dissociation constant (KD) of 15 nM or less; (ii) blocks binding of IL-27 to IL-27 receptor; (iii) inhibits or reduces STAT1 and/or STAT3 phosphorylation in a cell; (iv) inhibits or reduces IL-27- mediated inhibition of CD161 expression in a cell; (v) inhibits or reduces IL-27-mediated PD-L1 and/or TIM-3 expression in a cell; and (vi) induces or enhances PD-1 -mediated secretion of one or more cytokines from a cell.
- KD equilibrium dissociation constant
- the isolated antibody, or antigen binding portion thereof binds to human IL-27 with an equilibrium dissociation constant (KD) of 15 nM or less.
- KD equilibrium dissociation constant
- the isolated antibody, or antigen binding portion thereof inhibits or reduces STAT1 and/or STAT3 phosphorylation in a cell. In some aspects the isolated antibody, or antigen binding portion thereof, reduces STAT1 and/or STAT3 phosphorylation in an immune cell or a cancer cell.
- the isolated antibody, or antigen binding portion thereof inhibits or reduces inhibition of CD161 expression in a cell. In some aspects, the isolated antibody, or antigen binding portion thereof, inhibits or reduces inhibition of CD161 expression in an immune cell.
- the isolated antibody, or antigen binding portion thereof inhibits or reduces PD-L1 and/or TIM-3 expression in a cell. In some aspects, the isolated antibody, or antigen binding portion thereof, inhibits or reduces PD-L1 and/or TIM-3 expression in an immune cell or a cancer cell. In some aspects, the isolated antibody, or antigen binding portion thereof, inhibits or reduces PD-L1 expression in a cancer cell. [0021] In some aspects, the isolated antibody, or antigen binding portion thereof, induces or enhances the PD 1 -mediated secretion of one or more cytokines from a cell.
- the one or more cytokines is IFNg (IFNy), IL-17, TNFa (TNFa), or IL-6.
- the antibody, or antigen binding portion thereof is selected from the group consisting of an IgGl, an IgG2, an IgG3, an IgG4, an IgM, an IgAl an IgA2, an IgD, and an IgE antibody.
- the antibody, or antigen binding portion thereof is an IgGl antibody or an IgG4 antibody.
- the antibody, or antigen binding portion thereof comprises an Fc domain comprising at least one mutation.
- compositions comprising any one of the described isolated antibodies, or antigen binding portions thereof, and a pharmaceutically acceptable carrier.
- nucleic acids comprising a nucleotide sequence encoding the light chain, heavy chain, or both light and heavy chains of the isolated antibody, or antigen binding portion thereof.
- an expression vector comprising the nucleic acid. Further disclosed is a cell transformed with the expression vector.
- the present disclosure also provides methods for producing an antibody that specifically binds human IL-27, or an antigen binding portion thereof, comprising maintaining a cell transformed with the expression vector under conditions permitting expression of the antibody or antigen binding portion thereof. In some aspects, the method further comprises obtaining the antibody, or antigen binding portion thereof.
- Disclosed herein is a method to inhibit or reduce STAT1 and/or STAT3 phosphorylation in a cell comprising contacting the cell with the antibody, or antigen binding portion thereof, wherein the antibody, or antigen binding portion thereof, inhibits or reduces STAT1 and/or STAT3 phosphorylation in a cell.
- a method to inhibit or reduce inhibition of CD161 expression in a cell comprising contacting the cell with the antibody, or antigen binding portion thereof, wherein the antibody, or antigen binding portion thereof, inhibits or reduces inhibition of CD161 expression in a cell.
- Also disclosed is a method to inhibit or reduce PD-L1 and/or TIM-3 expression in a cell comprising contacting the cell with the antibody, or antigen binding portion thereof, wherein the antibody, or antigen binding portion thereof, inhibits PD-L1 and/or TIM-3 expression in a cell.
- a method to induce or enhance secretion of one or more cytokines from a cell comprising contacting the cell with the antibody, or antigen binding portion thereof, wherein the antibody, or antigen binding portion thereof, induces or enhances PD-1 mediated secretion of one or more cytokines from a cell.
- a method of stimulating an immune response in a subject comprising admistering to the subject an effective amount of a disclosed isolated antibody, or antigen binding fragment or a disclosed pharmaceutical composition.
- a method of treating cancer in a subj ect comprising admistering to the subject an effective amount of a disclosed isolated antibody, or antigen binding fragment or a disclosed pharmaceutical composition.
- Disclosed herein is a method of stimulating an immune response, or treating a cancer in a subject.
- the method comprises administering to the subject an effective amount of a disclosed isolated antibody, or antigen binding portion thereof or a disclosed pharmaceutical composition, wherein the antibody, antigen binding portion thereof, or the pharmaceutical composition inhibits or reduces STAT1 and/or STAT3 phosphorylation in a cell, thereby stimulating immune response, or treating the cancer.
- a method of stimulating an immune response, or treating a cancer in a subject comprises administering to the subject an effective amount of a disclosed isolated antibody, or antigen binding portion thereof or a disclosed pharmaceutical composition, wherein the antibody, antigen binding portion thereof, or the pharmaceutical composition inhibits or reduces inhibition of CD161 expression in a cell, thereby stimulating the immune response, or treating the cancer.
- a method of stimulating an immune response, or treating a cancer in a subject comprises administering to the subject an effective amount of a disclosed isolated antibody, or antigen binding portion thereof or a disclosed pharmaceutical composition, wherein the antibody, antigen binding portion thereof, or the pharmaceutical composition inhibits or reduces PD-L1 and/or TIM-3 expression on a cell, thereby stimulating the immune response, or treating the cancer.
- a method of stimulating an immune response, or treating a cancer in a subject comprises administering to the subject an effective amount of a dislosed isolated antibody, or antigen binding portion thereof or a disclosed pharmaceutical composition, wherein the antibody, antigen binding portion thereof, or the pharmaceutical composition induces or enhances PD-1 -mediated secretion of one or more cytokines from a cell, thereby stimulating the immune response, or treating the cancer.
- the cancer treated by the method is chosen from lung cancer (e.g., non-small cell lung cancer), sarcoma, testicular cancer, ovarian cancer, pancreas cancer, breast cancer (e.g., triple-negative breast cancer), melanoma, head and neck cancer (e.g., squamous head and neck cancer), colorectal cancer, bladder cancer, endometrial cancer, prostate cancer, thyroid cancer, hepatocellular carcinoma, gastric cancer, brain cancer, lymphoma (e.g., DL-BCL), leukemia (e.g., AML) or renal cancer (e.g., renal cell carcinoma, e.g., renal clear cell carcinoma).
- lung cancer e.g., non-small cell lung cancer
- sarcoma testicular cancer
- ovarian cancer pancreas cancer
- breast cancer e.g., triple-negative breast cancer
- melanoma melanoma
- head and neck cancer e.g., squam
- an anti -PD- 1 antibody e.g., enhances PD-l-mediated cytokine secretion; enhances anti-PD-1 mediated TNFa secretion; enhances anti-PD-1 mediated IL-6 secretion from a cell exposed to anti-PD-1 antibodies.
- the method comprises exposing a cell to a disclosed antibody, or antigen binding portion thereof, concurrently with or sequentially to an anti-PD-1 antibody, thereby to enhance one or more activities of anti -PD 1 antibodies.
- a pharmaceutical composition comprising an anti-PD-1 antibody, a disclosed antibody, or antigen binding portion thereof, and a pharmaceutically acceptable carrier.
- kits comprising an anti-PD-1 antibody, and a disclosed antibody, or antigen binding portion thereof, for concurrent or sequential administration, and instructions for its use.
- any one of the disclosed methods of stimulating an immune response or treating a cancer wherein the disclosed isolated antibody, or antigen binding portion thereof, is administered in combination with one or more additional therapeutic agents or procedure.
- the second therapeutic agent or procedure is selected from the group consisting of: a chemotherapy, a targeted anti-cancer therapy, an oncolytic drug, a cytotoxic agent, an immune- based therapy, a cytokine, surgical procedure, a radiation procedure, an activator of a costimulatory molecule, an inhibitor of an inhibitory molecule, a vaccine, or a cellular immunotherapy, or a combination thereof.
- the one or more additional therapeutic agents is a PD-1 antagonist, a PD-L1 inhibitor, a TIM-3 inhibitor, a LAG-3 inhibitor, a TIGIT inhibitor, a CD112R inhibitor, a TAM inhibitor, a STING agonist, a 4- IBB agonist, a tyrosine kinase inhibitor, an agent targeting the adenosine axis (for example a CD39 antagonist, a CD73 antagonist or a A2AR, A2BR or dual A2AR/A2BR antagonist), a CCR8 antagonist, a CTLA4 antagonist, a VEG-F inhibitor or a combination thereof.
- the one or more additional therapeutic agents is a PD-1 antagonist.
- the PD-1 antagonist is selected from the group consisting of: PDR001, nivolumab, pembrolizumab, pidilizumab, MEDI0680, REGN2810, TSR-042, PF-06801591, and AMP-224.
- the PD-L1 inhibitor is selected from the group consisting of: FAZ053, Atezolizumab, Avelumab, Durvalumab, and BMS-936559.
- the one or more additional therapeutic agents is selected from the group consisting of Sunitinib (SUTENT®), Cabozantinib (CABOMETYX®), Axitinib (INLYTA®), Lenvatinib (LENVIMA®), Everolimus (AFINITOR®), Bevacizumab (AVASTIN®), epacadostat, NKTR-214 (CD-122-biased agonist), Tivozanib (FOTIVDA®), abexinostat, Ipilimumab (YERVOY®), tremelimumab, Pazopanib (VOTRIENT®), Sorafenib (NEXAVAR®), Temsirolimus (TORISEL®), Ramucirumab (CYRAMZA®), niraparib, savolitinib, vorolanib (X-82), Regorafenib (STIVARGO®), Donafenib (multikinase
- the one or more additional therapeutic agents is a TIM-3 inhibitor, optionally wherein the TIM-3 inhibitor is MGB453 or TSR-022.
- the one or more additional therapeutic agents is a LAG-3 inhibitor, optionally wherein the LAG-3 inhibitor is selected from the group consisting of LAG525, BMS-986016, and TSR-033.
- the one or more additional therapeutic agents is a TIGIT inhibitor.
- the one or more additional therapeutic agents is a CD112R inhibitor.
- the one or more additional therapeutic agents is a TAM (Axl, Mer, Tyro) inhibitor.
- the one or more additional therapeutic agents is a 4- IBB agonist.
- the one or more additional therapeutic agents is a Tyrosine Kinase Inhibitor (TKI).
- TKI is selected from imatinib, dasatinib, nilotinib, bosutinib, or ponatinib.
- the one or more additional agents is a an agent targeting the adenosine axis.
- the agent targeting the adenosine axis is selected from a CD39 antagonist, a CD73 antagonist, a A2AR antagnoist, A2BR antagonist or a dual A2AR/A2BR antagonist.
- the one or more additional therapeutic agents is a CD39 antagonist.
- CD39 antagnoists examples include those described in US2019/0284295 (Surface Oncology, Inc.), which is herein incorporated by reference.
- the one or more additional therapeutic agents is a CD73 antagonist.
- CD73 antagonists include small molecule CD73 inhibitors such as AB421 (Arcus), a CD73 antibody, or antigen binding portion thereof, that binds to CD73 such as MEDI9447 (Medimmune), BMS-986179 (Bristol Meyers Squibb), or such as described in US2018/0009899 (Corvus), which is incorporated herein by reference in its entirety.
- the one or more additional therapeutic agents is a A2AR antagnoist, A2BR antagonist or a dual A2AR/A2BR antagonist.
- A2AR, A2BR and dual A2AR/A2BR antagonists include Preladenant/SCH 420814 (Merck/Schering, CAS Registry Number: 377727-87-2), which is described in Hodgson et al., (2009) J Pharmacol Exp Ther 330(l):294-303 and incorporated herein by reference in its entirety; ST-4206 (Leadiant Biosciences), which is described in US Pat.
- the one or more additional therapeutic agents is a CCR8 antagonist.
- the CCR8 antagnoist is selected from a small molecule and an antibody.
- the one or more additional therapeutic agents is a CTLA4 antagonist.
- the CTLA4 antagonist is selected from the group consisting of: Yervoy® (ipilimumab or antibody 10D1, described in PCT Publication WO 01/14424), tremelimumab (formerly ticilimumab, CP-675,206), monoclonal or an anti- CTLA-4 antibody described in any of the following publications: WO 98/42752; WO 00/37504; U.S. Pat. No. 6,207,156; Hurwitz et al.
- the one or more additional therapeutic agents is a VEG-F inhibitor.
- the VEG-F inhibitor is selected from cabozantinib, paopanib, bevacizumab, sunitinib, axitinib, lenvantinib, sorafenib, regorafenib, ponatinib, cabozantinib, vandetanib, ramucirumab, or bevacizumab.
- Disclosed herein is a use of the disclosed antibody, or antigen binding portion thereof, or the disclosed pharmaceutical composition for stimulating an immune response in a subject, or for treating cancer in a subject, optionally for use in in combination with one or more additional therapeutic agents or procedure.
- kits comprising the disclosed antibody, or antigen binding portion thereof, or the disclosed pharmaceutical composition, and instructions for use in stimulating an immune response in a subject, or treating cancer in a subject, optionally with instructions for use in combination with one or more additional therapeutic agents or procedure.
- kit compising the disclosed antibody, or antigen binding portion thereof, and instructions for use in detecting IL-27 in a sample from a subject, optionally with instructions for use to detect an IL-27-associated cancer in a subject.
- agonist refers to any molecule that partially or fully promotes, induces, increases, and/or activates a biological activity of a native polypeptide disclosed herein.
- Suitable agonist molecules specifically include agonist antibodies or antibody fragments, fragments or amino acid sequence variants of native polypeptides, peptides or proteins. In some aspects, activation in the presence of the agonist is observed in a dose-dependent manner.
- the measured signal (e.g., biological activity) is at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or at least about 100% higher than the signal measured with a negative control under comparable conditions. Also disclosed herein, are methods of identifying agonists suitable for use in the methods of the disclosure.
- binding assays such as enzyme-linked immuno-absorbent assay (ELISA), FORTE BIO® systems, and radioimmunoassay (RIA).
- ELISA enzyme-linked immuno-absorbent assay
- RIA radioimmunoassay
- binding assays determine the ability of an agonist to bind the polypeptide of interest (e.g., a receptor or ligand) and therefore indicate the ability of the agonist to promote, increase or activate the activity of the polypeptide.
- Efficacy of an agonist can also be determined using functional assays, such as the ability of an agonist to activate or promote the function of the polypeptide.
- a functional assay may comprise contacting a polypeptide with a candidate agonist molecule and measuring a detectable change in one or more biological activities normally associated with the polypeptide.
- the potency of an agonist is usually defined by its ECso value (concentration required to activate 50% of the agonist response). The lower the EC so value the greater the potency of the agonist and the lower the concentration that is required to activate the maximum biological response.
- alanine scanning refers to a technique used to determine the contribution of a specific wild-type residue to the stability or function(s) (e.g., binding affinity) of given protein or polypeptide.
- the technique involves the substitution of an alanine residue for a wild-type residue in a polypeptide, followed by an assessment of the stability or function(s) (e.g., binding affinity) of the alanine-substituted derivative or mutant polypeptide and comparison to the wild-type polypeptide.
- Techniques to substitute alanine for a wild-type residue in a polypeptide are known in the art.
- ameliorating refers to any therapeutically beneficial result in the treatment of a disease state, e.g., cancer, including prophylaxis, lessening in the severity or progression, remission, or cure thereof.
- amino acid refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids.
- Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, g- carboxyglutamate, and O-phosphoserine.
- Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e., a carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid.
- Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that function in a manner similar to a naturally occurring amino acid.
- Amino acids can be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, can be referred to by their commonly accepted single-letter codes.
- amino acid substitution refers to the replacement of at least one existing amino acid residue in a predetermined amino acid sequence (an amino acid sequence of a starting polypeptide) with a second, different “replacement” amino acid residue.
- amino acid insertion refers to the incorporation of at least one additional amino acid into a predetermined amino acid sequence. While the insertion will usually consist of the insertion of one or two amino acid residues, larger “peptide insertions,” can also be made, e.g. insertion of about three to about five or even up to about ten, fifteen, or twenty amino acid residues. The inserted residue(s) may be naturally occurring or non- naturally occurring as disclosed above.
- an “amino acid deletion” refers to the removal of at least one amino acid residue from a predetermined amino acid sequence.
- the term “amount” or “level” is used in the broadest sense and refers to a quantity, concentration or abundance of a substance (e.g., a metabolite, a small molecule, a protein, an mRNA, a marker).
- a metabolite or small molecule e.g. a drug
- concentration are generally used interchangeably and generally refer to a detectable amount in a biological sample.
- Elevated levels or “increased levels” refers to an increase in the quantity, concentration or abundance of a substance within a sample relative to a control sample, such as from an individual or individuals who are not suffering from the disease or disorder (e.g., cancer) or an internal control.
- a control sample such as from an individual or individuals who are not suffering from the disease or disorder (e.g., cancer) or an internal control.
- the elevated level of a substance (e.g., a drug) in a sample refers to an increase in the amount of the substance of about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% relative to the amount of the substance in a control sample, as determined by techniques known in the art (e.g., HPLC).
- Reduced levels refers to a decrease in the quantity, concentration or abundance of a substance (e.g., a drug) in an individual relative to a control, such as from an individual or individuals who are not suffering from the disease or disorder (e.g., cancer) or an internal control. In some aspects, a reduced level is little or no detectable quantity, concentration or abundance.
- the reduced level of a substance (e.g., a drug) in a sample refers to a decrease in the amount of the substance of about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% relative to the amount of the substance in a control sample, as determined by techniques known in the art (e.g, HPLC).
- the terms “level of expression” or “expression level” in general are used interchangeably and generally refer to a detectable amount of a protein, mRNA, or marker in a biological sample.
- a detectable amount or detectable level of a protein, mRNA or a marker is associated with a likelihood of a response to an agent, such as those described herein.
- “Expression” generally refers to the process by which information contained within a gene is converted into the structures (e.g., a protein marker, such as PD-L1) present and operating in the cell.
- expression may refer to transcription into a polynucleotide, translation into a polypeptide, or even polynucleotide and/or polypeptide modifications (e.g., posttranslational modification of a polypeptide). Fragments of the transcribed polynucleotide, the translated polypeptide, or polynucleotide and/or polypeptide modifications (e.g., posttranslational modification of a polypeptide) shall also be regarded as expressed whether they originate from a transcript generated by alternative splicing or a degraded transcript, or from a post-translational processing of the polypeptide, e.g., by proteolysis.
- “Expressed genes” include those that are transcribed into a polynucleotide as mRNA and then translated into a polypeptide, and also those that are transcribed into RNA but not translated into a polypeptide (for example, transfer and ribosomal RNAs).
- “Elevated expression,” “elevated expression levels,” or “elevated levels” refers to an increased expression or increased levels of a substance within a sample relative to a control sample, such as an individual or individuals who are not suffering from the disease or disorder (e.g., cancer) or an internal control.
- the elevated expression of a substance refers to an increase in the amount of the substance of about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% relative to the amount of the substance in a control sample, as determined by techniques known in the art (e.g., FACS).
- Reduced expression refers to a decrease expression or decreased levels of a substance (e.g., a protein marker) in an individual relative to a control, such as an individual or individuals who are not suffering from the disease or disorder (e.g., cancer) or an internal control. In some aspects, reduced expression is little or no expression.
- a substance e.g., a protein marker
- reduced expression is little or no expression.
- the reduced expression of a substance refers to a decrease in the amount of the substance of about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% relative to the amount of the substance in a control sample, as determined by techniques known in the art (e.g, FACS).
- a substance e.g., a protein marker
- angiogenesis refers to the process by which new blood vessels develop from pre-existing vessels (Varner et a!., (1999) Angiogen. 3:53-60; Mousa et al, (2000) Angiogen. Stim. Inhib. 35:42-44; Kim et al, (2000) Amer. J. Path. 156:1345-1362; Kirn et al, (2000) J Biol. ( hem. 275:33920-33928; Kumar et al (2000) Angiogenesis: From Molecular to Integrative Pharm . 169-180).
- Endothelial cells from pre existing blood vessels or from circulating endothelial stem cells become activated to migrate, proliferate, and differentiate into structures with lumens, forming new blood vessels, in response to growth factor or hormonal cues, or hypoxic or ischemic conditions.
- endothelial stem cells such as occurs in cancer, the need to increase oxygenation and delivery of nutrients apparently induces the secretion of angiogenic factors by the affected tissue; these factors stimulate new blood vessel formation.
- antagonist refers to an inhibitor of a target molecule and may be used synonymously herein with the term “inhibitor.”
- the term “antagonist” refers to any molecule that partially or fully blocks, inhibits, or neutralizes a biological activity of a native polypeptide disclosed herein.
- Suitable antagonist molecules specifically include antagonist antibodies or antibody fragments, fragments or amino acid sequence variants of native polypeptides, peptides or proteins. In some aspects, inhibition in the presence of the antagonist is observed in a dose-dependent manner.
- the measured signal (e.g., biological activity) is at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or at least about 100% lower than the signal measured with a negative control under comparable conditions. Also disclosed herein, are methods of identifying antagonists suitable for use in the methods of the disclosure.
- these methods include, but are not limited to, binding assays such as enzyme-linked immuno-absorbent assay (ELISA), ForteBio®sy stems, radioimmunoassay (RIA), Meso Scale Discovery assay (e.g., Meso Scale Discovery Electrochemiluminescence (MSD-ECL), and bead-based Luminex ® assay.
- binding assays such as enzyme-linked immuno-absorbent assay (ELISA), ForteBio®sy stems, radioimmunoassay (RIA), Meso Scale Discovery assay (e.g., Meso Scale Discovery Electrochemiluminescence (MSD-ECL), and bead-based Luminex ® assay.
- binding assays such as enzyme-linked immuno-absorbent assay (ELISA), ForteBio®sy stems, radioimmunoassay (RIA), Meso Scale Discovery assay (e.g., Meso Scale Discovery Electrochemiluminescence (MSD
- Efficacy of an antagonist can also be determined using functional assays, such as the ability of an antagonist to inhibit the function of the polypeptide or an agonist.
- a functional assay may comprise contacting a polypeptide with a candidate antagonist molecule and measuring a detectable change in one or more biological activities normally associated with the polypeptide.
- the potency of an antagonist is usually defined by its IC50 value (concentration required to inhibit 50% of the agonist response). The lower the IC50 value the greater the potency of the antagonist and the lower the concentration that is required to inhibit the maximum biological response.
- the phrase "antibody that antagonizes human IL-27, or an antigen binding portion thereof' refers to an antibody that antagonizes at least one art-recognized activity of human IL-27 (e.g., IL-27 biological activity and/or downstream pathway(s) mediated by IL-27 signaling or other IL-27-mediated function), for example, relating to a decrease (or reduction) in human IL-27 activity that is at least 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or more. Additional examples of IL-27 biological activities and/or downstream pathway(s) mediated by IL-27 signaling or other IL-27-mediated function are described in additional detail below and elsewhere herein.
- anti-IL-27 antagonist antibody As used herein, the term "anti-IL-27 antagonist antibody” (interchangeably termed
- anti-IL-27 antibody refers to an antibody that specifically binds to IL-27 and inhibits IL-27 biological activity and/or downstream pathway(s) mediated by IL-27 signaling or other IL-27- mediated function.
- An anti-IL-27 antagonist antibody encompasses antibodies that block, antagonize, suppress, inhibit or reduce an IL-27 biological activity (e.g., ligand binding, enzymatic activity), including downstream pathways mediated by IL-27 signaling or function, such as receptor binding and/or elicitation of a cellular response to IL-27 or its metabolites.
- an anti-IL-27 antagonist antibody binds to human IL-27 and prevents, blocks, or inhibits binding of human IL-27 to its cognate or normal receptor (e.g., IL-27 receptor), or one or more receptor subunits (e.g., gpl30 and/or IL-27Ra (also known as WSX1/TCCR)).
- the anti-IL-27 antagonist antibody prevents, blocks, or inhibits the binding of human IL-27 to the gpl30.
- the anti-IL-27 antagonist antibody prevents, blocks, or inhibits the binding of human IL-27 to the IL-27Ra.
- the anti- IL-27 antagonist antibody prevents, blocks, or inhibits the dimerization of IL-27 monomers. In some aspects, the anti-IL-27 antibody does not specifically bind to the EBI3 monomer. In some aspects, the anti-IL-27 antibody specifically binds to the IL-27p28 monomer. In some embodiments, the anti-IL-27 antibody specifically binds to a non-contiguous epitope comprising P28, but does not bind to the EBI3 monomer. In some aspects, the anti-IL-27 antibody inhibits or reduces STAT1 and/or STAT3 phosphorylation in a cell.
- the anti-IL-27 antibody inhibits or reduces inhibition of CD 161 expression in a cell (e.g., ameliorates or relieves IL-27 mediated inhibition of CD161 expression in a cell). In some aspects, the anti-IL-27 antibody inhibits or reduces PD-L1 and/or TIM-3 expression in a cell. In some aspects, the anti-IL-27 induces or enhances PD- 1 -mediated secretion of one or more cytokines from a cell. In some aspects, an anti-IL-27 antagonist antibody binds to human IL-27 and stimulates or enhances an anti-tumor response. In some aspects, the anti-IL-27 antagonist antibody binds to human IL-27 with an affinity of 15nM or less.
- the anti-IL-27 antagonist antibody binds to human IL-27 and comprises a wild type or mutant IgGl heavy chain constant region or a wild type or mutant IgG4 heavy chain constant region.
- anti-IL-27 antagonist antibodies are provided herein.
- antibody refers to a whole antibody comprising two light chain polypeptides and two heavy chain polypeptides. Whole antibodies include different antibody isotypes including IgM, IgG, IgA, IgD, and IgE antibodies.
- antibody includes a polyclonal antibody, a monoclonal antibody, a chimerized or chimeric antibody, a humanized antibody, a primatized antibody, a deimmunized antibody, and a fully human antibody.
- the antibody can be made in or derived from any of a variety of species, e.g., mammals such as humans, non-human primates (e.g., orangutan, baboons, or chimpanzees), horses, cattle, pigs, sheep, goats, dogs, cats, rabbits, guinea pigs, gerbils, hamsters, rats, and mice.
- the antibody can be a purified or a recombinant antibody.
- the term "antibody fragment,” "antigen-binding fragment,” or similar terms refer to a fragment of an antibody that retains the ability to bind to a target antigen (e.g., IL-27) and inhibit the activity of the target antigen.
- a target antigen e.g., IL-27
- Such fragments include, e.g., a single chain antibody, a single chain Fv fragment (scFv), an Fd fragment, an Fab fragment, an Fab’ fragment, or an F(ab’)2 fragment.
- An scFv fragment is a single polypeptide chain that includes both the heavy and light chain variable regions of the antibody from which the scFv is derived.
- intrabodies, minibodies, triabodies, and diabodies are also included in the definition of antibody and are compatible for use in the methods described herein. See, e.g., Todorovska et al., (2001) J. Immunol. Methods 248(l):47-66; Hudson and Kortt, (1999) J Immunol.
- antibody fragment also includes, e.g., single domain antibodies such as camelized single domain antibodies. See, e.g., Muyldermans et al., (2001) Trends Biochem. Sci. 26:230-235; Nuttall et al., (2000) Curr. Pharm. Biotech. 1:253-263; Reichmann et al., (1999) J. Immunol. Meth. 231:25-38; PCT application publication nos. WO 94/04678 and WO 94/25591; and U.S. patent no. 6,005,079, all of which are incorporated herein by reference in their entireties.
- an antigen-binding fragment includes the variable region of a heavy chain polypeptide and the variable region of a light chain polypeptide.
- an antigen-binding fragment described herein comprises the CDRs of the light chain and heavy chain polypeptide of an antibody.
- APC antigen presenting cell
- T cells recognize this complex using T cell receptor (TCR).
- APCs include, but are not limited to, B cells, dendritic cells (DCs), peripheral blood mononuclear cells (PBMC), monocytes (such as THP-1), B lymphoblastoid cells (such as C1R.A2, 1518 B-LCL) and monocyte-derived dendritic cells (DCs).
- DCs dendritic cells
- PBMC peripheral blood mononuclear cells
- monocytes such as THP-1
- B lymphoblastoid cells such as C1R.A2, 1518 B-LCL
- DCs monocyte-derived dendritic cells
- antigen presentation refers to the process by which APCs capture antigens and enables their recognition by T cells, e.g., as a component of an MHC -I and/or MHC- II conjugate.
- apoptosis refers to the process of programmed cell death that occurs in multicellular organisms (e.g. humans).
- the highly regulated biochemical and molecular events that result in apoptosis can lead to observable and characteristic morphological changes to a cell, including membrane blebbing, cell volume shrinkage, chromosomal DNA condensation and fragmentation, and mRNA decay.
- a common method to identify cells, including T cells, undergoing apoptosis is to expose cells to a fluorophore-conjugated protein (Annexin V). Annexin V is commonly used to detect apoptotic cells by its ability to bind to phosphatidylserine on the outer leaflet of the plasma membrane, which is an early indicator that the cell is undergoing the process of apoptosis.
- B cell refers to a type of white blood cell of the lymphocyte subtype.
- B cells function in the humoral immunity component of the adaptive immune system by secreting antibodies.
- B cells also present antigen and secrete cytokines.
- B cells unlike the other two classes of lymphocytes, T cells and natural killer cells, express B cell receptors (BCRs) on their cell membrane. BCRs allow the B cell to bind to a specific antigen, against which it will initiate an antibody response.
- binds to immobilized IL-27 refers to the ability of an antibody of the disclosure to bind to IL-27, for example, expressed on the surface of a cell or which is attached to a solid support.
- bispecific or bifunctional antibody refers to an artificial hybrid antibody having two different heavy/light chain pairs and two different binding sites.
- Bispecific antibodies can be produced by a variety of methods including fusion of hybridomas or linking of Fab' fragments. See, e.g., Songsivilai & Lachmann, (1990) Clin. Exp. Immunol. 79:315- 321; Kostelny et al, (1992) J. Immunol. 148:1547-1553.
- bispecific antibodies are based on the co-expression of two immunoglobulin heavy-chain/light-chain pairs, where the two heavy chain/light chain pairs have different specificities (Milstein and Cuello, (1983) Nature 305:537- 539).
- Antibody variable domains with the desired binding specificities can be fused to immunoglobulin constant domain sequences.
- the fusion of the heavy chain variable region is preferably with an immunoglobulin heavy-chain constant domain, including at least part of the hinge, CH2, and CH3 regions.
- Bispecific antibodies also include cross-linked or heteroconjugate antibodies. Heteroconjugate antibodies may be made using any convenient cross-linking methods. Suitable cross-linking agents are well known in the art, and are disclosed in U.S. Pat. No. 4,676,980, along with a number of cross-linking techniques. [0066] Various techniques for making and isolating bispecific antibody fragments directly from recombinant cell culture have also been described. For example, bispecific antibodies have been produced using leucine zippers. See, e.g., Kostelny et al. (1992) J Immunol 148(5): 1547- 1553.
- the leucine zipper peptides from the Fos and Jun proteins may be linked to the Fab' portions of two different antibodies by gene fusion.
- the antibody homodimers may be reduced at the hinge region to form monomers and then re-oxidized to form the antibody heterodimers. This method can also be utilized for the production of antibody homodimers.
- the "diabody” technology described by Hollinger et al. (1993) Proc Natl Acad Sci USA 90:6444-6448 has provided an alternative mechanism for making bispecific antibody fragments.
- the fragments comprise a heavy-chain variable domain (VH) connected to a light-chain variable domain (VL) by a linker which is too short to allow pairing between the two domains on the same chain.
- the VH and VL domains of one fragment are forced to pair with the complementary VL and VH domains of another fragment, thereby forming two antigen-binding sites.
- Another strategy for making bispecific antibody fragments by the use of single-chain Fv (scFv) dimers has also been reported. See, e.g., Gruber et al. (1994) J Immunol 152:5368.
- the antibodies can be "linear antibodies” as described in, e.g., Zapata et al. (1995) Protein Eng. 8(10): 1057-1062. Briefly, these antibodies comprise a pair of tandem Fd segments (VH-CH1-VH-CH1) which form a pair of antigen binding regions. Linear antibodies can be bispecific or monospecific.
- Antibodies with more than two valencies are contemplated and described in, e.g., Tutt et al. (1991) J Immunol 147:60.
- the disclosure also embraces variant forms of multi-specific antibodies such as the dual variable domain immunoglobulin (DVD-Ig) molecules described in Wu et al. (2007) Nat Biotechnol 25(11): 1290-1297.
- DVD-Ig molecules are designed such that two different light chain variable domains (VL) from two different parent antibodies are linked in tandem directly or via a short linker by recombinant DNA techniques, followed by the light chain constant domain.
- the heavy chain comprises two different heavy chain variable domains (VH) linked in tandem, followed by the constant domain CHI and Fc region.
- the bispecific antibody is a Fabs-in-Tandem immunoglobulin, in which the light chain variable region with a second specificity is fused to the heavy chain variable region of a whole antibody.
- Such antibodies are described in, e.g., International Patent Application Publication No. WO 2015/103072.
- cancer antigen refers to (i) tumor- specific antigens, (ii) tumor- associated antigens, (iii) cells that express tumor- specific antigens, (iv) cells that express tumor- associated antigens, (v) embryonic antigens on tumors, (vi) autologous tumor cells, (vii) tumor- specific membrane antigens, (viii) tumor- associated membrane antigens, (ix) growth factor receptors, (x) growth factor ligands, and (xi) any other type of antigen or antigen- presenting cell or material that is associated with a cancer.
- cancer-specific immune response refers to the immune response induced by the presence of tumors, cancer cells, or cancer antigens.
- the response includes the proliferation of cancer antigen specific lymphocytes.
- the response includes expression and upregulation of antibodies and T-cell receptors and the formation and release of lymphokines, chemokines, and cytokines. Both innate and acquired immune systems interact to initiate antigenic responses against the tumors, cancer cells, or cancer antigens.
- the cancer-specific immune response is a T cell response.
- carcinoma is art recognized and refers to malignancies of epithelial or endocrine tissues including respiratory system carcinomas, gastrointestinal system carcinomas, genitourinary system carcinomas, testicular carcinomas, breast carcinomas, prostatic carcinomas, endocrine system carcinomas, and melanomas.
- the anti-IL-27 antibodies described herein can be used to treat patients who have, who are suspected of having, or who may be at high risk for developing any type of cancer, including renal carcinoma or melanoma, or any viral disease.
- Exemplary carcinomas include those forming from tissue of the cervix, lung, prostate, breast, head and neck, colon and ovary.
- carcinosarcomas which include malignant tumors composed of carcinomatous and sarcomatous tissues.
- An "adenocarcinoma” refers to a carcinoma derived from glandular tissue or in which the tumor cells form recognizable glandular structures.
