WO2021042072A1 - Methods and compositions for the modification and delivery of lymphocytes - Google Patents
Methods and compositions for the modification and delivery of lymphocytes Download PDFInfo
- Publication number
- WO2021042072A1 WO2021042072A1 PCT/US2020/048843 US2020048843W WO2021042072A1 WO 2021042072 A1 WO2021042072 A1 WO 2021042072A1 US 2020048843 W US2020048843 W US 2020048843W WO 2021042072 A1 WO2021042072 A1 WO 2021042072A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cells
- cell
- modified
- replication incompetent
- recombinant retroviral
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/39—Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/15—Natural-killer [NK] cells; Natural-killer T [NKT] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/31—Chimeric antigen receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/421—Immunoglobulin superfamily
- A61K40/4211—CD19 or B4
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/421—Immunoglobulin superfamily
- A61K40/4212—CD22, BL-CAM, siglec-2 or sialic acid binding Ig-related lectin 2
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/4214—Receptors for cytokines
- A61K40/4215—Receptors for tumor necrosis factors [TNF], e.g. lymphotoxin receptor [LTR], CD30
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/4221—CD20
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0646—Natural killers cells [NK], NKT cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/80—Vaccine for a specifically defined cancer
- A61K2039/804—Blood cells [leukemia, lymphoma]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2121/00—Preparations for use in therapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/31—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/38—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2300/00—Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2501/00—Active agents used in cell culture processes, e.g. differentation
- C12N2501/70—Enzymes
- C12N2501/73—Hydrolases (EC 3.)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2510/00—Genetically modified cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/15011—Lentivirus, not HIV, e.g. FIV, SIV
- C12N2740/15023—Virus like particles [VLP]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/15011—Lentivirus, not HIV, e.g. FIV, SIV
- C12N2740/15041—Use of virus, viral particle or viral elements as a vector
- C12N2740/15043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/15011—Lentivirus, not HIV, e.g. FIV, SIV
- C12N2740/15051—Methods of production or purification of viral material
- C12N2740/15052—Methods of production or purification of viral material relating to complementing cells and packaging systems for producing virus or viral particles
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16041—Use of virus, viral particle or viral elements as a vector
- C12N2740/16043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2830/00—Vector systems having a special element relevant for transcription
- C12N2830/20—Vector systems having a special element relevant for transcription transcription of more than one cistron
- C12N2830/205—Vector systems having a special element relevant for transcription transcription of more than one cistron bidirectional
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/24—Hydrolases (3) acting on glycosyl compounds (3.2)
- C12N9/2402—Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing O- and S- glycosyl compounds (3.2.1)
- C12N9/2474—Hyaluronoglucosaminidase (3.2.1.35), i.e. hyaluronidase
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y302/00—Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2)
- C12Y302/01—Glycosidases, i.e. enzymes hydrolysing O- and S-glycosyl compounds (3.2.1)
- C12Y302/01035—Hyaluronoglucosaminidase (3.2.1.35), i.e. hyaluronidase
Definitions
- PCT/US2018/051392 filed September 17, 2018; and claims the benefit of U.S. Provisional Application No. 62/726,293, filed September 2, 2018; U.S. Provisional Application No. 62/726,294, filed September 2, 2018; U.S. Provisional Application No. 62/728,056 filed September 6, 2018; U.S. Provisional Application No. 62/732,528, filed September 17, 2018; U.S. Provisional Application No. 62/821,434, filed March 20, 2019; and U.S. Provisional Application No. 62/894,853, filed September 1, 2019; and International Application No. PCT/US2018/051392 is a continuation-in-part of International Application No.
- PCT/US2018/020818 filed March 3, 2018; and claims the benefit of U.S. Provisional Application No. 62/560,176, filed September 18, 2017; U.S. Provisional Application No. 62/564,253, filed September 27, 2017; U.S. Provisional Application No. 62/564,991, filed September 28, 2017; and U.S. Provisional Application No. 62/728,056, filed September 6, 2018; International Application No. PCT/US2018/020818 is a continuation-in-part of International Application No. PCT/US2017/023112 filed March 19, 2017; a continuation-in-part of International Application No. PCT/US2017/041277 filed July 8, 2017; a continuation-in-part of U.S. Application No.
- This disclosure relates to the field of immunology, or more specifically, to the genetic modification of T lymphocytes or other immune cells, and methods of controlling proliferation of such cells.
- Lymphocytes isolated from a subject can be activated in vitro and genetically modified to express synthetic proteins that enable redirected engagement with other cells and environments based upon the genetic programs incorporated.
- synthetic proteins include engineered T cell receptors (TCRs) and chimeric antigen receptors (CARs).
- TCRs engineered T cell receptors
- CARs chimeric antigen receptors
- One CAR that is currently used is a fusion of an extracellular recognition domain (e.g., an antigen-binding domain), a transmembrane domain, and one or more intracellular signaling domains encoded by a replication incompetent recombinant retrovirus.
- CAR therapies further cannot be controlled for propagation rate in vivo once introduced into the body, nor safely directed towards targets that are also expressed outside the tumor.
- CAR therapies today are typically infused from cells expanded ex vivo from 12 to 28 days using doses from 1 x 10 s to 1 x 10 s cells/kg and are directed towards targets, for example tumor targets, for which off tumor on target toxicity is generally acceptable.
- Such cell lines and methods would be useful in analyzing different components of recombinant viruses, such as recombinant retroviral particles, and for methods that use packaging cells lines for the production of recombinant retroviral particles.
- recombinant viruses such as recombinant retroviral particles
- packaging cells lines for the production of recombinant retroviral particles.
- cytokines bind to and stimulate T cells and NK cells nonspecifically, thus reducing the amount of cytokines available to stimulate the CAR T cells or NK cells.
- the cytokines also can diffuse away further reducing the cytokines available to stimulate the CAR T cells or NK cells.
- kits that simplify and speed up the process of genetically modifying lymphocytes, in illustrative embodiments T cells and/or NK cells.
- Some aspects and embodiments provided herein are well-suited for point-of-care cell processing and do not require transport of cells to specialized processing facilities.
- methods, uses, compositions, and kits provided herein help overcome issues related to the effectiveness and safety of methods for transducing and/or modifying and in illustrative embodiments genetically modifying lymphocytes such as T cells and/or NK cells. Certain embodiments of such methods are useful for performing adoptive cell therapy with these cells.
- kits for modifying lymphocytes, especially T cell and/or NK cells, and/or for regulating the activity of transduced, genetically modified, and/or modified T cells and/or NK cells are provided herein.
- Such methods, compositions, and kits provide improved efficacy and safety over current technologies, especially with respect to T cells and/or NK cells that express engineered T cell receptors (TCRs), chimeric antigen receptors (CARs), and in illustrative embodiments microenvironment restricted biologic (“MRB”) CARs.
- TCRs engineered T cell receptors
- CARs chimeric antigen receptors
- MRB microenvironment restricted biologic
- Transduced and/or modified and in illustrative embodiments genetically modified T cells and/or NK cells that are produced by and/or used in methods provided herein include functionality and combinations of functionality, in illustrative embodiments delivered from retroviral (e.g. lentiviral) genomes via retroviral (e.g. lentiviral) particles, that provide improved features for such cells and for methods that utilize such cells, such as research methods, commercial production methods, and adoptive cellular therapy. For example, such cells can be produced in less time ex vivo, and that have improved growth properties that can be better regulated.
- such methods, uses, compositions, and kits include, or are adapted for intramuscular or in further illustrative embodiments, subcutaneous delivery to a subject.
- methods are provided for transducing and/or modifying and in illustrative embodiments genetically modifying lymphocytes such as T cells and/or NK cells, and in illustrative embodiments, ex vivo methods for transducing, genetically modifying, and/or modified resting T cells and/or NK cells.
- Some of these aspects can be performed much more quickly than previous methods, which can facilitate more efficient research, more effective commercial production, and improved methods of patient care.
- Methods, uses, compositions, and kits provided herein can be used as research tools, in commercial production, and in adoptive cellular therapy with transduced and/or modified and in illustrative embodiments genetically modified T cells and/or NK cells expressing a TCR or a CAR.
- lymphocytes such as T cells and/or NK cells
- methods, and associated uses and compositions are provide herein that include transduction reactions of enriched PBMCs, TNCs, or transduction reactions without prior cellular enrichment, such as in whole blood that are simplified and quicker methods for performing ex-vivo cell processing, for example for CAR-T therapy.
- Such methods require less specialized instrumentation and training.
- such methods reduce the risk of non-targeted cell transduction compared to in vivo transduction methods.
- RNAs capable of engrafting in a lymphoreplete environment.
- patients or subjects are not lymphodepleted prior to reinfusion with modified and/or genetically modified T cells and or NK cells
- genetic constructs that are especially well- suited to provide genetically modified T cells and/or NK cells the ability to survive and proliferate in a more controllable manner.
- constitutive promoters operably linked to lymphoproliferative elements or inducible promoters operably linked to secreted cytokines such aspects and embodiments provide inducible promoters operably linked to membrane-bound lymphoproliferative elements, that when induced by CAR-binding to its target, can induce proliferation of T cells and/or NK cells, such as, for example, those present in the tumor microenvironment.
- FIGs. 1A-1D are flowcharts of non-limiting exemplary cell processing workflows.
- FIG. 1A is a flow chart of a process that uses a system with PBMC isolation before the contacting of T cells and NK cells in the PBMCs with retroviral particles. An optional step to deplete unwanted cells can be initiated prior to PBMC isolation.
- FIG. IB is a flow chart of a process that performs total nucleated cell (TNC) isolation before the contacting of T cells and NK cells in the total nucleated cells, with retroviral particles.
- TNC total nucleated cell
- the TNC isolation in illustrative embodiments is performed using a leukoreduction filter assembly.
- FIG. 1C is a flow chart of a process in which no blood cell fractionation or enrichment is performed before T cells and NK cells in the whole blood are contacted with retroviral particles, and a PBMC isolation is performed after the contacting and optional incubation.
- An optional step to deplete unwanted cells can be initiated prior to PBMC isolation.
- FIG. ID is a flow chart of a process in which no blood cell fractionation or enrichment is performed before T cells and NK cells in the whole blood are contacted with retroviral particles, and a TNC isolation/concentration is performed after the contacting and optional incubation, in illustrative embodiments using filtration, for example using a leukoreduction filter assembly.
- An optional step to deplete unwanted cells followed by a filtration process can be performed prior to the TNC isolation/concentration step.
- FIG. IE is a flow chart of a process that performs TNC isolation before the “Cold Contacting” of T cells and NK cells in the total nucleated cells, with retroviral particles.
- An optional step to deplete unwanted cells can be initiated prior to TNC isolation.
- FIG. IF is a flow chart of a process that performs TNC isolation before the “Cold Contacting” of T cells and NK cells in the total nucleated cells, with retroviral particles.
- An optional step to deplete unwanted cells can be initiated prior to TNC isolation.
- Another optional step is a secondary incubation. Any one or more of the wash steps are optional.
- Each of these cell processing workflows could be used for rPOC cell therapy.
- FIG. 2 is a diagram of a non-limiting exemplary leukoreduction filter assembly (200) with associated blood processing bags, tubes, valves, and filter enclosure (210) comprising a leukoreduction filter set.
- FIGs. 3A and 3B show histograms of experimental results with different pseudotyping elements.
- FIG. 3A shows a histogram of the total number of live cells per well on Day 6 following transduction.
- FIG. 3B shows a histogram of the percent of CD3+ cells transduced as measured by eTAG expression.
- FIGs. 4 A and 4B show histograms of experimental results with transduction reaction mixtures that include whole blood, lentiviral particles, and anticoagulants EDTA or heparin, without PBMC enrichment before the reaction mixture was formed.
- FIG. 4A shows a histogram of the absolute cell number per uL of the live lymphocyte population.
- FIG. 4B shows a histogram of the percentage (%) CD3+eTag+ cells in the live lymphocyte population at Day 6 post-transduction.
- FIG. 5 shows a contour FACS plot of the expression of CD3 and eTag on the live lymphocyte population at Day 7 post-transduction of whole blood for 4 hours with F1-3-23GU followed by an isolation of total nucleated cells by TNC filtration using an illustrative leukoreduction filter assembly.
- FIG. 6 shows the number of CD3+eTAG+ CAR-T cells per 60m1 of peripheral blood in individual mice 7, 14, and 21 days post intravenous CAR-T dosing. Dosed cells were either untransduced or transduced with F1-3-247GU at the indicated MOI.
- FIG. 7 shows the number of CD3+eTAG+ CAR-T cells per 60m1 of peripheral blood in individual mice 8, 14, and 21 days post subcutaneous CAR-T dosing. Dosed cells were either untransduced or transduced with F1-3-247GU at the indicated MOI.
- FIG. 8 shows a graph of the mean tumor volume of Raji tumors in B-NDG mice dosed intravenously on Day 0 with PBMCs that were not transduced (UNT) or that were transduced (TRNSD) by a 4 hour exposure to F1-3-247GU at the indicated MOI. Mice in each group were dosed with either 1 million or 5 million PBMCs as indicated.
- FIG. 9 shows a graph of the mean tumor volume of Raji tumors in B-NDG mice dosed subcutaneously on Day 0 with PBMCs that were not transduced (UNT) or that were transduced (TRNSD) by a 4 hour exposure to F1-3-247GU at the indicated MOI. Mice in each group were dosed with either 1 million or 5 million PBMCs as indicated.
- FIG. 10 shows schematics of certain genomic plasmids used in the examples.
- FIG. 11A shows a graph of the titers of recombinant lentiviral viral particles with various transcriptional units under the control of an EFl-a, PGK, SV40hCD43, or MSCVU3 promoter in either the forward (Fl-0-03) or reverse (F1-0-03RS) orientation or without a promoter in the reverse (Fl-0- 03RS-AEFla) orientation.
- FIG. 1 IB shows a graph of GFP expression levels in transiently transfected Lenti-XTM 293T as represented by mean fluorescence intensity (MFI) as determined by FACS.