- CD112R refers to a member of poliovirus receptor-like proteins and is a co-inhibitory receptor for human T cells.
- CD112R is an inhibitory receptor primarily expressed by T cells and NK cells and competes for CD112 binding with the activating receptor CD226.
- the interaction of CD112 with CD112R is of higher affinity than with CD226 and thereby effectively regulates CD226 mediated cell activation.
- Anti-CD112R antagonists that block the interaction with CD112 limit inhibitory signaling directly downstream of CD112R while simultaneously promoting greater immune cell activation by increasing CD226 interactions with CD 112.
- CD112R inhibitor refers to an agent that disrupts, blocks or inhibits the biological function or activity of CD112R.
- CD137 refers to a member of the tumor necrosis factor (TNF) receptor superfamily.
- 4- IBB is a co-stimulatory immune checkpoint molecule, primarily for activated T cells. Crosslinking of CD137 enhances T cell proliferation, IL-2 secretion, survival and cytolytic activity.
- 4-1BB agonist refers to an agent that stimulates, induces or increases one or more function of 4-1BB.
- An exemplary 4-1BB agonist is Utomilumab (PF-05082566), a fully human IgG2 monoclonal antibody that targets this 4-1BB to stimulate T cells.
- CD161 refers to a member of the C- type lectin superfamily.
- CD161 is a marker of T cells and CD161 expression has been associated with T cell infiltration into the tumor microenvironment for a number of different cancer types. CD161 is further described in Fergusson et al, (2014) Cell Reports 9(3): 1075-1088, which is incorporated herein by reference it its entirety.
- IL-27 or "interleukin 27” refers to the IL-27 cytokine.
- IL-27 is related to the IL-6/IL-12 cytokine families, and is a heterodimeric cytokine that comprises a first subunit known as Epstein-Barr Virus Induced Gene 3 (EBI3; also known as IL-27 subunit b and IL-27B) and a second subunit known as IL-27p28 (also known as IL30, IL-27 subunit a and IL-27A).
- EBI3 Epstein-Barr Virus Induced Gene 3
- IL-27p28 also known as IL30, IL-27 subunit a and IL-27A
- IL-27 is predominantly synthesized by activated antigen-presenting cells including monocytes, endothelial cells and dendritic cells (Jankowski et al. (2010) Arch Immunol. Ther. Exp. 58:417-425, Diakowski et al. (2013) Adv. Clin. Exp.
- IL-27 can have proinflammatory effects, many studies suggest an important role of IL-27 as an immunosuppressive agent (Shimizu et al. (2006) J. Immunol. 176:7317-7324, Hisada et al. (2004) Cancer Res. 64:1152-1156, Diakowski (2013) supra). Although it was initially described as a factor promoting the initiation of Thl responses, IL-27 was later found to play a major T-cell suppressive function by limiting Thl responses, inhibiting Th2 and Thl 7 cell differentiation, and regulating the development of Trl and other T regulatory cell populations (Dietrich et al. (2014) J. Immunol. 192:5382-5389). In addition to its role as an immunoregulator, IL-27 also regulates angiogenesis, hematopoiesis, and osteocalstogenesis (Id.).
- IL-27 signals through a heterodimeric type I cytokine receptor (the IL-27 receptor or IL-27R) that comprises a first subunit known as WSX1 (also known as IL-27 receptor subunit a, IL-27RA, T-Cell Cytokine Receptor Type 1 (TCCR), and Cytokine Receptor-Like 1 (CRLl)) and a second subunit known as gpl30 (also known as Interleukin-6 Signal Transducer (IL6ST), Interleukin-6 Receptor Subunit b (IL-6RB), and Oncostatin M Receptor).
- WSX1 also known as IL-27 receptor subunit a, IL-27RA, T-Cell Cytokine Receptor Type 1 (TCCR), and Cytokine Receptor-Like 1 (CRLl)
- gpl30 also known as Interleukin-6 Signal Transducer (IL6ST), Interleukin-6 Receptor Subunit b
- gpl30 is also a receptor subunit for the IL-6 family cytokines (Liu et al. (2008) Scan. J. Immunol. 68:22-299, Diakowski (2013) supra).
- IL-27 signaling through IL-27R activates multiple signaling cascades, including the JAK-STAT and p38 MAPK pathways.
- EBI3 is also believed to have biological functions independent of p28 or the IL-27 heterodimer.
- EBI3 also interacts with p35 to form the heterodimeric cytokine IL-35 (Yoshida et al. (2015) Annu. Rev Immunol. 33:417-43) and has been shown to be selectively overexpressed in certain cell types without a corresponding increase in p28 or IL-27 (Larousserie et al. (2005) Am. J. Pathol. 166(4): 1217-28).
- An amino acid sequence of an exemplary human p28 protein is provided in SEQ ID NO: 2 (NCBI Reference Sequence: NP 663634.2; N- mgqtagdlgwrlsllllplllvqagvwgfprppgrpqlslqelrreftvslhlarkllsevrgqahrfaeshlpgvnlyllplgeqlpdvsltf qawrrlsdperlcfisttlqpfhallgglgtqgrwtnmermqlwamrldlrdlqrhlrfqvlaagfnlpeeeeeeeeeeerkgllpgalg salqgpaqvswpqllstyrllhslelvlsravrellllskaghsvwplgfptlspqp-C).
- NP_004834.1 N- mrggrgapfwlwplpklallpllwvlfqrtrpqgsagplqcygvgplgdlncsweplgdlgapselhlqsqkyrsnktqtvavaagrs wvaipreqltmsdkllvwgtkagqplwppvfvnletqmkpnaprlgpdvdfseddpleatvhwapptwpshkvlicqfhyrrcqea awtllepelktipltpveiqdlelatgykvygrcrmekeedlwgewspilsfqtppsapkdvwvsgnlcgtpggeeplllwkapgpcv qvsykvwfwvggrelspegitcccslipsga
- SEQ ID NO: 4 An amino acid sequence of an exemplary human gpl30 protein is provided in SEQ ID NO: 4 (NCBI Reference Sequence: NP_002175.2; N- mltlqtwlvqalfiflttestgelldpcgyispespvvqlhsnftavcvlkekcmdyfhvnanyivwktnhftipkeqytiinrtassvtftd iaslniqltcniltfgqleqnvygitiisglppekpknlscivnegkkmrcewdggrethletnftlksewathkfadckakrdtptsctvd ystvyfvnievwveaenalgkvtsdhinfdpvykvkpnpphnlsvinseelssilkltwtnpsik
- an assay e.g., a competitive binding assay; a cross-blocking assay
- a test antigen-binding protein e.g., a test antibody
- inhibits e.g., reduces or blocks
- a reference antigen-binding protein e.g., a reference antibody
- a polypeptide or amino acid sequence "derived from” a designated polypeptide or protein refers to the origin of the polypeptide.
- the polypeptide or amino acid sequence which is derived from a particular sequence has an amino acid sequence that is essentially identical to that sequence or a portion thereof, wherein the portion consists of at least 10-20 amino acids, preferably at least 20-30 amino acids, more preferably at least 30-50 amino acids, or which is otherwise identifiable to one of ordinary skill in the art as having its origin in the sequence.
- Polypeptides derived from another peptide may have one or more mutations relative to the starting polypeptide, e.g., one or more amino acid residues which have been substituted with another amino acid residue or which has one or more amino acid residue insertions or deletions.
- a polypeptide can comprise an amino acid sequence which is not naturally occurring. Such variants necessarily have less than 100% sequence identity or similarity with the starting molecule. In certain aspects, the variant will have an amino acid sequence from about 75% to less than 100% amino acid sequence identity or similarity with the amino acid sequence of the starting polypeptide, more preferably from about 80% to less than 100%, more preferably from about 85% to less than 100%, more preferably from about 90% to less than 100% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%) and most preferably from about 95% to less than 100%, e.g., over the length of the variant molecule.
- the antibodies of the disclosure are encoded by a nucleotide sequence.
- Nucleotide sequences of the invention can be useful for a number of applications, including: cloning, gene therapy, protein expression and purification, mutation introduction, DNA vaccination of a host in need thereof, antibody generation for, e.g., passive immunization, PCR, primer and probe generation, and the like.
- antibodies suitable for use in the methods disclosed herein may be altered such that they vary in sequence from the naturally occurring or native sequences from which they were derived, while retaining the desirable activity of the native sequences.
- nucleotide or amino acid substitutions leading to conservative substitutions or changes at "non-essential" amino acid residues may be made.
- Mutations may be introduced by standard techniques, such as site-directed mutagenesis and PCR-mediated mutagenesis.
- the antibodies suitable for use in the methods disclosed herein may comprise conservative amino acid substitutions at one or more amino acid residues, e.g., at essential or non- essential amino acid residues.
- a "conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain.
- Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
- basic side chains e.g., lysine, arginine, histidine
- acidic side chains e.g., aspartic acid
- a nonessential amino acid residue in a binding polypeptide is preferably replaced with another amino acid residue from the same side chain family.
- a string of amino acids can be replaced with a structurally similar string that differs in order and/or composition of side chain family members.
- mutations may be introduced randomly along all or part of a coding sequence, such as by saturation mutagenesis, and the resultant mutants can be incorporated into binding polypeptides of the invention and screened for their ability to bind to the desired target.
- antigen "cross-presentation” refers to presentation of exogenous protein antigens to T cells via MHC class I and class II molecules on APCs.
- cross-reacts refers to the ability of an antibody of the disclosure to bind to IL-27 from a different species.
- an antibody of the present disclosure which binds human IL-27 may also bind another species of IL-27.
- cross-reactivity is measured by detecting a specific reactivity with purified antigen in binding assays (e.g ., SPR, ELISA) or binding to, or otherwise functionally interacting with, cells physiologically expressing IL-27.
- Methods for determining cross-reactivity include standard binding assays as described herein, for example, by BiacoreTM surface plasmon resonance (SPR) analysis using a BiacoreTM 2000 SPR instrument (Biacore AB, Uppsala, Sweden), or flow cytometric techniques.
- SPR surface plasmon resonance
- cytotoxic T lymphocyte (CTL) response refers to an immune response induced by cytotoxic T cells. CTL responses are mediated primarily by CD8 + T cells.
- DC dendritic cell
- BM bone marrow
- MHC major histocompatibility complex
- DCs are heterogeneous, e.g. myeloid and plasmacytoid DCs; although all DCs are capable of antigen uptake, processing and presentation to naive T cells, the DC subtypes have distinct markers and differ in location, migratory pathways, detailed immunological function and dependence on infections or inflammatory stimuli for their generation.
- Thl polarized T-helper 1
- dendritic cell activation refers to the transition from immature to mature dendritic cell; and the activated dendritic cells encompass mature dendritic cells and dendritic cells in the process of the transition, wherein the expression of CD80 and CD86 that induce costimulatory signals are elevated by the activating stimuli.
- Mature human dendritic cells are cells that are positive for the expression of CD40, CD80, CD86, and HLA-class II (e.g., HLA-DR).
- An immature dendritic cell can be distinguished from a mature dendritic cell, for example, based on markers selected from the group consisting of CD80 and CD86.
- An immature dendritic cell is weakly positive and preferably negative for these markers, while a mature dendritic cell is positive. Discrimination of mature dendritic cells is routinely performed by those skilled in the art, and the respective markers described above and methods for measuring their expression are also well known to those skilled in the art.
- ECso refers to the concentration of an antibody or an antigen-binding portion thereof, which induces a response, either in an in vitro or an in vivo assay, which is 50% of the maximal response, i.e., halfway between the maximal response and the baseline.
- the term "effective dose” or “effective dosage” is defined as an amount sufficient to achieve or at least partially achieve the desired effect.
- therapeutically effective dose is defined as an amount sufficient to cure or at least partially arrest the disease and its complications in a patient already suffering from the disease. Amounts effective for this use will depend upon the severity of the disorder being treated and the general state of the patient’s own immune system.
- epitope or “antigenic determinant” refers to a site on an antigen to which an immunoglobulin or antibody specifically binds.
- epitope mapping refers to a process or method of identifying the binding site, or epitope, of an antibody, or antigen binding fragment thereof, on its target protein antigen. Epitope mapping methods and techniques are provided herein. Epitopes can be formed both from contiguous amino acids or noncontiguous amino acids juxtaposed by tertiary folding of a protein.
- Epitopes formed from contiguous amino acids are typically retained on exposure to denaturing solvents, whereas epitopes formed by tertiary folding are typically lost on treatment with denaturing solvents.
- An epitope typically includes at least 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15 amino acids in a unique spatial conformation.
- Methods for determining what epitopes are bound by a given antibody i.e., epitope mapping
- epitope mapping include, for example, immunoblotting and immunoprecipitation assays, wherein overlapping or contiguous peptides from IL-27 are tested for reactivity with the given anti- IL-27 antibody.
- Methods of determining spatial conformation of epitopes include techniques in the art and those described herein, for example, x-ray crystallography and 2-dimensional nuclear magnetic resonance (see, e.g., Epitope Mapping Protocols inMethods in Molecular Biology, Vol. 66, G. E. Morris, Ed. (1996)).
- antibodies that bind to an epitope on IL-27 which comprises all or a portion of an epitope recognized by the particular antibodies described herein (e.g., the same or an overlapping region or a region between or spanning the region).
- antibodies that bind the same epitope and/or antibodies that compete for binding to human IL-27 with the antibodies described herein can be identified using routine techniques. Such techniques include, for example, an immunoassay, which shows the ability of one antibody to block the binding of another antibody to a target antigen, /. e. , a competitive binding assay.
- ком ⁇ онент binding is determined in an assay in which the immunoglobulin under test inhibits specific binding of a reference antibody to a common antigen, such as IL-27.
- a common antigen such as IL-27.
- Numerous types of competitive binding assays are known, for example: solid phase direct or indirect radioimmunoassay (RIA), solid phase direct or indirect enzyme immunoassay (EIA), sandwich competition assay (see Stahli et al., Methods in Enzymology 9:242 (1983)); solid phase direct biotin-avidin EIA (see Kirkland et al., J. Immunol.
- solid phase direct labeled assay solid phase direct labeled sandwich assay (see Harlow and Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Press (1988)); solid phase direct label RIA using 1-125 label (see Morel et al., Mol. Immunol. 25(1):7 (1988)); solid phase direct biotin-avidin EIA (Cheung et al., Virology 176:546 (1990)); and direct labeled RIA. (Moldenhauer et al., Scand. J. Immunol. 32:77 (1990)).
- such an assay involves the use of purified antigen bound to a solid surface or cells bearing either of these, an unlabeled test immunoglobulin and a labeled reference immunoglobulin.
- Competitive inhibition is measured by determining the amount of label bound to the solid surface or cells in the presence of the test immunoglobulin.
- the test immunoglobulin is present in excess.
- a competing antibody when a competing antibody is present in excess, it will inhibit specific binding of a reference antibody to a common antigen by at least 50-55%, 55- 60%, 60-65%, 65-70% 70-75% or more.
- Other techniques include, for example, epitope mapping methods, such as, x-ray analyses of crystals of antigemantibody complexes which provides atomic resolution of the epitope and mass spectrometry combined with hydrogen/deuterium (H/D) exchange which studies the conformation and dynamics of antigemantibody interactions.
- Other methods monitor the binding of the antibody to antigen fragments or mutated variations of the antigen where loss of binding due to a modification of an amino acid residue within the antigen sequence is often considered an indication of an epitope component.
- computational combinatorial methods for epitope mapping can also be used. These methods rely on the ability of the antibody of interest to affinity isolate specific short peptides from combinatorial phage display peptide libraries. The peptides are then regarded as leads for the definition of the epitope corresponding to the antibody used to screen the peptide library.
- computational algorithms have also been developed which have been shown to map conformational discontinuous epitopes.
- Fc-mediated effector functions or “Fc effector functions” refer to the biological activities of an antibody other than the antibody’s primary function and purpose.
- the effector functions of a therapeutic agnostic antibody are the biological activities other than the activation of the target protein or pathway.
- antibody effect functions include Clq binding and complement dependent cytotoxicity; Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell surface receptors (e.g., B cell receptor); lack of activation of platelets that express Fc receptor; and B cell activation. Many effector functions begin with Fc binding to an Fey receptor.
- the tumor antigen-targeting antibody has effector function, e.g., ADCC activity.
- a tumor antigen-targeting antibody described herein comprises a variant constant region having increased effector function (e.g. increased ability to mediate ADCC) relative to the unmodified form of the constant region.
- the term "Fc receptor” refers to a polypeptide found on the surface of immune effector cells, which is bound by the Fc region of an antibody.
- the Fc receptor is an Fey receptor.
- FcyRI CD64
- FcyRII CD32
- FycRIII CD 16
- All four IgG isotypes IgGl, IgG2, IgG3 and IgG4 bind and activate Fc receptors FcyRI, FcyRII A and FcyRIIIA.
- FcyRIIB is an inhibitory receptor, and therefore antibody binding to this receptor does not activate complement and cellular responses.
- FcyRI is a high affinity receptor that binds to IgG in monomeric form
- FcyRIIA and FcyRIIA are low affinity receptors that bind IgG only in multimeric form and have slightly lower affinity.
- the binding of an antibody to an Fc receptor and/or Clq is governed by specific residues or domains within the Fc regions. Binding also depends on residues located within the hinge region and within the CH2 portion of the antibody.
- the agonistic and/or therapeutic activity of the antibodies described herein is dependent on binding of the Fc region to the Fc receptor (e.g., FcyR).
- the agonistic and/or therapeutic activity of the antibodies described herein is enhanced by binding of the Fc region to the Fc receptor (e.g., FcyR).
- glycosylation pattern is defined as the pattern of carbohydrate units that are covalently attached to a protein, more specifically to an immunoglobulin protein.
- a glycosylation pattern of a heterologous antibody can be characterized as being substantially similar to glycosylation patterns which occur naturally on antibodies produced by the species of the nonhuman transgenic animal, when one of ordinary skill in the art would recognize the glycosylation pattern of the heterologous antibody as being more similar to said pattern of glycosylation in the species of the nonhuman transgenic animal than to the species from which the CH genes of the transgene were derived.
- human antibody includes antibodies having variable and constant regions (if present) of human germline immunoglobulin sequences.
- Human antibodies of the disclosure can include amino acid residues not encoded by human germline immunoglobulin sequences (e.g ., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo) (See, e.g., Lonberg et al., (1994 ) Nature 368(6474): 856-859); Lonberg, (1994) Handbook of Experimental Pharmacology 113:49-101; Lonberg & Huszar, (1995) Intern. Rev. Immunol. 13:65-93, and Harding & Lonberg, (1995) Ann.
- human antibody does not include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences (i.e. humanized antibodies).
- a heterologous antibody is defined in relation to the transgenic non-human organism producing such an antibody. This term refers to an antibody having an amino acid sequence or an encoding nucleic acid sequence corresponding to that found in an organism not consisting of the transgenic non-human animal, and generally from a species other than that of the transgenic non-human animal.
- inducing an immune response and “enhancing an immune response” are used interchangeably and refer to the stimulation of an immune response (i.e., either passive or adaptive) to a particular antigen.
- induce as used with respect to inducing CDC or ADCC refer to the stimulation of particular direct cell killing mechanisms.
- immunogenic apoptosis refers to a cell death modality associated with the activation of one or more signaling pathways that induces the pre-mortem expression and emission of damaged- associated molecular pattern (DAMPs) molecules (e.g., adenosine triphosphate, ATP) from the tumor cell, resulting in the increase of immunogenicity of the tumor cell and the death of the tumor cell in an immunogenic manner (e.g., by phagocytosis).
- DAMPs damaged- associated molecular pattern
- ATP adenosine triphosphate
- the terms “inhibits”, “reduces” or “blocks” are used interchangeably and encompass both partial and complete inhibition/blocking.
- the inhibition/blocking of IL-27 reduces or alters the normal level or type of activity that occurs without inhibition or blocking.
- Inhibition and blocking are also intended to include any measurable decrease in the binding affinity of IL-27 when in contact with an anti -IL-27 antibody as compared to IL-27 not in contact with an anti-IL-27 antibody, e.g., inhibits binding of IL-27 by at least about 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%.
- “reduces angiogenesis” refer to reducing the level of angiogenesis in a tissue to a quantity which is at least 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or less than the quantity in a corresponding control tissue, and most preferably is at the same level which is observed in a control tissue.
- the term "inhibits growth” is intended to include any measurable decrease in the growth of a cell, e.g, the inhibition of growth of a cell by at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 99%, or 100%.
- a subject “in need of prevention,” “in need of treatment,” or “in need thereof,” refers to one, who by the judgment of an appropriate medical practitioner (e.g., a doctor, a nurse, or a nurse practitioner in the case of humans; a veterinarian in the case of non-human mammals), would reasonably benefit from a given treatment (such as treatment with a composition comprising an anti-IL-27 antibody).
- an appropriate medical practitioner e.g., a doctor, a nurse, or a nurse practitioner in the case of humans; a veterinarian in the case of non-human mammals
- in vivo refers to processes that occur in a living organism.
- isolated antibody is intended to refer to an antibody which is substantially free of other antibodies having different antigenic specificities (e.g, an isolated antibody that specifically binds to human IL-27 is substantially free of antibodies that specifically bind antigens other than IL-27).
- An isolated antibody that specifically binds to an epitope may, however, have cross-reactivity to other IL-27 proteins from different species. However, the antibody continues to display specific binding to human IL-27 in a specific binding assay as described herein.
- an isolated antibody is typically substantially free of other cellular material and/or chemicals.
- a combination of "isolated" antibodies having different IL-27 specificities is combined in a well-defined composition.
- isolated nucleic acid molecule refers to nucleic acids encoding antibodies or antibody portions (e.g ., VH, VL, CDR3) that bind to IL-27, is intended to refer to a nucleic acid molecule in which the nucleotide sequences encoding the antibody or antibody portion are free of other nucleotide sequences encoding antibodies or antibody portions that bind antigens other than IL-27, which other sequences may naturally flank the nucleic acid in human genomic DNA.
- a sequence selected from a sequence set forth in Table 12 corresponds to the nucleotide sequences comprising the heavy chain (VH) and light chain (VL) variable regions of anti-IL-27 antibody monoclonal antibodies described herein.
- isotype refers to the antibody class (e.g., IgM or IgGl) that is encoded by heavy chain constant region genes.
- a human monoclonal antibody of the disclosure is of the IgGl isotype.
- a human monoclonal antibody of the disclosure is of the IgG2 isotype.
- a human monoclonal antibody of the disclosure is of the IgG3 isotype.
- a human monoclonal antibody of the disclosure is of the IgG4 isotype.
- antibody isotypes e.g., IgGl, IgG2, IgG3, IgG4, IgM, IgAl IgA2, IgD, and IgE
- IgGl immunoglobulin Gl
- IgG2, IgG3, IgG4, IgM immunoglobulin A2
- IgA2 immunoglobulin A2
- IgD immunoglobulin D
- isotype switching refers to the phenomenon by which the class, or isotype, of an antibody changes from one Ig class to one of the other Ig classes.
- KD or "KD” refers to the equilibrium dissociation constant of a binding reaction between an antibody and an antigen.
- the value of KD is a numeric representation of the ratio of the antibody off-rate constant (kd) to the antibody on-rate constant (ka).
- the value of KD is inversely related to the binding affinity of an antibody to an antigen. The smaller the KD value the greater the affinity of the antibody for its antigen. Affinity is the strength of binding of a single molecule to its ligand and is typically measured and reported by the equilibrium dissociation constant (KD), which is used to evaluate and rank order strengths of bimolecular interactions.
- kd or "kd” (alternatively “koff or “k 0ff ”) is intended to refer to the off-rate constant for the dissociation of an antibody from an antibody/antigen complex.
- the value of kd is a numeric representation of the fraction of complexes that decay or dissociate per second, and is expressed in units sec -1 .
- ka As used herein, the term “ka” or “k a “ (alternatively “kon” or “k 0n ”) is intended to refer to the on-rate constant for the association of an antibody with an antigen.
- the value of ka is a numeric representation of the number of antibody/antigen complexes formed per second in a 1 molar (1M) solution of antibody and antigen, and is expressed in units M-1 sec -1 .
- leukocyte refers to a type of white blood cell involved in defending the body against infective organisms and foreign substances. Leukocytes are produced in the bone marrow. There are 5 main types of white blood cells, subdivided between 2 main groups: polymorphonuclear leukocytes (neutrophils, eosinophils, basophils) and mononuclear leukocytes (monocytes and lymphocytes).
- lymphocytes refers to a type of leukocyte or white blood cell that is involved in the immune defenses of the body. There are two main types of lymphocytes: B-cells and T-cells.
- local administration refers to delivery that does not rely upon transport of the composition or agent to its intended target tissue or site via the vascular system.
- the composition may be delivered by injection or implantation of the composition or agent or by injection or implantation of a device containing the composition or agent.
- the composition or agent, or one or more components thereof may diffuse to the intended target tissue or site.
- MHC molecules refers to two types of molecules, MHC class I and MHC class II.
- MHC class I molecules present antigen to specific CD8+ T cells and MHC class II molecules present antigen to specific CD4+ T cells.
- Antigens delivered exogenously to APCs are processed primarily for association with MHC class II.
- antigens delivered endogenously to APCs are processed primarily for association with MHC class I.
- human monoclonal antibody refers to an antibody which displays a single binding specificity and affinity for a particular epitope.
- human monoclonal antibody refers to an antibody which displays a single binding specificity and which has variable and optional constant regions derived from human germline immunoglobulin sequences.
- human monoclonal antibodies are produced by a hybridoma which includes a B cell obtained from a transgenic non-human animal, e.g. , a transgenic mouse, having a genome comprising a human heavy chain transgene and a light chain transgene fused to an immortalized cell.
- monocyte refers to a type of leukocyte and can differentiate into macrophages and dendritic cells to effect an immune response.
- NK cell refers to a type of cytotoxic lymphocyte. These are large, usually granular, non-T, non-B lymphocytes, which kill certain tumor cells and play an important role in innate immunity to viruses and other intracellular pathogens, as well as in antibody-dependent cell-mediated cytotoxicity (ADCC).
- ADCC antibody-dependent cell-mediated cytotoxicity
- naturally occurring refers to the fact that an object can be found in nature.
- a polypeptide or polynucleotide sequence that is present in an organism (including viruses) that can be isolated from a source in nature and which has not been intentionally modified by man in the laboratory is naturally occurring.
- nonswitched isotype refers to the isotypic class of heavy chain that is produced when no isotype switching has taken place; the CH gene encoding the nonswitched isotype is typically the first CH gene immediately downstream from the functionally rearranged VDJ gene.
- Isotype switching has been classified as classical or non-classical isotype switching.
- Classical isotype switching occurs by recombination events which involve at least one switch sequence region in the transgene.
- Non-classical isotype switching may occur by, for example, homologous recombination between human s m and human ⁇ m (d-associated deletion).
- Alternative non-classical switching mechanisms such as intertransgene and/or interchromosomal recombination, among others, may occur and effectuate isotype switching.
- nucleic acid refers to deoxyribonucleotides or ribonucleotides and polymers thereof in either single- or double- stranded form. Unless specifically limited, the term encompasses nucleic acids containing known analogues of natural nucleotides that have similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions) and complementary sequences and as well as the sequence explicitly indicated.
- degenerate codon substitutions can be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et al., Nucleic Acid Res. 19:5081, 1991; Ohtsuka et al., Biol. Chem. 260:2605-2608, 1985; and Cassol et al, 1992; Rossolini et al, Mol. Cell. Probes 8:91-98, 1994).
- arginine and leucine modifications at the second base can also be conservative.
- nucleic acid is used interchangeably with gene, cDNA, and mRNA encoded by a gene.
- Polynucleotides used herein can be composed of any polyribonucleotide or polydeoxribonucleotide, which can be unmodified RNA or DNA or modified RNA or DNA.
- polynucleotides can be composed of single- and double-stranded DNA, DNA that is a mixture of single- and double- stranded regions, single- and double- stranded RNA, and RNA that is mixture of single- and double- stranded regions, hybrid molecules comprising DNA and RNA that can be single- stranded or, more typically, double-stranded or a mixture of single- and double- stranded regions.
- polynucleotide can be composed of triple-stranded regions comprising RNA or DNA or both RNA and DNA.
- a polynucleotide can also contain one or more modified bases or DNA or RNA backbones modified for stability or for other reasons.
- Modified bases include, for example, tritylated bases and unusual bases such as inosine.
- a variety of modifications can be made to DNA and RNA; thus, "polynucleotide” embraces chemically, enzymatically, or metabolically modified forms.
- a nucleic acid is "operably linked" when it is placed into a functional relationship with another nucleic acid sequence.
- a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence.
- operably linked means that the DNA sequences being linked are contiguous and, where necessary to join two protein coding regions, contiguous and in reading frame.
- operably linked indicates that the sequences are capable of effecting switch recombination.
- parenteral administration refers to modes of administration other than enteral and topical administration, usually by injection, and include, without limitation, intravenous, intranasal, intraocular, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural, intracerebral, intracranial, intracarotid and intrasternal injection and infusion.
- the term "patient” includes human and other mammalian subjects that receive either prophylactic or therapeutic treatment.
- the term "PD-1 antagonist” refers to any chemical compound or biological molecule that inhibits the PD-1 signaling pathway or that otherwise inhibits PD-1 function in a cell (e.g. an immune cell).
- a PD-1 antagonist blocks binding of PD- L1 to PD-1 and/or PD-L2 to PD-1.
- the PD-1 antagonist specifically binds PD-1.
- the PD-1 antagonist specifically binds PD-L1.
- percent identity in the context of two or more nucleic acid or polypeptide sequences, refer to two or more sequences or subsequences that have a specified percentage of nucleotides or amino acid residues that are the same, when compared and aligned for maximum correspondence, as measured using one of the sequence comparison algorithms described below (e.g., BLASTP and BLASTN or other algorithms available to persons of skill) or by visual inspection.
- sequence comparison algorithms e.g., BLASTP and BLASTN or other algorithms available to persons of skill
- the "percent identity” can exist over a region of the sequence being compared, e.g., over a functional domain, or, alternatively, exist over the full length of the two sequences to be compared.
- sequence comparison typically one sequence acts as a reference sequence to which test sequences are compared.
- test and reference sequences are input into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated.
- sequence comparison algorithm then calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters.
- Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Nat'l. Acad. Sci. USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.), or by visual inspection (see generally Ausubel et al, infra).
- BLAST Altschul et al, J. Mol. Biol. 215:403-410 (1990). Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information website.
- pharmaceutically acceptable refers to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues, organs, and/or bodily fluids of human beings and animals without excessive toxicity, irritation, allergic response, or other problems or complications commensurate with a reasonable benefit/risk ratio.
- a "pharmaceutically acceptable carrier” refers to, and includes, any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible.
- the compositions can include a pharmaceutically acceptable salt, e.g., an acid addition salt or a base addition salt (see, e.g., Berge et al. (1977) J Pharm Sci 66:1-19).
- polypeptide As used herein, the terms “polypeptide,” “peptide”, and “protein” are used interchangeably to refer to a polymer of amino acid residues. The terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymer.
- the term "preventing” when used in relation to a condition refers to administration of a composition which reduces the frequency of, or delays the onset of, symptoms of a medical condition in a subject relative to a subject which does not receive the composition.
- the term “purified” or “isolated” as applied to any of the proteins refers to administration of a composition which reduces the frequency of, or delays the onset of, symptoms of a medical condition in a subject relative to a subject which does not receive the composition.
- antibodies or fragments described herein refers to a polypeptide that has been separated or purified from components (e.g., proteins or other naturally occurring biological or organic molecules) which naturally accompany it, e.g., other proteins, lipids, and nucleic acid in a prokaryote expressing the proteins.
- a polypeptide is purified when it constitutes at least 60 (e.g., at least 65, 70, 75, 80, 85, 90, 92, 95, 97, or 99) %, by weight, of the total protein in a sample.
- PD-1 Programmed Cell Death Protein 1
- PD-1 refers to the Programmed Cell Death Protein 1 polypeptide, an immune-inhibitory receptor belonging to the CD28 family and is encoded by the PDCD1 gene in humans.
- Alternative names or synonyms for PD-1 include: PDCD1, PD1, CD279 and SLEB2.
- PD-1 is expressed predominantly on previously activated T cells, B cells, and myeloid cells in vivo , and binds to two ligands, PD-L1 and PD-L2.
- PD-1 as used herein includes human PD-1 (hPD-1), variants, isoforms, and species homologs of hPD-1, and analogs having at least one common epitope with hPD-1.
- hPD-1 human PD-1
- variants variants
- isoforms and species homologs of hPD-1
- analogs having at least one common epitope with hPD-1 can be found under GenBank Accession No. AAC51773.
- the term "Programmed Death Ligand-1" or "PD-L1” is one of two cell surface glycoprotein ligands for PD-1 (the other being PD-L2) that downregulates T cell activation and cytokine secretion upon binding to PD-1.
- Alternative names and synonyms for PD- L1 include: PDCD1L1, PDL1, B7H1, B7-4, CD274 and B7-H.
- the term "PD-L1” as used herein includes human PD-L1 (hPD-Ll), variants, isoforms, and species homologs of hPD-Ll, and analogs having at least one common epitope with hPD-Ll. The complete hPD-Ll sequence can be found under GenBank Accession No. Q9NZQ7.
- PD-1 is known as an immune-inhibitory protein that negatively regulates TCR signals (Ishida, Y. et al. (1992) EMBO J. 11:3887-3895; Blank, C. et al. (Epub 2006 Dec. 29) Immunol. Immunother. 56(5):739-745).
- the interaction between PD-1 and PD-L1 can act as an immune checkpoint, which can lead to a decrease in T-cell receptor mediated proliferation (Dong et al. (2003) J. Mol. Med. 81:281-7; Blank et al. (2005) Cancer Immunol. Immunother. 54:307- 314; Konishi et al. (2004) Clin. Cancer Res. 10:5094-100).
- Immune suppression can be reversed by inhibiting the local interaction of PD-1 with PD-L1 or PD-L2; the effect is additive when the interaction of PD-1 with PD-L2 is blocked as well (Iwai et al. (2002) Proc. Nat'l. Acad. Sci. USA 99:12293-7; Brown et al. (2003) J. Immunol. 170:1257-66).
- tumor survival and proliferation is sustained by tumor- mediated immune checkpoint modulation.
- This modulation can result in the disruption of anti cancer immune system functions.
- immune checkpoint receptors ligands such as PD-L1 or PD-L2
- PD-L1 immune checkpoint receptors ligands
- PD-L1 is abundantly expressed by a variety of human cancers (Dong et al., (2002) Nat Med 8:787-789).
- the receptor for PD-L1, PD-1 is expressed on lymphocytes (e.g., activated T cells) and is normally involved in down-regulating the immune system and promoting self-tolerance, particularly by suppressing T cells.
- lymphocytes e.g., activated T cells
- PD-1 receptors expressed on T cells bind to cognate PD-L1 ligands on tumor cells, the resulting T cell suppression contributes to an impaired immune response against the tumor (e.g., a decrease in tumor infiltrating lymphocytes or the establishment of immune evasion by cancer cells).
- PD-1 expression on tumor lymphocytes was found to mark dysfunctional T cells in breast cancer (Kitano et al., (2017) ESMO Open 2(2):e000150) and melanoma (Kleffel et al., (2015) Cell 162(6): 1242- 1256).
- PD-1 antagonists such as those that affect the function of the PD-1/PD-L1/PD-L2 signaling axis and/or disrupt the interaction between PD-1 and PD-L1 and/or PD-L2, for example, have been developed and represent a novel class of anti-tumor inhibitors that function via modulation of immune cell-tumor cell interaction.
- the term "rearranged" refers to a configuration of a heavy chain or light chain immunoglobulin locus wherein a V segment is positioned immediately adjacent to a D- J or J segment in a conformation encoding essentially a complete VH or VL domain, respectively.
- a rearranged immunoglobulin gene locus can be identified by comparison to germline DNA; a rearranged locus will have at least one recombined heptamer/nonamer homology element.
- recombinant host cell (or simply “host cell”) is intended to refer to a cell into which a recombinant expression vector has been introduced. It should be understood that such terms are intended to refer not only to the particular subject cell but to the progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term “host cell” as used herein.
- the term "recombinant human antibody” includes all human antibodies that are prepared, expressed, created or isolated by recombinant means, such as (a) antibodies isolated from an animal (e.g., a mouse) that is transgenic or transchromosomal for human immunoglobulin genes or a hybridoma prepared therefrom, (b) antibodies isolated from a host cell transformed to express the antibody, e.g, from a transfectoma, (c) antibodies isolated from a recombinant, combinatorial human antibody library, and (d) antibodies prepared, expressed, created or isolated by any other means that involve splicing of human immunoglobulin gene sequences to other DNA sequences.
- variable and constant regions that utilize particular human germline immunoglobulin sequences are encoded by the germline genes, but include subsequent rearrangements and mutations which occur, for example, during antibody maturation.
- the variable region contains the antigen binding domain, which is encoded by various genes that rearrange to form an antibody specific for a foreign antigen.
- the variable region can be further modified by multiple single amino acid changes (referred to as somatic mutation or hypermutation) to increase the affinity of the antibody to the foreign antigen.
- the constant region will change in further response to an antigen (i.e., isotype switch).
- the rearranged and somatically mutated nucleic acid molecules that encode the light chain and heavy chain immunoglobulin polypeptides in response to an antigen may not have sequence identity with the original nucleic acid molecules, but instead will be substantially identical or similar (i.e., have at least 80% identity).
- reference antibody (used interchangeably with “reference mAh”) or “reference antigen-binding protein” refers to an antibody, or an antigen-binding fragment thereof, that binds to a specific epitope on IL-27 and is used to establish a relationship between itself and one or more distinct antibodies, wherein the relationship is the binding of the reference antibody and the one or more distinct antibodies to the same epitope on IL-27.
- the term connotes an anti-IL-27 antibody that is useful in a test or assay, such as those described herein, (e.g., a competitive binding assay), as a competitor, wherein the assay is useful for the discovery, identification or development, of one or more distinct antibodies that bind to the same epitope.
- a test or assay such as those described herein, (e.g., a competitive binding assay), as a competitor, wherein the assay is useful for the discovery, identification or development, of one or more distinct antibodies that bind to the same epitope.
- the terms “specific binding,” “selective binding,” “selectively binds,” and “specifically binds,” refer to antibody binding to an epitope on a predetermined antigen.
- the antibody binds with an equilibrium dissociation constant (KD) of approximately less than 10 6 M, such as approximately less than 10 7 , 10 8 M, 10 9 M or 10 10 M or even lower when determined by surface plasmon resonance (SPR) technology in a BIACORE 2000 instrument using recombinant human IL-27 as the analyte and the antibody as the ligand and binds to the predetermined antigen with an affinity that is at least two-fold greater than its affinity for binding to a non-specific antigen (e.g, BSA, casein) other than the predetermined antigen or a closely- related antigen.
- KD equilibrium dissociation constant
- an antibody that specifically binds to IL-27 binds with an equilibrium dissociation constant (KD) of approximately less than 100 nM (10 -7 M), optionally approximately less than 50 nM (5 x 10 8 M), optionally approximately less than 15 nM (1.5 x 10 8 M), optionally approximately less than 10 nM (10 8 M), optionally approximately less than 5 nM (5 x 10 -9 M), optionally approximately less than 1 nM (10 9 M), optionally approximately less than 0.1 nM (10 -10 M), optionally approximately less than 0.01 nM (10 -11 M), or even lower, when determined by surface plasmon resonance (SPR) technology in a BIACORE 2000 instrument using recombinant human IL-27 as the analyte and the antibody as the ligand, where binding to the predetermined antigen occurs with an affinity that is at least two-fold greater than the antibody’s affinity for binding to a non-specific antigen (e.g ., BSA, casein) other than the
- STAT1 phosphorylation refers to the phosphorylation of the Signal Transducer and Activator of Transcription 1 (STAT1) polypeptide, a transcription factor encoded by the ST ATI gene in humans.
- STAT molecules are phosphorylated by receptor associated kinases, that cause activation and dimerization by forming homo- or heterodimers which translocate to the nucleus to work as transcription factors.
- STAT1 can be activated (i.e., phosphorylated) in response to signaling via several ligands, including IL-27. IL-27 signaling through the IL-27R results in phosphorylation of STAT1 (pSTATl).
- STAT1 has a key role in gene expression involved in survival of the cell, viability or pathogen response.
- Methods to determine STAT1 phosphorylation as a result of IL-27 signaling include, but are not limited to, flow cytometric analysis of cells labeled with antibodies that specifically recognize phosphorylated STAT1 (see e.g., Tochizawa et al, (2006) J Immunol Methods 313(l-2):29-37).
- STAT3 phosphorylation refers to the phosphorylation of the Signal Transducer and Activator of Transcription 3 (STAT3) polypeptide, a transcription factor encoded by the STAT3 gene in humans.
- STAT3 mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis.
- Methods to determine STAT3 phosphorylation as a result of IL-27 signaling include, but are not limited to, analysis of cells or cell extracts labeled with antibodies that specifically recognize phosphorylated STAT3 (see e.g., Fursov et al , (2011) Assay Drug Dev Technol 9(4):420-429).
- switch sequence refers to those DNA sequences responsible for switch recombination.
- a "switch donor” sequence typically a m switch region, will be 5' (i.e., upstream) of the construct region to be deleted during the switch recombination.
- the "switch acceptor” region will be between the construct region to be deleted and the replacement constant region ( e.g ., y, e, etc.). As there is no specific site where recombination always occurs, the final gene sequence will typically not be predictable from the construct.
- the term "subject” includes any human or non-human animal.
- the methods and compositions of the present invention can be used to treat a subject with an immune disorder.
- non-human animal includes all vertebrates, e.g., mammals and non-mammals, such as non-human primates, sheep, dog, cow, chickens, amphibians, reptiles, etc.
- nucleic acids the term “substantial homology” indicates that two nucleic acids, or designated sequences thereof, when optimally aligned and compared, are identical, with appropriate nucleotide insertions or deletions, in at least about 80% of the nucleotides, usually at least about 90% to 95%, and more preferably at least about 98% to 99.5% of the nucleotides. Alternatively, substantial homology exists when the segments will hybridize under selective hybridization conditions, to the complement of the strand.
- the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm, as described in the non-limiting examples below.
- the percent identity between two nucleotide sequences can be determined using the
- GAP program in the GCG software package (available at http://www.gcg.com), using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and a length weight of 1, 2, 3, 4, 5, or 6.
- the percent identity between two nucleotide or amino acid sequences can also be determined using the algorithm of E. Meyers and W. Miller (CABIOS, 4:11-17 (1989)) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
- the percent identity between two amino acid sequences can be determined using the Needleman and Wunsch ( J . Mol. Biol.
- nucleic acid and protein sequences of the present disclosure can further be used as a "query sequence" to perform a search against public databases to, for example, identify related sequences.
- Such searches can be performed using the NBLAST and XBLAST programs (version 2.0) of Altschul, et al. (1990) J. Mol. Biol. 215:403-10.
- Gapped BLAST can be utilized as described in Altschul et al. , (1997) Nucleic Acids Res. 25(17):3389-3402.
- the default parameters of the respective programs e.g ., XBLAST and NBLAST
- XBLAST and NBLAST See http://www.ncbi.nlm.nih.gov.
- the nucleic acids may be present in whole cells, in a cell lysate, or in a partially purified or substantially pure form.
- a nucleic acid is "isolated” or “rendered substantially pure” when purified away from other cellular components or other contaminants, e.g., other cellular nucleic acids or proteins, by standard techniques, including alkaline/SDS treatment, CsCl banding, column chromatography, agarose gel electrophoresis and others well known in the art. See, F. Ausubel, et al, ed. Current Protocols in Molecular Biology, Greene Publishing and Wiley Interscience, New York (1987).
- nucleic acid compositions of the present disclosure while often in a native sequence (except for modified restriction sites and the like), from either cDNA, genomic or mixtures thereof may be mutated, in accordance with standard techniques to provide gene sequences. For coding sequences, these mutations, may affect amino acid sequence as desired.
- DNA sequences substantially homologous to or derived from native V, D, J, constant, switches and other such sequences described herein are contemplated (where "derived" indicates that a sequence is identical or modified from another sequence).
- Stimulator of Interferon Genes a protein that functions both as a direct cytosolic DNA sensor and as an adaptor protein.
- STING is encoded by the TMEM173 gene.
- STING plays an important role in innate immunity.
- STING induces type I interferon production when cells are infected with intracellular pathogens, such as viruses, mycobacteria and intracellular parasites.
- Type I interferon mediated by STING, protects infected cells and nearby cells from local infection by binding to the same cell that secretes it and nearby cells.
- An exemplary amino acid sequence for STING is provided by the NCBI Genbank database under the accession number NP 001288667.
- T cell refers to a type of white blood cell that can be distinguised from other white blood cells by the presence of a T cell receptor on the cell surface.
- T helper cells a.k.a.
- TH cells or CD4 + T cells and subtypes, including THI, TH2, TH3, TH17, TH9, and TFH cells, cytotoxic T cells (a.k.a Tc cells, CD8 + T cells, cytotoxic T lymphocytes, T-killer cells, killer T cells), memory T cells and subtypes, including central memory T cells (TCM cells), effector memory T cells (TEM and TEMRA cells), and resident memory T cells (TRM cells), regulatory T cells (a.k.a.
- T reg cells or suppressor T cells and subtypes, including CD4 + FOXP3 + Treg cells, CD4 + FOXP3 Treg cells, Trl cells, Th3 cells, and Tregl7 cells, natural killer T cells (a.k.a. NKT cells), mucosal associated invariant T cells (MAITs), and gamma delta T cells (gd T cells), including Vy9/Vd2 T cells.
- CD4 + FOXP3 + Treg cells CD4 + FOXP3 + Treg cells
- Trl cells Trl cells, Th3 cells, and Tregl7 cells
- natural killer T cells a.k.a. NKT cells
- MAITs mucosal associated invariant T cells
- gd T cells gamma delta T cells
- Vy9/Vd2 T cells gamma delta T cells
- T cell-mediated response refers to any response mediated by T cells, including, but not limited to, effector T cells (e.g ., CD8 + cells) and helper T cells (e.g ., CD4 + cells). T cell mediated responses include, for example, T cell cytotoxicity and proliferation.
- therapeutically effective amount or “therapeutically effective dose,” or similar terms used herein are intended to mean an amount of an agent (e.g., an anti-IL-27 antibody or an antigen-binding fragment thereof) that will elicit the desired biological or medical response (e.g., an improvement in one or more symptoms of a cancer).
- TAM receptor refers to the TAM receptor protein tyrosine kinases (TYRO3, AXL and MER). TAM receptors are involved in the regulation of immune system homeostasis. In a cancer setting, TAM receptors have a dual regulatory role, controlling the initiation and progression of tumor development and, at the same time, the associated anti-tumor responses of diverse immune cells. Further description of TAM receptors is found in Paolino and Penninger (2016) Cancers 8(97): doi:10.3390/cancers8100097). As used herein, the term “TAM receptor inhibitor” or “TAM inhibitor” refers to an agent that inhibits, blocks or reduces the function or activity of a TAM receptor.
- TIGIT or "T-cell immunoreceptor with Ig and ITIM domains” refers to any native TIGIT from any vertebrate source, including mammals such as primates (e.g., humans) and rodents (e.g., mice and rats), unless otherwise indicated.
- TIGIT is also known in the art as DKFZp667A205, FLJ39873, V-set and immunoglobulin domain-containing protein 9, V-set and transmembrane domain-containing protein 3, VSIG9, VSTM3, and WUCAM.
- the term also encompasses naturally occurring variants of TIGIT, e.g., splice variants or allelic variants.
- the amino acid sequence of an exemplary human TIGIT may be found under UniProt Accession Number Q495 A1.
- treatment refers to therapeutic or preventative measures described herein.
- the methods of “treatment” employ administration to a subject, in need of such treatment, a human antibody of the present disclosure, for example, a subject in need of an enhanced immune response against a particular antigen or a subject who ultimately may acquire such a disorder, in order to prevent, cure, delay, reduce the severity of, or ameliorate one or more symptoms of the disorder or recurring disorder, or in order to prolong the survival of a subject beyond that expected in the absence of such treatment.
- tumor microenvironment refers to the cellular environment or milieu in which the tumor or neoplasm exists, including surrounding blood vessels as well as non-cancerous cells including, but not limited to, immune cells, fibroblasts, bone marrow-derived inflammatory cells, and lymphocytes. Signaling molecules and the extracellular matrix also comprise the TME.
- the tumor and the surrounding microenvironment are closely related and interact constantly. Tumors can influence the microenvironment by releasing extracellular signals, promoting tumor angiogenesis and inducing peripheral immune tolerance, while the immune cells in the microenvironment can affect the growth and evolution of tumor cells.
- the term "unrearranged" or “germline configuration” refers to the configuration wherein the V segment is not recombined so as to be immediately adjacent to a D or J segment.
- vector is intended to refer to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
- plasmid refers to a circular double stranded DNA loop into which additional DNA segments may be ligated.
- viral vector Another type of vector is a viral vector, wherein additional DNA segments may be ligated into the viral genome.
- Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors).
- vectors e.g, non-episomal mammalian vectors
- vectors can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome.
- certain vectors are capable of directing the expression of genes to which they are operatively linked.
- Such vectors are referred to herein as "recombinant expression vectors" (or simply, "expression vectors”).
- expression vectors of utility in recombinant DNA techniques are often in the form of plasmids.
- plasmid and vector may be used interchangeably as the plasmid is the most commonly used form of vector.
- the invention is intended to include such other forms of expression vectors, such as viral vectors (e.g ., replication defective retroviruses, adenoviruses and adeno-associated viruses), which serve equivalent functions.
- FIG. 1 is a table that provides affinity data for anti-IL-27 antibodies that are capable of binding to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leul42, Aspl46, Argl49, Hisl50, Phel53, Leul56, Leul62, and Glul64 of SEQ ID NO: 2 (IL-27p28). Affinity measurements were performed using ForteBio and Meso Scale Discovery methods.
- FIG. 2A is a graph depicting the inhibition of IL-27-mediated phosphorylation of
- FIG. 2B is a graph depicting the inhibition of IL-27-mediated phosphorylation of STAT1 in U937 cells by anti-IL-27 antibodies, as indicated, as measured by flow cytometry.
- FIG. 2C is a graph depicting the inhibition of IL-27-mediated phosphorylation of STAT1 in HUT-78 cells by anti-IL- 27 antibodies, as indicated, as measured by flow cytometry.
- FIG. 3 is graph showing that an anti-IL-27 antibody of the present disclosure ("anti-IL-27 antibody
- IL-27 Abl inhibits IL-27-mediated pSTATl in human whole blood T cells.
- FIG. 4 is a graph depicting the reversal of IL-27-mediated inhibition of CD161 expression in T cells by a range of concentrations of anti-IL-27 antibodies, as indicated. CD161 expression was determined using flow cytometry.
- FIG. 5A is a graph depicting the extent of anti-IL-27 antibodies to enhance the PD-
- FIG. 5B is a graph depicting the extent of anti-IL-27 antibodies to enhance the PD- 1 -mediated secretion of IL-6 in human PBMCs as measured by ELISA.
- FIG. 5E-5H summarize observed cytokine induction of TNFa (FIG. 5E), IFNy (FIG. 5F), IL-6 (FIG. 5G), and IL-17A (FIG. 5H) in activated PBMC cultures from several individual donors including healthy control, and patients with RCC, HCC and ovarian cancer, when such cells were contacted with anti-IL-27 Ab 1 antibody, aPD-1 antibody, or a combination of anti-IL-27 Abl and aPD-1 antibodies.
- FIG. 6A is a graph depicting the inhibition of IL-27-mediated expression of PD-L1 by treatment of human monocytes with anti-IL-27 antibody as determined by flow cytometry.
- FIG. 6B is a graph depicting the inhibition of IL-27-mediated expression of TIM3 by treatment of human monocytes with anti-IL-27 antibody, as determined by flow cytometry.
- FIG. 6C is a graph depicting the inhibition of IL-27-mediated expression of PD-L1 by treatment of resting human T cells with anti-IL-27 antibody, as determined by flow cytometry.
- FIG. 7A is a dotplot depicting the number of surface lung B16F10 metastatic nodules (pulmonary nodules) from B16F10 tumor-bearing mice treated with anti-IL27 antibody (anti-IL-27 Abl), isotype control antibody, aWSX-1 antibody or combined aPD-1 and ocCTLA-4 antibodies, as indicated, as determined by visual counting of nodules from lungs isolated from mice.
- FIG. 7B provides a graph depicting the growth kinetics of bioluminescent B16-Luc tumors in mice treated with anti-IL-27 antibody (anti-IL-27 Abl) or isotype control antibody, as determined by bioluminescent imaging analysis.
- FIG. 7C-7F show a series of images of fixed, sectioned lung tissue stained with hematoxylin and eosin isolated from B16F10 tumor-bearing mice treated with anti-IL27 antibody (anti-IL-27 Abl) (FIG.7D), isotype control antibody (FIG. 7C), aWSX-1 antibody (FIG. 7E) or combined aPD-1 and ocCTLA-4 antibodies (FIG. 7F), as indicated.
- FIG. 7D shows a series of images of fixed, sectioned lung tissue stained with hematoxylin and eosin isolated from B16F10 tumor-bearing mice treated with anti-IL27 antibody (anti-IL-27 Abl)
- FIG. 7D isotype control antibody
- FIG. 7E isotype control antibody
- FIG. 7E aWSX-1 antibody
- FIG. 7F combined aPD-1 and ocCTLA-4 antibodies
- 7G is a dotplot depicting the total tumor area as a percentage of total tissue area of fixed, sectioned lung tissue B16F10 tumor tissue stained with hematoxylin and eosin isolated from B16F10 tumor-bearing mice treated with anti-IL27 antibody (anti-IL-27 Abl), isotype control antibody, aWSX-1 antibody or combined aPD-1 and aCTLA-4 antibodies, as indicated, as determined by image analysis software.
- IL-27RA WSX-1
- FIG. 8A provides a volcano plot depicting microarray data of genes with an expression change > 1.0 log2 fold change (black dots) in splenocytes isolated from mice overexpressing IL-27 following treatment with IL-27 minicircles.
- the x axis shows log2 fold change of gene expression (IL-27 minicircle treated vs control).
- the y axis is a t test p value showing probablitiy of fold change for each gene.
- FIG. 8B provides a graph depicting the expression level of select immunomodulatory genes, as indicated, in splenocytes as in FIG. 8A.
- FIG. 8C-8F show ectopic expression of human IL-27 induces inhibitory receptor expression (by flow cytometry analysis) on murine T cells in vivo and that anti-IL-27 Abl reduces inhibitory receptor expression on T cells in vivo after IL-27 minicircle treatment.
- Six-week-old female Balb/c mice were injected with empty vector (control) or hIL-27 minicircle(FIGs. 8C and 8D).
- PBMCs and (FIGs. 8E and 8F) total splenocytes were collected 5 days after transfection and cells were stained and analyzed by flow cytometry. Expression of the indicated markers were analyzed on CD4+ T cells (FIGs. 8C and 8E) and CD8+ T cells (FIGs. 8D and 8F). Analysis was performed using FlowJo software.
- FIG. 8G shows that anti-IL-27 Abl inhibits detection of minicircle-derived human IL-27 in murine plasma.
- FIG. 9 is a crystal ribbon structure of an IL-27 - anti-IL-27 Abl complex determined using the molecular replacement software Phaser (McCoy et al, (2007) ./. Appl. Cyrst. 40: 658-74) and Molrep (Vagin et al, (1997) J Appl. Cyrst. 30: 1022-25). Heavy chain, light chain, p28, and EBI-3 are colored in yellow, red, grey, and green respectively.
- FIG. 9 shows that anti-IL- 27 Abl is bound to the p28 molecule of IL-27.
- FIGs. 10A-10B are graphs showing human IL-27 heterodimer binding affinity to
- WSX-1 (FIG. 10 A) and gpl30 (FIG. 10B) in the presense (dark grey line) or absence (light grey line) of anti-IL-27 Abl, as measured by surface plasmon resonance.
- FIG. 11 is a ribbon diagram of p28, showing the residues where anti-IL-27 Abl binds p28.
- LC light chain of anti-IL-27 Abl;
- HC heavy chain of anti-IL-27 Abl
- FIG. 12 is a ribbon diagram of the structural alignment of IL-27/anti -IL-27 Abl
- FIG. 13 is a ribbon diagram of the structural alignment of IL-27/anti -IL-27 Abl
- FIGs. 14A-14B are ribbon diagrams of the binding interface of p28 and EBI3, with
- FIG. 14B showing an enargement of FIG. 14A to illustrate the location of salt bridge interactions and aromatic/hydrophobic interactions between p28 and EBI3.
- FIGs. 15A-15B are images of sequence alignments of p28 (FIG. 15A) and EBI3
- FIG. 15B across several animal species. Arrows point to conserved salt bridging amino acids and conserved hydrophobic amino acids, as indicated.
- FIG. 16A is a ribbon diagram illustrating the structural alignment of IL-27 heterodimer with IL-6/IL-6Ra.
- FIGs. 16B-16C are sequence alignments of IL-27 and and IL-6/IL- 6Ra. Arrows point to conserved salt bridging amino acids and conserved hydrophobic amino acids.
- FIG. 16D is a ribbon diagram illustrating several p28 interactions with EBI3 that are conserved with IL-6Ra.
- FIG. 17 is a table presenting binding affinity data for human IL-27 and gpl30.
- FIG. 18A is a sequence alignment of the mouse and human p28 amino acid sequences.
- FIG. 18B is a ribbon diagram, focused in at residue 162 (Leu in the human sequence, and Cys in the mouse sequence).
- FIG. 19A shows the electrostatic surface potential of human IL-27.
- FIG. 19B shows the primary sequence of human IL-27, showing the ocA, ocB, ocC, ocD helices, and unresolved CD loop with poly-Glu sequence.
- FIG. 20A is graphical represenation illustrating differential expression of EBI3, IL-
- FIGs. 20B-20D are Kaplan- Meier curves (percent death-free survival in days) for RCC patients stratified by high (1) or low (2) expression of EBI3 (FIG. 20B), IL-27p28 (FIG. 20C), and IL-27RA (FIG. 20D). Data were generated using TCGA as previously described (see, e.g., Li et al., Cancer Research. 2017;77(21):el08-el 10; Li et al., Genome Biology 2016; 17(1): 174).
- FIGs. 21A-21B show IL-27 induced gene expression signatures in activated human
- FIG. 21 A is a fold change scatter plot of IL-27-treated CD4 + T cells as compared to untreated controls for two separate donors.
- FIG. 21B shows the top 31 genes in the IL-27 signature in CD4 + T cells. Fifteen of the 31 genes (marked with a star) were associated with poor outcome. Data were generated using TCGA.
- FIGs. 22A-22B are graphical representations of the genome-wide hazard ratios associated with the expression of IL-27 signature genes in RCC (FIG. 22A) and BRCA (FIG. 22B) tumor samples. Data were generated using TCGA.
- FIG. 23A is graphical representations of EBI3 plasma levels in patients with RCC, as compared to healthy donor serum and serum from a pregnant female (positive control), as measured using an EB 13-specific antibody pair.
- FIG. 23B shows EBI3 levels in a separate cohort of patients with RCC grouped by tumor stage.
- FIG. 23C shows overall survival and
- FIG. 23D shows disease-free survival in patients with RCC, stratified by serum EBI3 levels.
- FIGs. 24A-24B are graphical representations of the effect of anti-IL-27 Abl on tumor growth and lung metastases in an orthotopic Renca model.
- FIGs. 24A and 24B show the net primary tumor weight (kidney) and the number of lung metastases in control and anti-IL-27 Abl-treated Renca mice. (*P ⁇ 0.05; unpaired t-test)
- FIGs. 25A-25B show the effect of anti-IL-27 Abl as a single agent on mean orthotopic Hepal-6 tumor flux overtime as compared to isotype control (FIG. 25B) in the orthotopic Hepal-6-luc tumor model (FIG. 25A). Error bars indicate standard error.
- FIGs. 26A-26F show dose-dependent inhibition of orthotopic Hepal-6 tumor growth following serial administration of anti-IL-27 Abl (FIG. 26A).
- FIG. 26B shows mean bioluminescence imaging (“BLI”, photons/second) at 5, 8, 13, and 16 days post implant for control and anti-IL-27 Abl (5 mg/kg, 25 mg/kg, and 50 mg/kg) dosing.
- FIGs. 26C-26F show BLI (photons/second) at 5, 8, 13, and 16 days post implant for individual animals in control (FIG. 26C) and anti-IL-27 Abl 5 mg/kg (FIG. 26D), 25 mg/kg (FIG. 26E), and 50 mg/kg groups (FIG. 26F). [0197] FIGs.
- FIG. 27A-27C show modulation of gene expression in Hepal-6 livers following administration of anti-IL-27 Abl (FIGs. 27A and 27B).
- FIG. 27C is a volcano plot of genes modulated by anti-IL-27 Abl administration. Tables 11 A-l IB, below, provide lists of upregulated and downregulated genes represented in FIG. 27B.
- FIGs. 28A-28E are graphical representations illustrating the expression of various
- IL-27 component genes FIG. 28A
- CD274, TIGIT, LAG3, HAVCR2, and PDCD1 FIG. 28B
- TGFA and TGFB1 FIG. 28C
- AFP FIG. 28D
- TNFRSF10B, TNFRSF1A, and PDGFA FIG. 28E
- FIGs. 29A-29B are graphical representations of the relative expression of various macrophage and NK transcript marker genes in the tumor microenvironment (TME) following anti-IL-27 Abl administration.
- FIG. 30 is a graphical representation of the expression of NK-associated receptors following administration of either anti-IL-27 Abl or an isotype control.
- FIG. 31 shows the relative expression of various cell surface markers following administration of anti-IL-27 Abl as compared to an IgG isotype control. Ratios were obtained by normalizing target marker transcript level to PTPRC level. Directionality is expressed as difference between anti-IL-27 Abl ratio and IgG ratio.
- FIGs. 32A-32D are bar graphs showing the expression of IL17A (FIG. 32A), IFNg
- FIGs. 33A-33D are scatter plots showing the expression of IL17A (FIG. 33A),
- IFNg IFNg
- TNFa TNFa
- IL-10 FIG. 33D
- FIG. 34 is a volcano plot representing the log2 fold-change in gene expression after
- FIG. 35 is a scatter plot showing TNFSF15 expression in activated PBMCs following culture in anti-IL-27 Abl or an isotype control (IgG).
- FIGs. 36A-36B are bar graphs showing TNFSF15 expression in activated (FIG.
- FIG. 36A resting (FIG. 36B) PBMCs cultured in the presence of two different lots of anti-IL-27 Abl (1 mg/mL) or isotype control.
- FIG. 37 is a bar graph showing the fold change in TNFSF15 transcript after IL-27 inhibition with anti-IL-27 Abl compared to isotype control in various cell types, as indicated.
- FIG. 38 is a bar graph showing the fold expression in TNFSF 15 transcript following treatment with anti-IL-27 Abl, an anti-CD39 antibody, and two anti-CD 112R antibodies, as indicated.
- FIGs. 39A-39B are bar graphs showing TNFSF 15 transcript (FIG. 39A) and secreted TNFSF 15 protein (FIG. 39B) after blocking IL-27 with anti-IL-27 Abl in activated PBMCs with delayed kinetics.
- IL-27 and “IL27” as used herein refer interchangeably to the heterodimeric cytokine, IL-27 that is composed of two distinct subunits, encoded by two different genes: Epstein-Barr virus-induced gene 3 (EBI3) and IL-27p28.
- EBI3 Epstein-Barr virus-induced gene 3
- IL-27 has both pro- and anti-inflammatory properties with diverse effects on - hematopoietic and non-hematopoietic cells.
- the disclosure provides an isolated antibody that specifically binds to and antagonizes human IL-27, or an antigen binding portion thereof, wherein the antibody or antigen binding portion thereof specifically binds to the epitopes disclosed herein and exhibits at least one or more of the following properties:
- Additional aspects of the invention include nucleic acid molecules encoding the antibody molecules, expression vectors, host cells and methods for making the antibody molecules. Immunoconjugates, multi- or bispecific molecules and pharmaceutical compositions comprising the antibody molecules are also provided.
- the anti-IL-27 antibody molecules disclosed herein can be used to treat, prevent and/or diagnose cancerous or malignant disorders, e.g., solid and liquid tumors (e.g., leukemia, e.g., lymphoma, e.g., AML), lung cancer (e.g., non-small cell lung cancer), pancreatic cancer, breast cancer (e.g., triple-negative breast cancer), melanoma, testicular cancer, sarcoma, head and neck cancer (e.g., squamous head and neck cancer), liver cancer (e.g., hepatocellular carcinoma (HCC)), colorectal cancer, ovarian cancer, brain cancer (e.g., glioblastoma multiforme), or renal cancer
- the present disclosure provides antibodies, and antigen binding portions thereof, that specifically bind to IL-27p28 and antagonize IL-27, in particular human IL-27.
- the present disclosure is directed to an isolated antibody that antagonizes human
- IL-27 or an antigen binding portion thereof, wherein the antibody or antigen binding portion thereof specifically binds to an epitope comprising one or more amino acids of (i) amino acids 37 to 56 corresponding to SEQ ID NO: 2 (IL-27p28), (ii) amino acids 142 to 164 corresponding to SEQ ID NO: 2 (IL-27p28), or (iii) both (i) and (ii).
- an isolated antibody of the disclosure that antagonizes human IL-27, or an antigen binding portion thereof, specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leu 156, Alai 57, Glyl59, Phel60, Asnl61, Leul62, Prol63, or Glul64 of SEQ ID NO: 2 (IL- 27p28).
- an antibody, or antigen binding portion thereof, of the present disclosure specifically binds to an epitope comprising Aspl46, Argl49, and/or Phel53 of SEQ ID NO: 2 (IL-27p28). In some aspects, an antibody, or antigen binding portion thereof, of the present disclosure specifically binds to an epitope comprising Aspl46, Argl49, and Phel53 of SEQ ID NO: 2 (IL-27p28). In some aspects, the epitope comprises Aspl46, Argl49, Hisl50, and Phel53 of SEQ ID NO: 2 (IL-27p28).
- the epitope comprises Aspl46, Argl49, Phel53, and Leul56 of SEQ ID NO: 2 (IL-27p28). In some aspects, the epitope comprises Aspl46, Argl49, Hisl50, Phel53, and Leul56 of SEQ ID NO: 2 (IL-27p28).
- an antibody, or antigen binding portion thereof, of the present disclosure specifically binds to an epitope comprising Leul42, Aspl46, Argl49, Hisl50, Phel53, Leul56, and Glul64of SEQ ID NO: 2 (IL-27p28).
- the epitope comprises Gln37, Leu38, Glu42, Aspl46, Argl49, Hisl50, Phel53, and Leul56 of SEQ ID NO: 2 (IL-27p28).
- an antibody, or antigen binding portion thereof, of the present disclosure specifically binds to an epitope comprising Gln37, Leu38, Glu42, Leul42, Aspl46, Argl49, Hisl50, Phel53, Leu 156, and Glul64 of SEQ ID NO: 2 (IL-27p28).
- an antibody, or antigen binding portion thereof, of the present disclosure specifically binds to an epitope comprising Leul42, Aspl46, Argl49, Hisl50, Phel53, Leul56, Leul62, and Glul64 of SEQ ID NO: 2 (IL-27p28).
- an antibody, or antigen binding portion thereof, of the present disclosure specifically binds to an epitope comprising Glu46, Val49, Ser50, Leul42, Aspl46, Argl49, Hisl50, Phel53, Leul56, and Glul64of SEQ ID NO: 2 (IL-27p28).
- an antibody, or antigen binding portion thereof, of the present disclosure specifically binds to an epitope comprising Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leul42, Aspl46, Argl49, Hisl50, Phel53, Leul56, Leul62, and Glul64 of SEQ ID NO: 2 (IL-27p28).
- an antibody, or antigen binding portion thereof, of the present disclosure specifically binds to an epitope consisting of or consisting essentially of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leul42, Aspl46, Argl49, Hisl50, Phel53, Leul56, Leul62, and Glut 64 of SEQ ID NO: 2 (IL-27p28).
- an antibody, or antigen binding portion thereof, of the present disclosure specifically binds to an epitope comprising Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu 142, Asp 146, Argl49, Hisl50, Phel53, Leul56, Leul62, and Glul64 of SEQ ID NO: 2 (IL- 27p28) and at least one residues selected from the group consisting of: Leu53, Lys56, Aspl43, Leu 147, Argl52, Alal57, Glyl59, Phel60, or Asnl61 of SEQ ID NO: 2 (IL-27p28).
- an antibody, or antigen binding portion thereof, of the present disclosure specifically binds to an epitope comprising Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu 142, Asp 146, Argl49, Hisl50, Phel53, Leul56, Leul62, and Glul64 of SEQ ID NO: 2 (IL- 27p28) and at least one residues selected from the group consisting of: Leu53, Lys56, Aspl43, Argl45, Leu 147, Argl52, Alal57, Glyl59, Phel60, Asnl61, or Prol63 of SEQ ID NO: 2 (IL- 27p28).
- an antibody, or antigen binding portion thereof, of the present disclosure specifically binds to an epitope consisting or consisting essentially of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leul62, and Glul64 of SEQ ID NO: 2 (IL-27p28).
- an antibody, or antigen binding portion thereof, of the present disclosure specifically binds to an epitope consisting or consisting essentially of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leul62, Prol63, and Glul64 of SEQ ID NO: 2 (IL-27p28).