- MFI mean fluorescence intensity
- FIG. 12A shows a schematic of an illustrative bicistronic lenti viral genomic vector with divergent transcriptional units.
- a first transcriptional unit comprising an eTagged lymphoproliferative element (eTag:LE) followed by a polyadenylation sequence (Poly A) under the transcriptional control of an NFAT-responsive minimal IL-2 promoter (6x NFAT) is encoded in the reverse orientation.
- an insulator element Ins separates the first and second transcriptional units.
- the second transcriptional unit encodes a CAR (CAR) under the transcriptional control of a constitutive promoter (Promoter) and is encoded in the forward orientation.
- CAR CAR
- Triangles shown in dashed lines represent 3 possible locations into any one or more of which, one or more miRNAs could optionally be inserted into the vector.
- the triangle shown in a dotted line represents 1 possible location in an exon within a promoter such as for EFl-a into which one or more miRNAs could optionally be inserted into the vector.
- SA and SD correspond to splice donor and splice acceptor sites.
- FIG. 12B shows the identity, features, and overall size of each lentiviral genomic vector tested in Example 7.
- FIG. 13 shows a graph of the percentage of CD 19 CAR+ Jurkat cells expressing eTag.
- Jurkat cells were transduced with the indicated biscistronic lentiviral genomic construct and eTag expression was measured by flow cytometry 24 hours after the samples were stimulated (or left non-stimulated) with 20nM PMA and lug/ml ionomycin.
- FIG. 14 shows a graph of the mean fluorescence intensity (MFI) of eTag expression on the surface of CD 19 CAR+ Jurkat cells.
- MFI mean fluorescence intensity
- FIG. 15 shows a graph of the percentage of Jurkat cells expressing CD 19 CAR.
- Jurkat cells were transduced with the indicated biscistronic lentiviral genomic construct and CAR expression was measured by flow cytometry 24 hours after the samples were stimulated (or left non-stimulated) with 20nM PMA and lug/ml ionomycin.
- FIG. 16 shows a graph of the mean fluorescence intensity (MFI) of CD 19 CAR expression on the surface of Jurkat cells.
- Jurkat cells were transduced with the indicated biscistronic lentiviral genomic construct and CAR expression was measured by flow cytometry 24 hours after the samples were stimulated (or left non-stimulated) with 20nM PMA and lug/ml ionomycin.
- FIG. 17 shows a graph of the percentage of CD3+CAR+ PMBCs expressing eTag.
- PBMCs were transduced with the indicated biscistronic lenti viral genomic construct and were fed with CD 19- expressing Raji cells every other day beginning on day 7, or left unfed in the absence of exogenous cytokines.
- CD3+CAR+ cells were assayed by flow cytometry for the expression of eTag each day as indicated.
- FIGs. 18A-D show graphs of the fold expansion of CD3+CAR+ PMBCs.
- PBMCs were transduced with the lentiviral genomic construct Fl-3-635 (FIG. 18A), Fl-3-637 (FIG. 18B), Fl-3-23 (FIG. 18C), or Fl-3-247 (FIG. 18D), and either fed with CD 19-expressing Raji cells every other day beginning on day 7, or left unfed in the absence of exogenous cytokines.
- CD3+CAR+ cells were detected by flow cytometry.
- FIG. 19 shows a graph of the fold expansion of CD3+CAR+ PMBCs.
- PBMCs were transduced with the lentiviral genomic constructs Fl-3-635, Fl-3-637, Fl-3-23, or Fl-3-635, and were left unfed and culture in the absence of cytokines after day 7.
- FIG. 20 shows a graph of the percent viability of CD3+CAR+ PMBCs.
- PBMCs were transduced with the lentiviral genomic constructs Fl-3-635, Fl-3-637, Fl-3-23, or Fl-3-635, and were left unfed and culture in the absence of cytokines after day 7.
- FIG. 21 shows a graph of the total flux [p/s] of Raji-luciferase disseminated tumor burden in NSG-(KbDb)null (IA)null mice dosed subcutaneously on Day 0 with PBMCs that were not transduced (Gl) or that were transduced by exposure of whole blood to F1-3-637GU (G2) or F1-4-713GU (G3) lentiviral particles for 4 hours followed by a PBMC enrichment procedure. Mice in G4 were treated with a half dose of PBMCs from G2 and G3.
- the genomic vectors of F1-3-637GU and F1-4-713GU encode self-driving CARs to CD 19 and CD22, respectively.
- FIG. 22 shows a graph of the probability of survival for 8 weeks of the mice in FIG. 21
- FIG. 23 shows total cell recoveries and cell surface marker expression of TNCs transduced with F1-3-637GU after 6 days of culture in CTS media supplemented with rhIL-2. The contacting step of the rPOC cell process was performed as shown in either FIG. ID (Whole Blood) or FIG. IB. (On Filter).
- FIG. 24 shows a graph of IFN gamma production (pg/ml) by the cells from FIG. 23 as measured by ELISA, after the cells were left untreated (NA), or treated with CHO-S, Raji, or PMA + Ionomycin for 16 hours
- FIG. 25 shows a graph of the total flux [p/s] of Raji-luciferase disseminated tumor burden in NSG mice dosed subcutaneously on Day 0 with PBS (Gl), TNCs (G2), PBMCs (G3), or cells that were transduced by exposure of whole blood to F1-3-637GU lentiviral particles for 4 hours followed by a TNC enrichment procedure as shown in FIG. ID (G4) or a PBMC enrichment procedure as shown in FIG. 1C (G5).
- chimeric antigen receptor or “CAR” or “CARs” refers to engineered receptors, which graft an antigen specificity onto cells, for example T cells, NK cells, macrophages, and stem cells.
- the CARs of the invention include at least one antigen-specific targeting region (ASTR), a transmembrane domain (TM), and an intracellular activating domain (I AD) and can include a stalk, and one or more co-stimulatory domains (CSDs).
- ASTR antigen-specific targeting region
- TM transmembrane domain
- I AD intracellular activating domain
- the CAR is a bispecific CAR, which is specific to two different antigens or epitopes. After the ASTR binds specifically to a target antigen, the IAD activates intracellular signaling.
- the IAD can redirect T cell specificity and reactivity toward a selected target in a non-MHC-restricted manner, exploiting the antigen-binding properties of antibodies.
- the non-MHC-restricted antigen recognition gives T cells expressing the CAR the ability to recognize an antigen independent of antigen processing, thus bypassing a major mechanism of tumor escape.
- CARs advantageously do not dimerize with endogenous T cell receptor (TCR) alpha and beta chains.
- the term “constitutive T cell or NK cell promoter” refers to a promoter which, when operably linked with a polynucleotide that encodes or specifies a gene product, causes the gene product to be produced in a cell under most or all physiological conditions of the cell.
- inducible promoter or “activatable promoter” refer to promoters that when operably linked with a polynucleotide that encodes or specifies a gene product, cause the gene product to be produced in a cell substantially only when a promoter-specific inducer is present in the cell. Inducible promoters have no, or a low level, of basal transcription activity but the transcription activity increases, sometimes greatly, in the presence of an inducing signal.
- insulator refers to a cis-regulatory element that mediates intra- and inter-chromosomal interactions and can block interactions between enhancers and promoters. Typically, insulators are between 200 and 2000 base pairs in length and contain clustered binding sites for sequence specific DNA-binding proteins.
- the term "microenvironment” means any portion or region of a tissue or body that has constant or temporal, physical, or chemical differences from other regions of the tissue or regions of the body.
- a tumor microenvironment refers to the environment in which a tumor exists, which is the non-cellular area within the tumor and the area directly outside the tumorous tissue but does not pertain to the intracellular compartment of the cancer cell itself.
- the tumor microenvironment can refer to any and all conditions of the tumor milieu including conditions that create a structural and or functional environment for the malignant process to survive and/or expand and/or spread.
- the tumor microenvironment can include alterations in conditions such as, but not limited to, pressure, temperature, pH, ionic strength, osmotic pressure, osmolality, oxidative stress, concentration of one or more solutes, concentration of electrolytes, concentration of glucose, concentration of hyaluronan, concentration of lactic acid or lactate, concentration of albumin, levels of adenosine, levels of R-2-hydroxyglutarate, concentration of pyruvate, concentration of oxygen, and/or presence of oxidants, reductants, or co-factors, as well as other conditions a skilled artisan will understand.
- conditions such as, but not limited to, pressure, temperature, pH, ionic strength, osmotic pressure, osmolality, oxidative stress, concentration of one or more solutes, concentration of electrolytes, concentration of glucose, concentration of hyaluronan, concentration of lactic acid or lactate, concentration of albumin, levels of adenosine, levels of R-2-hydroxyglutar
- polynucleotide and “nucleic acid” refer to a polymeric form of nucleotides of any length, either ribonucleotides or deoxyribonucleotides.
- this term includes, but is not limited to, single-, double-, or multi-stranded DNA or RNA, genomic DNA, cDNA, DNA-RNA hybrids, or a polymer comprising purine and pyrimidine bases or other natural, chemically or biochemically modified, non-natural, or derivatized nucleotide bases.
- antibody includes polyclonal and monoclonal antibodies, including intact antibodies and fragments of antibodies which retain specific binding to antigen.
- the antibody fragments can be, but are not limited to, fragment antigen binding (Fab) fragments, Fab' fragments,
- F(ab')2 fragments Fv fragments, Fab'-SH fragments, (Fab')2 Fv fragments, Fd fragments, recombinant IgG (rlgG) fragments, single-chain antibody fragments, including single-chain variable fragments (scFv), divalent scFv's, bivalent scFv's, and single domain antibody fragments (e.g., sdAb, sdFv, nanobody).
- scFv single-chain variable fragments
- divalent scFv's divalent scFv's
- bivalent scFv's bivalent scFv's
- single domain antibody fragments e.g., sdAb, sdFv, nanobody.
- the term includes genetically engineered and/or otherwise modified forms of immunoglobulins, such as intrabodies, peptibodies, chimeric antibodies, single-chain antibodies, fully human antibodies, humanized antibodies, fusion proteins including an antigen-specific targeting region of an antibody and a non antibody protein, heteroconjugate antibodies, multispecific, e.g., bispecific, antibodies, diabodies, triabodies, and tetrabodies, tandem di-scFv's, and tandem bi-scFv's.
- antibody should be understood to include functional antibody fragments thereof.
- the term also includes intact or full-length antibodies, including antibodies of any class or sub-class, including IgG and sub classes thereof, IgM, IgE, IgA, and IgD.
- antibody fragment includes a portion of an intact antibody, for example, the antigen binding or variable region of an intact antibody.
- antibody fragments include Fab, Fab', F(ab')2, and Fv fragments; diabodies; linear antibodies (Zapata et al., Protein Eng.
- the terms "single-chain Fv,” “scFv,” or “sFv” antibody fragments include the V H and V L domains of antibody, wherein these domains are present in a single polypeptide chain.
- the Fv polypeptide further includes a polypeptide linker or spacer between the V H and V L domains, which enables the sFv to form the desired structure for antigen binding.
- VH and VL domains refer to VH and VL domains that have been isolated from a host without further molecular evolution to change their affinities when generated in an scFv format under specific conditions such as those disclosed in US patent 8709755 B2 and application WO/2017/033331A1.
- affinity refers to the equilibrium constant for the reversible binding of two agents and is expressed as a dissociation constant (Kd).
- Kd dissociation constant
- Affinity can be at least 1-fold greater, at least 2-fold greater, at least 3-fold greater, at least 4-fold greater, at least 5-fold greater, at least 6-fold greater, at least 7-fold greater, at least 8-fold greater, at least 9-fold greater, at least 10-fold greater, at least 20- fold greater, at least 30-fold greater, at least 40-fold greater, at least 50-fold greater, at least 60-fold greater, at least 70-fold greater, at least 80-fold greater, at least 90-fold greater, at least 100-fold greater, or at least 1000-fold greater, or more, than the affinity of an antibody for unrelated amino acid sequences.
- Affinity of an antibody to a target protein can be, for example, from about 100 nanomolar (nM) to about 0.1 nM, from about 100 nM to about 1 picomolar (pM), or from about 100 nM to about 1 femtomolar (fM) or more.
- nM nanomolar
- pM picomolar
- fM femtomolar
- the term “avidity” refers to the resistance of a complex of two or more agents to dissociation after dilution.
- the terms “immunoreactive” and “preferentially binds” are used interchangeably herein with respect to antibodies and/or antigen-binding fragments.
- binding refers to a direct association between two molecules, due to, for example, covalent, electrostatic, hydrophobic, and ionic and/or hydrogen-bond interactions, including interactions such as salt bridges and water bridges.
- Non-specific binding would refer to binding with an affinity of less than about 10 7 M, e.g., binding with an affinity of 10 6 M, 10 5 M, 10 4 M, etc.
- cell surface expression system or “cell surface display system” refers to the display or expression of a protein or portion thereof on the surface of a cell.
- a cell is generated that expresses proteins of interest fused to a cell-surface protein.
- a protein is expressed as a fusion protein with a transmembrane domain.
- element includes polypeptides, including fusions of polypeptides, regions of polypeptides, and functional mutants or fragments thereof and polynucleotides, including microRNAs and shRNAs, and functional mutants or fragments thereof.
- region is any segment of a polypeptide or polynucleotide.
- a "domain” is a region of a polypeptide or polynucleotide with a functional and/or structural property.
- the terms "stalk” or “stalk domain” refer to a flexible polypeptide connector region providing structural flexibility and spacing to flanking polypeptide regions and can consist of natural or synthetic polypeptides.
- a stalk can be derived from a hinge or hinge region of an immunoglobulin (e.g., IgGl) that is generally defined as stretching from Glu216 to Pro230 of human IgGl (Burton (1985) Molec. Immunol., 22:161-206). Hinge regions of other IgG isotypes may be aligned with the IgGl sequence by placing the first and last cysteine residues forming inter-heavy chain disulfide (S-S) bonds in the same positions.
- IgGl immunoglobulin
- S-S inter-heavy chain disulfide
- the stalk may be of natural occurrence or non-natural occurrence, including but not limited to an altered hinge region, as disclosed in U.S. Pat. No. 5,677,425.