- the disclosure provides an isolated antibody that specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leu 156, Alal57, Glyl59, Phel60, Asnl61, Leul62, Prol63, and Glul64 of SEQ ID NO: 2 (IL- 27p28) and antagonizes human IL-27, or an antigen binding portion thereof, wherein the antibody or antigen binding portion thereof exhibits at least one or more of the following properties: (i) binds to human IL-27 with an equilibrium dissociation constant (KD) of 15 nM or less; (ii) blocks binding of IL-27 to IL-27 receptor; (iii) inhibits or
- the isolated antibody, or antigen binding portion thereof binds to an epitope of one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leu 142, Aspl43, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alai 57, Glyl59, Phel60, Asnl61, Leul62, Prol63, and Glul64 of SEQ ID NO: 2 (human IL- 27p28) with an equilibrium dissociation constant (KD) of 15 nM or less.
- KD equilibrium dissociation constant
- the isolated antibody, or antigen binding portion thereof binds to recombinant human IL-27p28 or to murine IL-27p28.
- the isolated antibody, or antigen binding portion thereof inhibits or reduces STAT1 and/or STAT3 phosphorylation in a cell.
- the cell is an immune cell.
- the cell is a cancer cell.
- the isolated antibody, or antigen binding portion thereof inhibits or reduces inhibition of CD161 expression in a cell (e.g. ameliorates or relieves the inhibition of CD161 expression in a cell).
- the cell is an immune cell.
- the isolated antibody, or antigen binding portion thereof inhibits or reduces PD-L1 and/or TIM-3 expression in a cell.
- PD-L1 expression is inhibited or reduced.
- TIM-3 expression is inhibited or reduced.
- both PD-L1 expression and TIM-3 expression is reduced.
- the cell is an immune cell.
- the antibodies are monoclonal antibodies.
- the isolated antibody, or antigen binding portion thereof induces or enhances the PD-1 -mediated secretion of one or more cytokines from a cell.
- the one or more cytokines is TNFa.
- the one or more cytokine is IL-6.
- the one or more cytokine is TNFa and IL-6.
- the cell is an immune cell.
- the isolated antibody, or antigen binding portion thereof is selected from the group consisting of an IgGl, an IgG2, an IgG3, an IgG4, an IgM, an IgAl an IgA2, an IgD, and an IgE antibody.
- the antibody is an IgGl antibody or an IgG4 antibody. In some aspects, the antibody comprises a wild type IgGl heavy chain constant region. In some aspects, the antibody comprises a wild type IgG4 heavy chain constant region. In some aspects, the antibody comprises an Fc domain comprising at least one mutation. In some aspects, the antibody comprises a mutant IgGl heavy chain constant region. In some aspects, the antibody comprises a mutant IgG4 heavy chain constant region. In some aspects, the mutant IgG4 heavy chain constant region comprises any one of the substitutions S228P, L235E, L235A, or a combination thereof, according to EU numbering.
- the disclosure provides an isolated antibody, or antigen binding portion thereof, that binds to substantially the same epitope on IL-27 as the antibody, or antigen binding portion thereof, according to any one of the aforementioned aspects.
- the disclosure provides an isolated antibody, or antigen binding portion thereof, that binds to at least one of the amino acid residues selected from the group consisting of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Argl45, Asp 146, Leu 147, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leu 162, Pro 163, and Glul64 of SEQ ID NO: 2 (IL-27p28) bound by the antibody, or antigen binding portion thereof, according to any one of the aforementioned aspects.
- the disclosure provides an isolated antibody, or antigen binding portion thereof, wherein a mutation of the epitope (Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leu 156, Alal57, Glyl59, Phel60, Asnl61, Leul62, Prol63, and Glul64 of SEQ ID NO: 2 (IL- 27p28)) bound by the antibody or antigen binding portion thereof inhibits, reduces, or blocks binding to both the antibody or antigen binding portion thereof and to the antibody or antigen binding portion thereof according to any one of the aforementioned aspects.
- a mutation of the epitope (Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Argl
- the antibody, or antigen binding portion thereof comprises heavy chain CDR1, heavy chain CDR2, heavy chain CDR3, light chain CDR1, light chain CDR2, and light chain CDR3, wherein light chain CDR1 consists of N-XXXXXLFSSNXKXYXX-C.
- the antibody, or antigen binding portion thereof comprises heavy chain CDR1, heavy chain CDR2, heavy chain CDR3, light chain CDR1, light chain CDR2, and light chain CDR3, wherein light chain CDR3 consists of N-XXXASAXXX-C.
- the antibody, or antigen binding portion thereof comprises heavy chain CDR1, heavy chain CDR2, heavy chain CDR3, light chain CDR1, light chain CDR2, and light chain CDR3, wherein heavy chain CDR2 consists of N-XXSSSXSYXYXXXXXX-C.
- the antibody, or antigen binding portion thereof comprises heavy chain CDR1, heavy chain CDR2, heavy chain CDR3, light chain CDR1, light chain CDR2, and light chain CDR3, wherein heavy chain CDR3 consists of N- XXXXGRTSYTATXHNXXXX-C, wherein X is any amino acids.
- the antibody, or antigen binding portion thereof comprises heavy chain CDR1, heavy chain CDR2, heavy chain CDR3, light chain CDR1, light chain CDR2, and light chain CDR3, wherein light chain CDR1 consists of N-XXXXXXLFSSNXKXYXX-C and light chain CDR3 consists of N-XXXASAXXX-C.
- the antibody, or antigen binding portion thereof comprises heavy chain CDR1, heavy chain CDR2, heavy chain CDR3, light chain CDR1, light chain CDR2, and light chain CDR3, wherein heavy chain CDR2 consists of N-XXSSSXSYXYXXXXXX-C and heavy chain CDR3 consists of N- XXXXGRTSYTATXHNXXXX-C, wherein X is any amino acids.
- the antibody, or antigen binding portion thereof comprises heavy chain CDR1, heavy chain CDR2, heavy chain CDR3, light chain CDR1, light chain CDR2, and light chain CDR3, wherein light chain CDR1 consists of N-XXXXXXLFSSNXKXYXX-C, light chain CDR3 consists of N-XXXASAXXX-C, heavy chain CDR2 consists of N- XXSSSXSYXYXXXXXXX-C, and heavy chain CDR3 consists of N- XXXXGRTSYTATXHNXXXX-C, wherein X is any amino acids.
- the present disclosure provides an isolated antibody or antigen binding portion thereof that specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Argl45, Aspl46, Leu 147, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leul62, Pro 163, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof does not comprise heavy and light chain CDRs selected from the group consisting of:
- the present disclosure provides an isolated antibody or antigen binding portion thereof that specifically binds to an epitope comprising or consisting of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leul42, Aspl46, Argl49, Hisl50, Phel53, Leul56, Leul62, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof does not comprise heavy and light chain CDRs selected from the group consisting of:
- the present disclosure provides an isolated antibody or antigen binding portion thereof that specifically binds to an epitope comprising or consisting of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leul62, Prol63, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof does not comprise heavy and light chain CDRs selected from the group consisting of:
- the present disclosure provides an isolated antibody or antigen binding portion thereof that specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Argl45, Aspl46, Leu 147, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leul62, Pro 163, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof does not comprise heavy and light chain CDRs selected from the group consisting of:
- the present disclosure provides an isolated antibody or antigen binding portion thereof that specifically binds to an epitope comprising or consisting of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leul42, Aspl46, Argl49, Hisl50, Phel53, Leul56, Leul62, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof does not comprise heavy and light chain CDRs selected from the group consisting of:
- the present disclosure provides an isolated antibody or antigen binding portion thereof that specifically binds to an epitope comprising or consisting of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leul62, Prol63, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof does not comprise heavy and light chain CDRs selected from the group consisting of:
- the present disclosure provides an isolated antibody or antigen binding portion thereof that specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Argl45, Aspl46, Leu 147, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leul62, Pro 163, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof comprises a heavy chain CDR1, a heavy chain CDR2, a heavy chain CDR3, a light chain CDR1, a light chain CDR2, and a light chain CDR3 and wherein the heavy chain CDR1 does not consist of N-GFTF[S/A/R] [S/R] [T/Y] [G/S]
- the present disclosure provides an isolated antibody or antigen binding portion thereof that specifically binds to an epitope comprising or consisting of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leul42, Aspl46, Argl49, Hisl50, Phel53, Leul56, Leul62, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof comprises a heavy chain CDR1, a heavy chain CDR2, a heavy chain CDR3, a light chain CDR1, a light chain CDR2, and a light chain CDR3 and wherein the heavy chain CDR1 does not consist of N-GFTF[S/A/R] [S/R] [T/Y] [G/S]-C (SEQ ID NO: 144) and/or the heavy chain CDR2 does not consist of N-ISSS[S/G][S/A]YI-C (SEQ ID NO: 146).
- the present disclosure provides an isolated antibody or antigen binding portion thereof that specifically binds to an epitope comprising or consisting of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leul62, Prol63, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof comprises a heavy chain CDR1, a heavy chain CDR2, a heavy chain CDR3, a light chain CDR1, a light chain CDR2, and a light chain CDR3 and wherein the heavy chain CDR1 does not consist of N-GFTF[S/A/R] [S/R] [T/Y] [G/S]-C
- the present disclosure provides an isolated antibody or antigen binding portion thereof that specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Argl45, Aspl46, Leu 147, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leul62, Pro 163, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof comprises a heavy chain CDR1, a heavy chain CDR2, a heavy chain CDR3, a light chain CDR1, a light chain CDR2, and a light chain CDR3 and wherein the heavy chain CDR1 does not comprise N-FTF[S/A/R][S/R][T/Y][G/S]M
- the present disclosure provides an isolated antibody or antigen binding portion thereof that specifically binds to an epitope comprising or consisting of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leul42, Aspl46, Argl49, Hisl50, Phel53, Leul56, Leul62, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof comprises a heavy chain CDR1, a heavy chain CDR2, a heavy chain CDR3, a light chain CDR1, a light chain CDR2, and a light chain CDR3 and wherein the heavy chain CDR1 does not comprise N-FTF[S/A/R][S/R][T/Y][G/S]MN-C (SEQ ID NO: 148) and/or the heavy chain CDR2 does not comprise N-[G/S]ISSS[S/G][S/A]YI[L/Y]YADSV
- the present disclosure provides an isolated antibody or antigen binding portion thereof that specifically binds to an epitope comprising or consisting of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leul62, Prol63, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof comprises a heavy chain CDR1, a heavy chain CDR2, a heavy chain CDR3, a light chain CDR1, a light chain CDR2, and a light chain CDR3 and wherein the heavy chain CDR1 does not comprise N-FTF[S/A/R][S/R][T/Y][G/S]MN-
- the present disclosure provides an isolated antibody or antigen binding portion thereof that specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Argl45, Aspl46, Leu 147, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leul62, Pro 163, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof does not comprise: (i) heavy chain CDR1 consisting of N-GFTFXXXX-C (SEQ ID NO: 145), heavy chain CDR2 consisting of N-ISSSXXYI-C (SEQ ID NO: 147), and heavy chain CDR3 sequence set forth in SEQ ID NO: 121; and light chain C
- heavy chain CDR1 consisting of N-FTFXXXXMN-C (SEQ ID NO: 150), heavy chain CDR2 consisting of N-XISSSXXYIXYADSVKG-C (SEQ ID NO: 151), and heavy chain CDR3 sequence set forth in SEQ ID NO: 124; and light chain CDR1, CDR2 and CDR3 sequences set forth in SEQ ID NOs: 130, 131 and 132, respectively.
- the present disclosure provides an isolated antibody or antigen binding portion thereof that specifically binds to an epitope comprising or consisting of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leul42, Aspl46, Argl49, Hisl50, Phel53, Leul56, Leul62, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof does not comprise:
- heavy chain CDR1 consisting of N-GFTFXXXX-C (SEQ ID NO: 145), heavy chain CDR2 consisting of N-ISSSXXYI-C (SEQ ID NO: 147), and heavy chain CDR3 sequence set forth in SEQ ID NO: 121; and light chain CDR1, CDR2 and CDR3 sequences set forth in SEQ ID NOs: 127, 128 and 129, respectively; or
- heavy chain CDR1 consisting of N-FTFXXXXMN-C (SEQ ID NO: 150), heavy chain CDR2 consisting of N-XISSSXXYIXYADSVKG-C (SEQ ID NO: 151), and heavy chain CDR3 sequence set forth in SEQ ID NO: 124; and light chain CDR1, CDR2 and CDR3 sequences set forth in SEQ ID NOs: 130, 131 and 132, respectively.
- the present disclosure provides an isolated antibody or antigen binding portion thereof that specifically binds to an epitope comprising or consisting of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leul62, Prol63, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof does not comprise:
- heavy chain CDR1 consisting of N-GFTFXXXX-C (SEQ ID NO: 145), heavy chain CDR2 consisting of N-ISSSXXYI-C (SEQ ID NO: 147), and heavy chain CDR3 sequence set forth in SEQ ID NO: 121; and light chain CDR1, CDR2 and CDR3 sequences set forth in SEQ ID NOs: 127, 128 and 129, respectively; or (ii) heavy chain CDR1 consisting of N-FTFXXXXMN-C (SEQ ID NO: 150), heavy chain CDR2 consisting of N-XISSSXXYIXYADSVKG-C (SEQ ID NO: 151), and heavy chain CDR3 sequence set forth in SEQ ID NO: 124; and light chain CDR1, CDR2 and CDR3 sequences set forth in SEQ ID NOs: 130, 131 and 132, respectively.
- the present disclosure provides an isolated antibody or antigen binding portion thereof that antagonizes IL-27 and specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Asp 143, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leu 162, Pro 163, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof comprises heavy and light chain variable regions, wherein the heavy chain variable region does not comprise an amino acid sequence selected from the group consisting of SEQ ID NOs: 15, 37, 59, 81, 103, and 125; and wherein the light chain variable region does not comprise an amino acid sequence selected from the group consisting of SEQ ID NOs: 15, 37
- the present disclosure provides an isolated antibody or antigen binding portion thereof that antagonizes IL-27 and specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Asp 143, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leu 162, Pro 163, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof comprises heavy and light chain variable regions, wherein the heavy chain variable region and the light chain variable region are not amino acid sequences selected from the group consisting of:
- the present disclosure provides an isolated antibody or antigen binding portion thereof that antagonizes IL-27 and specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Asp 143, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leu 162, Pro 163, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof comprises heavy and light chain variable regions, wherein the heavy chain variable region does not comprise an amino acid sequence which is at least 90% identical to the amino acid sequence selected from the group consisting of SEQ ID NOs: 15, 37, 59, 81, 103, and 125; and wherein the light chain variable region does not comprise an epitope comprising one or
- the present disclosure provides an isolated antibody or antigen binding portion thereof that antagonizes IL-27 and specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Asp 143, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leu 162, Pro 163, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof comprises heavy and light chain variable regions, wherein the heavy chain variable region and the light chain variable region do not comprise amino acid sequences at least 90% identical to the amino acid sequences selected from the group consisting of:
- the present disclosure provides an isolated antibody or antigen binding portion thereof that antagonizes IL-27 and specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Asp 143, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leu 162, Pro 163, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof comprises a heavy chain and a light chain, wherein the heavy chain does not comprise an amino acid sequence selected from the group consisting of SEQ ID NOs: 25,47, 69, 91, 113, and 135; and wherein the light chain does not comprise an amino acid sequence selected from the group consisting of SEQ
- the present disclosure provides an isolated antibody or antigen binding portion thereof that antagonizes IL-27 and specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Asp 143, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leu 162, Pro 163, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof comprises a heavy and a light chain, wherein the heavy chain does not comprise an amino acid sequence which is at least 90% identical to the amino acid sequence selected from the group consisting of SEQ ID NOs: 25,47, 69, 91, 113, and 135; and wherein the light chain does not comprise an amino acid
- the present disclosure provides an isolated antibody or antigen binding portion thereof that antagonizes IL-27 and specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Asp 143, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leu 162, Pro 163, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof comprises a heavy chain and a light chain, wherein the heavy chain does not comprise an amino acid sequence selected from the group consisting of SEQ ID NOs: 29, 51, 73, 95, 117, and 139; and wherein the light chain does not comprise an amino acid sequence selected from the group consisting of SEQ ID NOs:
- the present disclosure provides an isolated antibody or antigen binding portion thereof that antagonizes IL-27 and specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Asp 143, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leu 162, Pro 163, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof comprises a heavy and a light chain, wherein the heavy chain does not comprise an amino acid sequence which is at least 90% identical to the amino acid sequence selected from the group consisting of SEQ ID NOs: 29, 51, 73, 95, 117, and 139; and wherein the light chain does not comprise an amino acid sequence
- the present disclosure provides an isolated antibody or antigen binding portion thereof that antagonizes IL-27 and specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Asp 143, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leu 162, Pro 163, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof comprises a heavy chain and a light chain, and wherein the heavy chain and the light chain do not comprise amino acid sequences selected from the group consisting of:
- the present disclosure provides an isolated antibody or antigen binding portion thereof that antagonizes IL-27 and specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Asp 143, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leu 162, Pro 163, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof comprises a heavy chain and a light chain and wherein the heavy chain and the light chain do not comprise amino acid sequences at least 90% identical to the amino acid sequences selected from the group consisting of:
- the present disclosure provides an isolated antibody or antigen binding portion thereof that antagonizes IL-27 and specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Asp 143, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leu 162, Pro 163, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof comprises a heavy and a light chain and wherein the heavy chain and the light chain do not comprise amino acid sequences selected from the group consisting of:
- the present disclosure provides an isolated antibody or antigen binding portion thereof that antagonizes IL-27 and specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Asp 143, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leul62, Prol63, and Glul64 of SEQ ID NO: 2 (IL27-p28), wherein the antibody or antigen binding portion thereof comprises a heavy and a light chain and wherein the heavy chain and the light chain do not comprise amino acid sequences at least 90% identical to the amino acid sequences selected from the group consisting of:
- the disclosure also features methods for producing any of the anti-IL-27 antibodies or antigen-binding fragments thereof described herein.
- methods for preparing an antibody described herein can include immunizing a subject (e.g., a non-human mammal) with an appropriate immunogen. Suitable immunogens for generating any of the antibodies described herein are set forth herein.
- a skilled artisan can immunize a suitable subject (e.g., a non-human mammal such as a rat, a mouse, a gerbil, a hamster, a dog, a cat, a pig, a goat, a horse, or a non-human primate) with IL-27.
- a suitable subject e.g., a non-human mammal such as a rat, a mouse, a gerbil, a hamster, a dog, a cat, a pig, a goat, a horse, or a non-human primate
- a full-length human IL-27p28 monomer polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 2 is used as the immunogen.
- a suitable subject e.g., a non-human mammal
- the immunogen can be administered to a subject (e.g., a non-human mammal) with an adjuvant.
- Adjuvants useful in producing an antibody in a subject include, but are not limited to, protein adjuvants; bacterial adjuvants, e.g., whole bacteria (BCG, Corynebacterium parvum or Salmonella minnesota ) and bacterial components including cell wall skeleton, trehalose dimycolate, monophosphoryl lipid A, methanol extractable residue (MER) of tubercle bacillus , complete or incomplete Freund’s adjuvant; viral adjuvants; chemical adjuvants, e.g., aluminum hydroxide, and iodoacetate and cholesteryl hemi succinate.
- protein adjuvants e.g., whole bacteria (BCG, Corynebacterium parvum or Salmonella minnesota ) and bacterial components including cell wall skeleton, trehalose dimycolate, monophosphoryl lipid A, methanol extractable residue (MER) of tubercle bacillus , complete or incomplete Freund’s adj
- the methods include preparing a hybridoma cell line that secretes a monoclonal antibody that binds to the immunogen.
- a suitable mammal such as a laboratory mouse is immunized with a IL-27 polypeptide as described above.
- Antibody-producing cells e.g., B cells of the spleen
- the cells can be fused in the presence of a fusion promoter such as, e.g., vaccinia virus or polyethylene glycol.
- the hybrid cells obtained in the fusion are cloned, and cell clones secreting the desired antibodies are selected.
- spleen cells of Balb/c mice immunized with a suitable immunogen can be fused with cells of the myeloma cell line PAI or the myeloma cell line Sp2/0-Ag 14.
- suitable culture medium which is supplemented with a selection medium, for example HAT medium, at regular intervals in order to prevent normal myeloma cells from overgrowing the desired hybridoma cells.
- the obtained hybrid cells are then screened for secretion of the desired antibodies, e.g., an antibody that binds to human IL-27 and
- the desired antibodies e.g., an antibody that binds to human IL-27 and
- a skilled artisan can identify an anti-IL-27 antibody from a non-immune biased library as described in, e.g., U.S. patent no. 6,300,064 (to Knappik et al.; Morphosys AG) and Schoonbroodt et al. (2005) Nucleic Acids Res 33(9):e81.
- the methods described herein can involve, or be used in conjunction with, e.g., phage display technologies, bacterial display, yeast surface display, eukaryotic viral display, mammalian cell display, and cell-free (e.g., ribosomal display) antibody screening techniques (see, e.g., Etz et al. (2001 ) J Bacteriol 183:6924-6935; Georgias (2000) Curr Opin Biotechnol 11_:450-454; Klemm et al. (2000) Microbiology 146:3025-3032; Kieke et al. (1997) Protein Eng 10:1303-1310; Yeung et al.
- phage display technologies e.g., phage display technologies, bacterial display, yeast surface display, eukaryotic viral display, mammalian cell display, and cell-free (e.g., ribosomal display) antibody screening techniques (see, e.g., Etz et al. (2001 ) J Bacterio
- phage display methods functional antibody domains are displayed on the surface of phage particles which carry the polynucleotide sequences encoding them.
- phage can be utilized to display antigen-binding domains of antibodies, such as Fab, Fv, or disulfide-bond stabilized Fv antibody fragments, expressed from a repertoire or combinatorial antibody library (e.g., human or murine).
- Phage used in these methods are typically filamentous phage such as fd and Ml 3.
- the antigen binding domains are expressed as a recombinantly fused protein to any of the phage coat proteins pill, pVIII, orpIX.
- phage display methods that can be used to make the immunoglobulins, or fragments thereof, described herein include those disclosed in Brinkman et al. (1995 ⁇ J Immunol Methods 182:41-50; Ames et al. (1995) J Immunol Methods 184:177-186; Kettleborough et al. (1994) Eur J Immunol 24:952-958; Persic et al. (1997) Gene 187:9-18; Burton et al. (1994) Advances in Immunology 57:191-280; and PCT publication nos.
- WO 90/02809 WO 91/10737, WO 92/01047, WO 92/18619, WO 93/11236, WO 95/15982, and WO 95/20401.
- Suitable methods are also described in, e.g., U.S. patent nos. 5,698,426; 5,223,409; 5,403,484; 5,580,717; 5,427,908; 5,750,753; 5,821,047; 5,571,698; 5,427,908; 5,516,637; 5,780,225; 5,658,727; 5,733,743 and 5,969,108.
- the phage display antibody libraries can be generated using mRNA collected from B cells from the immunized mammals.
- a splenic cell sample comprising B cells can be isolated from mice immunized with IL-27 polypeptide as described above.
- mRNA can be isolated from the cells and converted to cDNA using standard molecular biology techniques. See, e.g., Sambrook et al. (1989) "Molecular Cloning: A Laboratory Manual, 2 nd Edition," Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.; Harlow and Lane (1988), supra ; Benny K. C. Lo (2004), supra ; and Borrebaek (1995), supra.
- the cDNA coding for the variable regions of the heavy chain and light chain polypeptides of immunoglobulins are used to construct the phage display library. Methods for generating such a library are described in, e.g., Merz et al. (1995) J Neurosci Methods 62(l-2):213-9; Di Niro et al. (2005) Biochem J 388(Pt 3 ):889-894; and Engberg et al. (1995) Methods Mol Biol 51:355-376.
- a combination of selection and screening can be employed to identify an antibody of interest from, e.g., a population of hybridoma-derived antibodies or a phage display antibody library.
- Suitable methods are known in the art and are described in, e.g., Hoogenboom (1997) Trends in Biotechnology 15:62-70; Brinkman et al. (1995), supra ; Ames et al. (1995), supra ; Kettleborough et al. (1994), supra ; Persic et al. (1997), supra ; and Burton et al. (1994), supra.
- a plurality of phagemid vectors each encoding a fusion protein of a bacteriophage coat protein (e.g., pill, pVIII, or pIX of M13 phage) and a different antigen combining region are produced using standard molecular biology techniques and then introduced into a population of bacteria (e.g., E. coli).
- Expression of the bacteriophage in bacteria can, in some aspects, require use of a helper phage. In some aspects, no helper phage is required (see, e.g., Chasteen et al., (2006) Nucleic Acids Res 34(21):el45).
- Phage produced from the bacteria are recovered and then contacted to, e.g., a target antigen bound to a solid support (immobilized). Phage may also be contacted to antigen in solution, and the complex is subsequently bound to a solid support.
- a subpopulation of antibodies screened using the above methods can be characterized for their specificity and binding affinity for a particular antigen (e.g., human IL- 27p28) using any immunological or biochemical based method known in the art.
- a particular antigen e.g., human IL- 27p28
- immunological or biochemical based methods such as, but not limited to, an ELISA assay, SPR assays, immunoprecipitation assay, affinity chromatography, and equilibrium dialysis as described above.
- Immunoassays which can be used to analyze immuno-specific binding and cross-reactivity of the antibodies include, but are not limited to, competitive and non-competitive assay systems using techniques such as Western blots, RIA, ELISA (enzyme linked immunosorbent assay), "sandwich” immunoassays, immunoprecipitation assays, immunodiffusion assays, agglutination assays, complement-fixation assays, immunoradiometric assays, fluorescent immunoassays, and protein A immunoassays. Such assays are routine and well known in the art.
- nucleic acids encoding the CDRs can be chemically synthesized as described in, e.g., Shiraishi et al. (2007) Nucleic Acids Symposium Series 51( :129- 130 and U.S. Patent No. 6,995,259.
- the region of the nucleic acid sequence encoding the CDRs can be replaced with the chemically synthesized nucleic acids using standard molecular biology techniques.
- the 5’ and 3’ ends of the chemically synthesized nucleic acids can be synthesized to comprise sticky end restriction enzyme sites for use in cloning the nucleic acids into the nucleic acid encoding the variable region of the donor antibody.
- the anti-IL-27 antibodies described herein comprise an altered heavy chain constant region that has reduced (or no) effector function relative to its corresponding unaltered constant region.
- Effector functions involving the constant region of the anti-IL-27 antibody may be modulated by altering properties of the constant or Fc region.
- Altered effector functions include, for example, a modulation in one or more of the following activities: antibody- dependent cellular cytotoxicity (ADCC), complement-dependent cytotoxicity (CDC), apoptosis, binding to one or more Fc-receptors, and pro-inflammatory responses.
- Modulation refers to an increase, decrease, or elimination of an effector function activity exhibited by a subject antibody containing an altered constant region as compared to the activity of the unaltered form of the constant region.
- modulation includes situations in which an activity is abolished or completely absent.
- the anti-IL-27 antibodies described herein comprise an IgG4 heavy chain constant region.
- the IgG4 heavy chain constant region is a wild type IgG4 heavy chain constant region.
- the IgG4 constant region comprises a mutation, e.g., one or both of S228P and L235E or L235A, e.g., according to EU numbering (Rabat, E. A., et al., supra).
- the anti-IL-27 antibodies described herein comprise an IgGl constant region.
- the IgGl heavy chain constant region is a wild type IgGl heavy chain constant region.
- the IgGl heavy chain constant region comprises a mutation.
- An altered constant region with altered FcR binding affinity and/or ADCC activity and/or altered CDC activity is a polypeptide which has either an enhanced or diminished FcR binding activity and/or ADCC activity and/or CDC activity compared to the unaltered form of the constant region.
- An altered constant region which displays increased binding to an FcR binds at least one FcR with greater affinity than the unaltered polypeptide.
- An altered constant region which displays decreased binding to an FcR binds at least one FcR with lower affinity than the unaltered form of the constant region.
- Such variants which display decreased binding to an FcR may possess little or no appreciable binding to an FcR, e.g., 0 to 50% (e.g., less than 50, 49, 48,
- an altered constant region that displays modulated ADCC and/or CDC activity may exhibit either increased or reduced ADCC and/or CDC activity compared to the unaltered constant region.
- the anti-IL-27 antibody comprising an altered constant region can exhibit approximately 0 to 50% (e.g., less than 50, 49, 48, 47, 46, 45, 44, 43,
- An anti-IL-27 antibody described herein comprising an altered constant region displaying reduced ADCC and/or CDC may exhibit reduced or no ADCC and/or CDC activity.
- an anti-IL-27 antibody described herein exhibits reduced or no effector function.
- an anti-IL-27 antibody comprises a hybrid constant region, or a portion thereof, such as a G2/G4 hybrid constant region (see e.g., Burton et al. (1992) Advlmmun 5L1-18; Canfield et al. (1991) J Exp Med 173:1483-1491; and Mueller et al. (1997) Mol Immunol 34(6):441-452). See above.
- an anti-IL-27 antibody may contain an altered constant region exhibiting enhanced or reduced complement dependent cytotoxicity (CDC).
- Modulated CDC activity may be achieved by introducing one or more amino acid substitutions, insertions, or deletions in an Fc region of the antibody. See, e.g., U.S. patent no. 6,194,551. Alternatively, or additionally, cysteine residue(s) may be introduced in the Fc region, thereby allowing interchain disulfide bond formation in this region.
- the homodimeric antibody thus generated may have improved or reduced internalization capability and/or increased or decreased complement- mediated cell killing. See, e.g., Caron et al.
- the antibodies or antigen-binding fragments thereof described herein can be produced using a variety of techniques known in the art of molecular biology and protein chemistry.
- a nucleic acid encoding one or both of the heavy and light chain polypeptides of an antibody can be inserted into an expression vector that contains transcriptional and translational regulatory sequences, which include, e.g., promoter sequences, ribosomal binding sites, transcriptional start and stop sequences, translational start and stop sequences, transcription terminator signals, polyadenylation signals, and enhancer or activator sequences.
- the regulatory sequences include a promoter and transcriptional start and stop sequences.
- the expression vector can include more than one replication system such that it can be maintained in two different organisms, for example in mammalian or insect cells for expression and in a prokaryotic host for cloning and amplification.
- Several possible vector systems are available for the expression of cloned heavy chain and light chain polypeptides from nucleic acids in mammalian cells.
- One class of vectors relies upon the integration of the desired gene sequences into the host cell genome.
- Cells which have stably integrated DNA can be selected by simultaneously introducing drug resistance genes such as E. coli gpt (Mulligan and Berg (1981) Proc Natl Acad Sci USA 78:2072) or Tn5 neo (Southern and Berg ( 1982) Mol Appl Genet 1:327).
- the selectable marker gene can be either linked to the DNA gene sequences to be expressed or introduced into the same cell by co-transfection (Wigler et al. (1979) Cell 16:77).
- a second class of vectors utilizes DNA elements which confer autonomously replicating capabilities to an extrachromosomal plasmid.
- These vectors can be derived from animal viruses, such as bovine papillomavirus (Sarver et al. (1982) Proc Natl Acad Sci USA , 79:7147), cytomegalovirus, polyoma virus (Deans et al. (1984) Proc Natl Acad Sci USA 81:1292), or SV40 virus (Lusky and Botchan (1981) Nature 293:79).
- the expression vectors can be introduced into cells in a manner suitable for subsequent expression of the nucleic acid.
- the method of introduction is largely dictated by the targeted cell type, discussed below. Exemplary methods include CaPCri precipitation, liposome fusion, cationic liposomes, electroporation, viral infection, dextran-mediated transfection, polybrene-mediated transfection, protoplast fusion, and direct microinjection.
- Appropriate host cells for the expression of antibodies or antigen-binding fragments thereof include yeast, bacteria, insect, plant, and mammalian cells. Of particular interest are bacteria such as E. coli , fungi such as Saccharomyces cerevisiae and Pichia pastoris, insect cells such as SF9, mammalian cell lines (e.g., human cell lines), as well as primary cell lines.
- an antibody or fragment thereof can be expressed in, and purified from, transgenic animals (e.g., transgenic mammals).
- transgenic animals e.g., transgenic mammals
- an antibody can be produced in transgenic non-human mammals (e.g., rodents) and isolated from milk as described in, e.g., Houdebine (2002) Curr Opin Biotechnol 13(6):625-629; van Kuik-Romeijn et al. (2000) Transgenic Res 9(2): 155-159; and Pollock et al. (1999) J Immunol Methods 231(1-2): 147-157.
- the antibodies and fragments thereof can be produced from the cells by culturing a host cell transformed with the expression vector containing nucleic acid encoding the antibodies or fragments, under conditions, and for an amount of time, sufficient to allow expression of the proteins.
- Such conditions for protein expression will vary with the choice of the expression vector and the host cell and will be easily ascertained by one skilled in the art through routine experimentation.
- antibodies expressed in E. coli can be refolded from inclusion bodies (see, e.g., Hou et al. (1998) Cytokine 10:319-30).
- an antibody or fragment thereof can be isolated or purified in a variety of ways known to those skilled in the art depending on what other components are present in the sample.
- Standard purification methods include electrophoretic, molecular, immunological, and chromatographic techniques, including ion exchange, hydrophobic, affinity, and reverse-phase HPLC chromatography.
- an antibody can be purified using a standard anti-antibody column (e.g., a protein-A or protein-G column). Ultrafiltration and diafiltration techniques, in conjunction with protein concentration, are also useful. See, e.g., Scopes (1994) "Protein Purification, 3 rd edition," Springer- Verlag, New York City, New York.
- Methods for determining the yield or purity of a purified antibody or fragment thereof include, e.g., Bradford assay, UV spectroscopy, Biuret protein assay, Lowry protein assay, amido black protein assay, high pressure liquid chromatography (HPLC), mass spectrometry (MS), and gel electrophoretic methods (e.g., using a protein stain such as Coomassie Blue or colloidal silver stain).
- the antibodies or antigen-binding fragments thereof can be modified following their expression and purification.
- the modifications can be covalent or non-covalent modifications.
- Such modifications can be introduced into the antibodies or fragments by, e.g., reacting targeted amino acid residues of the polypeptide with an organic derivatizing agent that is capable of reacting with selected side chains or terminal residues.
- Suitable sites for modification can be chosen using any of a variety of criteria including, e.g., structural analysis or amino acid sequence analysis of the antibodies or fragments.
- the antibodies or antigen-binding fragments thereof can be conjugated to a heterologous moiety.
- the heterologous moiety can be, e.g., a heterologous polypeptide, a therapeutic agent (e.g., a toxin or a drug), or a detectable label such as, but not limited to, a radioactive label, an enzymatic label, a fluorescent label, a heavy metal label, a luminescent label, or an affinity tag such as biotin or streptavidin.
- Suitable heterologous polypeptides include, e.g., an antigenic tag (FLAG (DYKDDDDK (SEQ ID NO: 141)), polyhistidine (6-His; HHHHHH (SEQ ID NO: 142), hemagglutinin (HA; YPYDVPDYA (SEQ ID NO: 143)), glutathione-S-transferase (GST), or maltose-binding protein (MBP)) for use in purifying the antibodies or fragments.
- FLAG DYKDDDDK
- polyhistidine 6-His
- HHHHHHHH SEQ ID NO: 142
- hemagglutinin HA
- YPYDVPDYA SEQ ID NO: 143
- GST glutathione-S-transferase
- MBP maltose-binding protein
- Heterologous polypeptides also include polypeptides (e.g., enzymes) that are useful as diagnostic or detectable markers, for example, luciferase, a fluorescent protein (e.g., green fluorescent protein (GFP)), or chloramphenicol acetyl transferase (CAT).
- Suitable radioactive labels include, e.g., 32 P, 33 P, 14 C, 125 I, 131 I, 35 S, and 3 H.
- Suitable fluorescent labels include, without limitation, fluorescein, fluorescein isothiocyanate (FITC), green fluorescent protein (GFP), DyLightTM 488, phycoerythrin (PE), propidium iodide (PI), PerCP, PE-Alexa Fluor® 700, Cy5, allophycocyanin, and Cy7.
- Luminescent labels include, e.g., any of a variety of luminescent lanthanide (e.g., europium or terbium) chelates.
- suitable europium chelates include the europium chelate of diethylene triamine pentaacetic acid (DTP A) or tetraazacyclododecane-l,4,7,10-tetraacetic acid (DOTA).
- Enzymatic labels include, e.g., alkaline phosphatase, CAT, luciferase, and horseradish peroxidase.
- Two proteins can be cross-linked using any of a number of known chemical cross linkers.
- cross linkers are those which link two amino acid residues via a linkage that includes a "hindered" disulfide bond.
- a disulfide bond within the cross-linking unit is protected (by hindering groups on either side of the disulfide bond) from reduction by the action, for example, of reduced glutathione or the enzyme disulfide reductase.
- SMPT 4-succinimidyloxycarbonyl-a-methyl- a(2-pyridyldithio) toluene
- cross linkers include, without limitation, reagents which link two amino groups (e.g., N-5-azido-2- nitrobenzoyloxysuccinimide), two sulfhydryl groups (e.g., 1,4-bis-maleimidobutane), an amino group and a sulfhydryl group (e.g., m-maleimidobenzoyl-N-hydroxysuccinimide ester), an amino group and a carboxyl group (e.g., 4-[p-azidosalicylamido]butylamine), and an amino group and a guanidinium group that is present in the side chain of arginine (e.g., p-azidophenyl glyoxal monohydrate).
- reagents which link two amino groups e.g., N-5-azido-2- nitrobenzoyloxysuccinimide
- two sulfhydryl groups e.g.
- a radioactive label can be directly conjugated to the amino acid backbone of the antibody.
- the radioactive label can be included as part of a larger molecule (e.g., 125 I in meta-[ 125 I]iodophenyl-N-hydroxysuccinimide ([ 125 I]mIPNHS) which binds to free amino groups to form meta-iodophenyl (mIP) derivatives of relevant proteins (see, e.g., Rogers et al. (1997) J Nucl Med 38:1221-1229) or chelate (e.g., to DOTA or DTP A) which is in turn bound to the protein backbone.
- a larger molecule e.g., 125 I in meta-[ 125 I]iodophenyl-N-hydroxysuccinimide ([ 125 I]mIPNHS) which binds to free amino groups to form meta-iodophenyl (mIP) derivatives of relevant proteins (see, e.g
- fluorophore to a protein (e.g., an antibody) are known in the art of protein chemistry.
- fluorophores can be conjugated to free amino groups (e.g., of lysines) or sulfhydryl groups (e.g., cysteines) of proteins using succinimidyl (NHS) ester or tetrafluorophenyl (TFP) ester moieties attached to the fluorophores.
- the fluorophores can be conjugated to a heterobifunctional cross-linker moiety such as sulfo-SMCC.
- Suitable conjugation methods involve incubating an antibody protein, or fragment thereof, with the fluorophore under conditions that facilitate binding of the fluorophore to the protein. See, e.g., Welch and Redvanly (2003) “Handbook of Radiopharmaceuticals: Radiochemistry and Applications,” John Wiley and Sons (ISBN 0471495603).
- the antibodies or fragments can be modified, e.g., with a moiety that improves the stabilization and/or retention of the antibodies in circulation, e.g., in blood, serum, or other tissues.
- the antibody or fragment can be PEGylated as described in, e.g., Lee et al. (1999) Bioconjug Chem 10(6): 973-8; Kinstler et al. (2002) Advanced Drug Deliveries Reviews 54:477-485; and Roberts et al. (2002) Advanced Drug Delivery Reviews 54:459-476 or HESylated (Fresenius Kabi, Germany; see, e.g., Pavisic et al.
- the stabilization moiety can improve the stability, or retention of, the antibody (or fragment) by at least 1.5 (e.g., at least 2, 5, 10, 15, 20, 25, 30, 40, or 50 or more) fold.
- the antibodies or antigen-binding fragments thereof described herein can be glycosylated.
- an antibody or antigen-binding fragment thereof described herein can be subjected to enzymatic or chemical treatment, or produced from a cell, such that the antibody or fragment has reduced or absent glycosylation.
- Methods for producing antibodies with reduced glycosylation are known in the art and described in, e.g., U.S. patent no. 6,933,368; Wright et al. (1991) EMBO J 10(10):2717-2723; and Co et al. (1993) Mol Immunol 30:1361.
- the invention provides for a pharmaceutical composition
- a pharmaceutical composition comprising an anti-IL-27 antibody with a pharmaceutically acceptable diluent, carrier, solubilizer, emulsifier, preservative and/or adjuvant.
- acceptable formulation materials preferably are nontoxic to recipients at the dosages and concentrations employed.
- the formulation material(s) are for s.c. and/or I.V. administration.
- the pharmaceutical composition can contain formulation materials for modifying, maintaining or preserving, for example, the pH, osmolality, viscosity, clarity, color, isotonicity, odor, sterility, stability, rate of dissolution or release, adsorption or penetration of the composition.
- suitable formulation materials include, but are not limited to, amino acids (such as glycine, glutamine, asparagine, arginine or lysine); antimicrobials; antioxidants (such as ascorbic acid, sodium sulfite or sodium hydrogen- sulfite); buffers (such as borate, bicarbonate, Tris-HCl, citrates, phosphates or other organic acids); bulking agents (such as mannitol or glycine); chelating agents (such as ethylenediamine tetraacetic acid (EDTA)); complexing agents (such as caffeine, polyvinylpyrrolidone, beta-cyclodextrin or hydroxypropyl-beta- cyclodextrin); fillers; monosaccharides; disaccharides; and other carbohydrates (such as glucose, mannose or dextrins); proteins (such as serum albumin, gelatin or immunoglobulins); coloring, flavoring and diluting agents; emulsifying agents
- the formulation comprises PBS; 20 mM NaOAC, pH 5.2, 50 mM NaCl; and/or 10 mM NAOAC, pH 5.2, 9% Sucrose.
- the optimal pharmaceutical composition will be determined by one skilled in the art depending upon, for example, the intended route of administration, delivery format and desired dosage. See, for example, Remington's Pharmaceutical Sciences, supra. In certain aspects, such compositions may influence the physical state, stability, rate of in vivo release and/or rate of in vivo clearance of the anti-IL-27 antibody.
- the primary vehicle or carrier in a pharmaceutical composition can be either aqueous or non-aqueous in nature.
- a suitable vehicle or carrier can be water for injection, physiological saline solution or artificial cerebrospinal fluid, possibly supplemented with other materials common in compositions for parenteral administration.
- the saline comprises isotonic phosphate-buffered saline.
- neutral buffered saline or saline mixed with serum albumin are further exemplary vehicles.
- pharmaceutical compositions comprise Tris buffer of about pH 7.0-8.5, or acetate buffer of about pH 4.0-5.5, which can further include sorbitol or a suitable substitute therefore.
- a composition comprising an anti-IL-27 antibody can be prepared for storage by mixing the selected composition having the desired degree of purity with optional formulation agents (Remington's Pharmaceutical Sciences, supra) in the form of a lyophilized cake or an aqueous solution. Further, in certain aspects, a composition comprising an anti-IL-27 antibody can be formulated as a lyophilizate using appropriate excipients such as sucrose.
- the pharmaceutical composition can be selected for parenteral delivery.
- the compositions can be selected for inhalation or for delivery through the digestive tract, such as orally.
- the preparation of such pharmaceutically acceptable compositions is within the ability of one skilled in the art.
- the formulation components are present in concentrations that are acceptable to the site of administration.
- buffers are used to maintain the composition at physiological pH or at a slightly lower pH, typically within a pH range of from about 5 to about 8.
- a therapeutic composition when parenteral administration is contemplated, can be in the form of a pyrogen-free, parenterally acceptable aqueous solution comprising an anti-IL-27 antibody, in a pharmaceutically acceptable vehicle.
- a vehicle for parenteral injection is sterile distilled water in which an anti-IL-27 antibody is formulated as a sterile, isotonic solution, and properly preserved.
- the preparation can involve the formulation of the desired molecule with an agent, such as injectable microspheres, bio-erodible particles, polymeric compounds (such as polylactic acid or polyglycolic acid), beads or liposomes, that can provide for the controlled or sustained release of the product which can then be delivered via a depot injection.
- hyaluronic acid can also be used, and can have the effect of promoting sustained duration in the circulation.
- implantable drug delivery devices can be used to introduce the desired molecule.
- a pharmaceutical composition can be formulated for inhalation.
- an anti-IL-27 antibody can be formulated as a dry powder for inhalation.
- an inhalation solution comprising an anti-IL-27 antibody can be formulated with a propellant for aerosol delivery.
- solutions can be nebulized. Pulmonary administration is further described in PCT application No. PCT/US94/001875, which describes pulmonary delivery of chemically modified proteins.
- formulations can be administered orally.
- an anti-IL-27 antibody that is administered in this fashion can be formulated with or without those carriers customarily used in the compounding of solid dosage forms such as tablets and capsules.
- a capsule can be designed to release the active portion of the formulation at the point in the gastrointestinal tract when bioavailability is maximized and pre systemic degradation is minimized.
- at least one additional agent can be included to facilitate absorption of an anti-IL-27 antibody.
- diluents, flavorings, low melting point waxes, vegetable oils, lubricants, suspending agents, tablet disintegrating agents, and binders can also be employed.
- a pharmaceutical composition can involve an effective quantity of an anti-IL-27 antibody in a mixture with non-toxic excipients which are suitable for the manufacture of tablets.
- suitable excipients include, but are not limited to, inert diluents, such as calcium carbonate, sodium carbonate or bicarbonate, lactose, or calcium phosphate; or binding agents, such as starch, gelatin, or acacia; or lubricating agents such as magnesium stearate, stearic acid, or talc.
- sustained-release preparations can include semipermeable polymer matrices in the form of shaped articles, e.g. films, or microcapsules.
- Sustained release matrices can include polyesters, hydrogels, polylactides (U.S. Pat. No. 3,773,919 and EP 058,481), copolymers of L-glutamic acid and gamma ethyl-L-glutamate (Sidman et al, Biopolymers, 22:547-556 (1983)), poly (2-hydroxyethyl-methacrylate) (Langer et ah, J. Biomed. Mater. Res., 15: 167-277 (1981) and Langer, Chem.
- sustained release compositions can also include liposomes, which can be prepared by any of several methods known in the art. See, e.g., Eppstein et al, Proc. Natl. Acad. Sci. USA, 82:3688-3692 (1985); EP 036,676; EP 088,046 and EP 143,949.
- the pharmaceutical composition to be used for in vivo administration typically is sterile. In certain aspects, this can be accomplished by filtration through sterile filtration membranes. In certain aspects, where the composition is lyophilized, sterilization using this method can be conducted either prior to or following lyophilization and reconstitution. In certain aspects, the composition for parenteral administration can be stored in lyophilized form or in a solution. In certain aspects, parenteral compositions generally are placed into a container having a sterile access port, for example, an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle.
- the pharmaceutical composition can be stored in sterile vials as a solution, suspension, gel, emulsion, solid, or as a dehydrated or lyophilized powder.
- such formulations can be stored either in a ready-to-use form or in a form (e.g., lyophilized) that is reconstituted prior to administration.
- kits are provided for producing a single-dose administration unit.
- the kit can contain both a first container having a dried protein and a second container having an aqueous formulation.
- kits containing single and multi- chambered pre-filled syringes e.g., liquid syringes and lyosyringes are included.
- the effective amount of a pharmaceutical composition comprising an anti-IL-27 antibody to be employed therapeutically will depend, for example, upon the therapeutic context and objectives.
- the appropriate dosage levels for treatment will thus vary depending, in part, upon the molecule delivered, the indication for which an anti-IL-27 antibody is being used, the route of administration, and the size (body weight, body surface or organ size) and/or condition (the age and general health) of the patient.
- the clinician can titer the dosage and modify the route of administration to obtain the optimal therapeutic effect.
- the frequency of dosing will take into account the pharmacokinetic parameters of an anti-IL-27 antibody in the formulation used.
- a clinician will administer the composition until a dosage is reached that achieves the desired effect.
- the composition can therefore be administered as a single dose or as two or more doses (which may or may not contain the same amount of the desired molecule) over time, or as a continuous infusion via an implantation device or catheter. Further refinement of the appropriate dosage is routinely made by those of ordinary skill in the art and is within the ambit of tasks routinely performed by them.
- appropriate dosages can be ascertained through use of appropriate dose-response data.
- the route of administration of the pharmaceutical composition is in accord with known methods, e.g. orally, through injection by intravenous, intraperitoneal, intracerebral (intra-parenchymal), intracerebroventricular, intramuscular, subcutaneously, intra ocular, intraarterial, intraportal, or intralesional routes; by sustained release systems or by implantation devices.
- the compositions can be administered by bolus injection or continuously by infusion, or by implantation device.
- individual elements of the combination therapy may be administered by different routes.
- the composition can be administered locally via implantation of a membrane, sponge or another appropriate material onto which the desired molecule has been absorbed or encapsulated.
- the device can be implanted into any suitable tissue or organ, and delivery of the desired molecule can be via diffusion, timed-release bolus, or continuous administration.
- it can be desirable to use a pharmaceutical composition comprising an anti-IL-27 antibody in an ex vivo manner. In such instances, cells, tissues and/or organs that have been removed from the patient are exposed to a pharmaceutical composition comprising an anti-IL-27 antibody after which the cells, tissues and/or organs are subsequently implanted back into the patient.
- an anti-IL-27 antibody can be delivered by implanting certain cells that have been genetically engineered, using methods such as those described herein, to express and secrete the polypeptides.
- such cells can be animal or human cells, and can be autologous, heterologous, or xenogeneic.
- the cells can be immortalized.
- the cells in order to decrease the chance of an immunological response, the cells can be encapsulated to avoid infiltration of surrounding tissues.
- the encapsulation materials are typically biocompatible, semi-permeable polymeric enclosures or membranes that allow the release of the protein product(s) but prevent the destruction of the cells by the patient's immune system or by other detrimental factors from the surrounding tissues.
- compositions described herein can be used in a number of diagnostic and therapeutic applications.
- detectably labeled antigen-binding molecules can be used in assays to detect the presence or amount of the target antigens in a sample (e.g., a biological sample).
- the compositions can be used in in vitro assays for studying inhibition of target antigen function.
- the compositions can be used as positive controls in assays designed to identify additional novel compounds that inhibit complement activity or otherwise are useful for treating a complement-associated disorder.
- a IL-27-inhibiting composition can be used as a positive control in an assay to identify additional compounds (e.g., small molecules, aptamers, or antibodies) that reduce or abrogate IL-27 production.
- additional compounds e.g., small molecules, aptamers, or antibodies
- the compositions can also be used in therapeutic methods as elaborated on below.
- the disclosure provides a method of detecting IL-27 in a biological sample or in a subject, comprising (i) contacting the sample or the subject (and optionally, a reference sample or subject) with any antibody described herein under conditions that allow interaction of the antibody molecule and IL-27 to occur, and (ii) detecting formation of a complex between the antibody molecule and the sample or the subject (and optionally, the reference sample or subject).
- kits can include an anti-IL-27 antibody as disclosed herein, and instructions for use.
- the kits may comprise, in a suitable container, an anti-IL-27 antibody, one or more controls, and various buffers, reagents, enzymes and other standard ingredients well known in the art.
- the disclosure provides a kit comprising an anti-IL-27 antibody or antigen-binding portion as disclosed herein, and instructions for use in stimulating an immune response in a subject, or treating cancer in a subject, optionally with instructions for use in combination with one or more additional therapeutic agents or procedure as disclosed herein.
- the container can include at least one vial, well, test tube, flask, bottle, syringe, or other container means, into which an anti-IL-27 antibody may be placed, and in some instances, suitably aliquoted.
- the kit can contain additional containers into which this component may be placed.
- the kits can also include a means for containing an anti-IL-27 antibody and any other reagent containers in close confinement for commercial sale.
- Such containers may include injection or blow-molded plastic containers into which the desired vials are retained.
- Containers and/or kits can include labeling with instructions for use and/or warnings. Methods of Use
- compositions of the present invention have numerous in vitro and in vivo utilities involving the detection and/or quantification of IL-27 and/or the antagonism of IL-27 function.
- the disclosure provides a method to inhibit or reduce STAT1 and/or STAT3 phosphorylation in a cell, the method comprising contacting the cell with an isolated antibody, or antigen binding fragment, provided by the disclosure, wherein the antibody, or antigen binding portion thereof, inhibits or reduces STAT1 and/or STAT3 phosphorylation in a cell.
- the disclosure provides a method to inhibit or reduce inhibition of
- CD 161 expression in a cell comprising contacting the cell with an isolated antibody, or antigen binding fragment, provided by the disclosure, wherein the antibody, or antigen binding portion thereof, inhibits or reduces inhibition of CD161 expression in a cell.
- the disclosure provides a method to inhibit or reduce PD-L1 and/or
- TIM-3 expression in a cell comprising contacting the cell with an isolated antibody, or antigen binding fragment, provided by the disclosure, wherein the antibody, or antigen binding portion thereof, inhibits or PD-L1 and/or TIM-3 expression in a cell.
- the disclosure provides a method to induce or enhance secretion of one or more cytokines from a cell, the method comprising contacting the cell with the isolated antibody, or antigen binding fragment, provided by the disclosure, wherein the antibody, or antigen binding portion thereof, induces or enhances PD-1 mediated secretion of one or more cytokines from a cell.
- the disclosure provides a method of stimulating an immune response in a subject, the method comprising administering to the subject an effective amount of an isolated antibody, or antigen binding portion thereof, that specifically binds to and antagonizes IL-27, provided by the disclosure, or a pharmaceutical composition comprising the antibody or antigen binding portion thereof, and a pharmaceutically acceptable carrier.
- the disclosure provides a method of treating a cancer in a subject, the method comprising administering to the subject an effective amount an isolated antibody, or antigen binding portion thereof, that specifically binds to and antagonizes IL-27, provided by the disclosure, or a pharmaceutical composition comprising the antibody or antigen binding portion thereof, and a pharmaceutically acceptable carrier.
- the disclosure provides a method of stimulating an immune response, or treating a cancer in a subject, the method comprising administering to the subject an effective amount of an isolated antibody, or antigen binding fragment, provided by the disclosure, or a pharmaceutical composition comprising the antibody or antigen binding portion thereof, and a pharmaceutically acceptable carrier, wherein the antibody, or antigen binding portion thereof, or the pharmaceutical composition, inhibits or reduces STAT1 and/or STAT3 phosphorylation in a cell, thereby stimulating the immune response, or treating the cancer.
- the disclosure provides a method of stimulating an immune response, or treating a cancer in a subject, the method comprising administering to the subject an effective amount of an isolated antibody, or antigen binding fragment, provided by the disclosure, or a pharmaceutical composition comprising the antibody or antigen binding portion thereof, and a pharmaceutically acceptable carrier, wherein the antibody, or antigen binding portion thereof, or the pharmaceutical composition, inhibits or reduces inhibition of CD161 expression in a cell, thereby stimulating the immune response, or treating the cancer.
- the disclosure provides a method of stimulating an immune response, or treating a cancer in a subject, the method comprising administering to the subject an effective amount of an isolated antibody, or antigen binding fragment, provided by the disclosure, or a pharmaceutical composition comprising the antibody or antigen binding portion thereof, and a pharmaceutically acceptable carrier, wherein the antibody, or antigen binding portion thereof, or the pharmaceutical composition, inhibits or reduces PD-L1 and/or TIM-3 expression in a cell, thereby stimulating the immune response, or treating the cancer.
- the disclosure provides a method of stimulating an immune response, or treating a cancer in a subject, the method comprising administering to the subject an effective amount of an isolated antibody, or antigen binding fragment, provided by the disclosure, or a pharmaceutical composition comprising the antibody or antigen binding portion thereof, and a pharmaceutically acceptable carrier, wherein the antibody, or antigen binding portion thereof, or the pharmaceutical composition, induces or enhances PD- 1 -mediated secretion of one or more cytokines from a cell, thereby stimulating the immune response, or treating the cancer.
- the cancer is chosen from lung cancer (e.g., non-small cell lung cancer), sarcoma, testicular cancer, ovarian cancer, pancreas cancer, breast cancer (e.g., triple negative breast cancer), melanoma, head and neck cancer (e.g., squamous head and neck cancer), colorectal cancer, bladder cancer, endometrial cancer, prostate cancer, thyroid cancer, hepatocellular carcinoma, gastric cancer, brain cancer, lymphoma (e.g., DL-BCL), leukemia (e.g., AML) or renal cancer (e.g., renal cell carcinoma, e.g., renal clear cell carcinoma).
- lung cancer e.g., non-small cell lung cancer
- sarcoma testicular cancer
- ovarian cancer pancreas cancer
- breast cancer e.g., triple negative breast cancer
- melanoma melanoma
- head and neck cancer e.g., squamous head and neck cancer
- compositions are useful in, inter alia , methods for treating or preventing a variety of cancers in a subject.
- the compositions can be administered to a subject, e.g., a human subj ect, using a variety of methods that depend, in part, on the route of administration.
- the route can be, e.g., intravenous injection or infusion (IV), subcutaneous injection (SC), intraperitoneal (IP) injection, intramuscular injection (IM), or intrathecal injection (IT).
- IV intravenous injection or infusion
- SC subcutaneous injection
- IP intraperitoneal
- IM intramuscular injection
- IT intrathecal injection
- the injection can be in a bolus or a continuous infusion.
- Administration can be achieved by, e.g., local infusion, injection, or by means of an implant.
- the implant can be of a porous, non-porous, or gelatinous material, including membranes, such as silastic membranes, or fibers.
- the implant can be configured for sustained or periodic release of the composition to the subject. See, e.g., U.S. Patent Application Publication No. 20080241223; U.S. Patent Nos. 5,501,856; 4,863,457; and 3,710,795; EP488401; and EP 430539, the disclosures of each of which are incorporated herein by reference in their entirety.
- composition can be delivered to the subject by way of an implantable device based on, e.g., diffusive, erodible, or convective systems, e.g., osmotic pumps, biodegradable implants, electrodiffusion systems, electroosmosis systems, vapor pressure pumps, electrolytic pumps, effervescent pumps, piezoelectric pumps, erosion-based systems, or electromechanical systems.
- an anti-IL-27 antibody or antigen-binding fragment thereof is therapeutically delivered to a subject by way of local administration.
- a suitable dose of an antibody or fragment thereof described herein, which dose is capable of treating or preventing cancer in a subject can depend on a variety of factors including, e.g., the age, sex, and weight of a subject to be treated and the particular inhibitor compound used. For example, a different dose of a whole anti-IL-27 antibody may be required to treat a subject with cancer as compared to the dose of a IL-27-binding Fab’ antibody fragment required to treat the same subject. Other factors affecting the dose administered to the subject include, e.g., the type or severity of the cancer.
- a subject having metastatic melanoma may require administration of a different dosage of an anti-IL-27 antibody than a subject with glioblastoma.
- Other factors can include, e.g., other medical disorders concurrently or previously affecting the subject, the general health of the subject, the genetic disposition of the subject, diet, time of administration, rate of excretion, drug combination, and any other additional therapeutics that are administered to the subject.
- a specific dosage and treatment regimen for any particular subject will also depend upon the judgment of the treating medical practitioner (e.g., doctor or nurse). Suitable dosages are described herein.
- a pharmaceutical composition can include a therapeutically effective amount of an anti-IL-27 antibody or antigen-binding fragment thereof described herein.
- Such effective amounts can be readily determined by one of ordinary skill in the art based, in part, on the effect of the administered antibody, or the combinatorial effect of the antibody and one or more additional active agents, if more than one agent is used.
- a therapeutically effective amount of an antibody or fragment thereof described herein can also vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the antibody (and one or more additional active agents) to elicit a desired response in the individual, e.g., reduction in tumor growth.
- a therapeutically effective amount of an anti-IL-27 antibody can inhibit (lessen the severity of or eliminate the occurrence of) and/or prevent a particular disorder, and/or any one of the symptoms of the particular disorder known in the art or described herein.
- a therapeutically effective amount is also one in which any toxic or detrimental effects of the composition are outweighed by the therapeutically beneficial effects.
- Suitable human doses of any of the antibodies or fragments thereof described herein can further be evaluated in, e.g., Phase I dose escalation studies. See, e.g., van Gurp et al. (2008) Am J Transplantation 8(8): 1711-1718; Hanouska et al. (2007) Clin Cancer Res 13(2, part 1): 523- 531; and Hetherington et al. (2006) Antimicrobial Agents and Chemotherapy 50(10): 3499-3500.
- the composition contains any of the antibodies or antigen-binding fragments thereof described herein and one or more (e.g., two, three, four, five, six, seven, eight, nine, 10, or 11 or more) additional therapeutic agents such that the composition as a whole is therapeutically effective.
- a composition can contain an anti-IL-27 antibody described herein and an alkylating agent, wherein the antibody and agent are each at a concentration that when combined are therapeutically effective for treating or preventing a cancer (e.g., melanoma) in a subject.
- Toxicity and therapeutic efficacy of such compositions can be determined by known pharmaceutical procedures in cell cultures or experimental animals (e.g., animal models of any of the cancers described herein). These procedures can be used, e.g., for determining the LDso (the dose lethal to 50% of the population) and the EDso (the dose therapeutically effective in 50% of the population). The dose ratio between toxic and therapeutic effects is the therapeutic index and it can be expressed as the ratio LD50/ED50. An antibody or antigen-binding fragment thereof that exhibits a high therapeutic index is preferred. While compositions that exhibit toxic side effects may be used, care should be taken to design a delivery system that targets such compounds to the site of affected tissue and to minimize potential damage to normal cells and, thereby, reduce side effects.
- the data obtained from the cell culture assays and animal studies can be used in formulating a range of dosage for use in humans.
- the dosage of such antibodies or antigen-binding fragments thereof lies generally within a range of circulating concentrations of the antibodies or fragments that include the ED 50 with little or no toxicity.
- the dosage may vary within this range depending upon the dosage form employed and the route of administration utilized.
- the therapeutically effective dose can be estimated initially from cell culture assays.
- a dose can be formulated in animal models to achieve a circulating plasma concentration range that includes the IC 50 (i.e., the concentration of the antibody which achieves a half-maximal inhibition of symptoms) as determined in cell culture.
- Such information can be used to more accurately determine useful doses in humans.
- Levels in plasma may be measured, for example, by high performance liquid chromatography.
- cell culture or animal modeling can be used to determine a dose required to achieve a therapeutically effective concentration within the local site.
- the methods can be performed in conjunction with other therapies for cancer.
- the composition can be administered to a subject at the same time, prior to, or after, radiation, surgery, targeted or cytotoxic chemotherapy, chemoradiotherapy, hormone therapy, immunotherapy, gene therapy, cell transplant therapy, precision medicine, genome editing therapy, or other pharmacotherapy.
- compositions described herein can be used to treat a variety of cancers such as but not limited to: Kaposi's sarcoma, leukemia, acute lymphocytic leukemia, acute myelocytic leukemia, myeloblasts promyelocyte myelomonocytic monocytic erythroleukemia, chronic leukemia, chronic myelocytic (granulocytic) leukemia, chronic lymphocytic leukemia, mantle cell lymphoma, primary central nervous system lymphoma, Burkitt’s lymphoma and marginal zone B cell lymphoma, Polycythemia vera Lymphoma, Hodgkin's disease, non-Hodgkin's disease, multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, solid tumors, sarcomas, and carcinomas, fibrosarcoma, mya thereof.
- an anti-IL-27 antibody, or antigen binding portion thereof, provided by the disclosure can be combined with one or more additional therapeutics or treatments, e.g., another therapeutic or treatment for a cancer.
- the anti-IL-27 antibody, or antigen binding portion thereof can be administered to a subject (e.g., a human patient) in combination with one or more additional therapeutics, wherein the combination provides a therapeutic benefit to a subject who has, or is at risk of developing, cancer.
- an anti-IL-27 antibody, or antigen binding portion thereof, and the one or more additional therapeutics are administered at the same time (e.g., simultaneously).
- the anti-IL-27 antibody, or antigen binding portion thereof is administered first in time and the one or more additional therapeutics are administered second in time (e.g., sequentially).
- the one or more additional therapeutics are administered first in time and the anti-IL-27 antibody is administered second in time.
- An anti-IL-27 antibody or an antigen-binding fragment thereof described herein can replace or augment a previously or currently administered therapy.
- administration of the one or more additional therapeutics can cease or diminish, e.g., be administered at lower levels.
- administration of the previous therapy can be maintained.
- a previous therapy will be maintained until the level of the anti-IL-27 antibody reaches a level sufficient to provide a therapeutic effect.
- the disclosure provides a method of treating cancer in a subject, the method comprising administering to the subject an effective amount of an isolated antibody, or antigen binding portion thereof, that specifically binds to and antagonizes IL-27, provided by the disclosure, in combination with one or more additional therapeutic agents or procedure, wherein the second therapeutic agent or procedure is selected from the group consisting of: a chemotherapy, a targeted anti-cancer therapy, an oncolytic drug, a cytotoxic agent, an immune-based therapy, a cytokine, surgical procedure, a radiation procedure, an activator of a costimulatory molecule, an inhibitor of an inhibitory molecule, a vaccine, or a cellular immunotherapy, or a combination thereof.
- the second therapeutic agent or procedure is selected from the group consisting of: a chemotherapy, a targeted anti-cancer therapy, an oncolytic drug, a cytotoxic agent, an immune-based therapy, a cytokine, surgical procedure, a radiation procedure, an activator of a costimulatory molecule, an
- the one or more additional therapeutic agents is a PD-1 antagonist, a TIM-3 inhibitor, a LAG-3 inhibitor, a TIGIT inhibitor, a CD112R inhibitor, a TAM inhibitor, a STING agonist, a 4- IBB agonist, or a combination thereof.
- the one or more additional therapeutic agents is a CD39 antagonist, a CD73 antagonist, a CCR8 antagonist, or a combination thereof.
- the anti-CD73 is any anti-CD73 antibody disclosed in, e.g. , U.S. Publication No. 2019/0031766 Al, which is incorporated by reference herein in its entirety.
- the anti-CD39 is any anti-CD39 antibody disclosed in, e.g., Int'l Publication No. WO 2019/178269 A2, which is incorporated by reference herein in its entirety.
- the one or more additional therapeutic agents is a PD-1 antagonist.
- the PD-1 antagonist is selected from the group consisting of: PDR001, nivolumab, pembrolizumab, pidilizumab, MEDI0680, REGN2810, TSR-042, PF-06801591, and AMP-224.
- the one or more additional therapeutic agents is a PD-L1 inhibitor.
- the PD-L1 inhibitor is selected from the group consisting of: FAZ053, Atezolizumab, Avelumab, Durvalumab, and BMS-936559.
- the disclosure provides a method of enhancing one or more activities of an anti-PD-1 antibody (e.g., enhances PD-l-mediated cytokine secretion; enhances anti-PD-1 mediated TNFa secretion; enhances anti-PD-1 mediated IL-6 secretion from a cell exposed to anti-PD-1 antibodies), the method comprising exposing a cell to an antibody, or antigen binding portion thereof, provided by the disclosure, concurrently with or sequentially to an anti-PD-1 antibody, thereby to enhance one or more activities of the anti-PDl antibody.
- an anti-PD-1 antibody e.g., enhances PD-l-mediated cytokine secretion; enhances anti-PD-1 mediated TNFa secretion; enhances anti-PD-1 mediated IL-6 secretion from a cell exposed to anti-PD-1 antibodies
- the one or more additional therapeutic agents is Sunitinib
- the one or more additional therapeutic agents is a TIM-3 inhibitor, optionally wherein the TIM-3 inhibitor is MGB453 or TSR-022.
- the one or more additional therapeutic agents is a LAG-3 inhibitor, optionally wherein the LAG-3 inhibitor is selected from the group consisting of LAG525, BMS- 986016, and TSR-033.
- the one or more additional therapeutic agents is a TIGIT inhibitor.
- the one or more additional therapeutic agents is a CD112R inhibitor. In some aspects, the one or more additional therapeutic agents is a TAM (Axl, Mer, Tyro) inhibitor. In some aspects, the one or more additional therapeutic agents is a STING agonist. In some aspects, the one or more additional therapeutic agents is a 4- IBB agonist.
- the one or more additional therapeutic agents is a tyrosine kinase inhibitor, an agent targeting the adenosine axis (for example a CD39 antagonist, a CD73 antagonist or a A2AR, A2BR or dual A2AR/A2BR antagonist), a CCR8 antagonist, a CTLA4 antagonist, a VEG-F inhibitor or a combination thereof.
- Chemotherapeutic agents suitable for combination and/or co-administration with compositions of the present invention include, for example: taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorubicin, daunorubicin, dihydroxyanthrancindione, mitoxantrone, mithramycin, actinomycin D, 1 -dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, and puromycin and analogs or homologs thereof.
- Further agents include, for example, antimetabolites (e.g., methotrexate, 6-mercaptopurine, 6-thioguanine, cytarabine, 5-fluorouracil decarbazine), alkylating agents (e.g., mechlorethamine, thioTEPA, chlorambucil, melphalan, carmustine (BSNU), lomustine (CCNU), cyclophosphamide, busulfan, dibromomannitol, streptozotocin, mitomycin C, cis-dichlordiamine platinum (II)(DDP), procarbazine, altretamine, cisplatin, carboplatin, oxaliplatin, nedaplatin, satraplatin, or triplatin tetranitrate), anthracycline (e.g., daunorubicin (formerly daunomycin) and doxorubicin), antibiotics (e.g., dact
- the anti-IL-27 antibodies, or antigen binding portions thereof, provided by the disclosure are combined (e.g., administered in combination) with one or more PD- 1 antagonist that specifically binds to human PD-1 or PD-L1 and inhibits PD-1/PD-L1 biological activity and/or downstream pathway(s) and/or cellular processed mediated by human PD-1/PD-L1 signaling or other human PD-l/PD-Ll-mediated functions.