- the stalk can include a complete hinge region derived from an antibody of any class or subclass.
- the stalk can also include regions derived from CD8, CD28, or other receptors that provide a similar function in providing flexibility and spacing to flanking regions.
- isolated means that the material is removed from its original environment (e.g., the natural environment if it is naturally occurring).
- a naturally-occurring polynucleotide or polypeptide present in a living animal is not isolated, but the same polynucleotide or polypeptide, separated from some or all of the coexisting materials in the natural system, is isolated.
- Such polynucleotides could be part of a vector and/or such polynucleotides or polypeptides could be part of a composition, and still be isolated in that such vector or composition is not part of its natural environment.
- polypeptide is a single chain of amino acid residues linked by peptide bonds. A polypeptide does not fold into a fixed structure nor does it have any posttranslational modification. A “protein” is a polypeptide that folds into a fixed structure. “Polypeptides” and “proteins” are used interchangeably herein.
- a polypeptide may be “purified” to remove contaminant components of a polypeptide’s natural environment, e.g. materials that would interfere with diagnostic or therapeutic uses for the polypeptide such as, for example, enzymes, hormones, and other proteinaceous or nonproteinaceous solutes.
- a polypeptide can be purified (1) to greater than 90%, greater than 95%, or greater than 98%, by weight of antibody as determined by the Lowry method, for example, more than 99% by weight, (2) to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence by use of a spinning cup sequenator, or (3) to homogeneity by sodium dodecyl sulfate- polyacrylamide gel electrophoresis (SDS-PAGE) under reducing or nonreducing conditions using Coomassie blue or silver stain.
- SDS-PAGE sodium dodecyl sulfate- polyacrylamide gel electrophoresis
- immune cells generally includes white blood cells (leukocytes) which are derived from hematopoietic stem cells (HSC) produced in the bone marrow.
- HSC hematopoietic stem cells
- Immune cells includes, e.g., lymphocytes (T cells, B cells, natural killer (NK) cells) and myeloid-derived cells (neutrophil, eosinophil, basophil, monocyte, macrophage, dendritic cells).
- T cell includes all types of immune cells expressing CD3 including T-helper cells (CD4 + cells), cytotoxic T cells (CD8 + cells), T-regulatory cells (Treg) and gamma-delta T cells.
- a "cytotoxic cell” includes CD8 + T cells, natural -killer (NK) cells, NK-T cells, gd T cells, a subpopulation of CD4 + cells, and neutrophils, which are cells capable of mediating cytotoxicity responses.
- stem cell generally includes pluripotent or multipotent stem cells.
- stem cells includes, e.g., embryonic stem cells (ES); mesenchymal stem cells (MSC); induced- pluripotent stem cells (iPS); and committed progenitor cells (hematopoietic stem cells (HSC); bone marrow derived cells, etc.).
- ES embryonic stem cells
- MSC mesenchymal stem cells
- iPS induced- pluripotent stem cells
- HSC hematopoietic stem cells
- bone marrow derived cells etc.
- treatment refers to obtaining a desired pharmacologic and/or physiologic effect.
- the effect may be prophylactic in terms of completely or partially preventing a disease or symptom thereof and/or may be therapeutic in terms of a partial or complete cure for a disease and/or adverse effect attributable to the disease.
- Treatment covers any treatment of a disease in a mammal, e.g., in a human, and includes: (a) preventing the disease from occurring in a subject which may be predisposed to the disease but has not yet been diagnosed as having it; (b) inhibiting the disease, i.e., arresting its development; and (c) relieving the disease, i.e., causing regression of the disease.
- the terms “individual”, “subject”, “host”, and “patient” refer to a mammal, including, but not limited to, humans, murines (e.g., rats, mice), lagomorphs (e.g., rabbits), non human primates, humans, canines, felines, ungulates (e.g., equines, bovines, ovines, porcines, caprines), etc.
- murines e.g., rats, mice
- lagomorphs e.g., rabbits
- non human primates humans
- canines felines
- ungulates e.g., equines, bovines, ovines, porcines, caprines
- the terms “therapeutically effective amount” or “efficacious amount” refers to the amount of an agent, or combined amounts of two agents, that, when administered to a mammal or other subject for treating a disease, is sufficient to affect such treatment for the disease.
- the “therapeutically effective amount” will vary depending on the agent(s), the disease and its severity and the age, weight, etc., of the subject to be treated.
- the term “evolution” or “evolving” refers to using one or more methods of mutagenesis to generate a different polynucleotide encoding a different polypeptide, which is itself an improved biological molecule and/or contributes to the generation of another improved biological molecule.
- Physiological or "normal” or “normal physiological” conditions are conditions such as, but not limited to, pressure, temperature, pH, ionic strength, osmotic pressure, osmolality, oxidative stress, concentration of one or more solutes, concentration of electrolytes, concentration of glucose, concentration of hyaluronan, concentration of lactic acid or lactate, concentration of albumin, levels of adenosine, levels of R-2-hydroxyglutarate, concentration of pyruvate, concentration of oxygen, and/or presence of oxidants, reductants, or co-factors, as well as other conditions, that would be considered within a normal range at the site of administration, or at the tissue or organ at the site of action, to a subject.
- a “transduced cell” or a “stably transfected cell” is a cell that contains an exogenous nucleic acid(s) that is integrated into the genome of the cell.
- a “genetically modified cell” is a cell that contains an exogenous nucleic acid(s) regardless of whether the exogenous nucleic acid(s) is integrated into the genome of the cell, and regardless of the method used to introduce the exogenous nucleic acid(s) into the cell.
- Exogenous nucleic acid(s) inside a cell that are not integrated into the genome of the cell can be referred to as “extrachromosomal” herein.
- a “modified cell” is a cell that is associated with a recombinant nucleic acid vector, which in illustrative embodiments is a replication incompetent recombinant retroviral particle, that contains an exogenous nucleic acid, or a cell that has been genetically modified by an exogenous nucleic acid.
- a modified cell associates with a replication incompetent recombinant retroviral particle through interactions between proteins on the surface of the cell and proteins on the surface of the replication incompetent recombinant retroviral particle, including pseudotyping elements and/or T cell activation elements.
- compositions and methods that include transfection of nucleic acid inside a lipid-based reagent such as a liposomal reagent
- the lipid-based reagent containing nucleic acid which is a type of recombinant nucleic acid vector
- nucleic acid is typically associated with a positively charged transfection reagent to form the recombinant nucleic acid vector that associates with the negatively charged membrane of the modified cell before the complex is internalized by the modified cell.
- PEI polyethylenimine
- calcium phosphate-based transfection the nucleic acid is typically associated with a positively charged transfection reagent to form the recombinant nucleic acid vector that associates with the negatively charged membrane of the modified cell before the complex is internalized by the modified cell.
- polypeptide as used herein can include part of or an entire protein molecule as well as any posttranslational or other modifications.
- a pseudotyping element as used herein can include a "binding polypeptide” that includes one or more polypeptides, typically glycoproteins, that identify and bind the target host cell, and one or more "fusogenic polypeptides” that mediate fusion of the retroviral and target host cell membranes, thereby allowing a retroviral genome to enter the target host cell.
- the “binding polypeptide” as used herein can also be referred to as a “T cell and/or NK cell binding polypeptide” or a “target engagement element,” and the “fusogenic polypeptide” can also be referred to as a “fusogenic element”.
- a “resting” lymphocyte such as for example, a resting T cell, is a lymphocyte in the GO stage of the cell cycle that does not express activation markers such as Ki-67. Resting lymphocytes can include naive T cells that have never encountered specific antigen and memory T cells that have been altered by a previous encounter with an antigen. A “resting” lymphocyte can also be referred to as a “quiescent” lymphocyte.
- lymphodepletion involves methods that reduce the number of lymphocytes in a subject, for example by administration of a lymphodepletion agent. Lymphodepletion can also be attained by partial body or whole body fractioned radiation therapy.
- a lymphodepletion agent can be a chemical compound or composition capable of decreasing the number of functional lymphocytes in a mammal when administered to the mammal.
- One example of such an agent is one or more chemotherapeutic agents.
- Such agents and dosages are known, and can be selected by a treating physician depending on the subject to be treated.
- lymphodepletion agents include, but are not limited to, fludarabine, cyclophosphamide, cladribine, denileukin diftitox, alemtizumab or combinations thereof.
- RNA interference is a biological process in which RNA molecules inhibit gene expression or translation by neutralizing targeted RNA molecules.
- the RNA target may be mRNA, or it may be any other RNA susceptible to functional inhibition by RNAi.
- an “inhibitory RNA molecule” refers to an RNA molecule whose presence within a cell results in RNAi and leads to reduced expression of a transcript to which the inhibitory RNA molecule is targeted.
- An inhibitory RNA molecule as used herein has a 5’ stem and a 3’ stem that is capable of forming an RNA duplex.
- the inhibitory RNA molecule can be, for example, a miRNA (either endogenous or artificial) or a shRNA, a precursor of a miRNA (i.e. a Pri-miRNA or Pre-miRNA) or shRNA, or a dsRNA that is either transcribed or introduced directly as an isolated nucleic acid, to a cell or subject.
- a miRNA either endogenous or artificial
- a shRNA a precursor of a miRNA (i.e. a Pri-miRNA or Pre-miRNA) or shRNA
- a dsRNA that is either transcribed or introduced directly as an isolated nucleic acid, to a cell or subject.
- double stranded RNA or “dsRNA” or “RNA duplex” refers to RNA molecules that are comprised of two strands. Double-stranded molecules include those comprised of two RNA strands that hybridize to form the duplex RNA structure or a single RNA strand that doubles back on itself to form a duplex structure. Most, but not necessarily all of the bases in the duplex regions are base- paired. The duplex region comprises a sequence complementary to a target RNA.
- the sequence complementary to a target RNA is an antisense sequence, and is frequently from 18 to 29, from 19 to 29, from 19 to 21, or from 25 to 28 nucleotides long, or in some embodiments between 18, 19, 20, 21, 22, 23, 24, 25 on the low end and 21, 22, 23, 24, 25, 26, 27, 2829, or 30 on the high end, where a given range always has a low end lower than a high end.
- Such structures typically include a 5’ stem, a loop, and a 3’ stem connected by a loop which is contiguous with each stem and which is not part of the duplex.
- the loop comprises, in certain embodiments, at least 3, 4, 5, 6, 7, 8, 9, or 10 nucleotides.
- the loop comprises from 2 to 40, from 3 to 40, from 3 to 21, or from 19 to 21 nucleotides, or in some embodiments between 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 on the low end and 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, or 40 on the high end, where a given range always has a low end lower than a high end.
- microRNA flanking sequence refers to nucleotide sequences including microRNA processing elements.
- MicroRNA processing elements are the minimal nucleic acid sequences which contribute to the production of mature microRNA from precursor microRNA. Often these elements are located within a 40 nucleotide sequence that flanks a microRNA stem-loop structure. In some instances the microRNA processing elements are found within a stretch of nucleotide sequences of between 5 and 4,000 nucleotides in length that flank a microRNA stem-loop structure.
- linker when used in reference to a multiplex inhibitory RNA molecule refers to a connecting means that joins two inhibitory RNA molecules.
- a “recombinant retrovirus” refers to a non-replicable, or “replication incompetent”, retrovirus unless it is explicitly noted as a replicable retrovirus.
- the terms “recombinant retrovirus” and “recombinant retroviral particle” are used interchangeably herein.
- retrovirus/retroviral particle can be any type of retroviral particle including, for example, gamma retrovirus, and in illustrative embodiments, lentivirus.
- retroviral particles typically are formed in packaging cells by transfecting the packing cells with plasmids that include packaging components such as Gag, Pol and Rev, an envelope or pseudotyping plasmid that encodes a pseudotyping element, and a transfer, genomic, or retroviral (e.g. lentiviral) expression vector, which is typically a plasmid on which a gene(s) or other coding sequence of interest is encoded.
- a retroviral (e.g. lentiviral) expression vector includes sequences (e.g. a 5’ LTR and a 3’ LTR flanking e.g. a psi packaging element and a target heterologous coding sequence) that promote expression and packaging after transfection into a cell.
- lentivirus and “lentiviral particle” are used interchangeably herein.
- a “framework” of a miRNA consists of “5’ microRNA flanking sequence” and/or “3’ microRNA flanking sequence” surrounding a miRNA and, in some cases, a loop sequence that separates the stems of a stem-loop structure in a miRNA.
- the “framework” is derived from naturally occurring miRNAs, such as, for example, miR-155.
- the terms “5’ microRNA flanking sequence” and “5’ arm” are used interchangeably herein.
- the terms “3’ microRNA flanking sequence” and “3’ arm” are used interchangeably herein.
- miRNA precursor refers to an RNA molecule of any length which can be enzymatically processed into an miRNA, such as a primary RNA transcript, a pri-miRNA, or a pre- rniRNA.
- construct refers to an isolated polypeptide or an isolated polynucleotide encoding a polypeptide.
- a polynucleotide construct can encode a polypeptide, for example, a lymphoproliferative element.
- a skilled artisan will understand whether a construct refers to an isolated polynucleotide or an isolated polypeptide depending on the context.
- MOI Multiplicity of Infection ratio where the MOI is equal to the ratio of the number of virus particles used for infection per number of cells. Functional titering of the number of virus particles can be performed using FACS and reporter expression, as non-limiting examples.
- PBMCs peripheral blood mononuclear cells
- lymphocytes e.g. T cells, NK cells, and B cells
- monocytes e.g. T cells, NK cells, and B cells
- red blood cells e.g. platelets and granulocytes (i.e. neutrophils, eosinophils, and basophils).
- the present disclosure overcomes prior art challenges by providing improved methods and compositions for modifying and in illustrative embodiments genetically modifying lymphocytes, for example NK cells and in illustrative embodiments, T cells.
- Some of the methods and compositions herein provide simplified and more rapid processes for transducing or transfecting lymphocytes that avoid some steps that require specialized devices.
- the methods provide an important step toward democratization of cell therapy methods.