- PD-1 antagonists that directly or allosterically block, antagonize, suppress, inhibit or reduce PD-1/PD-L1 biological activity, including downstream pathways and/or cellular processes mediated by PD-1/PD-L1 signaling, such as receptor binding and/or elicitation of a cellular response to PD-1/PD-L1. Also provided herein are PD-1 antagonists that reduce the quantity or amount of human PD-1 or PD-L1 produced by a cell or subject.
- the disclosure provides a PD-1 antagonist that binds human PD-1 and prevents, inhibits or reduces PD-L1 binding to PD-1.
- the PD-1 antagonist binds to the mRNA encoding PD-1 or PD-L1 and prevents translation.
- the PD-1 antagonist binds to the mRNA encoding PD-1 or PD-L1 and causes degradation and/or turnover.
- the PD-1 antagonist inhibits PD-1 signaling or function.
- the PD-1 antagonist blocks binding of PD-1 to PD-L1, PD-L2, or to both PD-L1 and PD- L2.
- the PD-1 antagonist blocks binding of PD-1 to PD-L1. In some aspects, the PD-1 antagonist blocks binding of PD-1 to PD-L2. In some aspects, the PD-1 antagonist blocks the binding of PD-1 to PD-L1 and PD-L2. In some aspects, the PD-1 antagonist specifically binds PD-1. In some aspects, the PD-1 antagonist specifically binds PD-L1. In some aspects, the PD-1 antagonist specifically binds PD-L2.
- the PD-1 antagonist inhibits the binding of PD-1 to its cognate ligand. In some aspects, the PD-1 antagonist inhibits the binding of PD-1 to PD-L1, PD-1 to PD- L2, or PD-1 to both PD-L1 and PD-L2. In some aspects, the PD-1 antagonist does not inhibit the binding of PD-1 to its cognate ligand.
- the PD-1 antagonist is an isolated antibody (mAh), or antigen binding fragment thereof, which specifically binds to PD-1 or PD-L1. In some aspects, the PD-1 antagonist is an antibody or antigen binding fragment thereof that specifically binds to human PD- 1. In some aspects, the PD-1 antagonist is an antibody or antigen binding fragment thereof that specifically binds to human PD-L1. In some aspects, the PD-1 antagonist is an antibody or antigen binding fragment that binds to human PD-L1 and inhibits the binding of PD-L1 to PD-1. In some aspects, the PD-1 antagonist is an antibody or antigen binding fragment that binds to human PD-1 and inhibits the binding of PD-L1 to PD-1.
- anti-human PD- 1 antibodies, or antigen binding fragments thereof, that may comprise the PD-1 antagonist in any of the compositions, methods, and uses provided by the disclosure include, but are not limited to: KEYTRUDA ® (pembrolizumab, MK-3475, h409Al l; see US8952136, US8354509, US8900587, and EP2170959, all of which are included herein by reference in their entirety; Merck), OPDIVO ® (nivolumab, BMS-936558, MDX-1106, ONO-4538; see US7595048, US8728474, US9073994, US9067999, EP1537878, US8008449, US8779105, and EP2161336, all of which are included herein by reference in their entirety; Bristol Myers Squibb), MEDI0680 (AMP-514), BGB-A317 and BGB-108 (BeiGene), 244C8 and 388D4
- Examples of anti -human PD-L1 antibodies, or antigen binding fragments thereof, that may comprise the PD-1 antagonist in any of the compositions, methods, and uses provided by the disclosure include, but are not limited to: BAVENCIO ® (avelumab, MSB0010718C, see WO20 13/79174, which is incorporated herein by reference in its entirety; Merck/Pfizer), IMFINZI ® (durvalumab, MEDI4736), TECENTRIQ ® (atezolizumab, MPDL3280A, RG7446; see W02010/077634, which is incorporated herein by reference in its entirety; Roche), MDX-1105 (BMS-936559, 12A4; seeUS7943743 and WO2013/173223, both of which are incorporated herein by reference in their entirety; Medarex/BMS), and FAZ053 (Novartis). Accordingly, in some aspects the PD-1 antagonist is avelumab. In some aspects the
- the PD-1 antagonist is an immunoadhesin that specifically bind to human PD-1 or human PD-L1, e.g., a fusion protein containing the extracellular or PD-1 binding portion of PD-L1 or PD-L2 fused to a constant region such as an Fc region of an immunoglobulin molecule.
- immunoadhesion molecules that specifically bind to PD-1 are described in W02010/027827 and WO2011/066342, both of which are incorporated herein by reference in their entirety.
- the PD-1 antagonist is AMP -224 (also known as B7-DCIg), which is a PD-L2-FC fusion protein that specifically binds to human PD-1.
- the PD-1/PD-L1 antagonist is a small molecule, a nucleic acid, a peptide, a peptide mimetic, a protein, a carbohydrate, a carbohydrate derivative, or a glycopolymer.
- exemplary small molecule PD-1 inhibitors are described in Zhan et al, (2016) Drug Discov Today 21(6):1027-1036.
- an anti-IL-27 antibody, or antigen binding portion thereof, provided by the disclosure is combined (e.g., administered in combination) with a TIM-3 inhibitor.
- the TIM-3 inhibitor may be an antibody, an antigen binding fragment thereof, an immunoadhesin, a fusion protein, or an oligopeptide.
- the TIM-3 inhibitor is chosen from MGB453 (Novartis), TSR-022 (Tesaro), or LY3321367 (Eli Lilly).
- the anti-IL-27 antibody, or antigen binding portion thereof is administered in combination with MGB453.
- the anti-IL-27 antibody, or antigen binding portion thereof is administered in combination with TSR-022.
- an anti-IL-27 antibody, or antigen binding portion thereof, provided by the disclosure is combined (e.g., administered in combination) with a LAG-3 inhibitor.
- the LAG-3 inhibitor may be an antibody, an antigen binding fragment thereof, an immunoadhesin, a fusion protein, or oligopeptide.
- the LAG-3 inhibitor is chosen from LAG525 (Novartis), BMS-986016 (Bristol-Myers Squibb), TSR-033 (Tesaro), MK-4280 (Merck & Co), or REGN3767 (Regeneron).
- an anti-IL-27 antibody, or antigen binding portion thereof, provided by the disclosure is combined (e.g., administered in combination) with a TIGIT inhibitor, a kinase inhibitor (e.g., a tyrosine kinase inhibitor (TKI)), a CD112R inhibitor, a TAM receptor inhibitor, a STING agonist and/or a 4- IBB agonist, or a combination thereof.
- a TIGIT inhibitor e.g., a tyrosine kinase inhibitor (TKI)
- TKI tyrosine kinase inhibitor
- an anti-IL-27 antibody, or antigen binding portion thereof, provided by the disclosure is combined (e.g., administered in combination) with a tyrosine kinase inhibitor, an agent targeting the adenosine axis (for example a CD39 antagonist, a CD73 antagonist or a A2AR, A2BR or dual A2AR/A2BR antagonist), a CCR8 antagonist, a CTLA4 antagonist, a VEG-F inhibitor or a combination thereof
- an anti-IL-27 antibody or an antigen-binding fragment thereof described herein can be employed in methods of detection and/or quantification of human IL-27 in a biological sample. Accordingly, an anti-IL-27 antibody, or an antigen-binding fragment thereof, as described herein is useful to diagnose, prognose and/or determine progression of disease (e.g., cancer) in a patient.
- disease e.g., cancer
- Monitoring a subject for an improvement in a cancer, as defined herein, means evaluating the subject for a change in a disease parameter, e.g., a reduction in tumor growth.
- the evaluation is performed at least one (1) hour, e.g., at least 2, 4, 6, 8, 12, 24, or 48 hours, or at least 1 day, 2 days, 4 days, 10 days, 13 days, 20 days or more, or at least 1 week, 2 weeks, 4 weeks, 10 weeks, 13 weeks, 20 weeks or more, after an administration.
- the subject can be evaluated in one or more of the following periods: prior to beginning of treatment; during the treatment; or after one or more elements of the treatment have been administered.
- Evaluation can include evaluating the need for further treatment, e.g., evaluating whether a dosage, frequency of administration, or duration of treatment should be altered. It can also include evaluating the need to add or drop a selected therapeutic modality, e.g., adding or dropping any of the treatments for a cancer described herein.
- the disclosure provides a method of detecting IL-27 in a sample from a subject, the method comprising the (a) contacting a sample from the subject with a detection antibody under conditions to permit the detection antibody to form a detection antibody - IL-27 complex, if IL-27 is present in the sample, wherein the detection antibody is an antibody, or antigen binding fragment thereof, provided by the disclosure; and (b) detecting the presence of the complex, if any, produced in step (a).
- the disclosure provides a method of detecting an D s associated cancer in a subject, the method comprising the steps of: (a) contacting a sample from a subject suspected of having an IL-27-associated cancer with a detection antibody under conditions to permit the detection antibody to form a detection antibody-IL-27 complex, if IL-27 is present in the sample, wherein the detection antibody is an antibody, or antigen binding portion thereof, provided by the disclosure; and (b) detecting the presence of the complex, if any, produced in step (a).
- the detection antibody is coupled to a detectable label.
- the method further comprises contacting the sample with a capture antibody to produce a complex comprising IL-27 and the capture antibody, if IL-27 is present in the sample, wherein the capture antibody is an antibody, or antigen binding portion thereof, provided by the disclosure.
- the capture antibody is immobilized on a solid support.
- the sample is contacted with the capture antibody before the detection antibody.
- the sample is a body fluid sample.
- the fluid sample is blood, serum, plasma, cell lysates or tissue lysates.
- the cancer is selected from renal cell carcinoma (RCC), hepatocellular carcinoma, lung cancer, gastroesophageal cancer, ovarian cancer, endometrial cancer, melanoma, leukemia and lymphoma.
- the cancer is renal cell carcinoma (RCC).
- the cancer is hepatocellular carcinoma (HCC).
- the cancer is selected from leukemia and lymphoma.
- the cancer is acute myeloid leukemia (AML).
- Example 1 Generation of Anti-IL-27 Antibodies In Yeast That Specifically Bind P28 Subunits of Human IL-27
- Anti-IL-27 antibodies representing multiple epitope bins were selected from eight naive human synthetic yeast libraries using methods described below.
- yeast cells ( ⁇ 10 10 cells/library) were incubated with 3 mL of 100 nM biotinylated antigen (recombinant human IL-27; R&D Systems) for 30 min at 30°C in wash buffer (phosphate-buffered saline (PBS)/0.1% bovine serum albumin (BSA)). After washing once with 40 mL ice-cold wash buffer, the cell pellet was resuspended in 20 mL wash buffer, and Streptavidin MicroBeads (500 mL) were added to the yeast and incubated for 15 min at 4°C.
- wash buffer phosphate-buffered saline (PBS)/0.1% bovine serum albumin (BSA)
- PBS phosphate-buffered saline
- BSA bovine serum albumin
- yeast cells were pelleted, resuspended in 20 mL wash buffer, and loaded onto a Miltenyi LS column. After the 20 mL was loaded, the column was washed 3 times with 3 mL wash buffer. The column was then removed from the magnetic field, and the yeast cells were eluted with 5 mL of growth media and then grown overnight. The following rounds of selection were performed using flow cytometry.
- yeast cells were pelleted, washed three times with wash buffer, and incubated at 30°C with either decreasing concentrations of biotinylated antigen (100 to 1 nM) under equilibrium conditions, 30 nM biotinylated antigens of different species in order to obtain species cross-reactivity, or with a poly-specificity depletion reagent (PSR) to remove non-specific antibodies from the selection.
- PSR poly-specificity depletion reagent
- the libraries were incubated with a 1:10 dilution of biotinylated PSR reagent.
- Light chain batch diversification protocol Heavy chain plasmids from a naive selection output were extracted from the yeast via smash and grab, propagated in and subsequently purified from E. coli and transformed into a light chain library with a diversity of 5 x 10 6 . Selections were performed with one round of MACS and four rounds of FACS employing the same conditions as the naive discovery.
- CDRH1 and CDRH2 selection The CDRH3 of a single antibody was recombined into a premade library with CDRH1 and CDRH2 variants of a diversity of 1 x 10 8 and selections were performed with one round of MACS and four rounds of FACS as described in the naive discovery. In the different FACS rounds the libraries were looked at for PSR binding, species cross reactivity, and affinity pressure by titration or parental Fab pre-complexing, and sorting was performed in order to obtain a population with the desired characteristics.
- Yeast clones were grown to saturation and then induced for 48 h at 30°C with shaking. After induction, yeast cells were pelleted and the supernatants were harvested for purification. IgGs were purified using a Protein A column and eluted with acetic acid, pH 2.0. Fab fragments were generated by papain digestion and purified over KappaSelect (GE Healthcare LifeSciences).
- ForteBio affinity measurements were performed on an Octet RED384 generally as previously described (see, e.g., Estep et al, High throughput solution-based measurement of antibody-antigen affinity and epitope binning. Mobs 5(2), 270-278 (2013), herein incorporated by reference in its entirety). Briefly, ForteBio affinity measurements were performed by loading IgGs on-line onto AHQ sensors. Sensors were equilibrated off-line in assay buffer for 30 min and then monitored on-line for 60 seconds for baseline establishment. Sensors with loaded IgGs were exposed to 100 nM antigen for 3 minutes, and afterwards were transferred to assay buffer for 3 min for off-rate measurement. All kinetics were analyzed using the 1:1 binding model. Recombinant Human IL-27 Protein (R&D Systems Cat: 2526-IL) was used as an antigen. Affinity measurements for anti -IL-27 antibodies is shown in FIG. 1.
- Epitope binning/ligand blocking was performed using a standard sandwich format cross-blocking assay. Control anti-target IgG was loaded onto AHQ sensors and unoccupied Fc- binding sites on the sensor were blocked with an irrelevant human IgGl antibody. The sensors were then exposed to 100 nM target antigen followed by a second anti -target antibody or ligand. Additional binding by the second antibody or ligand after antigen association indicates an unoccupied epitope (non-competitor), while no binding indicates epitope blocking (competitor or ligand blocking). MSD-SET kinetic assay
- Solution equilibrium titrations were performed in PBS + 0.1% IgG-Free BSA (PBSF) with antigen held constant at 10-100 pM and incubated with 3-to 5-fold serial dilutions of antibody starting at 5 - 100 nM (experimental condition is sample dependent).
- Antibodies (20 nM in PBS) were coated onto standard bind MSD-ECL plates overnight at 4°C or at room temperature for 30 min. Plates were then blocked for 30 min with shaking at 700 rpm, followed by three washes with wash buffer (PBSF + 0.05% Tween 20).
- SET samples were applied and incubated on the plates for 150s with shaking at 700 rpm followed by one wash.
- Antigen captured on a plate was detected with 250 ng/mL sulfotag-labeled streptavidin in PBSF by incubation on the plate for 3 min. The plates were washed three times with wash buffer and then read on the MSD Sector Imager 2400 instrument using lx Read Buffer T with surfactant. The percent free antigen was plotted as a function of titrated antibody in Prism and fit to a quadratic equation to extract the KD. TO improve throughput, liquid handling robots were used throughout MSD-SET experiments, including SET sample preparation.
- Example 2 Binding of Anti-IL-27 Antibodies to Recombinant Human IL-27
- the ability of anti-IL-27 antibodies described in Example 1 to bind to recombinant human IL-27 was assessed by ELISA. Briefly, Nunc MaxiSorp ELISA Plates (Affymetrix #44- 2404-21) were coated with 100 mL/well recombinant human IL-27 (R&D Systems #2526-IL/CF) (0.5 mg/mL diluted in PBS), sealed and incubated overnight at 4°C. Plates were washed 3 times with 100 mL/well of wash buffer (PBS + 0.01% Tween).
- Blocking buffer was decanted and 100 mL per well of diluted control and anti- IL-27 antibodies were added, as indicated. A 10-point serial dilution was created for each antibody by diluting antibodies 1:10 starting from a top concentration of 1 mg/mL. Plates were incubated for 1-2 hours at RT with shaking. Plates were washed 3 times with 100 mL/well of wash buffer. 100 pL/well of anti-human IgG secondary antibody (SouthernBiotech; Cat. # 2014-05) was added (1 :5000 diluted in blocking buffer).
- Anti-IL-27 Ab 1 binds to the p28 subunit (but not the EBI3 subunit) of the heterodimeric cytokine IL-27.
- Anti-IL-27 Abl bound to human, nonhuman primate, and rodent recombinant IL- 27, and the extent of the binding differed between species.
- the binding specificity of anti IL 27 Abl to IL-27 was confirmed by testing against a panel of -4500 cell surface and soluble molecules, and no off-target binding was observed.
- the binding specificity of IL-27 for its receptor IL-27RA (WSX-1) was also confirmed; no other cell surface receptor bound human IL-27.
- the ability of anti-IL-27 Abl to block the interaction between human IL-27 and IL-27RA (WSX-1) was confirmed by Surface Plasmon Resonance.
- IL-27 is biologically active on mouse cells
- systemic overexpression of human IL-27 in mice using DNA minicircle delivery was utilized to analyze IL-27-mediated effects in vivo by whole-genome microarray analysis, flow cytometry, and serum cytokine analysis.
- Many of the markers that were modulated by IL-27 in vivo were consistent with findings in human cell-based assays.
- Anti-IL-27 Ab3 was also evaluated in a disseminated B16 tumor model. In that setting, treatment with anti-IL-27 Ab3 showed results consistent with phenotypes observed in mice deficient for various components of IL-27 ligand (IL-27p28, EBI3) or receptor (IL-27RA).
- Example 3 Anti-IL27 Antibodies Inhibit Phosphorylation of STAT1 In Vitro
- IL-27 signaling through the IL-27 receptor results in the phosphorylation of the Signal Transducer And Activator Of Transcription 1 (STAT1) polypeptide (pSTATl).
- STAT1 Signal Transducer And Activator Of Transcription 1
- pSTATl Signal Transducer And Activator Of Transcription 1
- Anti- IL-27 antibodies described in Example 1 were tested for their ability to inhibit IL-27-mediated phosphorylation of STAT1 in human whole blood, human PBMCs, the U937 myeloid cells (histiocytic lymphoma cell line) and HUT-78 T cell lymphoma cells by flow cytometry.
- Anti-IL-27 antibodies were tested for their ability to inhibit IL-27-mediated phosphorylation of STAT1 in human whole blood. Briefly, EDTA anticoagulated whole human blood, stored at room temperature, was used in this assay. 45 mL blood was distributed into each well of a deep well, round bottom plate (Phenix #850356) and warmed for 30 minutes at 37°C on a plate warmer (EchoTherm IC20) or in a 37°C incubator. Anti-IL-27 antibodies were diluted to a lOx top concentration in endotoxin-free PBS (Teknova #P0300) in a polypropylene V-bottom plate (Corning #3363).
- Anti-IL-27 antibodies were serially diluted as desired in endotoxin-free PBS. PBS alone was added to wells for unstimulated and stimulated controls. 5 mL of each dilution was added to a well of 45 pL blood and mixed by shaking on plate shaker 15 seconds 1000 RPM (Eppendorf Mix Mate). The plate was incubated for 60 minutes at 37°C on a plate warmer or in a 37°C incubator.
- a 10 pg vial of recombinant human IL-27 (R&D Systems # 2526-IL) was reconstituted to 100 mg/mL by adding 100 mL PBS + 0.1% BSA (made from 10% BSA Sigma #A1595).
- a working stock of the recombinant hIL-27 (rhIL-27) was prepared by dilution to 200 ng/mL in endotoxin-free PBS. After the 60-minute incubation, 5 pL of 200 ng/mL rhIL-27 was added to each well of stimulated blood. 5 pL PBS was added to unstimulated control wells. The plate was shaken on a plate shaker for 15 seconds at 1000 RPM. The plate was incubated for 30 minutes at 37°C.
- Lyse/Fix reagent (BD #558049) was diluted 1:5 in sterile water (Hyclone #SH3052902) and warmed to 37°C in a water bath. 500 pL Lyse/Fix reagent was added to each well of the deep well plate and the plate was mixed on a plate shaker for 15 seconds at 1000 RPM. The plate was incubated for 15 min at 37°C.
- FACS Buffer PBS, Gibco #14190-144 /2% FBS, Sigma #F8317/lmM EDTA, Fisher #BP2482
- U-bottom 96 well plate Costar #3799
- the plate was sealed with plate sealer (VWR #89134-432) and incubated for 30 minutes at room temperature in the dark.
- 150 mL FACS buffer was added to each well and the plate was centrifuged at 1500 RPM for 5 minutes at room temperature. The cell pellets were then resuspended in 100 mL Perm III (stored at -20°C) (BD #558050) with pipetting and the plate was sealed with plate sealer and lid. The plate was incubated overnight at -20°C or 15 minutes at 4°C.
- the plate was incubated for 1 hour at room temperature in the dark. After the 1- hour incubation, 100 mL of FACS buffer was added and the plate was centrifuged at 1500 RPM for 5 minutes at room temperature. The supernatant was discarded from the plate by flicking and the plate was resuspended in 100 mL FACS buffer for analysis by flow cytometry.
- Example 1 The anti-IL-27 antibodies described in Example 1 were tested for their ability to inhibit IL-27-mediated phosphorylation of STAT1 in pooled human PBMCs by flow cytometry. Briefly, frozen cryovials of human PBMC’s (peripheral blood mononuclear cells), obtained from huffy coats, were removed from liquid nitrogen storage and quickly thawed in a 37°C water bath. The contents of each cryovial was removed with a P1000 pipet and transferred to a 15 mL conical falcon tube. 2-3 mL of complete RPMI-1640 (Gibco, 61870-036) was slowly added to the thawed cells and cells were gently swirled or flicked to suspend. Conical tubes were topped-off up to 10 mL with complete RPMI-1640 and tubes were inverted to mix. Conical tubes were centrifuged tube at 1400 RPM at room temperature for 8 minutes.
- PBMC peripheral blood mononuclear cells
- PBMC cells were resuspended at a density of 4 million cells per mL in warm, serum-free RPMI-1640 and plated at a density of 200,000 cells per well (50 mL) in a round bottom 96-well plate (Costar, 3799).
- Anti-IL-27 antibodies were diluted in serum-free RPMI-1640 in the first row of a 96-well polypropylene plate to a top concentration of 40 mg/mL (will be 10 mg/mL final).
- Serial dilutions as desired (1 :2, 1 :3, etc) were made in the remainder of the first 10 rows of the plate.
- the pelleted PBMC’ s were stained with pSTATl PE (BD Phosflow, 526069) 1 : 100 in FACS buffer (2% FBS, 2 mM EDTA in DPBS) for 45 minutes at room temperature in the dark. Special care was taken to mix each well with a 12-channel pipette when adding the stain. After the 45-minute incubation, 100 mL FACS buffer was added into each well and the plate was centrifuged at 2000 RPM for 5 minutes. Supernatant was discarded by flicking and the plate was washed 2 times as described previously. Cells were resuspended in 100 mL FACS buffer and analyzed by flow cytometry.
- anti -IL-27 antibodies inhibited phosphorylation of STAT1 in human pooled PBMCs.
- the present disclosure also assessed IL-27 inhibition by anti-IL-27 Abl across species in a whole blood assay.
- IL-27 Ab 1 activity across species recombinant IL-27 from human, cynomolgus monkey, rat, and mouse was tested to stimulate pSTATl signaling in T lymphocytes from whole blood samples obtained from these species (data not shown).
- FIG. 3 Representative data for anti-IL-27 Abl signaling inhibition in human T cells are shown in FIG. 3. Consistent with observations made on the affinity of anti-IL-27 Abl to different species, the potency of IL-27 signaling inhibition by anti-IL-27 Abl was strongest in human, followed by cynomolgus monkey, rat, and mouse (see e.g., Table 7). Table 7: Anti-IL-27 Abl IC 50 Values in Peripheral Blood T Cells from Different
- the C-type lectin CD161 is a marker of T cells whose expression is suppressed by
- IL-27 Anti-IL-27 antibodies described in Example 1 were tested for their ability to reverse the IL- 27-mediated inhibition of CD161 in pooled human PBMC cells by flow cytometry. Briefly, frozen cryovials of pooled human PBMC’s (peripheral blood mononuclear cells), obtained from huffy coats, were removed from liquid nitrogen storage and quickly thawed in a 37°C water bath. Contents of each cryovial was removed with a P1000 pipet and transferred to a 15 mL conical falcon tube. 2-3 mL of complete RPMI-1640 (Gibco, 61870-036) was slowly added to the thawed cells and cells were gently swirled or flicked to suspend. Conical tubes were topped-off up to 10 mL with complete RPMI-1640 and tubes were inverted to mix. Conical tubes were centrifuged tube at 1400 RPM, room temperature for 8 minutes.
- Outer wells should be filled with 200 mL per well ofDPBS (Gibco, 14190-144). PBMC cells were resuspended at a density of 2 million cells per mL in warm, complete RPMI-1640. Purified human anti-CD3 antibody (Biolegend, UCTH1, #300402) was added at a concentration of 0.5 mg/mL (this is 2X the final concentration). Plate 100 mL per well of this cell mixture (200,000 cells per well) in a round bottom 96 well plate (Costar, 3799).
- Anti-IL-27 antibodies were diluted in complete RPMI-1640 in the first row of a 96 well polypropylene plate to a top concentration of 40 mg/mL (will be 10 ug/mL final). Serial dilutions as desired (1:2, 1 :3, etc...) were made in the remainder of the first 10 rows of the plate. 50 mL of the antibody stock (4x) was added to the first 10 rows the plate of PBMC cells in the round bottom plate. In rows 11 and 12, 50 mL of complete RPMI-1640 was added.
- Example 5 Enhancement of PD-l-Mediated Secretion of TNFa , IL-6 and other Cytokines by Anti-IL-27 Antibodies, Including Additional In Vitro Characterization of Anti-IL-27 Antibodies
- Anti-IL-27 antibodies were tested for their ability to enhance PD-l-mediated secretion of TNFa and IL-6 in human PBMC cells from cancer patients.
- Human PBMC cells from cancer patients were cultured essentially as described in Example 4 with the addition of wells also receiving anti -PD- 1 antibody, as indicated, at 1 mg/mL.
- Supernatants from the assay were analyzed for TNFa and IL-6 using Human CBA Thl/Th2/Thl7 Kit (BD, 560484).
- anti-IL-27 antibodies enhance the PD- 1 -mediated secretion of TNFa and IL-6 in pooled human PBMC cells.
- IL-27 is known to negatively regulate the expression of several inflammatory cytokines.
- human PBMCs from healthy donors, patients with RCC, and patients with ovarian cancer were activated with anti-CD3 in the presence or absence of anti-IL- 27 Abl for several days and tested for levels of secreted cytokines including IL-17, IFNy (IFNg), TNFa (TNFa), and IL-6.
- PBMCs isolated from fresh whole blood from 4 healthy donors, 5 patients with RCC, and 2 patients with ovarian cancer were activated by 0.25 mg/mL anti-CD3 antibody in the absence or presence of anti-IL-27 Abl (1 mg/mL), anti PD 1 (pembrolizumab, 1 mg/mL) or both antibodies.
- supernatants were collected and tested for levels of TNFa (A) or IFNy (B) by MSD or CBA. Data shown represent the fold-change in cytokine production compared to anti-CD3 stimulation alone. Statistics were calculated by paired t-test (*p ⁇ 0.005).
- Anti -PD- 1 antibody was used as a control in these assays and the combination of
- PD-1 and IL-27 blockade was also explored as shown in FIG. 5C.
- anti-IL-27 Abl treatment led to increased TNFa production in 6 of 11 PBMC samples tested (determined by > 2 fold increase) including 2 of 4 healthy donors, 3 of 5 patients with RCC, and 1 of 2 patients with ovarian cancer. When tested in a subset of donors this activity was anti-IL-27 Abl dose dependent (data not shown).
- Anti -PD-1 (pembrolizumab) treatment showed an increase in TNFa in 2 of the 11 donors tested (1 of 5 RCC and 1 of 2 ovarian cancer) while the combination of anti-IL-27 Abl and anti- PD-1 led to an increase in 10 of 11 donors.
- PBMCs from human whole blood were activated by 0.25 mg/mL anti-CD3 antibody.
- Cells were treated either control IgGl (1 mg/mL), aPD-1 antibody (pembrolizumab, 1 mg/mL) alone, rhIL-27 (25 ng/mL) plus aPD-1 or rhIL-27 plus aPD-1 with anti-IL-27 Abl (1 mg/mL) at 37°C for 5 days.
- Supernatants were collected for CBA detection.
- cytokines IL-17A and IFNY
- IL-17A and IFNY The example cytokines from 4 healthy donors were shown as fold change to control. Mean and standard deviation were depicted. Statistics were calculated by paired t-test (* p ⁇ 0.05, ** p ⁇ 0.01). Similar results were also seen in PBMCs from patients with RCC.PD-1 blockade increased both IL-17 and IFNy in these cultures and IL-27 could completely inhibit this activity, a response that was reversed in the presence of anti-IL-27 Abl as shown in FIG. 5D. These data show that IL-27 can attenuate the effects of anti PD-1 treatment on cytokine production.
- IL-27 was shown to inhibit anti -PD-1 mediated pro-inflammatory cytokine production in activated human PBMCs, a property that was blocked by anti-IL-27 Abl. Moreover, anti-IL-27 Ab 1 in combination with PD-1 blockade led to increased cytokine production in activated PBMCs from healthy donors and patients with RCC. Thus, by blocking IL-27, anti- IL-27 Abl enhances immune cell activation by altering immunoregulatory receptor expression and increasing inflammatory cytokine production.
- Example 6 Inhibition of IL-27-Mediated Expression of PD-L1 and TIM3 by Anti-IL-27 Antibodies
- Outer wells should be filled with 200 mL per well of DPBS (Gibco, 14190-144).
- Monocytes were resuspended at a density of 2 million cells per mL in warm, complete RPMI-1640. 100 mL per well of this cell mixture was plated (200,000 cells per well) in a round bottom 96-well plate (Costar, 3799).
- Anti-IL-27 antibodies were diluted in complete RPMI-1640 in the first row of a 96- well polypropylene plate to a top concentration of 40 pg/ml (10 mg/mL final concentration). Serial dilutions as desired (1:2, 1 :3, etc...) were made in the remainder of the first 10 rows of the plate. 50 mL of the antibody stock (4x) was added to the first 10 rows the plate of PBMC cells in the round bottom plate. In rows 11 and 12, 1250 mL of complete RPMI-1640 was added.
- the plate was agitated on a plate shaker for 30 seconds at 600 RPM and the plate was incubated for 30 minutes 4°C in the dark.
- anti-IL-27 antibodies potently inhibit the IL-27 mediated expression of PD-L1 and TIM3 in pooled human monocytes.
- Anti-IL-27 antibodies were further tested for their ability to inhibit IL-27-mediated expression of PD-L1 in resting T cells (inactivated) essentially as described for FIGS. 6A and 6B. Resting T-cells were isolated from human buffy coats using ROSETTESEPTM Human T cell Enrichment Cocktail (Stemcell #15061).
- the plate was agitated on a plate shaker for 30 seconds at 600 RPM and the plate was incubated for 30 minutes at 4°Cin the dark.
- Example 7 In Vivo Efficacy of an Anti-IL-27 Antibody in a Disseminated B16F10 Model of Melanoma
- IL-27 blockade using the clinical candidate anti-IL-27 Abl The growth of disseminated B16F10 lung metastases is known to be significantly reduced in EBI3 and I127ra (Wsx-l)-deficient mice (Sauer et al., ./. Immunology 181: 6148-6157). Since lung nodule size and growth kinetics are dependent on the number of B16F10 cells transferred and can proceed variably and rapidly, the combination of anti -PD- 1 and anti-CTLA-4 was studied as a benchmark for therapeutic activity. Anti-IL-27 Abl pre-treatment resulted in a significant reduction in overall tumor burden.
- Antibodies were dosed once weekly beginning 7 days before tumor injection for a total of four doses (days -7, 0, 7, and 14).
- days -7, 0, 7, and 14 For visual enumeration of lung metastases, B 16F10 tumor bearing mice were euthanized by CO2 asphyxiation 18 day s-post tumor cell injection and lungs were perfused with PBS via cardiac puncture, removed, and fixed in 10% neutral buffered formalin for 24 hours. Fixed lungs were then transferred to 70% ethanol and surface lung metastases were counted visually.
- B16-Luc tumor-bearing animals were injected i.v. via the tail vein with 3 mg of VivoGlo D-luciferin in 200 mL PBS (Promega) twice weekly. Five minutes after luciferin injection animals were anesthetized and bioluminescent imaging was performed using an IVIS Lumina LT Series III imager. Images were analyzed using Living Image (version 4.5.5) software and represented as total flux measurements in photons/second.
- IL-27 antibody anti-IL-27 Abl resulted in a significant reduction in overall tumor burden as measured by both total counts of surface lung metastases (# pulmonary nodules, FIG. 7A), and by a reduction of tumor area in lung tissue sections by immunohistochemistry (IHC) analysis (FIGs. 7C-7F and FIG. 7G).
- Blockade of p28 with anti-IL-27 Abl resulted in a 42% reduction in the number of pulmonary B16 nodules compared to isotype control treatment.
- Anti-IL-27 Abl treatment resulted in an 83% reduction in overall lung tumor metastasis area as measured by IHC (16.43 ⁇ 1.39% in the isotype control group versus 2.83 ⁇ 1.45% in the anti-IL-27 Abl treatment group).
- IL-27RA WSX-1) mediated antibody blockade and with anti -PD- 1 + anti-CTLA-4 combination therapy, as shown in FIG. 7G.
- Example 8 Gene Expression Profiling of Murine Splenocytes from Mice Hydrodynamically Transfected with Human IL-27 Minicircles
- IL-27 is known to be species cross-reactive and can induce pSTATl signaling and PD LI in murine splenocytes in vitro. This species cross-reactivity was used to study the effects of human IL-27 overexpression in mice and its inhibition by anti-IL-27 Abl.
- DNA plasmid minicircles encoding human IL-27 were administered to mice by hydrodynamic transfection, as described below, which resulted in high systemic levels of IL-27.
- RNA samples were prepared by mechanical dissociation of whole spleens, followed by ACK lysis of red blood cells.
- Total RNA was extracted from splenocytes with the RNEASY ® Mini Kit (Qiagen, Cat. No: 74104) and adjusted to 20 ng/uL in nuclease free water (Qiagen, Cat. No: 19101).
- Gene expression profiling on was performed on Affymetrix GENECHIP TM Mouse Gene 2.0 ST Arrays (Applied Biosystems, Cat. No: 902118). Processing of RNA samples, hybridization and array scanning were carried out using standard Affymetrix GENECHIPTM protocols at the Boston University Microarray and Sequencing Resource (BUMSR).
- FcyRIII/II was blocked by preincubating cells with rat anti-mouse CD16/CD32 mAb (1 pg per million cells; Biolegend, San Diego, CA) in PBS with 2% FBS and 2mM EDTA.
- Cells were stained with APC-, PE-, Brilliant Violet 510-, and Brilliant Violet 711-conjugated mAbs against murine CD4 (clone GK1.5), CD8 (53-6.7), PD-L1 (10F.9G2), TIM3 (RMT3-23), LAG3 (C9B7W), and TIGIT (1G9) (Biolegend).
- Cell-associated fluorescence was measured using an LSRFortessa X-20 flow cytometer (BD Biosciences), and analysis was performed using FlowJo software (Tree Star, Ashland, OR).
- FIG. 8A A subset of these genes is shown in Tables 11A-11B. Among these genes were those that encode immune inhibitory receptors that play key roles in the immune response. As shown in FIG. 8B, Ly6a (encodes Sca-1), Lag 3, Tigit and 1110 were upregulated on splenocytes in response to IL-27. There was also a trend toward IL-27-mediated upregulation of Ctla4 and Cd274 (encodes PD-L1) that was less than 1-fold induction (data not shown). To validate the expression data, flow cytometry was utilized to assess the protein expression of PD-L1, LAG- 3, TIGIT and TIM-3 on T cells from these mice.
- IL-27 minicircles led to upregulation of PD-L1, LAG-3 and TIGIT in splenic (Spleen) and peripheral blood (PBMC) CD4 + T cells.
- PBMC peripheral blood
- IL-27 minicircles upregulated PD-L1, LAG-3, TIGIT, and TIM-3.
- FIGs. 8C-8F administration of IL-27 minicircles led to upregulation of PD-L1, Lag-3, and Tigit in splenic and peripheral blood CD4 + T cells.
- IL-27 minicircles upregulated PD-L1, Lag-3, Tigit, and Tim-3.
- IL-27 in vivo both target engagement by enzyme-linked immunosorbent assay (ELISA) and immunoregulatory receptor expression in splenocytes were studied.
- ELISA enzyme-linked immunosorbent assay
- MSD Meso Scale Discovery
- the IL-27 heterodimer assay utilizes a p28 capture antibody that cross blocks anti-IL-27 Abl and a human specific EBI3 detection antibody; therefore, if anti-IL-27 Abl is bound to IL-27 then its detection will be masked.
- the EBI3 assay utilizes both capture and detection antibodies specific for 2 distinct epitopes of human EBI3 and since the minicircle derived IL-27 is a tethered heterodimer this assay allows for detection of total IL 27 irrespective of anti-IL-27 Abl binding.
- FIG. 8G shows that anti -IL-27 Ab 1 treatment completely inhibits IL-27 detection in plasma by MSD. Similar data were seen when a dose of 25 mg/kg of anti -IL-27 Abl was tested.
- anti-IL-27 Abl significantly blocked IL 27-induced PD-L1 and Lag 3 expression in CD4+ PBMCs and PD-L1, Tim-3, Lag-3, and TIGIT expression in CD8+ PBMCs.
- anti-IL-27 Abl treatment also blocked IL 27 induced PD-L1, Lag-3, and TIGIT expression in CD4+ splenocytes and PD-L1 and Lag 3 expression in CD8+ splenocytes.
- Table 11A Genes Upregulated in Response to Administration of IL-27
- Table 11B Genes Downregulated in Response to Administration of IL-27
- Table 12 SEQUENCE LISTING
- Human IL-27 displayed the strongest binding affinity for anti-IL-27 Abl of all species tested in this study (3.86 pM). Recombinant rat and cynomolgus monkey IL-27 also showed strong affinities for anti-IL-27 Ab 1 with values of 80.9 and 37.4 pM, respectively, although somewhat weaker than the human protein. Recombinant mouse IL-27 had the weakest affinity for anti-IL-27 Abl by comparison with the human protein, with a value in the nM range (4.43 nM) as indicated by its slower association and faster dissociation rates.
- IL-27 interleukin 27
- k a association constant
- k d dissociation constant
- KD binding affinity
- a number of sub-selections of anti-IL-27 antibodies of the instant disclosure share sequence homology across their CDR regions, providing a diversity of variant CDR sequences that have been validated as retaining functionality. It is expressly contemplated herein that the following consensus CDR sequences are fully supported by - and are therefore within the scope of - the instant disclosure.
- anti-IL-27 Abl anti-IL-27 Ab3, anti-IL-27 Ab4, anti-IL-27 Ab5, anti-IL-27
- a consensus heavy chain CDR1 (IMGT) sequence for these homologous antibodies is therefore N-GFTF [S/A/R] [S/R] [T/Y] [G/S]-C (SEQ ID NO: 144) and, accordingly, more generally contemplated herein as a consensus heavy chain CDR1 (IMGT) sequence is N- GFTFXXXX-C (SEQ ID NO: 145), where X is any amino acid residue.
- a consensus heavy chain CDR2 (IMGT) sequence for these homologous antibodies is therefore N-ISSS[S/G][S/A]YI-C (SEQ ID NO: 146) and, accordingly, more generally contemplated herein as a consensus heavy chain CDR2 (IMGT) sequence is N-ISSSXXYI-C (SEQ ID NO: 147), where X is any amino acid residue.
- IMGT consensus heavy chain CDR2
- FTFRSYGMN 9 (SSQ ID NO: 34) 16 FTFRSYGMN 9 (SSQ ID NO: 122)
- Consensus heavy chain CDR1 (NT) and CDR2 (NT) sequences for these homologous antibodies are therefore N-FTF[S/A/R][S/R][T/Y][G/S]MN-C (SEQ ID NO: 148) and N-[G/S]ISSS[S/G][S/A]YI[L/Y]YADSVKG-C (SEQ ID NO: 149), respectively.
- consensus heavy chain CDR1 (NT) and CDR2 (NT) sequences N-FTFXXXXMN-C (SEQ ID NO: 150) and N- XISSSXXYIXYADSVKG-C (SEQ ID NO: 151), respectively, where X is any amino acid residue.
- IMGT or NT Heavy chain CDR3
- IMGT or NT light chain CDRs CDR1
- CDR2 (IMGT or NT) and CDR3 (IMGT or NT) were fully conserved between anti-IL-27 Abl, anti-IL-27 Ab3, anti-IL-27 Ab4, anti-IL-27 Ab5, anti-IL-27 Ab6, and anti-IL-27 Ab7.
- Example 11 Crystallization and Epitope Determination of IL-27 - Anti-IL-27 Abl Fab complex
- Binding and blocking studies were performed by SPR for both WSX-1 and gpl30 for the human IL-27 heterodimer.
- Human IL-27 bound with high affinity to WSX-1 and anti-IL- 27 Ab 1 was able to completely inhibit binding (FIG. 10A).
- Human IL-27 bound with lower affinity to gpl30, and anti-IL-27 Abl did not inhibit binding of IL-27 to gpl30 (FIG. 10B).
- Anti-IL-27 Abl Interacts with the aA and aC helices and the initial portion of the poly-Glu sequence (FIG. 11).
- Heavy-chain CDR’s 2 and 3 have the most extensive contacts with p28 (Table 16B)
- Table 16B Contacts between IL27-p28 and Anti-IL-27 Abl.
- FIG. 12 shows superimposition of complexes of IL27/anti-IL-27 Abl with
- IL23/IL23R using p28 and IL6 for the alignment in 3 -dimensional space.
- the gpl30 binding site on IL6 overlaps with the anti-IL-27 Abl binding site on p28.
- the IL23R binding site on pl9 does not overlap with the anti-IL-27 Abl binding site on p28.
- FIG. 13 shows superimposition of complexes of IL27/anti-IL-27 Abl with
- IL6/IL6Ra/gpl30 using p28 and IL6 for the alignment in 3 -dimensional space.
- the gpl30 binding site on IL6 again overlaps with the anti-IL-27 Abl binding site on p28.
- IL6Ra aligns with EBI-3.
- Binding affinity data for human IL-27 indicate that p28 had weak or no binding to either gpl30 or WSX-1 alone (FIG. 17). EBI3 had no binding for gpl30 alone, but moderate binding affinity for WSX-1. High affinity binding for Human IL27 was only observed when the heterodimer was assembled. The affinity of EBI3 for p28 was 5nM.
- Example 13 Targeting of IL-27 Expression in Renal Cell Carcinoma
- IL-27 is increased in renal cell carcinoma (RCC), with increased levels of EBI3, IL-27p28, and IL-27RA in RCC tumor tissue, relative to the expression of each in normal kidney tissue (FIG. 20A).
- RCC renal cell carcinoma
- EBI3 IL-27RA
- IL-27p28 IL-27p28
- IL-27 induces a reproducible gene expression signature in activated human CD4 + T cells.
- Peripheral blood mononuclear cells (PBMCs) from individual donors were activated with anti-CD3 ⁇ recombinant human IL-27 (rhIL-27) for 3 days.
- PBMCs Peripheral blood mononuclear cells
- rhIL-27 anti-CD3 ⁇ recombinant human IL-27
- CD4 + T cells were FACS sorted and gene expression was analyzed by microarray.
- 15 of the 31 genes were associated with poor outcome, namely AIM2, ALPKl, APOLl, GBP5, IFI44, IRFl, LAMP3, LOC400696, PARP3, RGS1, SAMD9L, SOCS1, STAT1, TNFSF13B, and XAFl.
- Twelve of the top signature genes were associated with poor outcomes in RCC (FIG. 22A) but these same genes were not associated with poor outcome in breast cancer (BRCA) (FIG. 22B).
- plasma levels of EBI3 in RCC patients can be predictraive of outcome.
- EBI3 levels were measured using an EBI3-specific antibody pair. Average EBI3 levels were elevated in serum from patients with RCC as compared with serum from healthy donors (FIG. 23A). Serum from pregnant donors was included as a positive control. EBI3 levels were highest in subjects stage 4 RCC relative to stage 2 or stage 3 (FIG. 23B); and overall survival (FIG. 23C) and disease-free survival (FIG. 23D) were higher in RCC patients with low serum EBI3 levels.
- Renca cells were orthotopically implanted into the left kidney.
- Three days postimplant mice were treated intraperitoneally with anti-IL-27 Abl or human IgGl isotype control (50 mg/kg twice weekly) for 2 weeks. After 21 days tissues were harvested, both kidneys were weighed to calculate net tumor weight, and lung metastases were counted visually. Though average tumor weight remained largely constant (FIG. 24A), lung metastasis was significantly reduced in anti-IL-27 Abl -treated mice as compared to isotype control -treated mice (FIG. 24B).
- Anti-IL-27 Abl demonstrates single-agent activity in an orthotopic model of RCC in vivo, and blockade of IL-27 with anti-IL- 27 Abl represents a promising strategy for patients with RCC who have high levels of circulating EBI3.
- Example 14 In vivo targeting of IL-27 using Anti-IL-27 Abl in an Orthotopic Hepal-6 HCC Mouse Model
- Table 17A Top 200 repressed genes in Hepal-6 mouse livers following anti-IL-
- Table 17B Top 200 induced genes in Hepal-6 mouse livers following anti-IL-27
- anti-IL-27 Abl was found to downregulate several key inhibitory genes, including PD-L1, TIGIT, and AFP expression (FIGs. 28B-28D), with no significant changes in the expression of EBI3, IL-27, and IL27RA (FIG. 28A).
- the TGFb pathway was also found to be suppressed following anti-IL-27 Abl administration, with decreased expression of TNFRSF10B, TNFRSFla, and PDGFA (FIG. 28C and FIG. 28E).
- IL-27 Abl promotes macrophage and NK transcript abundance in the tumor microenvironment (TME; FIG. 29A).
- TEE tumor microenvironment
- anti-IL-27 Abl enriches for CD206 and CD 163 (FIG. 29B), which are key macrophage associated markers; and anti-IL-27 Abl was found to modulate specific NK-associated receptors (FIG. 30).
- Heterogeneity in NK marker modulation suggests that anti-IL- 27 Abl influences NK function and not only infiltration in HEPA1-6 tumors.
- various other cell surface markers showed modulated expression following treatment with anti-IL-27 Abl (FIG. 31)
- TNFSF15 as a Biomarker of IL-27 Inhibition
- TNFSF15 tumor necrosis factor soluble factor 15
- TL1 A tumor necrosis factor like ligand 1 A
- VEGFI vascular endothelial growth factor inhibitor
- VEGI a novel cytokine of the tumor necrosis factor family, is an angiogenesis inhibitor that suppresses the growth of colon carcinomas in vivo.
- TNFSF15 was shown to be upregulated after blocking IL-27 subsequent to treatment with an IL-27 inhibitor, establishing its utility as a biomarker in assessing the effectiveness IL-27 inhibition following the administration of an therapeutic intended to inhibit IL-27.
- IL-27 inhibited the production of cytokines IL-17A, IFNy (or IFNg) and TNFa (or
- TNFa TNFa in activated PBMCs.
- Pooled human PBMCs from 3 donors were stimulated with anti-CD3 (0.25 mg/mL) for 3 days in the presence or absence of IL-27 (100 ng/mL).
- the supernatants were harvested and tested for the effect on IL-17A, IFNy, TNFa, and IL-10 by cytometric bead array; IL-27 resulted in decreased production of IL-17A, IFNy, and TNFa and had no effect on the production of IL-10(FIGs. 32A-32D).
- PBMCs from 3-4 individual donors were stimulated with anti-CD3 (0.25 mg/mL) for 4 days in the presence or absence of anti-IL-27 Abl (1 mg/mL).
- the supernatants were harvested and tested for the effect on IL-17A, IFNy, TNFa, and IL-10 by cytometric bead array; anti-IL-27 Abl resulted in the increased production of IL-17A, IFNy, and TNFa (FIGs. 33A-33D).
- gene expression profiling was performed by microarray analysis in activated PBMCs.
- PBMCs from three individual donors were stimulated with anti-CD3 (0.25 mg/mL) with or without anti-IL-27 Abl (1 mg/mL) for 24 hours.
- RNA from each sample was isolated and processed for gene expression profiling by microarray to determine the effect of IL-27 inhibition.
- genes were differentially expressed by volcano plot analysis subsequent to IL-27 inhibition with anti-IL-27 Abl as compared to isotype control, including MMPl, MMPIO and TNFSF15, as shown in Table 18.
- TNFSF15 transcript is significantly increased after IL-27 blockade.
- TNFSF 15 showed a reproducible increase in gene expression levels after treatment with anti-IL-27 Abl compared to treatment with isotype control in all 3 individual donors as shown in
- pooled human PBMCs were either stimulated with anti-CD3 (0.25 pg/ml) for 24 hours or left unstimulated in the presence of two different lots of anti-IL-27 Abl (1 mg/mL) or isotype control.
- RNA was harvested and TNFSF 15 relative quantity (RQ) was determined by qPCR, measuring TNFSF 15 transcripts using gene specific Taqman probes.
- RQ relative quantity
- PBMCs left resting (resting PBMC), PBMCs supplemented with a 1 :2 ratio of monocytes enriched from PBMC (resting PBMC + Monocyte), monocytes alone left resting (resting Monocyte), PBMCs that were activated with anti-CD3 (0.25 mg/mL) (Activated PMBC), or PBMCs supplemented with a 1 :2 ratio of monocytes and activated with anti-CD3 (0.25 mg/mL) (Activated PMBC + Monocytes).
- the values in FIG. 37 represent the fold change in TNFSF 15 transcript after IL-27 inhibition with anti-IL-27 Abl compared to isotype control.
- TNFSF 15 transcript was specific to IL-27 blockade and was not observed with other antibodies targeting CD39 or CD112R, as shown in FIG. 38.
- pooled human PBMCs were supplemented with monocyte derived macrophages and stimulated with anti-CD3 (0.25 mg/mL) for 24 hours in the presence of IgGl control antibody, anti-IL-27 antibody (anti-IL-27 Abl, 1 mg/mL), an anti-CD39 IgG4 antibody (1 mg/mL), an anti-CD112R IgGl antibody (1 mg/mL), or an anti-CDl 12R IgG4 antibody (1 mg/mL).
- the RNA was harvested at 24 hours; the TNFSF 15 transcript was measured in cell culture supernatants using human TL1A/TNFSF15 DuoSet ELISA (R&D Systems).
- TNFSF 15 protein was also seen after blocking IL-27 with anti-IL-27 Abl in activated PBMCs with delayed kinetics compared to the transcript (FIGs. 39A-39B).
- Pooled human PBMCs were supplemented with monocyte derived macrophages and stimulated with anti-CD3 (0.25 mg/mL) in the presence of IgGl control or anti-IL-27 antibody (anti-IL-27 Abl, 1 mg/mL).
- RNA was harvested at days 1, 2 and 5 and TNFSF 15 transcript relative quantity (RQ) was determined by qPCR for each timepoint. Culture supernatants were harvested at different times; TNFSF 15 protein was measured using a sandwich ELISA.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biochemistry (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Engineering & Computer Science (AREA)
- Pharmacology & Pharmacy (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Analytical Chemistry (AREA)
- Hematology (AREA)
- Pathology (AREA)
- Biomedical Technology (AREA)
- Urology & Nephrology (AREA)
- Physics & Mathematics (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- Food Science & Technology (AREA)
- General Physics & Mathematics (AREA)
- Cell Biology (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Oncology (AREA)
- Hospice & Palliative Care (AREA)
- General Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Investigating Or Analysing Biological Materials (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| BR112022004302A BR112022004302A2 (pt) | 2019-09-25 | 2020-09-25 | Anticorpos anti-il-27 e usos dos mesmos |
| JP2022518965A JP2022549854A (ja) | 2019-09-25 | 2020-09-25 | 抗il-27抗体及びその使用 |
| AU2020353672A AU2020353672A1 (en) | 2019-09-25 | 2020-09-25 | Anti-IL-27 antibodies and uses thereof |
| KR1020227013170A KR20220066346A (ko) | 2019-09-25 | 2020-09-25 | 항-il-27 항체 및 이의 용도 |
| CA3151078A CA3151078A1 (en) | 2019-09-25 | 2020-09-25 | Anti-il-27 antibodies and uses thereof |
| EP20789783.6A EP4034559A1 (en) | 2019-09-25 | 2020-09-25 | Anti-il-27 antibodies and uses thereof |
| MX2022003719A MX2022003719A (es) | 2019-09-25 | 2020-09-25 | Anticuerpos anti-il-27 y sus usos. |
| CN202080065875.3A CN115087671A (zh) | 2019-09-25 | 2020-09-25 | 抗il-27抗体及其用途 |
| IL291550A IL291550A (en) | 2019-09-25 | 2022-03-21 | Anti-il-27 antibodies and uses thereof |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201962906008P | 2019-09-25 | 2019-09-25 | |
| US62/906,008 | 2019-09-25 | ||
| US202063081705P | 2020-09-22 | 2020-09-22 | |
| US63/081,705 | 2020-09-22 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2021062244A1 true WO2021062244A1 (en) | 2021-04-01 |
Family
ID=72827018
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2020/052849 Ceased WO2021062244A1 (en) | 2019-09-25 | 2020-09-25 | Anti-il-27 antibodies and uses thereof |
Country Status (12)
| Country | Link |
|---|---|
| US (2) | US20210115127A1 (cg-RX-API-DMAC7.html) |
| EP (1) | EP4034559A1 (cg-RX-API-DMAC7.html) |
| JP (1) | JP2022549854A (cg-RX-API-DMAC7.html) |
| KR (1) | KR20220066346A (cg-RX-API-DMAC7.html) |
| CN (1) | CN115087671A (cg-RX-API-DMAC7.html) |
| AU (1) | AU2020353672A1 (cg-RX-API-DMAC7.html) |
| BR (1) | BR112022004302A2 (cg-RX-API-DMAC7.html) |
| CA (1) | CA3151078A1 (cg-RX-API-DMAC7.html) |
| IL (1) | IL291550A (cg-RX-API-DMAC7.html) |
| MX (1) | MX2022003719A (cg-RX-API-DMAC7.html) |
| TW (2) | TW202521984A (cg-RX-API-DMAC7.html) |
| WO (1) | WO2021062244A1 (cg-RX-API-DMAC7.html) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2022236134A1 (en) * | 2021-05-07 | 2022-11-10 | Surface Oncology, Inc. | Anti-il-27 antibodies and uses thereof |
| WO2026055168A1 (en) * | 2024-09-06 | 2026-03-12 | Surface Oncology, LLC | Anti-il-27 antibodies and uses and doses thereof |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN113583138B (zh) * | 2021-06-17 | 2023-07-28 | 武汉大学 | Il-6-il-27复合物及其在制备抗病毒药物中的应用 |
| WO2025040163A1 (zh) * | 2023-08-24 | 2025-02-27 | 北京三诺佳邑生物技术有限责任公司 | 一种分离的抗体及其应用 |
Citations (74)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3710795A (en) | 1970-09-29 | 1973-01-16 | Alza Corp | Drug-delivery device with stretched, rate-controlling membrane |
| US3773919A (en) | 1969-10-23 | 1973-11-20 | Du Pont | Polylactide-drug mixtures |
| EP0036676A1 (en) | 1978-03-24 | 1981-09-30 | The Regents Of The University Of California | Method of making uniformly sized liposomes and liposomes so made |
| EP0058481A1 (en) | 1981-02-16 | 1982-08-25 | Zeneca Limited | Continuous release pharmaceutical compositions |
| EP0088046A2 (de) | 1982-02-17 | 1983-09-07 | Ciba-Geigy Ag | Lipide in wässriger Phase |
| EP0133988A2 (de) | 1983-08-02 | 1985-03-13 | Hoechst Aktiengesellschaft | Regulatorische Peptide enthaltende pharmazeutische Präparate mit protrahierter Freisetzung und Verfahren zu deren Herstellung |
| EP0143949A1 (en) | 1983-11-01 | 1985-06-12 | TERUMO KABUSHIKI KAISHA trading as TERUMO CORPORATION | Pharmaceutical composition containing urokinase |
| US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
| US4863457A (en) | 1986-11-24 | 1989-09-05 | Lee David A | Drug delivery device |
| WO1990002809A1 (en) | 1988-09-02 | 1990-03-22 | Protein Engineering Corporation | Generation and selection of recombinant varied binding proteins |
| EP0430539A2 (en) | 1989-11-22 | 1991-06-05 | Visionex, Inc. | Ocular implants |
| WO1991010737A1 (en) | 1990-01-11 | 1991-07-25 | Molecular Affinities Corporation | Production of antibodies using gene libraries |
| WO1992001047A1 (en) | 1990-07-10 | 1992-01-23 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| EP0488401A1 (en) | 1990-11-30 | 1992-06-03 | Senju Pharmaceutical Co., Ltd. | A controlled-release pharmaceutical preparation for intra-ocular implant |
| WO1992018619A1 (en) | 1991-04-10 | 1992-10-29 | The Scripps Research Institute | Heterodimeric receptor libraries using phagemids |
| WO1993011236A1 (en) | 1991-12-02 | 1993-06-10 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| WO1994004678A1 (en) | 1992-08-21 | 1994-03-03 | Casterman Cecile | Immunoglobulins devoid of light chains |
| WO1994025591A1 (en) | 1993-04-29 | 1994-11-10 | Unilever N.V. | PRODUCTION OF ANTIBODIES OR (FUNCTIONALIZED) FRAGMENTS THEREOF DERIVED FROM HEAVY CHAIN IMMUNOGLOBULINS OF $i(CAMELIDAE) |
| WO1994029351A2 (en) | 1993-06-16 | 1994-12-22 | Celltech Limited | Antibodies |
| WO1995015982A2 (en) | 1993-12-08 | 1995-06-15 | Genzyme Corporation | Process for generating specific antibodies |
| US5427908A (en) | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
| WO1995020401A1 (en) | 1994-01-31 | 1995-08-03 | Trustees Of Boston University | Polyclonal antibody libraries |
| US5516637A (en) | 1994-06-10 | 1996-05-14 | Dade International Inc. | Method involving display of protein binding pairs on the surface of bacterial pili and bacteriophage |
| WO1996027011A1 (en) | 1995-03-01 | 1996-09-06 | Genentech, Inc. | A method for making heteromultimeric polypeptides |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| US5698426A (en) | 1990-09-28 | 1997-12-16 | Ixsys, Incorporated | Surface expression libraries of heteromeric receptors |
| US5733743A (en) | 1992-03-24 | 1998-03-31 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| US5750753A (en) | 1996-01-24 | 1998-05-12 | Chisso Corporation | Method for manufacturing acryloxypropysilane |
| US5780225A (en) | 1990-01-12 | 1998-07-14 | Stratagene | Method for generating libaries of antibody genes comprising amplification of diverse antibody DNAs and methods for using these libraries for the production of diverse antigen combining molecules |
| WO1998042752A1 (en) | 1997-03-21 | 1998-10-01 | Brigham And Women's Hospital Inc. | Immunotherapeutic ctla-4 binding peptides |
| US5821047A (en) | 1990-12-03 | 1998-10-13 | Genentech, Inc. | Monovalent phage display |
| WO1999051642A1 (en) | 1998-04-02 | 1999-10-14 | Genentech, Inc. | Antibody variants and fragments thereof |
| US6001329A (en) | 1996-05-06 | 1999-12-14 | Uab Research Foundation | Radiolabeled fusion toxins for cancer therapy |
| US6005079A (en) | 1992-08-21 | 1999-12-21 | Vrije Universiteit Brussels | Immunoglobulins devoid of light chains |
| WO2000037504A2 (en) | 1998-12-23 | 2000-06-29 | Pfizer Inc. | Human monoclonal antibodies to ctla-4 |
| US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
| WO2001014424A2 (en) | 1999-08-24 | 2001-03-01 | Medarex, Inc. | Human ctla-4 antibodies and their uses |
| US6300064B1 (en) | 1995-08-18 | 2001-10-09 | Morphosys Ag | Protein/(poly)peptide libraries |
| EP1537878A1 (en) | 2002-07-03 | 2005-06-08 | Ono Pharmaceutical Co., Ltd. | Immunopotentiating compositions |
| US6933368B2 (en) | 1992-03-09 | 2005-08-23 | Protein Design Labs, Inc. | Increasing antibody affinity by altering glycosylation of immunoglobulin variable region |
| US6995259B1 (en) | 1998-10-23 | 2006-02-07 | Sirna Therapeutics, Inc. | Method for the chemical synthesis of oligonucleotides |
| WO2007024715A2 (en) | 2005-08-19 | 2007-03-01 | Abbott Laboratories | Dual variable domain immunoglobin and uses thereof |
| WO2008024188A2 (en) | 2006-08-18 | 2008-02-28 | Abbott Laboratories | Dual variable domain immunoglobulin and uses thereof |
| US20080241223A1 (en) | 2004-04-30 | 2008-10-02 | Allergan, Inc. | Extended release biodegradable ocular implants |
| WO2009036379A2 (en) | 2007-09-14 | 2009-03-19 | Adimab, Inc. | Rationally designed, synthetic antibody libraries and uses therefor |
| WO2009156737A1 (en) | 2008-06-25 | 2009-12-30 | Vernalis (R&D) Limited | Triazolo [4, 5-d] pyramidine derivatives and their use as purine receptor antagonists |
| EP2161336A1 (en) | 2005-05-09 | 2010-03-10 | ONO Pharmaceutical Co., Ltd. | Human monoclonal antibodies to programmed death 1(PD-1) and methods for treating cancer using anti-PD-1 antibodies alone or in combination with other immunotherapeutics |
| WO2010027827A2 (en) | 2008-08-25 | 2010-03-11 | Amplimmune, Inc. | Targeted costimulatory polypeptides and methods of use to treat cancer |
| EP2170959A1 (en) | 2007-06-18 | 2010-04-07 | N.V. Organon | Antibodies to human programmed death receptor pd-1 |
| WO2010077634A1 (en) | 2008-12-09 | 2010-07-08 | Genentech, Inc. | Anti-pd-l1 antibodies and their use to enhance t-cell function |
| WO2010105256A1 (en) | 2009-03-13 | 2010-09-16 | Adimab, Inc. | Rationally designed, synthetic antibody libraries and uses therefor |
| WO2010118243A2 (en) * | 2009-04-08 | 2010-10-14 | Genentech, Inc. | Use of il-27 antagonists to treat lupus |
| US7943743B2 (en) | 2005-07-01 | 2011-05-17 | Medarex, Inc. | Human monoclonal antibodies to programmed death ligand 1 (PD-L1) |
| WO2011066342A2 (en) | 2009-11-24 | 2011-06-03 | Amplimmune, Inc. | Simultaneous inhibition of pd-l1/pd-l2 |
| WO2011095625A1 (en) | 2010-02-05 | 2011-08-11 | Heptares Therapeutics Limited | 1,2,4-triazine-4-amine derivatives |
| WO2012009568A2 (en) | 2010-07-16 | 2012-01-19 | Adimab, Llc | Antibody libraries |
| US8114845B2 (en) | 2008-08-25 | 2012-02-14 | Amplimmune, Inc. | Compositions of PD-1 antagonists and methods of use |
| WO2013079174A1 (en) | 2011-11-28 | 2013-06-06 | Merck Patent Gmbh | Anti-pd-l1 antibodies and uses thereof |
| WO2013173223A1 (en) | 2012-05-15 | 2013-11-21 | Bristol-Myers Squibb Company | Cancer immunotherapy by disrupting pd-1/pd-l1 signaling |
| US8796284B2 (en) | 2010-03-31 | 2014-08-05 | Palobiofarma, S.L. | 4-aminopyrimidine derivatives and their as as adenosine A2a receptor antagonists |
| US9029393B2 (en) | 2009-01-26 | 2015-05-12 | Kaldi Pharma, Sas | Adenosine receptor ligands and uses thereof |
| WO2015103072A1 (en) | 2013-12-30 | 2015-07-09 | Epimab Biotherapeutics | Fabs-in-tandem immunoglobulin and uses thereof |
| US9133197B2 (en) | 2009-03-20 | 2015-09-15 | Sigma-Tau Industrie Farmaceutiche Riunite S.P.A. | Oxidated derivatives of triazolylpurines useful as ligands of the adenosine A2A receptor and their use as medicaments |
| US9300829B2 (en) | 2014-04-04 | 2016-03-29 | Canon Kabushiki Kaisha | Image reading apparatus and correction method thereof |
| US20160129108A1 (en) | 2014-11-11 | 2016-05-12 | Medimmune Limited | Therapeutic combinations comprising anti-cd73 antibodies and uses thereof |
| WO2016106159A1 (en) | 2014-12-22 | 2016-06-30 | Enumeral Biomedical Holding, Inc. | Anti-pd-1 antibodies |
| US20170015758A1 (en) | 2014-01-21 | 2017-01-19 | Medimmune, Llc | Compositions And Methods For Modulating And Redirecting Immune Responses |
| WO2017025918A1 (en) | 2015-08-11 | 2017-02-16 | Novartis Ag | 5-bromo-2,6-di-(lh-pyrazol-l-yl)pyrimidin-4-amine for use in the treatment of cancer |
| US20180009899A1 (en) | 2016-07-11 | 2018-01-11 | Corvus Pharmaceuticals, Inc. | Anti-cd73 antibodies |
| US20190031766A1 (en) | 2017-06-22 | 2019-01-31 | Novartis Ag | Antibody molecules to cd73 and uses thereof |
| WO2019178269A2 (en) | 2018-03-14 | 2019-09-19 | Surface Oncology, Inc. | Antibodies that bind cd39 and uses thereof |
| WO2019183499A1 (en) * | 2018-03-22 | 2019-09-26 | Surface Oncology, Inc. | Anti-il-27 antibodies and uses thereof |
| WO2020123011A1 (en) * | 2018-12-13 | 2020-06-18 | Surface Oncology, Inc. | Anti-il-27 antibodies and uses thereof |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU2015244025B2 (en) * | 2014-04-08 | 2019-03-21 | Boston Pharmaceuticals Inc. | Binding molecules specific for IL-21 and uses thereof |
| AU2016274989A1 (en) * | 2015-06-12 | 2017-11-02 | Immunomedics, Inc. | Disease therapy with chimeric antigen receptor (car) constructs and t cells (car-t) or nk cells (car-nk) expressing car constructs |