- Illustrative methods and compositions for modifying lymphocytes, for example NK cells and in illustrative embodiments, T cells are performed in less time than prior methods, and in fact in some embodiments, provide rapid point of care methods.
- compositions that have many uses, including their use in these improved methods are provided, including cell formulation compositions that are adapted for subcutanous administration.
- Some of these compositions include modified and in illustrative embodiments genetically modified lymphocytes that have improved proliferative and survival qualities, including in in vitro culturing, for example in the absence of growth factors.
- modified and in illustrative embodiments genetically modified lymphocytes will have utility for example, as research tools to better understand factors that influence T cell proliferation and survival, and for commercial production, for example for the production of certain factors, such as growth factors and immunomodulatory agents, that can be harvested and tested or used in commercial products.
- modified and genetically modified lymphocytes having utility in the treatment treatment of cancer.
- Illustrative methods and compositions for immune cell therapy herein include, are compatible with, are effective for, and/or are even adapted for subcutaneous or intramuscular delivery and subcutaneous or intramuscular cell formulations.
- Some of these delivery methods and cell formulations i.e. delivery compositions
- delivery compositions promote cell aggregation.
- Such cell aggregation promotes cell proliferation and survival that in some embodiments is further enhanced by the addition of antigen, growth factors and immunomodulatory agents to the cell formulation or to the site of administration of the cell formulation.
- Also provided herein are methods and compositions that overcome the challenges associated with the resistance of CAR therapy by CAR-cancer cells such as loss of target antigen availability (e.g. epitope or antigen masking) through genetic modification of malignant cells.
- Methods provided herein in illustrative aspects include methods for modifying T cells and/or NK cells, or related methods of making cell formulations, that include contacting blood cells comprising lymphocytes (e.g. NK cells and/or T cells) ex vivo in a reaction mixture, with recombinant vectors such as replication incompetent recombinant retroviral particles, that are or include polynucleotides that encode a CAR.
- lymphocytes e.g. NK cells and/or T cells
- the reaction mixture includes a T cell activation element, either in solution or on the surface of the recombinant retroviral particles, to faciliate genetic modification of T cells in the reaction mixture.
- a T cell activation element either in solution or on the surface of the recombinant retroviral particles, to faciliate genetic modification of T cells in the reaction mixture.
- TTCs total nucleated cells
- Figure 1 provides a number of non-limiting exemplary work flows of such methods.
- some of the methods provided herein include an optional step where blood is collected (110) from a subject.
- Blood can be collected or obtained from a subject by any suitable method known in the art as discussed in more detail herein.
- the blood can be collected by venipuncture, apheresis or any other blood collection method by which a sample of blood is collected.
- the volume of blood collected is between 1 and 120 ml.
- the volume of blood collected is beween 1 ml and 25 ml.
- lymphocytes e.g. T cells and/or NK cells
- this contacting, and the reaction mixture in which the contacting occurs takes place within a closed cell processing system, as discussed in more detail herein.
- a closed processing system and method used in some aspects and embodiments of systems and methods provided herein can be any system and method known in the art.
- the system or method can be a traditional closed cell processing system and method, or a system or method referred to herein as a “more recent” method or system (See e.g. WO2018/136566 and WO2019/055946).
- traditional closed cell processing methods that involve genetic modification and/or transductions of lymphocytes ex vivo, especially in methods for autologous cell therapy, many steps occur over days, such as PBMC enrichment! s), washing(s), cell activation, transduction, expansion, collection, and optionally reintroduction.
- PBMC enrichment! s washing(s)
- cell activation transduction
- expansion expansion
- collection and optionally reintroduction.
- optionally reintroduction In more recent methods, some of the steps and time involved in this ex vivo cell processing have been reduced (see, e.g., WO2018/136566). In other more recent methods (See FIG.
- the T cell and/or NK cell activation element is associated with surfaces of retroviral particles present in the reaction mixture.
- a rapid point-of-care (rPOC) autologous cell therapy method is used in a rapid point-of-care (rPOC) autologous cell therapy method.
- rPOC rapid point-of-care
- PBMC enrichment step/procedure 120A
- cell counting, transfer and media addition which takes at least around 45 additional minutes before lymphocytes are contacted with retroviral particles to form a transduction reaction mixture (130A).
- lymphocytes are typically washed away from retroviral particles that remain in suspension (140A), for example using a Sepax, and collected by resuspending the PBMCs in a delivery solution (150A) to form a cell formulation typically in an infusion bag for reinfusion, a syringe for injection, or cryopreservation vial for storage (160A).
- PBMC enrichment procedures typically involve ficoll density gradients and centrifugal (e.g. centrifugation) or centripetal (e.g. Sepax) forces or use leukophoresis to enrich PBMCs.
- antibodies directed to antigens on the surface of unwanted cells are added to the blood (170A) or to TNCs (170B) before PBMC isolation and incubated for an effective period of time to bind to the unwanted cells, as discussed in more detail herein.
- the antibodies may be coupled to beads or additional antibodies can be included in the incubation to rosette the unwanted cells to erythrocytes as described in more detail herein.
- the unwanted cells are then depleted in the PBMC isolation step in which the unwanted cells pellet with the erythrocytes.
- lymphocytes e.g. T cells and/or NK cells
- lymphocytes can be contacted with replication incompetent retroviral particles in a reaction mixture of unfractionated whole blood that contains an anticoagulant, and a significant percentage of the lymphocytes can be modified, genetically modified, and/or transduced.
- effective genetic modification of lymphocytes by recombinant retroviral particles can be carried out in the presence of blood components and blood cells in addition to PBMCs.
- modification of T cells or NK cells which is or leads to genetic modification of T cells and/or NK cells, is carried out in a reaction mixture comprising blood components and blood cells in addition to PBMCs, where such genetic modification occurs by contacting T cells and NK cells in the reaction mixture with a recombinant nucleic acid vector, which in illustrative embodiments is a recombinant retroviral particle.
- a recombinant nucleic acid vector which in illustrative embodiments is a recombinant retroviral particle.
- a PBMC enrichment procedure e.g.
- a cell processing filter or set of filters that enriches lymphocytes over at least one or some other blood cell types e.g. leukoreduction filter assembly configurable for reverse perfusion with a filter set from which leukocytes can be removed by reverse perfusion
- 120B, 120E, and 120F e.g. leukoreduction filter assembly configurable for reverse perfusion with a filter set from which leukocytes can be removed by reverse perfusion
- This step enriches and concentrates lymphocytes, in certain emobidments, before they are contacted with recombinant retroviral particles to form a transduction reaction mixture (130B, 130E and 130F).
- the filter enriches blood cells in addition to PBMCs, for example the filter can enrich TNCs. As shown in FIG.
- lymphocytes are typically washed away from retroviral particles that remain in suspension, for example using a Sepax or by passing wash buffer over cells on the leukoreduction filter, and collected by resuspending the PBMCs or TNCs in a delivery solution (150B) to form a cell formulation, with the final cell formulation product typically in an infusion bag for reinfusion, a syringe for injection, or cryopreservation vial for storage (160B).
- a delivery solution 150B
- the contacting step with optional incubating of the “viral transduction” step is performed at temperatures between 32 °C and 42 °C, such as at 37 °C. In other illustrative embodiments, the contacting step with optional incubating of the “viral transduction” step, is performed at temperatures lower than 37 °C, such as between 4 °C and room temperature(referred to herein as the “cold contacting” step) (see FIG. IE and FIG. IF).
- the optional incubating associated with the cold contacting step can be performed for any length of time discussed herein. In illustrative embodiments, the optional incubating associated with the cold contacting step is performed for 1 hour or less.
- the lymphocytes are washed away from retroviral particles that remain on the filter, by passing wash buffer over cells on the leukoreduction filter (140E, 140cF), and collected by resuspending the TNCs in a delivery solution (150E, 150bF) to form a cell formulation, with the final product typically in an infusion bag for reinfusion, a syringe for injection, or cryopreservation vial for storage (160E,
- TNCs cold contacting TNCs for a time of 1 hour or less, with viral particle expressing an activation element on its surface, will lead to binding of the viral particle to T and/or NK cells, but little internalization of the virus. This will also lead to T and/or NK cell aggregates that are cross-linked by viral particles. Furthermore, because of the lower temperatures and shorter incubation times, there will be less activiation of the cells as compared to cells incubated for longer periods of time and/or temperatures closer to 37 °C. It is believed that activation of T and/or NK cells reults in their expression of adhesion molecules and binding to the leukoreduction filter, hindering the ability to recover these cells by reverse perfusion of the filter.
- the “viral transduction” step also comprises a secondary incubation (190E, 190F) after the cells have been removed from the leukoreduction filter.
- the secondary incubation is performed by suspending cells in culture medium such as Complete OpTmizerTM CTSTM T-Cell Expansion Media.
- the secondary incubation is performed in the delivery solution.
- the secondary incubation is performed in the delivery solution, but lacking any cryopreservation agent.
- the secondary incubation is performed at temperatures between 32 °C and 42 °C, such as at 37 °C.
- the optional secondary incubation can be performed for any length of time discussed herein. In illustrative embodiments, the optional secondary incubation is performed for less than 4 hours. Not to be limited by theory, it is believed that the secondary incubation of TNCs with viral particles expressing an activation element on its surface will lead to activation of the cells. Activation of T and/or NK cells will cause the cells to aggregate. [0100] Thus, there are at least two mechanisms in the workflows described in FIG. 1 by which T and/or NK cells can form aggregates.
- ⁇ -bound viral particles cross-link cells, which activity is enhanced at temperatures between 4 °C and room temperature
- activation of T and/or NK cells leads to their aggregation, which is enhanced at temperatures between 32 °C and 42 °C.
- aggregates formed by either mechanism under different conditions can be captured by a coarse filter while other debris, singlet cells including lymphocytes, monocytes, and granulocytes, which are approximately 14pm, and cell aggregates smaller than the pore size of the corase filter used, pass through into the waste.
- a transduction reaction that includes an incubation at temperatures near 37 °C, is passed through a coarse filter to capture aggregated T and/or NK cells (200E).
- a transduction reaction that is at or near temperatures between 4 °C and room temperature, is passed through a coarse filter to capture aggregated T and/or NK cells (200F).
- Cells on the coarse filter are collected in a delivery solution to form a cell formulation typically in an infusion bag for reinfusion, a syringe for injection, or cryopreservation vial for storage (160E and 160F).
- the cellular composition of the delivery solution is greater than 40%, 50%, 60%, 70%, 80%, 90% or 95% T cells.
- reaction mixtures uses, modified and in illustrative embodiments genetically modified T cell or NK cells, or methods for modifying and/or genetically modifying T cells and/or NK cells, provided herein, a blood sample and thus lymphocytes to be modified, genetically modified, and/or transduced, are not subjected to a PBMC enrichment procedure, before being contacted by recombinant retroviral particles.
- the blood sample for example an anticoagulated whole blood sample
- a filter such as a leukoreduction filter assembly, also known as a leukodepletion filter assembly
- TNCs total nucleated cells
- the leukoreduction filter assembly can include any filter known in the art, for example, filters that collect total nucleated cells (TNCs).
- the filter can include a membrane containing polyurethane, cellulose acetate, polyester, combed cotton, PTFE, or GHP.
- the leukoreduction filter assembly can include, for example, a HemaTrateTM filter, an AcrodiscTM filter, or any of the leukoreduction filters available from Pall, for example the LeukotrapTM filters, or from Haemonetics ® .
- the leukoreduction filter is a third or fourth generation or more advanced leukoreduction filter (Sharma et al. Asian J Transfus Sci. 2010 Jan; 4(1): 3- 8).
- the volume of blood sample applied to a leukoreduction filter is 40 to 120 ml (Hematrate; Cook Regentec) or 2 to 12 ml (Acrodisc; Pall, AP-4952).
- the pore diameter of the filter in a leukoreduction filter assembly is less than 10, 7.5, 5, 4, or 3 pm or from 0.5 to 4mpi.
- the leukoreduction filter assembly can collect and/or retain at least 90%of the white blood cells in the blood sample and at least 75% of the non-leukocyte cells pass through the filter and are not collected.
- the coarse filter can be physically attached to the leukoreduction filter assembly.
- the coarse filter typically has a larger pore diameter larger than the filter in the leukoreduction filter assembly.
- the pore diameter of the coarse filter is at least 15 um and in illustrative embodiments is between 15 and 60pm.
- the coarse filter can be used without using the leukoreduction filter assembly before the contacting step.
- the coarse filter can be used after the contacting step.
- the coarse filter can be used to capture T and/or NK cell aggregates. Such aggregates form when the cells are activated and/or when they are cross-linked by viral particles.
- the coarse filter is used to remove singlet blood cells, including neutrophils, which typically pass through the filter.
- the coarse filter can be used after the secondary incubation as shown in FIG. IE.
- the filtered cells can be collected and introduced or reintroduced into a subject.
- modified and/or genetically modified cells that are part of an aggregate are advantageously more effective in vivo, especially with subcutaneous administration.
- lymphocytes are modified, genetically modified, and/or transduced by adding replication incompetent retroviral particles directly to whole blood to form a reaction mixture (130C), and cells in the whole blood are contacted by the replication incompetent retroviral particles for contacting times with optional incubations provided herein.
- Such a further simplified method in this illustrative embodiment thus includes no lymphocyte enrichment steps before lymphocytes in whole blood, typically containing an anticoagulant, are contacted with retroviral particles.
- This further simplified method like other cell processing methods herein, is typically carried out within a closed cell processing system and can include no or minimal preactivation before lymphocytes are contacted with retroviral particles.
- lymphocytes in whole blood can be contacted with retroviral particles directly in a blood bag.
- lymphocytes that were contacted with retroviral particles can be washed and concentrated using a PBMC enrichment procedure (135C).
- no PBMC enrichment procedure and no lymphocyte-enriching filtration is performed before cells in whole blood, and typically comprising an anticoagulant, are contacted with recombinant retroviral particles.
- a PBMC enrichment method is performed (135C) for example using a Sepax with a ficoll gradient, after the contacting with optional incubation (130C) is carried out.
- lymphocytes optionally can be washed further away from any retroviral particles that remain unassociated with cells (140C), for example using a Sepax, and collected by resuspending the PBMCs in a delivery solution (150C) to form a cell formulation, with the final product typically in an infusion bag for reinfusion, a syringe for injection, or cryopreservation vial for storage (160C).
- 140C unassociated with cells
- 150C a delivery solution
- 160C cryopreservation vial for storage
- a PBMC enrichment procedure is not used in any step of the process, even after a contacting step (i.e. step where lymphocytes such as T cell and/or NK cells are contacted by recombinant retroviral particles within the reaction mixture and optionally incubated for any of the contacting and incubating times provided herein).
- This further simplified method is typically carried out within a closed cell processing system and can include no or minimal preactivation before lymphocytes are contacted with retroviral particles to form a transduction reaction mixture (130D), thus providing a powerful point of care method in some subembodiments.
- one or more leukoreduction cell processing filtrations (135D) for example using a FlemaTrate filter, can be performed, after the contacting step that includes an optional incubation (130D).
- lymphocytes can be optionally washed further away from any retroviral particles that remain (140D), for example by passing PBS with 2% FISA through the filter, and collected (150D), for example using reperfusion with a delivery solution to elute and resuspend TNCs to collect lymphocytes retained on the leukoreduction filter in a cell formulation, with the final product typically a syringe for injection or in an infusion bag for delivery to a subject or a cryopreservation vial for storage (160D).
- 140D retroviral particles that remain
- 150D for example using reperfusion with a delivery solution to elute and resuspend TNCs to collect lymphocytes retained on the leukoreduction filter in a cell formulation
- the final product typically a syringe for injection or in an infusion bag for delivery to a subject or a cryopreservation vial for storage (160D).
- the method embodiment workflows shown in FIG. 1 provide modified T cells and/or NK cells suspended in a cell formulation.
- a delivery solution as provided herein can be used to elute, resuspend, and collect cells from the filter to form a cell formulation having volumes suitable for administration to a subject, especially subcutaneously or intramuscularly, as provided herein.
- Such delivery solution can also be used for an optional wash as mentioned above, before the cells are resuspended, eluted and/or otherwise collected for administration.
- additional optional steps can be performed in any of the method workflow embodiments of FIG.
- EA-rosetting can be perfomed using antibodies for example, anti-CD19, to complex B cells to erythrocytes (170A, 170B, or 170C) which will pellet away from PBMCs in the dentisy-gradient PBMC isolation step as described in more detail herein.
- Beads coated with antibodies, for example, to CD19 can be used similarly to complex B cells to beads (170A, 170B, or 170C) which will pellet away from PBMCs in the dentisy-gradient PBMC isolation step.
- a filtration step can be used. Such a filtration step can be used to remove the cells complexed to beads (180D) or to capture aggregated lymphocytes such as T and/or NK cells that are activated and/or crosslinked by recombinant retroviral particles described herein.
- additional wash steps may be performed. In some embodiments, any one or more of the wash steps shown in FIG. 1 or described for a cell process workflow, may be omitted.
- any of the embodiments of FIG. 1D-F provide an even more rapid method to obtain an enriched preparation of modified, genetically modified, and/or transduced lymphocytes from whole blood, because a time-consuming PBMC enrichment procedure is not performed in any step of such a method, before or after transduction.
- the method is performed in a closed cell processing system, thus providing a powerful method for very rapid, relatively simple lymphocyte processing, for example as a point of care CAR-T method that overcomes many of the complications and excessive time limitations of current methods.
- modified lymphocytes e.g. T cells and/or NK cells
- a solution is introduced, and in illustrative embodiments reintroduced into a subject by subcutaneous administration, delivery, or injection.
- retroviral particles such as those exemplified in FIG.
- resulting cell formulations are optionally administered (e.g. readministered) into a subject.
- FIG. ID where a PBMC enrichment procedure is not used after lymphocytes are contacted with retroviral particles, cell formulations produced there can be reintroduced back into a subject using subcutaneous or intramuscular administration.
- a subcutaneous formulation of retrovirus reconstituted with total nucleated cells on a lymphoreduction filter may contain, in addition to lymphocytes, neutrophils (or more generally granulocytes).
- the cell formulation comprises neutrophils, B cells, monocytes, red blood cells, basophils, eosinophils, and/or macrophages together with modified T cells (CAR-T cells) and/or NK cells (CAR-NK cells).
- CAR-T cells modified T cells
- CAR-NK cells modified T cells
- a subcutaneous or intramuscular formulation and administration are advantageous over intravenous formulation and administration because a formulation (suspension) of retrovirus reconstituted with lymphocytes may further comprise cellular aggregates and express adhesion receptors that may introduce pulmonary congestion with intravenous delivery.
- subcatenous admin strati on are well known in the art and typically involve admin strati on into the fat layer under the skin. It should be noted that it is contemplated that any embodiment herein that involves subcutaneous devliery, can instead be intramuscular delivery, which is delivery into the muscle, or intratumoral delivery. In some embodiments, subcutaneous administrations can be performed in the upper thigh, upper arm, abdomen, or upper buttocks of a subject. Subcutaneous administration is distinguishable from intraperitoneal administration, which penetrates through the fatty layer used in subcutaneous administration and delivers a formulation or drug into the peritoneum of the subject.
- hyaluronidase may be added to the isolated modified, genetically modified, and/or transduced lymphocyte preparation that contains the lymphocytes that have been contacted with a recombinant retrovirus, or injected subcutaneously at or near the same location of sequential delivery of the isolated modified, genetically modified, and/or transduced lymphocyte preparation.
- an effective amount of hyaluronidase is used, particularly in embodiments where more than 1 or 2 ml (e.g 2-1,000 ml, 2-500 ml, 2-100 ml, 2-50 ml, 2-10 ml, 2-5 ml, 5-1,000 ml, 5-500 ml, 5-100 ml, 5-50 ml, or 5-10 ml) of a cell formulation of lymphocytes that have been contacted with retroviral particles, e.g. of a cell formulation comprising modified NK cells, and in illustrative embodiments T cells, are to be reintroduced subcutaneously into a subject.
- a cell formulation of lymphocytes that have been contacted with retroviral particles, e.g. of a cell formulation comprising modified NK cells, and in illustrative embodiments T cells
- hyaluronidase for example recombinant human hyaluronidase, facilitates the dispersion and absorption of other injected therapeutics by enabling large volume subcutaneous delivery, especially beyond the typically administered 2 mL or less volume, and potentially enhances pharmacokinetic profiles of a co-injected therapeutic (See e.g., Bookbinder LH, et al. “A recombinant human enzyme for enhanced interstitial transport of therapeutics.” J. Control Release (2006) Aug 28;114(2):230-41. Epub 2006 Jun 7, incorporated by reference herein, in its entirety; and Frost, GI, et al.
- Hyaluronidase e.g. recombination human hyaluronidase PH20 enzyme (rHuPH20), or Hylenex® 150 USP Units
- Halozyme Therapeutics, Inc. San Diego, CA.
- between 50 and 5000; or between 1,000 and 3,000 units/ml of rHuPH20 can be delivered together with the modified, genetically modified, and/or transduced lymphocytes in 1 to 50 ml, 2 to 25 ml, 2 to 20 ml, 2 to 10 ml, 2 to 5 ml, 2 to 4 ml, 2.5 to 25 ml, 2.5 to 20 ml, 2.5 to 10 ml, 2.5 to 5 ml, 5 to 20 ml, or 5 to 10 ml for example, or such delivery of hyaluronidase and lymphocytes can be sequential. Additional hyaluronidase enzymes for example, can be found in U.S. Pat. 7,767,429, incorporated by reference herein, in its entirety.
- FIG. 2 provides a non-limiting illustrative example of a cell processing leukoreduction filtration assembly (200) that enriches nucleated cells that can be used as the leukoreduction filter in the methods of FIG. 1.
- the illustrative leukoreduction filtration assembly (200) which in illustrative embodiments is a single -use filtration assembly, comprises a leukocyte depletion media (e.g. filter set) within a filter enclosure (210), that has an inlet (225), and an outlet (226), and a configuration of bags, valves and/or channels/tubes that provide the ability to concentrate, enrich, wash and collect retained white blood cells or nucleated blood cells using perfusion and reverse perfusion (see e.g.
- the leukoreduction filtration assembly (200) is a commercially available HemaTrate filter (Cook Regenetec, Indianapolis, IN). Eeukoreduction filtration assemblies can be used, to concentrate total nucleated cells (TNC) including granulocytes, which are removed in PBMC enrichment procedures in a closed cell processing system. Since a filter assembly comprising leukocyte depletion media of EP2602315A1 such as a HemaTrate filter and the illustrative leukoreduction filter assembly of FIG. 2 do not remove granulocytes, they are not considered PBMC enrichment assemblies or filters herein, and methods that incorporate them are not considered PBMC enrichment procedures or steps herein.
- the leukoreduction filter assembly (200) of FIG. 2 is a single -use sterile assembly that includes various tubes and valves, typically needle-free valves, that allow isolation of white blood cells from whole blood and blood cell preparations that include leukocytes, as well as rapid washing and concentrating of white blood cells.
- a blood bag (215) for example a 500 ml PVC bag containing about 120 ml of a transduction/contacting reaction mixture comprising whole blood, an anticoagulant, and retroviral particles is connected to the assembly (200) at a first assembly opening
- Lymphocytes including some modified T cells and/or NK cells with associated retroviral particles, and some that could be genetically modified at this point, as well as other blood cells and components in the whole blood reaction mixture as well as the anticoagulant enter the inlet tubing (255) through the first assembly opening (217) by gravitational force when a clamp on the first inlet tubing (255) is released.
- the modified and/or genetically modified T cells and/or NK cells pass through a inlet valve (247) and a collection valve (245), to enter a filter enclosure (210) through a filter enclosure inlet (225) to contact a leukoreduction IV filter set (e.g. SKU J1472A Jorgensen Labs) within the filter enclosure (210).
- a leukoreduction IV filter set e.g. SKU J1472A Jorgensen Labs
- Nucleated blood cells including leukocytes are retained by the filter, but other blood components pass through the filter and out the filter enclosure outlet (226) into the outlet tubing (256), then through an outlet valve (247) and are collected in a waste collection bag (216), which for example can be a 2L PVC waste collection bag.
- An optional buffer wash step can be performed by switching inlet valve (247) to a wash position.
- a buffer bag (219) for example a 500 ml saline wash bag, is connected to a second assembly opening (218) of inlet tubing (255).
- the buffer moves into the inlet tubing (255) through the second assembly opening (218) by gravitational force when a clamp on the inlet tubing (255) is released.
- the buffer passes through inlet valve (247) and collection valve (245), to enter filter enclosure (210) through the filter enclosure inlet (225) and passes through the leukoreduction filter set within the filter enclosure (210) to rinse the lymphocytes retained on the filter.
- the buffer moves out the filter enclosure outlet (226) into the outlet tubing (256), then through an outlet valve (247) and is collected in a waste collection bag (216), which can be the same waste collection bag as used to collect reaction mixture components that passed through the filter in the previous step, or a new waste collection bag swapped in place of the first waste collection bag before the buffer was allowed to enter the second assembly opening
- the optional wash step can be optionally performed multiple times by repeating the above process with additional buffer. Furthermore, in some embodiments the optional wash step is performed at least in part, using the elution/delivery solution.
- a reverse perfusion process is initiated to move fluid in an opposite direction in the assembly (200) to collect lymphocytes retained on the filter set within the filter enclosure (210).
- Illustrative embodiments of leukoreduction filter assemblies herein are adaptable for reperfusion. Before initiating the reverse perfusion process in the illustrative assembly (200), the outlet valve (247) is switched to a reperfusion position and the collection valve (245) is switched to a collection position.
- a delivery solution which in some embodiments can be a buffer (e.g.
- PBS that can have additional components as provided herein, and can be an elution solution, in syringe (266), which for example can be a 25 ml syringe, is passed into outlet tubing (256) by injection using syringe (266).
- the delivery solution then enters the filter enclosure (210) through the filter enclosure outlet (226) and suspends lymphocytes retained on the filter set into a cell formulation and moves the cell formulation out of the filter enclosure (210) through the filter enclosure inlet (225) and into the inlet tubing (255).
- the cell formulation that contains modified lymphocytes including some T cells and/or NK cells with associated retroviral particles, some of which could be genetically modified and/or transduced at this point, are collected in a cell sample collection bag (265), which for example can be a 25 ml cryopreservation bag, after the pass through the collection valve (245).
- the collected cell formulation optionally can the be administered to a subject, such as through subcutaneous administration.
- polynucleotides referred to herein as “self-driving CARs” that encode a membrane-bound lymphoproliferative element whose expression in a T cell or NK cell is under the control of an inducible promoter that is induced by the binding of an antigen to an extracellular binding pair member polypeptide that is expressed by the T cell or NK cell and is functionally linked to a intracellular activating domain, for example a CD3 zeta intracellular activating domain or any of the intracellular activating domains disclosed elsewhere herein.
- a binding pair member polypeptide is a CAR.
- such a binding pair member polypeptide is a TCR.
- polynucleotides that include an inducible promoter operably linked to a nucleic acid encoding a membrane-bound lymphoproliferative element, that is induced by CAR-binding to its target. Expression of the lymphoproliferative element can induce proliferation of the T cell or NK cell.
- tissue-bound lymphoproliferative element can induce proliferation of the T cell or NK cell.
- self-driving CAR-T cells that include a self-driving CAR.
- any of the embodiments that include a self-driving CAR-T cell could include a “self-driving CAR NK cell,” which is a genetically modified or transduced NK cell that includes a self-driving CAR.
- the self-driving CAR NK cell is present in addition to the self-driving CAR-T cell.
- the self-driving CAR NK cell is present instead of the self-driving CAR-T cell.
- these self-driving CARs and self-driving CAR-T cells respond to the binding of the CAR to its target antigen with a signaling cascade resulting in one or more inducing signals that increases transcription of one or more lymphoproliferative elements.