| US20190270802A1 (en) * | 2016-10-21 | 2019-09-05 | Merck Sharp & Dohme Corp. | Treating cancer with a combination of a pd-1 antagonist and an il-27 antagonist |
-
2020
- 2020-09-25 MX MX2022003719A patent/MX2022003719A/es unknown
- 2020-09-25 BR BR112022004302A patent/BR112022004302A2/pt unknown
- 2020-09-25 TW TW114105158A patent/TW202521984A/zh unknown
- 2020-09-25 AU AU2020353672A patent/AU2020353672A1/en active Pending
- 2020-09-25 WO PCT/US2020/052849 patent/WO2021062244A1/en not_active Ceased
- 2020-09-25 US US17/033,469 patent/US20210115127A1/en not_active Abandoned
- 2020-09-25 EP EP20789783.6A patent/EP4034559A1/en active Pending
- 2020-09-25 CA CA3151078A patent/CA3151078A1/en active Pending
- 2020-09-25 KR KR1020227013170A patent/KR20220066346A/ko active Pending
- 2020-09-25 TW TW109133399A patent/TWI875823B/zh active
- 2020-09-25 JP JP2022518965A patent/JP2022549854A/ja active Pending
- 2020-09-25 CN CN202080065875.3A patent/CN115087671A/zh active Pending
-
2022
- 2022-03-21 IL IL291550A patent/IL291550A/en unknown
-
2023
- 2023-04-27 US US18/307,850 patent/US20240199732A1/en active Pending
Patent Citations (92)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3773919A (en) | 1969-10-23 | 1973-11-20 | Du Pont | Polylactide-drug mixtures |
| US3710795A (en) | 1970-09-29 | 1973-01-16 | Alza Corp | Drug-delivery device with stretched, rate-controlling membrane |
| EP0036676A1 (en) | 1978-03-24 | 1981-09-30 | The Regents Of The University Of California | Method of making uniformly sized liposomes and liposomes so made |
| EP0058481A1 (en) | 1981-02-16 | 1982-08-25 | Zeneca Limited | Continuous release pharmaceutical compositions |
| EP0088046A2 (de) | 1982-02-17 | 1983-09-07 | Ciba-Geigy Ag | Lipide in wässriger Phase |
| EP0133988A2 (de) | 1983-08-02 | 1985-03-13 | Hoechst Aktiengesellschaft | Regulatorische Peptide enthaltende pharmazeutische Präparate mit protrahierter Freisetzung und Verfahren zu deren Herstellung |
| EP0143949A1 (en) | 1983-11-01 | 1985-06-12 | TERUMO KABUSHIKI KAISHA trading as TERUMO CORPORATION | Pharmaceutical composition containing urokinase |
| US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
| US4863457A (en) | 1986-11-24 | 1989-09-05 | Lee David A | Drug delivery device |
| US5648260A (en) | 1987-03-18 | 1997-07-15 | Scotgen Biopharmaceuticals Incorporated | DNA encoding antibodies with altered effector functions |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| US5403484A (en) | 1988-09-02 | 1995-04-04 | Protein Engineering Corporation | Viruses expressing chimeric binding proteins |
| WO1990002809A1 (en) | 1988-09-02 | 1990-03-22 | Protein Engineering Corporation | Generation and selection of recombinant varied binding proteins |
| US5571698A (en) | 1988-09-02 | 1996-11-05 | Protein Engineering Corporation | Directed evolution of novel binding proteins |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| EP0430539A2 (en) | 1989-11-22 | 1991-06-05 | Visionex, Inc. | Ocular implants |
| WO1991010737A1 (en) | 1990-01-11 | 1991-07-25 | Molecular Affinities Corporation | Production of antibodies using gene libraries |
| US5780225A (en) | 1990-01-12 | 1998-07-14 | Stratagene | Method for generating libaries of antibody genes comprising amplification of diverse antibody DNAs and methods for using these libraries for the production of diverse antigen combining molecules |
| US5427908A (en) | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
| US5580717A (en) | 1990-05-01 | 1996-12-03 | Affymax Technologies N.V. | Recombinant library screening methods |
| WO1992001047A1 (en) | 1990-07-10 | 1992-01-23 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| US5969108A (en) | 1990-07-10 | 1999-10-19 | Medical Research Council | Methods for producing members of specific binding pairs |
| US5698426A (en) | 1990-09-28 | 1997-12-16 | Ixsys, Incorporated | Surface expression libraries of heteromeric receptors |
| EP0488401A1 (en) | 1990-11-30 | 1992-06-03 | Senju Pharmaceutical Co., Ltd. | A controlled-release pharmaceutical preparation for intra-ocular implant |
| US5501856A (en) | 1990-11-30 | 1996-03-26 | Senju Pharmaceutical Co., Ltd. | Controlled-release pharmaceutical preparation for intra-ocular implant |
| US5821047A (en) | 1990-12-03 | 1998-10-13 | Genentech, Inc. | Monovalent phage display |
| WO1992018619A1 (en) | 1991-04-10 | 1992-10-29 | The Scripps Research Institute | Heterodimeric receptor libraries using phagemids |
| US5658727A (en) | 1991-04-10 | 1997-08-19 | The Scripps Research Institute | Heterodimeric receptor libraries using phagemids |
| WO1993011236A1 (en) | 1991-12-02 | 1993-06-10 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US6933368B2 (en) | 1992-03-09 | 2005-08-23 | Protein Design Labs, Inc. | Increasing antibody affinity by altering glycosylation of immunoglobulin variable region |
| US5733743A (en) | 1992-03-24 | 1998-03-31 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| WO1994004678A1 (en) | 1992-08-21 | 1994-03-03 | Casterman Cecile | Immunoglobulins devoid of light chains |
| US6005079A (en) | 1992-08-21 | 1999-12-21 | Vrije Universiteit Brussels | Immunoglobulins devoid of light chains |
| WO1994025591A1 (en) | 1993-04-29 | 1994-11-10 | Unilever N.V. | PRODUCTION OF ANTIBODIES OR (FUNCTIONALIZED) FRAGMENTS THEREOF DERIVED FROM HEAVY CHAIN IMMUNOGLOBULINS OF $i(CAMELIDAE) |
| WO1994029351A2 (en) | 1993-06-16 | 1994-12-22 | Celltech Limited | Antibodies |
| WO1995015982A2 (en) | 1993-12-08 | 1995-06-15 | Genzyme Corporation | Process for generating specific antibodies |
| WO1995020401A1 (en) | 1994-01-31 | 1995-08-03 | Trustees Of Boston University | Polyclonal antibody libraries |
| US5516637A (en) | 1994-06-10 | 1996-05-14 | Dade International Inc. | Method involving display of protein binding pairs on the surface of bacterial pili and bacteriophage |
| WO1996027011A1 (en) | 1995-03-01 | 1996-09-06 | Genentech, Inc. | A method for making heteromultimeric polypeptides |
| US6300064B1 (en) | 1995-08-18 | 2001-10-09 | Morphosys Ag | Protein/(poly)peptide libraries |
| US5750753A (en) | 1996-01-24 | 1998-05-12 | Chisso Corporation | Method for manufacturing acryloxypropysilane |
| US6001329A (en) | 1996-05-06 | 1999-12-14 | Uab Research Foundation | Radiolabeled fusion toxins for cancer therapy |
| US6207156B1 (en) | 1997-03-21 | 2001-03-27 | Brigham And Women's Hospital, Inc. | Specific antibodies and antibody fragments |
| WO1998042752A1 (en) | 1997-03-21 | 1998-10-01 | Brigham And Women's Hospital Inc. | Immunotherapeutic ctla-4 binding peptides |
| WO1999051642A1 (en) | 1998-04-02 | 1999-10-14 | Genentech, Inc. | Antibody variants and fragments thereof |
| US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
| US6995259B1 (en) | 1998-10-23 | 2006-02-07 | Sirna Therapeutics, Inc. | Method for the chemical synthesis of oligonucleotides |
| WO2000037504A2 (en) | 1998-12-23 | 2000-06-29 | Pfizer Inc. | Human monoclonal antibodies to ctla-4 |
| WO2001014424A2 (en) | 1999-08-24 | 2001-03-01 | Medarex, Inc. | Human ctla-4 antibodies and their uses |
| US8728474B2 (en) | 2002-07-03 | 2014-05-20 | Ono Pharmaceutical Co., Ltd. | Immunopotentiative composition |
| US7595048B2 (en) | 2002-07-03 | 2009-09-29 | Ono Pharmaceutical Co., Ltd. | Method for treatment of cancer by inhibiting the immunosuppressive signal induced by PD-1 |
| EP1537878A1 (en) | 2002-07-03 | 2005-06-08 | Ono Pharmaceutical Co., Ltd. | Immunopotentiating compositions |
| US9073994B2 (en) | 2002-07-03 | 2015-07-07 | Ono Pharmaceutical Co., Ltd. | Immunopotentiative composition |
| US9067999B1 (en) | 2002-07-03 | 2015-06-30 | Ono Pharmaceutical Co., Ltd. | Immunopotentiative composition |
| US20080241223A1 (en) | 2004-04-30 | 2008-10-02 | Allergan, Inc. | Extended release biodegradable ocular implants |
| US8008449B2 (en) | 2005-05-09 | 2011-08-30 | Medarex, Inc. | Human monoclonal antibodies to programmed death 1 (PD-1) and methods for treating cancer using anti-PD-1 antibodies alone or in combination with other immunotherapeutics |
| EP2161336A1 (en) | 2005-05-09 | 2010-03-10 | ONO Pharmaceutical Co., Ltd. | Human monoclonal antibodies to programmed death 1(PD-1) and methods for treating cancer using anti-PD-1 antibodies alone or in combination with other immunotherapeutics |
| US8779105B2 (en) | 2005-05-09 | 2014-07-15 | Medarex, L.L.C. | Monoclonal antibodies to programmed death 1 (PD-1) |
| US7943743B2 (en) | 2005-07-01 | 2011-05-17 | Medarex, Inc. | Human monoclonal antibodies to programmed death ligand 1 (PD-L1) |
| WO2007024715A2 (en) | 2005-08-19 | 2007-03-01 | Abbott Laboratories | Dual variable domain immunoglobin and uses thereof |
| WO2008024188A2 (en) | 2006-08-18 | 2008-02-28 | Abbott Laboratories | Dual variable domain immunoglobulin and uses thereof |
| US8900587B2 (en) | 2007-06-18 | 2014-12-02 | Merck Sharp & Dohme Corp. | Antibodies to human programmed death receptor PD-1 |
| US8952136B2 (en) | 2007-06-18 | 2015-02-10 | Merck Sharp & Dohme B.V. | Antibodies to human programmed death receptor PD-1 |
| EP2170959A1 (en) | 2007-06-18 | 2010-04-07 | N.V. Organon | Antibodies to human programmed death receptor pd-1 |
| US8354509B2 (en) | 2007-06-18 | 2013-01-15 | Msd Oss B.V. | Antibodies to human programmed death receptor PD-1 |
| WO2009036379A2 (en) | 2007-09-14 | 2009-03-19 | Adimab, Inc. | Rationally designed, synthetic antibody libraries and uses therefor |
| WO2009156737A1 (en) | 2008-06-25 | 2009-12-30 | Vernalis (R&D) Limited | Triazolo [4, 5-d] pyramidine derivatives and their use as purine receptor antagonists |
| US8114845B2 (en) | 2008-08-25 | 2012-02-14 | Amplimmune, Inc. | Compositions of PD-1 antagonists and methods of use |
| WO2010027827A2 (en) | 2008-08-25 | 2010-03-11 | Amplimmune, Inc. | Targeted costimulatory polypeptides and methods of use to treat cancer |
| WO2010077634A1 (en) | 2008-12-09 | 2010-07-08 | Genentech, Inc. | Anti-pd-l1 antibodies and their use to enhance t-cell function |
| US9029393B2 (en) | 2009-01-26 | 2015-05-12 | Kaldi Pharma, Sas | Adenosine receptor ligands and uses thereof |
| WO2010105256A1 (en) | 2009-03-13 | 2010-09-16 | Adimab, Inc. | Rationally designed, synthetic antibody libraries and uses therefor |
| US9133197B2 (en) | 2009-03-20 | 2015-09-15 | Sigma-Tau Industrie Farmaceutiche Riunite S.P.A. | Oxidated derivatives of triazolylpurines useful as ligands of the adenosine A2A receptor and their use as medicaments |
| WO2010118243A2 (en) * | 2009-04-08 | 2010-10-14 | Genentech, Inc. | Use of il-27 antagonists to treat lupus |
| WO2011066342A2 (en) | 2009-11-24 | 2011-06-03 | Amplimmune, Inc. | Simultaneous inhibition of pd-l1/pd-l2 |
| WO2011095625A1 (en) | 2010-02-05 | 2011-08-11 | Heptares Therapeutics Limited | 1,2,4-triazine-4-amine derivatives |
| US8796284B2 (en) | 2010-03-31 | 2014-08-05 | Palobiofarma, S.L. | 4-aminopyrimidine derivatives and their as as adenosine A2a receptor antagonists |
| WO2012009568A2 (en) | 2010-07-16 | 2012-01-19 | Adimab, Llc | Antibody libraries |
| WO2013079174A1 (en) | 2011-11-28 | 2013-06-06 | Merck Patent Gmbh | Anti-pd-l1 antibodies and uses thereof |
| WO2013173223A1 (en) | 2012-05-15 | 2013-11-21 | Bristol-Myers Squibb Company | Cancer immunotherapy by disrupting pd-1/pd-l1 signaling |
| WO2015103072A1 (en) | 2013-12-30 | 2015-07-09 | Epimab Biotherapeutics | Fabs-in-tandem immunoglobulin and uses thereof |
| US20170015758A1 (en) | 2014-01-21 | 2017-01-19 | Medimmune, Llc | Compositions And Methods For Modulating And Redirecting Immune Responses |
| US9300829B2 (en) | 2014-04-04 | 2016-03-29 | Canon Kabushiki Kaisha | Image reading apparatus and correction method thereof |
| US20160129108A1 (en) | 2014-11-11 | 2016-05-12 | Medimmune Limited | Therapeutic combinations comprising anti-cd73 antibodies and uses thereof |
| WO2016106159A1 (en) | 2014-12-22 | 2016-06-30 | Enumeral Biomedical Holding, Inc. | Anti-pd-1 antibodies |
| WO2017025918A1 (en) | 2015-08-11 | 2017-02-16 | Novartis Ag | 5-bromo-2,6-di-(lh-pyrazol-l-yl)pyrimidin-4-amine for use in the treatment of cancer |
| US20180009899A1 (en) | 2016-07-11 | 2018-01-11 | Corvus Pharmaceuticals, Inc. | Anti-cd73 antibodies |
| US20190031766A1 (en) | 2017-06-22 | 2019-01-31 | Novartis Ag | Antibody molecules to cd73 and uses thereof |
| WO2019178269A2 (en) | 2018-03-14 | 2019-09-19 | Surface Oncology, Inc. | Antibodies that bind cd39 and uses thereof |
| US20190284295A1 (en) | 2018-03-14 | 2019-09-19 | Surface Oncology, Inc. | Antibodies That Bind CD39 and Uses Thereof |
| WO2019183499A1 (en) * | 2018-03-22 | 2019-09-26 | Surface Oncology, Inc. | Anti-il-27 antibodies and uses thereof |
| WO2020123011A1 (en) * | 2018-12-13 | 2020-06-18 | Surface Oncology, Inc. | Anti-il-27 antibodies and uses thereof |
Non-Patent Citations (178)
| Title |
|---|
| "Epitope Mapping Protocols in Methods in Molecular Biology", vol. 66, 1996 |
| "GenBank", Database accession no. AAC51773 |
| "Genbank", Database accession no. NP 001288667 |
| "Molecular Cloning--A Laboratory Manual", 2001, COLD SPRING HARBOR LABORATORY PRESS |
| "Remington's Pharmaceutical Sciences", 1995, MACK PUBLISHING COMPANY |
| "UniProt", Database accession no. Q495A1 |
| ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410 |
| ALTSCHUL ET AL., NUCLEIC ACIDS RES., vol. 25, no. 17, 1997, pages 3389 - 3402 |
| ANONYMOUS: "Anti-human IL27 Fab Fragment (4066) - Creative Biolabs", 1 January 2007 (2007-01-01), XP055753484, Retrieved from the Internet <URL:https://www.creativebiolabs.net/Anti-IL27-Fab-40111.htm> [retrieved on 20201124] * |
| AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 1987, GREENE PUBLISHING AND WILEY INTERSCIENCE |
| BALDRIDGE ET AL., METHODS, vol. 19, 1999, pages 103 - 107 |
| BATZER ET AL., NUCLEIC ACID RES, vol. 19, 1991, pages 5081 |
| BERGE ET AL., JPHARM SCI, vol. 66, 1977, pages 1 - 19 |
| BIEG ET AL., AUTOIMMUNITY, vol. 31, no. 1, 1999, pages 15 - 24 |
| BLANK ET AL., CANCER IMMUNOL. IMMUNOTHER., vol. 54, 2005, pages 307 - 314 |
| BLANK, C. ET AL., IMMUNOL. IMMUNOTHER., vol. 56, no. 5, 29 December 2006 (2006-12-29), pages 739 - 745 |
| BODER ET AL., METHODS ENZYMOLOGY, vol. 328, 2000, pages 430 - 444 |
| BRENNAN ET AL., SCIENCE, vol. 229, 1985, pages 81 |
| BRINKMAN ET AL., J IMMUNOL METHODS, vol. 184, 1995, pages 177 - 186 |
| BROWN ET AL., J. IMMUNOL., vol. 170, 2003, pages 1257 - 66 |
| BURTON ET AL., ADVANCES IN IMMUNOLOGY, vol. 57, 1994, pages 191 - 280 |
| BURTON ET AL., ADVIMMUN, vol. 51, 1992, pages 1 - 18 |
| CAMACHO ET AL., J. CLIN. ONCOLOGY, vol. 22, no. 145, 2004 |
| CANFIELD ET AL., J EXP MED, vol. 173, 1991, pages 1483 - 1491 |
| CARON ET AL., J EXP MED, vol. 176, 1992, pages 1191 - 1195 |
| CAS, no. 155270-99-8 |
| CHASTEEN ET AL., NUCLEIC ACIDS RES, vol. 34, no. 21, 2006, pages e145 |
| CHENMELLMAN, IMMUNITY, vol. 39, no. 1, 2013, pages 61 - 730 |
| CHEUNG ET AL., VIROLOGY, vol. 176, 1990, pages 546 |
| CO ET AL., MOL IMMUNOL, vol. 30, 1993, pages 1361 |
| CORNELIS, CURR OPIN BIOTECHNOL, vol. 11, 2000, pages 450 - 454 |
| D'ARCY ET AL., ACTA CRYST. D BIOL CRYST., vol. 63, 2007, pages 550 - 54 |
| DEANS ET AL., PROC NATL ACAD SCI USA, vol. 81, 1984, pages 1292 |
| DI NIRO ET AL., BIOCHEM J, vol. 388, no. Pt 3, 2005, pages 889 - 894 |
| DIAKOWSKI ET AL., ADV. CLIN. EXP. MED., vol. 22, no. 5, 2013, pages 683 - 691 |
| DIETRICH ET AL., J. IMMUNOL., vol. 192, 2014, pages 5382 - 5389 |
| DONG ET AL., J. MOL. MED., vol. 81, 2003, pages 281 - 7 |
| DONG ET AL., NAT MED, vol. 8, no. 8, 2002, pages 793 - 800 |
| DUNCANWINTER, NATURE, vol. 322, 1988, pages 738 - 40 |
| E. MEYERSW. MILLER, CABIOS, vol. 4, 1989, pages 11 - 17 |
| EMSLEY ET AL., ACTA CRYST. D BIOL. CYRST., vol. 66, 2010, pages 486 - 501 |
| ENGBERG ET AL., METHODS MOL BIOL, vol. 51, 1995, pages 355 - 376 |
| EPPSTEIN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 3688 - 3692 |
| ESTEP ET AL.: "High throughput solution-based measurement of antibody-antigen affinity and epitope binning", MABS, vol. 5, no. 2, 2013, pages 270 - 278, XP055105281, DOI: 10.4161/mabs.23049 |
| ETZ ET AL., JBACTERIOL, vol. 183, 2001, pages 6924 - 6935 |
| EVANS ET AL., ACTA CRYST. BIOL. CRYST., vol. 69, 2013, pages 1204 - 14 |
| FABBI ET AL., MEDIATORS INFLAMM, 1 February 2017 (2017-02-01), pages 3958069 |
| FASEB J., HUMAN GENOME SCIENCES, INC., 1999 |
| FERGUSSON ET AL., CELL REPORTS, vol. 9, no. 3, 2014, pages 1075 - 1088 |
| FURSOV ET AL., ASSAY DRUG DEV TECHNOL, vol. 9, no. 4, 2011, pages 420 - 429 |
| GAO ET AL., CLIN CANCER RES, vol. 15, 2009, pages 971 - 979 |
| GHEBEH ET AL., NEOPLASIA, vol. 8, 2006, pages 190 - 198 |
| GRABHERR ET AL., COMB CHEM HIGH THROUGHPUT SCREEN, vol. 4, 2001, pages 185 - 192 |
| GRUBER ET AL., J IMMUNOL, vol. 152, 1994, pages 5368 |
| GRUBER ET AL., J. IMMUNOL., vol. 152, 1994, pages 5368 |
| GUPTA ET AL., VACCINE, vol. 13, no. 14, 1995, pages 1263 - 1276 |
| GURP ET AL., AM J TRANSPLANTATION, vol. 8, no. 8, 2008, pages 1711 - 1718 |
| HAMANISHI ET AL., PROC NAT ACAD SCI USA, vol. 104, 2007, pages 3360 - 3365 |
| HANAHANWEINBERG, CELL, vol. 144, no. 5, 2011, pages 646 - 674 |
| HANES ET AL., NAT BIOTECHNOL, vol. 18, 2000, pages 1287 - 1292 |
| HANOUSKA ET AL., CLIN CANCER RES, vol. 13, no. 2, 2007, pages 523 - 531 |
| HARDINGLONBERG, ANN. N.Y. ACAD. SCI., vol. 764, 1995, pages 536 - 546 |
| HELLE JENSEN ET AL: "EBI3 regulates the NK cell response to mouse cytomegalovirus infection", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, vol. 114, no. 7, 31 January 2017 (2017-01-31), pages 1625 - 1630, XP055753073, ISSN: 0027-8424, DOI: 10.1073/pnas.1700231114 * |
| HETHERINGTON ET AL., ANTIMICROBIAL AGENTS AND CHEMOTHERAPY, vol. 50, no. 10, 2006, pages 3499 - 3500 |
| HINO ET AL., CANCER, vol. 116, no. 7, 2010, pages 1757 - 1766 |
| HISADA ET AL., CANCER RES., vol. 64, 2004, pages 1152 - 1156 |
| HODGSON ET AL., J PHARMACOL EXP THER, vol. 330, no. 1, 2009, pages 294 - 303 |
| HOLLINGER ET AL., PROC NATL ACAD SCI USA, vol. 90, 1993, pages 6444 - 6448 |
| HOLLINGER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 6448 |
| HOOGENBOOM, TRENDS IN BIOTECHNOLOGY, vol. 15, 1997, pages 62 - 70 |
| HOU ET AL., CYTOKINE, vol. 10, 1998, pages 319 - 30 |
| HOUDEBINE, CURR OPIN BIOTECHNOL, vol. 13, no. 6, 2002, pages 625 - 629 |
| HUDSONKORTT, J. IMMUNOL. METHODS, vol. 231, no. 1, 1999, pages 177 - 189 |
| HURWITZ ET AL., PRO. NATL. ACAD. SCI. USA, vol. 95, no. 17, 1998, pages 10067 - 10071 |
| INMAN ET AL., CANCER, vol. 109, 2007, pages 1499 - 1505 |
| ISHIDA, Y. ET AL., EMBO J, vol. 11, 1992, pages 3887 - 3895 |
| ISNER ET AL., J. CLIN. INVEST., vol. 103, 1999, pages 1231 - 1236 |
| IWAI ET AL., PROC. NAT'L. ACAD. SCI. USA, vol. 99, 2002, pages 12293 - 7 |
| JANKOWSKI ET AL., ARCH IMMUNOL. THER. EXP., vol. 58, 2010, pages 417 - 425 |
| JIN ET AL., MUCOSAL IMMUNOLOGY, vol. 6, 19 December 2012 (2012-12-19), pages 886 - 99 |
| JOHNSON ET AL., J MED CHEM, vol. 42, 1999, pages 4640 - 4649 |
| KABASH, ACTA. CRYST. D. BIOL. CYRST., vol. 66, 2010, pages 125 - 32 |
| KASZUBSKA ET AL., PROTEIN EXPRESSION AND PURIFICATION, vol. 18, 2000, pages 213 - 220 |
| KETTLEBOROUGH ET AL., EUR J IMMUNOL, vol. 24, 1994, pages 952 - 958 |
| KIEKE ET AL., PROTEIN ENG, vol. 10, 1997, pages 1303 - 1310 |
| KIM ET AL., AMER. J. PATH., vol. 156, 2000, pages 1345 - 1362 |
| KIM ET AL., J . BIOL. CHEM., vol. 275, 2000, pages 33920 - 33928 |
| KINSTLER ET AL., ADVANCED DRUG DELIVERIES REVIEWS, vol. 54, 2002, pages 477 - 485 |
| KIRKLAND ET AL., J. IMMUNOL., vol. 137, 1986, pages 3614 |
| KITANO ET AL., ESMO OPEN, vol. 2, no. 2, 2017, pages e000150 |
| KLEFFEL ET AL., CELL, vol. 162, no. 6, 2015, pages 1242 - 1256 |
| KLEMM ET AL., MICROBIOLOGY, vol. 146, 2000, pages 3025 - 3032 |
| KONISHI ET AL., CLIN. CANCER RES., vol. 10, 2004, pages 5094 - 100 |
| KOSTELNY ET AL., J IMMUNOL, vol. 148, no. 5, 1992, pages 1547 - 1553 |
| KOSTELNY ET AL., J. IMMUNOL., vol. 148, no. 5, 1992, pages 1547 - 1553 |
| KUMAR ET AL., ANGIOGENESIS: FROM MOLECULAR TO INTEGRATIVE PHARM., 2000, pages 169 - 180 |
| LANGER ET AL., J. BIOMED. MATER. RES., vol. 15, 1981, pages 167 - 277 |
| LANGER, CHEM. TECH., vol. 12, 1982, pages 98 - 105 |
| LAROUSSERIE ET AL., AM. J. PATHOL., vol. 166, no. 4, 2005, pages 1217 - 28 |
| LEE ET AL., BIOCONJUG CHEM, vol. 10, no. 6, 1999, pages 973 - 8 |
| LEWITT ET AL., ANN NEUROL, vol. 63, no. 3, 2008, pages 295 - 302 |
| LI ET AL., CANCER RESEARCH, vol. 77, no. 21, 2017, pages e108 - e110 |
| LI ET AL., GENOME BIOLOGY, vol. 17, no. 1, 2016, pages 174 |
| LIU ET AL., SCAN. J. IMMUNOL., vol. 68, 2008, pages 22 - 299 |
| LODMELL ET AL., VACCINE, vol. 18, 2000, pages 1059 - 1066 |
| LONBERG ET AL., NATURE, vol. 368, no. 6474, 1994, pages 856 - 859 |
| LONBERG, NATURE BIOTECH, vol. 23, no. 9, 2005, pages 1117 - 1125 |
| LONBERGHUSZAR, INTERN. REV. IMMUNOL., vol. 13, 1995, pages 65 - 93 |
| LUSKYBOTCHAN, NATURE, vol. 293, 1981, pages 79 |
| MCCOY ET AL., J. APPL. CYRST., vol. 40, 2007, pages 658 - 74 |
| MERZ ET AL., J NEUROSCI METHODS, vol. 62, no. 1-2, 1995, pages 213 - 9 |
| MICHAEL ET AL., GENE THER, vol. 2, 1995, pages 660 - 668 |
| MIGONE ET AL., IMMUNITY, vol. 16, no. 3, March 2002 (2002-03-01), pages 479 - 92 |
| MILSTEINCUELLO, NATURE, vol. 305, 1983, pages 537 - 539 |
| MOKYR ET AL., CANCER RES, vol. 58, 1998, pages 5301 - 5304 |
| MOLDENHAUER ET AL., SCAND. J. IMMUNOL., vol. 32, 1990, pages 77 |
| MOREL ET AL., MOL. IMMUNOL., vol. 25, no. 1, 1988, pages 7 |
| MOUSA ET AL., ANGIOGEN STIIN. INHIB., vol. 35, 2000, pages 42 - 44 |
| MUELLER ET AL., MOLIMMUNOL, vol. 34, no. 6, 1997, pages 441 - 452 |
| MULLIGANBERG, PROC NATL ACAD SCI USA, vol. 78, 1981, pages 2072 |
| MUYLDERMANS ET AL., TRENDS BIOCHEM. SCI., vol. 26, 2001, pages 230 - 235 |
| NAKANISHI ET AL., CANCER IMMUNOL IMMUNOTHER, vol. 56, 2007, pages 1173 - 1182 |
| NEEDLEMANWUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 444 - 453 |
| NEWMAN ET AL., ACTA CRYST. D, vol. 61, 2005, pages 1426 |
| NOMI ET AL., CLIN CANCER RES, vol. 11, 2005, pages 2947 - 2953 |
| NUTTALL ET AL., CURR. PHARM. BIOTECH., vol. 1, 2000, pages 253 - 263 |
| OHTSUKA ET AL., BIOL. CHEM., vol. 260, 1985, pages 2605 - 2608 |
| PAVISIC ET AL., INT J PHARM, vol. 387, no. 1-2, 2010, pages 110 - 119 |
| PEARSONLIPMAN, PROC. NAT'L. ACAD. SCI. USA, vol. 85, 1988, pages 2444 |
| PEREBOEV ET AL., J VIROL, vol. 75, 2001, pages 7107 - 7113 |
| PERSIC ET AL., GENE, vol. 187, 1997, pages 9 - 18 |
| POLJAK, STRUCTURE, vol. 2, no. 12, 1994, pages 1121 - 1123 |
| REECE G. MARILLIER ET AL: "IL-27p28 is essential for parent-to-F1 acute graft-versus-host disease : Immunomodulation", EUROPEAN JOURNAL OF IMMUNOLOGY, vol. 44, no. 7, 1 July 2014 (2014-07-01), Weinheim, pages 2064 - 2073, XP055753104, ISSN: 0014-2980, DOI: 10.1002/eji.201444491 * |
| REICHMANN ET AL., J. IMMUNOL. METH., vol. 231, 1999, pages 25 - 38 |
| ROBERTS ET AL., ADVANCED DRUG DELIVERY REVIEWS, vol. 54, 2002, pages 459 - 476 |
| ROGERS ET AL., J NUCL MED, vol. 38, 1997, pages 1221 - 1229 |
| RONDONMARASCO, ANNU. REV. MICROBIOL., vol. 51, 1997, pages 257 - 283 |
| ROSSOLINI ET AL., MOL. CELL. PROBES, vol. 113, 1994, pages 91 - 101 |
| SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS |
| SARVER ET AL., PROC NATL ACAD SCI USA, vol. 79, 1982, pages 7147 |
| SAUER ET AL., J. IMMUNOLOGY, vol. 181, pages 6148 - 6157 |
| SCHAFFITZEL ET AL., J IMMUNOL METHODS, vol. 231, no. 1-2, 1999, pages 147 - 157 |
| SCHOONBROODT ET AL., NUCLEIC ACIDS RES, vol. 33, no. 9, 2005, pages e81 |
| SHALABY ET AL., J. EXP. MED., vol. 175, 1992, pages 217 - 225 |
| SHI ET AL., 1MB, vol. 397, 2010, pages 385 - 396 |
| SHIMAUCHI ET AL., INT J CANCER, vol. 121, 2007, pages 2585 - 2590 |
| SHIMIZU ET AL., J. IMMUNOL., vol. 176, 2006, pages 7317 - 7324 |
| SHIRAISHI ET AL., NUCLEIC ACIDS SYMPOSIUM SERIES, vol. 51, no. 1, 2007, pages 129 - 130 |
| SHOPES, IMMUNOL, vol. 148, 1992, pages 2918 - 2922 |
| SIDMAN ET AL., BIOPOLYMERS, vol. 22, 1983, pages 547 - 556 |
| SIEGEL ET AL., J IMMUNOL METHODS, vol. 286, no. 1-2, 2004, pages 141 - 153 |
| SMITHWATERMAN, ADV. APPL. MATH., vol. 2, 1981, pages 482 |
| SONGSIVILAILACHMANN, CLIN. EXP. IMMUNOL., vol. 79, 1990, pages 315 - 321 |
| SOUTHERNBERG1982, MOLAPPL GENET, vol. 1, pages 327 |
| STAHLI ET AL., METHODS IN ENZYMOLOGY, vol. 9, 1983, pages 242 |
| SURESH ET AL., METHODS ENZYMOL., vol. 121, 1986, pages 210 |
| TAKAHASHI ET AL., NAT. MED., vol. 5, 1995, pages 434 - 438 |
| THOMPSON ET AL., CLIN GENITOURIN CANCER, vol. 5, 2006, pages 206 - 211 |
| TICKLE ET AL., STRANISO. CAMBRIDGE, UNITED KINGDON: GLOBAL PHASING LTD., 2018 |
| TOCHIZAWA ET AL., J IMMUNOL METHODS, vol. 313, no. 1-2, 2006, pages 29 - 37 |
| TODOROVSKA ET AL., J. IMMUNOL. METHODS, vol. 248, no. 1, 2001, pages 47 - 66 |
| TUTT ET AL., J IMMUNOL, vol. 147, 1991, pages 60 |
| TUTT ET AL., J. IMMUNOL., vol. 147, 1991, pages 60 |
| VAGIN ET AL., J. APPL. CYRST., vol. 30, 1997, pages 1022 - 25 |
| VAN KUIK-ROMEIJN ET AL., TRANSGENIC RES, vol. 9, no. 2, 2000, pages 155 - 159 |
| VARNER ET AL., ANGIOGEN., vol. 3, 1999, pages 53 - 60 |
| VONRHEIN ET AL., ACTA CRYST. BIOL. CRYST., vol. 67, 2011, pages 292 - 302 |
| WELCHREDVANLY: "Handbook of Radiopharmaceuticals: Radiochemistry and Applications", 2003, JOHN WILEY AND SONS |
| WIGLER ET AL., CELL, vol. 16, 1979, pages 77 |
| WINN ET AL., ACTA CRYST. D BIOL. CRYST., vol. 67, 2011, pages 235 - 42 |
| WRIGHT ET AL., EMBO J, vol. 10, no. 10, 1991, pages 2717 - 2723 |
| WU ET AL., NAT BIOTECHNOL, vol. 25, no. 11, 2007, pages 1290 - 1297 |
| XU ET AL., PROTEIN ENG DES SEL, vol. 26, no. 10, 2013, pages 663 - 670 |
| YANG ET AL., INVEST OPHTHALMOL VIS SCI, vol. 49, no. 6, 2008, pages 2518 - 2525 |
| YEUNG ET AL., BIOTECHNOL PROG, vol. 18, 2002, pages 212 - 220 |
| YOSHIDA ET AL., ANNU. REV IMMUNOL., vol. 33, 2015, pages 417 - 43 |
| ZAPATA ET AL., PROTEIN ENG, vol. 8, no. 10, 1995, pages 1057 - 1062 |
| ZHAN ET AL., DRUG DISCOV TODAY, vol. 21, no. 6, 2016, pages 1027 - 1036 |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2022236134A1 (en) * | 2021-05-07 | 2022-11-10 | Surface Oncology, Inc. | Anti-il-27 antibodies and uses thereof |
| US12577299B2 (en) | 2021-05-07 | 2026-03-17 | Surface Oncology, LLC | Anti-IL-27 antibodies and uses thereof |
| WO2026055168A1 (en) * | 2024-09-06 | 2026-03-12 | Surface Oncology, LLC | Anti-il-27 antibodies and uses and doses thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| MX2022003719A (es) | 2022-04-26 |
| CA3151078A1 (en) | 2021-04-01 |
| BR112022004302A2 (pt) | 2022-06-21 |
| AU2020353672A1 (en) | 2022-03-31 |
| KR20220066346A (ko) | 2022-05-24 |
| CN115087671A (zh) | 2022-09-20 |
| US20210115127A1 (en) | 2021-04-22 |
| TW202128752A (zh) | 2021-08-01 |
| TW202521984A (zh) | 2025-06-01 |
| JP2022549854A (ja) | 2022-11-29 |
| TWI875823B (zh) | 2025-03-11 |
| IL291550A (en) | 2022-05-01 |
| EP4034559A1 (en) | 2022-08-03 |
| US20240199732A1 (en) | 2024-06-20 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20260055176A1 (en) | Anti-il-27 antibodies and uses thereof | |
| US20250154244A1 (en) | Anti-il-27 antibodies and uses thereof | |
| US20240199732A1 (en) | Anti-IL-27 Antibodies and Uses Thereof | |
| KR20240005809A (ko) | 항-il-27 항체 및 이의 용도 | |
| EA052811B1 (ru) | Антитела против ил-27 и их применение | |
| EA051778B1 (ru) | Антитела к il-27 и их применение |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20789783 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3151078 Country of ref document: CA |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112022004302 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2022518965 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2020353672 Country of ref document: AU Date of ref document: 20200925 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20227013170 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2020789783 Country of ref document: EP Effective date: 20220425 |
|
| ENP | Entry into the national phase |
Ref document number: 112022004302 Country of ref document: BR Kind code of ref document: A2 Effective date: 20220309 |