- This CAR-stimulated transcription is achieved through downstream transcription factors, e.g., nuclear factor of activated T cells (NFAT), activating transcription factor 2 (ATF2), activating protein 1 (AP-1), and nuclear factor kappa-light-chain-enhancer of activated B cells (NF-KB).
- NFAT nuclear factor of activated T cells
- ATF2 activating transcription factor 2
- AP-1 activating protein 1
- NF-KB nuclear factor kappa-light-chain-enhancer of activated B cells
- CAR-stimulated transcription is achieved through NFAT and the inducible promoter regulating expression of a lymphoproliferative element is the NFAT-responsive promoter.
- an isolated polynucleotide that includes a first sequence comprising one or more first transcriptional units operably linked to an inducible promoter inducible in at least one of a T cell or an NK cell, wherein at least one of the one or more first transcriptional units comprises a first polynucleotide sequence encoding a first polypeptide comprising a lymphoproliferative element and in illustrative embodiments, a second transcriptional unit encoding a chimeric antigen receptor (CAR), wherein the CAR comprises an antigen-specific targeting region (ASTR), a transmembrane domain, and an intracellular activating domain.
- ASTR antigen-specific targeting region
- the lymphoproliferative element is constitutively active in at least one of a T cell or an NK cell, and the lymphoproliferative element comprises a transmembrane domain.
- the one or more first transcriptional units does not encode a polypeptide that comprises a signal peptide sequence comprising a signal peptidase cleavage site, or other sequence that would result in the encoded polypeptide, once expressed, being secreted or otherwise released from the T or NK cell.
- an isolated polynucleotide that includes a first sequence in a reverse orientation comprising one or more first transcriptional units operably linked to an inducible promoter inducible in at least one of a T cell or an NK cell, and further includes a second sequence in a forward orientation comprising one or more second transcriptional units operably linked to a constitutive T cell or NK cell promoter, wherein the number of nucleotides between the 5’ end of the one or more first transcriptional units and the 5’ end of the one or more second transcriptional units is less than the number of nucleotides between the 3’ end of the one or more first transcriptional units and the 3’ end of the one or more second transcriptional units, wherein at least one of the one or more first transcriptional units encodes a lymphoproliferative element, and wherein at least one of the one or more second transcriptional units encodes a chimeric antigen receptor (CAR), wherein the CAR comprises an
- the distances between the 5’ end of the one or more first transcriptional units and the 5’ or 3’ end of the one or more second transcriptional units can be measured, for example, as the number of nucleotides between the 5’ nucleotide of the one or more first transcriptional units and the 5’ or 3’ nucleotide of the one or more second transcriptional units.
- the one or more first transcriptional units and the one or more second transcriptional units are transcribed divergently, and such transcriptional units are said to be arrange divergently, i.e. in opposite directions, wherein the 3’ ends of the one or more first and one or more second transcriptional units are farther away from each other than the 5’ ends of the one or more first and one or more second transcriptional units.
- the polynucleotides or vectors containing two transcriptional units can be referred to herein as bicistronic polynucleotides or vectors.
- a divergent bicistronic polynucleotide may encode 2, 3, 4 or more polypeptides and/or inhibitory RNAs.
- the polynucleotide typically contains an inducible promoter operably linked to a lymphoproliferative element and a constitutive promoter operably linked to a CAR and an optional cell tag separated by a ribosomal skip sequence. The binding of the target antigen to the CAR generates an inducing signal that promotes transcription of the transcriptional units operably linked to the inducible promoter.
- kits for genetically modifying and/or transducing a lymphocyte in illustrative embodiments a T cell and/or NK cell of a subject, wherein the use of the kit comprises transducing and/or genetically modifying the T cell or NK cell with a polynucleotide disclosed above.
- kits for administering a genetically modified lymphocyte to a subject wherein the genetically modified lymphocyte is produced by transducing and/or genetically modifying lymphocytes with a polynucleotide disclosed above in this Self-Driving CAR section.
- the administration of the genetically modified lymphocyte can be performed by intravenous injection, subcutaneous administration, or intramuscular administration.
- the modified lymphocytes introduced into the subject can be allogeneic lymphocytes.
- the lymphocytes are from a different person, and the lymphocytes from the subject are not modified.
- no blood is collected from the subject to harvest lymphocytes.
- composition and method aspects including a self-driving CAR are referred to herein as “composition and method aspects including a self-driving CAR.”
- the polynucleotide can include a constitutive T cell or NK cell promoter.
- Constitutive T cell or NK cell promoters that constitutively express a polynucleotide in a T cell or NK cell are known in the art.
- a transcriptional unit is a constitutive expression unit or construct, which in illustrative embodiments of self-driving CAR aspects, encodes a CAR.
- a constitutive expression construct can comprise regulatory sequences, such as transcription and translation initiation and termination codons.
- such regulatory sequences are specific to the type of cell into which the constitutive promoter is to be introduced, i.e., a T cell and/or an NK cell.
- a constitutive expression construct can comprise a native or non-native promoter operably linked to a nucleotide sequence of interest.
- the promoter is functional in lymphocytes, especially T cells and/or NK cells.
- Exemplary constitutive promoters include, e.g., CMV, E1F, VAV, TCRvbeta, MCSV, and PGK promoter. Operably linking of a nucleotide sequence with a promoter is within the skill of the artisan.
- a constitutive expression construct is or is part of a recombinant expression vector described herein.
- Constitutive T cell or NK cell promoters can transcribe a target sequence in a T cell or NK cell at a relatively consistent rate, although the activity may fluctuate consistent with the metabolic activity of the cell.
- the transcription of the target sequence from a constitutive promoter at one time remains within at most 2-fold, 1.5-fold, 1.45-fold, 1.4-fold, 1.35-fold, 1.3-fold, 1.25-fold, 1.2- fold, 1.15-fold, 1.1-fold, 1.05-fold, or at least 0.5-fold, 0.55-fold, 0.6-fold, 0.65-fold, 0.7-fold, 0.75-fold, 0.8-fold, 0.85-fold, 0.9-fold, or 0.95-fold of transcription of the target sequence under most or all physiological conditions of the cell.
- a constitutive T cell or NK cell promoter can include transcription that remains within a range between 0.5-fold, 0.55-fold, 0.6-fold, 0.65-fold, 0.7-fold, 0.75-fold, 0.8-fold, 0.85-fold, 0.9-fold, and 0.95-fold of a number of transcripts on the low end of the range and 1.05-fold, 1.1-fold, 1.15-fold, 1.2-fold, 1.25-fold, 1.3-fold, 1.35-fold, 1.4-fold, 1.45-fold, and 1.5 -fold of a number of transcripts on the high end of the range under most or all physiological conditions of the cell.
- a constitutive T cell or NK cell promoter can be any constitutive promoter known in the art.
- the constitutive T cell or NK cell promoter can be an EFl-a promoter, PGK promoter, CMV promoter, MSCV-U3 promoter, SV40hCD43 promoter, VAV promoter, TCRbeta promoter, or UBC promoter.
- a constitutive T cell or NK cell promoter can include the EFl-a promoter nucleotide sequence (SEQ ID NO:350), the PGK promoter nucleotide sequence (SEQ ID NO:351), or a functional portion or variant thereof.
- a constitutive T cell or NK cell promoter can include other than the EFl-a promoter.
- the polynucleotide includes an inducible or activatable promoter.
- the inducible or activatable promoter is an NFAT-responsive promoter.
- an inducible or activatable promoter can increase transcription of a target sequence in the presence of the inducing signal at least 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 20-fold, 25-fold, 50-fold, 100-fold, 250-fold, 500-fold, or 1,000-fold above transcription of the target sequence in the absence of the inducing signal.
- an inducible or activatable promoter can increase transcription of a target sequence in the presence of the inducing signal between 5-fold, 6-fold, 7-fold, 8- fold, 9-fold, 10-fold, 20-fold, 25-fold, 50-fold, 100-fold, and 250-fold on the low end of the range and 10- fold, 20-fold, 25-fold, 50-fold, 100-fold, 250-fold, 500-fold, and 1,000-fold above transcription of the target RNA in the absence of the inducing signal on the high end of the range.
- a transcriptional unit is an inducible expression unit or construct, which in illustrative embodiments of self driving CAR aspects, can encode a lymphoproliferative element.
- An inducible expression construct can comprise regulatory sequences, such as transcription and translation initiation and termination codons. In some embodiments, such regulatory sequences are specific to the type of cell into which the inducible promoter is to be introduced, i.e., a T cell and/or an NK cell.
- An inducible expression construct can comprise a native or non-native promoter operably linked to a nucleotide sequence of interest. Preferably, the promoter is functional in lymphocytes, especially T cells and/or NK cells.
- the inducible or activatable promoter can be an NFAT-responsive, ATF2-responsive, AP-1 responsive, or NF-KB -responsive promoter.
- promoters that are induced upon T cell activation and can be used as inducible promoters in embodiments herein, especially embodiments for self-driving CAR aspects, include an IL-2 promoter, an IFNg promoter, a CD25 promoter, a CD40L promoter, a CD69 promoter, a CD 107a promoter, a TNF promoter, a VLA1 promoter, an LFA1 promoter, or a functional and inducible fragment of any of these promoters. As discussed herein, such inducibility can result from the presence of one or more NFAT-binding elements.
- the first sequence can be in the reverse orientation and the second sequence can be in the forward orientation.
- the orientations of the first and second sequences are relative to the 5’ to 3’ orientation established by the 5’ LTR and the 3’ LTR of the polynucleotide when present in a recombinant retroviral particle capable of genetically modifying a T cell or NK cell.
- a sequence for example a transcriptional unit, a promoter, a coding sequence, an miRNA, whose 5’ end is closer to the 5’ LTR than its 3’ end is to the 5’ LTR, is in forward orientation and a sequence whose 3’ end is closer to the 5’ LTR than its 5’ end is to the 5’ LTR, is in reverse orientation.
- the distance between either end of a sequence and the 5’ LTR is typically measured, for example, as the number of nucleotides between the 5’ or 3’ nucleotide of the sequence and the 3’ nucleotide of the 5’ LTR.
- the polynucleotide can further include a ribos witch in reverse orientation as disclosed elsewhere herein.
- the inducible promoter can be an NFAT-responsive promoter, an ATF2- responsive promoter, an AP-1 responsive promoter, or an NF-KB -responsive promoter.
- the NFAT family of transcription factors includes NFATcl, NFATc2, NFATc3, NFATc4, and NFAT5.
- calcium signaling which in illustrative embodiments is initiated by CAR- antigen binding and resultant signaling, activates NFATcl, NFATc2, NFATc3, and NFATc4 transcriptional activity. As the cellular concentration of calcium increases it binds to calmodulin, which then activates the phosphatase calcineurin.
- NFAT cytoplasmic NFAT family members
- bZIP proteins e.g., activator protein 1 (AP-1)
- AP-1 activator protein 1
- Various aspects of the tumor microenvironment are inhibitory to the proliferation of CAR-T cells, including the acidic pFl and the presence of anti-proliferative cytokines.
- the localized concentrations of inhibitory signals are high, non-secreted and constitutively active lymphoproliferative elements can stimulate proliferation of CAR-T cells.
- lymphoproliferative elements only by CAR-T cells with active CAR signaling, as in self-driving CARs, can limit the expansion of CAR-T cells in the absence of antigen-binding. Furthermore, after the successful treatment of a tumor, self-driving CAR-T cells proliferate less in the absence of the antigen.
- the inducible promoter is an NFAT- responsive promoter.
- NFAT transcription factors generally have weak binding and multiple NFAT- binding sites can be used in the inducible promoter.
- the inducible or activatable promoter can be an NFAT-responsive promoter and include one or more NFAT-binding sites.
- the one or more NFAT-binding sites can be derived from promoters known in the art to be NFAT-responsive promoters.
- the one or more NFAT-binding sites can be derived from an IL-2 promoter, an IL-4 promoter, and/or an IL-8 promoter.
- the one or more NFAT-binding sites can be derived from an IL-2 promoter.
- the NFAT-responsive promoter can include 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 NFAT-binding sites, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, or at least 12 NFAT-binding sites, or between 1 and 12, 2 and 12, 2 and 10, 3 and 10, or 4 and 8 NFAT-binding sites.
- the NFAT-responsive promoter can include 4, 6, or 9 NFAT-binding sites.
- the NFAT-binding sites of an NFAT-responsive promoter can include functional sequence variants which retain the ability to bind NFAT, to avoid exact repeats.
- the NFAT- responsive promoter is responsive to NFATcl, NFATc2, NFATc3, NFATc4, and/or NFATc5.
- the NFAT-responsive promoter includes one or more NFAT-binding sites of SEQ ID NO:352.
- the spacing between copies of the NFAT-binding sites can be between 3 nucleotides on the low end of the range and 60 nucleotides on the high end of the range.
- the spacing between copies of the NFAT-binding sites can be between 6 nucleotides on the low end of the range and 20 nucleotides on the high end of the range.
- the NFAT-responsive promoter comprises 6 NFAT-binding sites and the nucleotide sequence comprises or consists of SEQ ID NO: 353 or a functional portion or functional variant thereof.
- the binding of a CAR to its antigen induces a signaling cascade through the CD3Z intracellular domain of the CAR, resulting in an influx of calcium ions that leads to calcineurin activation which dephosphorylates NFAT, which then translocates to the nucleus and can bind NFAT-responsive promoters to activate transcription.
- the CAR-T cell includes a CAR including a CD3Z intracellular domain and the inducible promoter for the one or more transcriptional units including the lymphoproliferative element, is an NFAT-responsive promoter.
- a transcriptional unit encoding a lymphoproliferative element includes a minimal constitutive promoter with upstream NFAT-binding sites to generate an inducible or activatable promoter with a low level of transcription even in the absence of an inducing signal.
- the low level of transcription of a lymphoproliferative element from such an inducible promoter can be less than 1/2, 1/4, 1/5 1/10, 1/25, 1/50, 1/100, 1/200, 2/250, 1/500, or 1/1,000 the level of transcription of a CAR from the constitutive promoter.
- the minimal constitutive promoter can include the minimal IL-2 promoter, the minimal CMV promoter, or the minimal MF1C promoter.
- the minimal promoter can be the minimal IL-2 promoter (SEQ ID NO:354) or a functional portion or functional variant thereof.
- one or more NFAT-binding sites are upstream of the minimal IL-2 promoter.
- the NFAT-responsive promoter includes six NFAT-binding sites upstream of the minimal IL-2 promoter and the nucleotide sequence includes or consists of SEQ ID NO:355, or a functional portion or functional variant thereof.
- the inducible and constitutive promoters in the polynucleotides disclosed above with a first sequence in reverse orientation and a second sequence in forward orientation can interfere with each other in unpredictable ways, especially in the presence of a strong constitutive promoter such as the EF1- a, CMV, and CAG promoters.
- Promoter interference can result in an increase or decrease in transcription from one or both promoters. Promoter interference can also result in a decrease in the dynamic range of an inducible promoter.
- an insulator is located between the divergent transcriptional units. In some embodiments, an insulator is located between the inducible and constitutive promoters.
- the insulator can be chicken HS4 insulator, Kaiso insulator, SAR/MAR elements, chimeric chicken insulator-SAR elements, CTCF insulator, the gypsy insulator, or the b-globin insulator or fragments thereof known in the art.
- the insulator can be b-globin polyA spacer B (SEQ ID NO:356), b-globin polyA spacer A (SEQ ID NO:357), 250 cHS4 insulator vl (SEQ ID NO:358), 250 cHS4 insulator v2 (SEQ ID NO:359), 650 cHS4 insulator (SEQ ID NO:360), 400 cHS4 insulator (SEQ ID NO:361), 650 cHS4 insulator and b-globin polyA spacer B (SEQ ID NO:362), or b- globin polyA spacer B and 650 cHS4 insulator (SEQ ID NO:3).
- the insulator can be in the forward orientation. In other embodiments, the insulator can be in the reverse orientation. In illustrative embodiments, an EFl-a promoter encoded in the forward orientation is separated from an NFAT-inducible minimal IL-2 promoter encoded in the reverse orientation by the 650cHS4 insulator encoded in the reverse orientation, the b-globin polyA spacer A encoded in reverse orientation, or the encoded in the forward orientation. A skilled artisan will understand how to incorporate an insulator between promoters to prevent or reduce promoter interference.
- the polynucleotide can include a number of adenosine nucleotides, known as a polyadenylation sequence, following the 3’ end of the sequence encoding a lymphoproliferative element in the reverse orientation.
- the polyadenylation sequence can be used with an insulator. In other embodiments, the polyadenylation sequence can be used in the absence of an insulator.
- the polyadenylation sequence can be derived from the b-globin polyadenylation sequence. In some embodiments, the polyadenylation sequence can be derived from the hGH polyadenylation sequence. In some embodiments, the polyadenylation sequence can be synthetic.
- the polyadenylation sequence can include one or more of the sequences selected from hGH polyA (SEQ ID NO:316), SPA1 (SEQ ID NO:317), or SPA2 (SEQ ID NO:318).
- the polynucleotide does not include exogenous splice sites. In illustrative embodiments, the polynucleotide does not include exogenous splice sites in the forward or reverse orientation.
- the polynucleotide can include one or more inhibitory RNA molecules, such as for example, a miRNA or shRNA, as disclosed elsewhere herein.
- the inhibitory RNA molecules can be encoded within introns, including for example, an EFl-a intron.
- the inhibitory RNA molecules can target any of the targets identified herein, including, but not limited to the Inhibitory RNA Molecules section herein.
- the inducible promoter can drive expression of a lymphoproliferative element, as disclosed elsewhere herein.
- the lymphoproliferative element is a non-secreted and constitutively active lymphoproliferative element.
- At least 5%, at least 10%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, or at least 75% of the neutrophils, basophils, and/or eosinophils present in a blood sample that is subjected to a method for modifying herein, are present in the cell formulation, including at the time of the optional delivery (i.e. administering) step.
- At least 5%, at least 10%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, or at least 75% of the B cells present in a blood sample that is subjected to a method for modifying herein, are present in the cell formulation, including at the time of the optional delivery step.
- At least 5%, at least 10%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, or at least 75% of the monocytes present in a blood sample that is subjected to a method for modifying herein, are present in the cell formulation, including at the time of the optional delivery step.
- the volume of the cell formulation including the modified lymphocytes is less than traditional CAR-T methods, which typically are infusion-delivery methods, and can be less than, or less than about 1 ml, about 2 ml, about 3 ml, about 4 ml, about 5 ml, about 10 ml, about 15 ml, about 20 ml, or about 25 ml.
- the advantageously short time between drawing blood and reintroducing the modified lymphocytes into the subject means that in some embodiments, some lymphocytes are associated with the recombinant nucleic acid vectors, in illustrative embodiments the replication incompetent recombinant retroviral particles, and not yet genetically modified. In some embodiments, at least 5% of the modified lymphocytes are not genetically modified. In some embodiments, the modified lymphocytes are genetically modified and contain the polynucleotide, either extrachromosomal or integrated into the genome. In some embodiments, the polynucleotide can be extrachromosomal in at least 5% of the modified lymphocytes. In some embodiments, at least 5% of the modified lymphocytes are not transduced.
- the short contacting time in certain embodiments also results in many of the modified lymphocytes in cell formulations herein, having on their surfaces, binding polypeptides, fusogenic polypeptides, and in some embodiments T cell activation elements that originated on the surface of retroviral particles, either through association with the recombinant retroviral particles or by fusion of the retroviral envelopes with the plasma membranes, including at the time of the optional delivery step.
- the modified lymphocytes in the cell formulation include a pseudotyping element and/or a T cell activation element, e.g., a T cell activating antibody.
- the pseudotyping element and/or T cell activation element can be bound to the surface of the modified lymphocytes through, for example, a T cell receptor, CD28, 0X40, 4-1BB, ICOS, CD9, CD53, CD63, CD81, CD82, and/or the pseudotyping element and/or T cell activation element can be present in the plasma membrane of the modified lymphocytes.
- Cell formulations are provided herein, that included for example T cells and/or NK cells. Such formulations, in illustrative embodiments are provided by methods provided herein. Any of the cell formulations provided herein can include self-driving CAR-T cells. In one aspect, provided herein is a cell formulation comprising a population of self-driving CAR-T cells, such as modified, genetically modified, transcribed, transfected, and/or stably integrated self-driving CAR-T cells in a delivery solution.
- lymphocytes are contacted with recombinant nucleic acid vectors and modified lymphocytes are ex vivo after such contacting in some illustrativeembodiments provided herein, in these embodiments some or all of the T and NK cells do not yet express the recombinant nucleic acid or have not yet integrated the recombinant nucleic acid into the genome of the cell, and some of the retroviral particles in embodiments including these, may be associted with, but may have not fused with the target cell membrane, before being used or included in any of the methods or compositions provided herein, including, but not limited to, being introduced or reintroduced back into a subject, or before being used to prepare a cell formulation.
- cell formulation aspects and embodiments are provided herein that can be produced, for example, from these illustrative methods provided herein, such as for example, rapid point of care methods that in illustrative embodiments involve subcutaneous administration.
- Such cell formulations including but not limited to those set out immediately below and in the Exemplary Embodiments section herein, can exist at the time of collection of cells after they are contacted with a recombinant retrovial vector and optionally rinsed, and can exist up to and including at the time of administration to a subject, in illustrative embodiments subcutaneously.
- cell formulations comprising T cells and/or NK cells, wherein less than 90%, 80%, 75%, 70%, 60%, 50%, 40%, 30%, 25%, 20%, 10%, or 5% of the cells in the cell formulation are T cells and/or NK cells.
- cell formulations comprising lymphocytes, NK cells, and/or T cells are provided wherein at least 4%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95% of the lymphocytes, NK cells, and/or in illustrative embodiments T cells in the cell formulation are modified cells.
- lymphocytes between 4%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, and 70% of the lymphocytes are modified on the low end of the range and 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, and 95% of the lymphocytes are modified cells on the high end of the range, for example between 5% and 95%, 10% and 90%, 25% and 75%, and 25% and 95%. In some embodiments, at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%,
- modified lymphocytes within the cell formulation are not genetically modified, transduced, or stably transfected. In some embodiments, between 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%,
- 55%, 60%, 65%, and 70% of the modified lymphocytes are not genetically modified, transduced, or stably transfected on the low end of the range and 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, and 99% or all of the modified lymphocytes are not genetically modified, transduced, or stably transfected on the high end of the range, for example between 5% and 95%, 10% and 90%, 25% and 75%, and 25% and 95%.
- the polynucleotide of genetically modified lymphocytes can be either extrachromosomal or integrated into the genome in these cell formulations that are formed after contacting and incubation, and at the time of optional administration. In some embodiments of these cell formulations, at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or all of the genetically modified lymphocytes have an extrachromosomal polynucleotide.
- the modified or genetically modified lymphocytes have an extrachromosomal polynucleotide on the low end of the range and 10%, 15%, 20%, 25%, 30%, 35%,
- modified or genetically modified lymphocytes have an extrachromosomal polynucleotide on the high end of the range, for example between 5% and 95%, 10% and 90%, 25% and 75%, and 25% and 95%.
- At least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or all of the modified or genetically modified lymphocytes are not transduced or stably transfected in these cell formulations, for example as a results of methods for genetically modifying T cells and/or NK cells provided herein.
- the modified or genetically modified lymphocytes are not transduced on the low end of the range and 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, and 99% or all of the modified or genetically modified lymphocytes are not transduced or stably transfected on the high end of the range, for example between 5% and 95%, 10% and 90%, 25% and 75%, and 25% and 95%.
- fewer of the modified or genetically modified lymphocytes can engraft if delivered intravenously compared to when delivered subcutaneously. In some embodiments, at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95% fewer lymphocytes engraft when delivered intravenously compared to when delivered subcutaneously.
- cell formulations including such formulations in existence at the time of collection of cells after they are contacted with a recombinant retrovial vector and optionally rinsed, and existing up to and including the time of administration to a subject, comprise at least two of unmodified lymphocytes, modified lymphocytes, and genetically modified lymphocytes. In some embodiments, such cell formulations comprise more unmodified lymphocytes than modified lymphocytes. In some embodiments of such cell formulations that are produced by methods provided herein, the percent of T cells and NK cells that are modified, genetically modified, transduced, and/or stably transfected is at least 5%, at least 10%, at least 15%, or at least 20%.
- lymphocytes in whole blood, between 1% and 20%, or between 5% and 20%, or between 1% and 15%, or between 5% and 15%, or between 7% and 12% or about 10% of lymphocytes, and in some embodiments of T cells and/or NK cells in the whole blood that is added to a reaction mixture or that is used to create a reaction mixture, are genetically modified and/or transduced and present in resultant cell formulations.
- the lymphocytes are not contacted with a recombinant nucleic acid vector, such as a replication incompetent recombinant retroviral particle, and are not modified.
- the lymphocytes are tumor infiltrating lymphocytes.
- cell formulations wherein at least 25%, 30%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or all of the modified T and/or NK cells in the cell formulation do not express a CAR, or a transposase in certain embodiments, and/or do not have a CAR associated with their cell membrane.
- cell formulations wherein at least 25%, 30%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or all of the modified T and/or NK cells in a cell formulation contain recombinant viral reverse transcriptase or integrase.
- T cells and/or NK cells are contacted with retroviral particles within hours of delivery, some or most of the reverse transcriptase and integrase present within the retroviral particles that moves into a T cell and/or NK cell after it fuses with a retroviral particle, would still be present in the modified T cells and/or NK cells at the time of delivery.
- cell formulations wherein at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or all of the modified T and NK cells in a cell formulation do not express the recombinant mRNA (e.g., encoding a CAR and/or a recombinant transposase).
- recombinant mRNA e.g., encoding a CAR and/or a recombinant transposase
- cell formulations wherein at least 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or all of the modified T and NK cells in such cell formulation do not have the recombinant nucleic acid stably integrated into their genomes. In some embodiments, greater than 50%, 60%, 70%, 75%, 80% or 90% of the cells, NK cells, and/or T cells in a cell formulation are viable.
- cell formulations comprisinged modified lymphocytes that can be introduced or reintroduced in methods herein, include monocytes and/or B cells.
- some of the B cells are modified during a contacting step when they are contacted by recombinant nucleic acid vectors, for example, naked DNA vectors, or in illustrative embodiments replication incompetent recombinant retoviral particles.
- At least some but not more than 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95% of the B cells are modified in cell formulations, which can optionally be administered or readministered. In illustrative embodiments, some of the B cells are not modified in such formulations and methods. In further illustrative embodiments, at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% of the B cells are not modified in such formulations and methods.
- modified lymphocytes are present in cell formulations along with unmodified lymphocytes, which optionally are delivered to a subject intramuscularly or subcutaneously.
- the modified lymphocytes in the cell formulations and optionally introduced into the subject can be allogeneic lymphocytes.
- the lymphocytes are from a different person, and the lymphocytes from the subject are not modified.
- no blood is collected from the subject to harvest lymphocytes.
- Neutrophils in illustrative embodiments, are present in the cell formulation, as a nonlimiting example a cell formulation for deliverying modified T cells and/or NK cells subcutaneously, at a concentration too high for intravenous delivery when considering the safety of a subject into which the cell formulation is administered.
- the injection or delivery of neutrophils intravenously can lead to pulmonary compromise, for example, as a result of transfusion-related acute lung injury (TRALI) and/or acute respiratory distress syndrome (ARDS).
- TRALI transfusion-related acute lung injury
- ARDS acute respiratory distress syndrome
- this situation can arise when the method for producing the modified lymphocytes does not involve a PBMC enrichment step before the cell formulation comprising the modified lymphocytes is prepared, and before the solution is optionally delivered subcutaneously to a subject.
- neutrophils are present in the cell formulation, for example at the time of the optional delivery step. More specifically, in some embodiments, at least 5%, at least 10%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, or at least 75% of the neutrophils present in a blood sample that is subjected to a method for modifying herein, are present in the cell formulation, including at the time of the optional delivery step. In some embodiments, at least 5%, at least 10%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, or at least 75% of the cells present in the cell formulation are neutrophils, including at the time of the optional delivery step.
- between 5%, 10%, 15%, 20%, 25%, 30%, or 40% of the cells present in the cell formulation are neutrophils at the low end of the range and 30%, 40%, 50%, 60%, 70%, or 75% of the cells present in the cell formulation are neutrophils at the high end of the range, including at the time of the optional delivery step, for example between 5% and 50%, 20% and 50%, 30% and 75%, or 50% and 75% of the cells present in the cell formulation are neutrophils, including at the time of the optional delivery step.
- At least 5%, at least 10%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, or at least 75% of the monocytes present in a blood sample that is subjected to a method for modifying herein are present in a cell formulation, including at the time of the optional delivery step.
- at least 5%, at least 10%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, or at least 75% of the B cells present in a blood sample that is subjected to a method for modifying herein are present in the resulting cell formulation, including at the time of the optional delivery step.
- the cell formulation can include a PBMC fraction, which includes the modified T and NK cells.
- a PBMC fraction which includes the modified T and NK cells.
- at least 1%, 2%, 3%, 4%, 5%, 10%, 15%, 20%, 25%, 50%, 75%, 80%, 85%, 90%, or 95%, or between 1% and 95%, 5% and 95%, 5% and 50%, or 10% and 50% of the modified T and NK cells in a cell formulation are genetically modified.
- the volume of cell formulation or other solution administered varies depending on the route of administration, as provided elsewhere herein.
- Cell formulations injected subcutaneously or intramuscularly typically have smaller volumes than those delivered via infusion.
- the volume of the cell formulation or other solution including a suspension of the modified, and in illustrative embodiments genetically modified lymphocytes is not more than 1 ml, 2 ml, 3 ml, 4 ml, 5 ml, 10 ml, 15 ml, 20 ml, 25 ml, 30 ml, 35 ml, 40 ml, 45 ml, or 50 ml.
- the volume of the cell formulation or other solution including a suspension of the modified lymphocytes can be between 0.20 ml, 0.25 ml, 0.5 ml, 1 ml, 2 ml, 3 ml, 4 ml, 5 ml, 10 ml, 15 ml, 20 ml, or 25 ml on the low end of the range and 0.5 ml, 1 ml, 2 ml, 3 ml, 4 ml, 5 ml, 10 ml, 15 ml, 20 ml, 25 ml, 30 ml, 35 ml, 40 ml, 45 ml, or 50 ml., 30 ml, 35 ml, 40 ml, 45 ml, 50 ml, 75 ml, 100 ml, 125 ml, 250 ml, 500 ml, or 1000 ml on the high end of the range.
- the volume can be between 0.2 ml and 10 ml, 0.5 ml and 10 ml, 0.5 and 2 ml, 1 ml and 250 ml, 1 ml and 100 ml, 10 ml and 100 ml, or 1 ml and 10 ml. In certain illustrative embodiments, less than 10 ml, between 1 ml and 25 ml, and in illustrative embodiments between 1 ml and 3 ml, bettween 1 ml and 5 ml, or between 1 ml and 10 ml of a cell formulation that includes modified lymphocytes in delivery solution are administered subcutaneously or intramuscularly.
- the volume of the solution including the modified lymphocytes can be between 0.20 ml, 0.25 ml, 0.5 ml, 1 ml, 2 ml, 3 ml, 4 ml, and 5 ml on the low end of the range and 0.5 ml, 1 ml, 2 ml, 3 ml, 4 ml, 5 ml, 10 ml, 15 ml, 20 ml, 25 ml, 30 ml, 35 ml, 40 ml, 45 ml, and 50 ml on the high end of the range.
- a 70 kg subject is dosed at 1.0 x 10 6 T cells/kg by administering 1 ml of a delivery formulation of T cells at 7.0 x 10 7 cells/ml subcutaneously.
- the solution can include hyaluronidase when the volume of the solution is at least 2 ml, 3 ml, 4 ml, 5 ml, 10 ml, 15 ml, 20 ml, or 25 ml.
- the delivery solution can be used to resuspend and/or elute cells from the filter in volumes that can be those provided above.
- a delivery solution provided herein is an elution solution.
- modified and in illustrative embodiments genetically modified lymphocytes are introduced or reintroduced into the subject by intratumoral or intramuscular administration and in illustrative embodiments, subcutaneous administration using a cell formulation present in a subcutaneous delivery device, such as a sterile syringe that is adapted to deliver a solution subcutaneously.
- a subcutaneous delivery device is used that holds a solution (e.g. a cell formulation herein) and has an open or openable end, which in illustrative embodiments is the open end of a needle, for adminstrating the solution (e.g. cell formulation) subcutaneously from the liquid holding portion of the device.
- Such subcutaneous delivery device is effective for, and in illustrative embodiments adapted for subcutaneous delivery, or effective to inject subcutaneously or adapted to inject subcutaneously.
- subcatenous delivery devices that are adapted to deliver a solution subcutaneously include subcutaneous catheters, such as indwelling subcutaneous catheters, such as for example, the Insuflon ® (Becton Dickinson) and needless closed indwelling subcutaneous catheter systems, for example with wings, such as for example, the Saf-T-Intima ® (Becton Dickinson).
- the delivery device can include a pump, for example an infusion pump or a peristaltic pump.
- the cell formulation is fluidly connected to any of the needles disclosed herein, for example a needle compatible with, effective for, adapted for, or adapted to deliver subcutaneously or effective to deliver subcutaneously.
- the needle can have a gauge between 26 and 30.
- the subcutaneous delivery device is a subcutaneous delivery pen. Such pen can include a syinge effective to deliver subcutaneously or adapted to deliver subcutaneously enclosed within a housing and can include a needle guard. Examples of such pens include pens used to deliver sumatriptan.
- said cell formulation is present in a subcutaneous delivery device, for example a syringe, with a needle that has penetrated the skin of a subject whose modified T cells and/or NK cells are the modified cells present in the syringe (i.e. the subject receiving the subcutaneous injection is the source of the autologous cells being injected), and in some embodiments is located with its open end in the subcatenous tissue of the subject.
- the subcutaneous devlier device e.g. syringe
- Subcutaneous administration typically uses needles with smaller diameters than used with intravenous catheters for blood infusion, which for example can employ a 16 gauge needle.
- a delivery device such as a syringe that is compatible with intramuscular and, in illustrative embodiments, subcutaneous delivery is any delivery device (e.g. syringe) that can be successfully used for intramuscular or subcutaneous delivery, and includes those delivery devices (e.g. syringes) that are effective for and adapted for intramuscular or subcutaneous delivery, plus general purpose syringes and syringes that are specifically designed for other purposes that can be successfully employed for intramuscular or subcutaneous delivery in at least some embodiments.
- a needle is inserted through the skin at a 45 to 90 degree angle.
- some embodiments include injecting a cell formulation subcutaneously at an angle of 45 to 90 degrees with respect to the skin, as well as a cell formulation contained within a syringe or other subcutaneous delivery device, having a needle at a 45 to 90 degree angle to the skine of a subject.
- a syringe that is effective for intramuscular and, in illustrative embodiments, subcutaneous delivery, or effective to inject intramuscularly or subcutaneously is a syringe with parameters that are typically effective for intramuscular or subcutaneous delivery, for example, a needle with a gauge between between 20 and 22 and a length between 1 inch and 1.5 inches is typically effective for intramuscular delivery and a needle with a gauge between between 26 and 30 and a length between 0.5 inches and 0.625 inches is typically effective for subcutaneous delivery.
- a syringe that is adapted for subcutaneous delivery, or adapted to inject subcutaneously is any syringe that is specifically made for subcutaneous delivery.
- One such syringe adapted for subcutaneous delivery uses a core annular flow that allows subcutaneous delivery of highly concentrated biological drug formulations not normally deliverable subcutaneously (Jayaprakash V et al. Adv Healthc Mater. 2020 Aug 24;e2001022).
- Another syringe adapted for subcutaneous delivery uses a shorter needle than generally used (Pager A, Expert Opin Drug Deliv. 2020 Aug 9; 1-14).
- Another syringe adapted for subcutaneous delivery uses a 29G/5- bevel needle with a Thermo Plastic Elastomer (TPE) needle shield (Jaber A et al. BMC Neurol. 2008 Oct 10;8:38).
- TPE Thermo Plastic Elastomer
- the outer diameter of the needle is less than 0.026”.
- the outer diameter of the needle is at most 0.01625”, 0.01865”, 0.01825”, 0.02025”, 0.02255”, or 0.02525”.
- the needle is a 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 26s, 27, 28, 29, or 30 gauge needle.
- the length of the needle is not more than 1 inch or 0.5 inches.
- the needle is 26, 26s, 27, 28, 29, or 30 gauge needle and the length of the needle is between 0.5 inches and 0/625 inches.
- the needle can be a winged infusion set, also known as a butterfly or scalp vein needle.
- the introduction or reintroduction can be performed using a subcutaneous cathether.
- subcutaneous and intramuscular delivery methods permit the cells and components of the cell formulation to remain in close proximity within a subject, for example in illustrative embodiments for up to several days as a controlled release while creating a local environment for cell activation and expansion maintaining properties similar to what T and NK cells encounter in the lymphoid organs such as the spleen or lymph node.
- the absorption of large protein molecules over 20 kDa such as antibodies from subcutaneous sites are absorbed into the blood through the lymphatics over 24 to 72 hours
- controlled release of T or NK cells from a local injection site using subcutaneous and intramuscular methods provided herein are believed to involve both migration from the injection site following an initial expansion phase before modified cells will generally be detectable in circulation.
- the local injection controlled release will result in genetically modified cells appearing in circulation after one to two weeks.
- the cell formulation is compatible with or even adapted for subcutaneous or intramuscular delivery to keep the cells aggregated locally to enable a controlled release of cells into circulation.
- the concentration of cells in a cell formulation for subcutaneous or intramuscular delivery in some embodiments is higher than that typically delivered intravenously.
- the concentration of white blood cells in the cell formulation for subcutaneous or intramuscular delivery is greater than, or greater than about 1.5 x 10 s cells/ml, about 5 x 10 s cells/ml, about 1 x 10 9 cells/ml to 1.2 x 10 9 cells/ml.
- cells for example mixtures of modified and unmodified lymphocytes discussed herein, are formulated in a delivery solution such that they are capable of, effective for, and adapted for subcutaneous or intramuscular administration.
- a delivery solution such that they are capable of, effective for, and adapted for subcutaneous or intramuscular administration.
- certain embodiments of commercial container and kit aspects provided herein are or include a container of sterile subcutaneous and/or intramuscular delivery solution, which in some embodiments is stored refrigerated.
- Such delivery solutions are capable of, and in illustrative embodiments effective for, and in further illustrative embodiments adapted for, subcutaneous or intramuscular administration, and in illustrative embodiments subcutaneous administration.
- such delivery solutions and resulting cell formulations typically have a pH and ionic composition that provides an environment in which cells to be administered can survive until they are administered, for example for at least 1 hour, and typically can survive for at least 4 hours.
- pH is typically between pH 6.5 to 8.0 or 7.0 and 8.0 or 7.2 to 7.6 and can be maintained by a buffer such as a phosphate buffer or bicarbonate present at a concentration effective for maintaining pH in a target range.
- the ionic composition of such formulations can for example, include a saline composition with salts, for example 0.8 to 1.0 or about 0.9 or 0.9 percent salts such as sodium chloride.
- the delivery solution is or includes PBS.
- the concentration of Na + is between 110 mM and 204 mM
- the concentration of Cl is between 98 mM and 122 mM
- the concentration of K + is between 3 mM and 6 M.
- a delivery solution and cell formulation comprising the same, contains calcium and/or magnesium.
- the concentration of calcium can, for example, be between 0.5 mM and 2 mM.
- the concentration of magnesium can, for example, be between 0.5 mM and 2 mM.
- the delivery solution is calcium and magnesium free.
- the delivery solution and cell formulations contain human serum albumin and/or heparin. In some embodiments the delivery solution and cell formulation contains up to 5% HSA. In some embodiments the delivery solution is PBS comprising 2% HSA. In some embodiments, the delivery solution is DPBS comprising 2% HSA. In some embodiments, the delivery solution is a saline solution comprising 30-100U/ml, 40-100U/ml, 30-60U/ml, or 60-80U/ml heparin, with or without 0.5- 5%, 1-5%, or 1-2.5% HSA. Discussion herein regarding concentrations of heparin in reaction mixture aspects, apply equally to delivery solution and cellular formulation aspects.
- the delivery solution is or includes a multiple electrolyte solution suitable for injection into a subject.
- a delivery solution can be or include a sterile, nonpyrogenic isotonic solution in a container, such as a single dose container.
- Such solution in certain embodiments is suitable or adapted for intravenous administration as well as subcutaneous and/or intramuscular administration.
- a delivery soluation can include a multiple analyte solution for injection into a subject where ach 100 mL contains 526 mg of Sodium Chloride, USP (NaCl); 502 mg of Sodium Gluconate (CeHnNaO ?
- the delivery solution contains no antimicrobial agents.
- the pH is adjusted with sodium hydroxide.
- the mulple electrolyte injection solution can be PLASMA-LYTE A Injection pH 7.4 available from various commercial suppliers.
- the cell formulation is never frozen.
- the cell formulation contains less than, or less than about 7%, about 6%, about 5%, about 4%, about 3%, about 2%, or about 1% DMSO (v/v).
- the cell formulation contains no DMSO.
- the cell formulation for subcutaneous or intramuscular delivery is a depot formulation or emulsion of cells that promotes cell aggregation, and a delivery solution herein used to prepare such a depot cell formulation, includes the accessory components that provide depot properties.
- the cells may be aggregated in the formulation, for example before it is administered to a subject, or for example within 1 hour, 45 minutes, 30 minutes, 15 minutes, 10 minutes, 5 minutes, or 1 minute of cells, for example modified lymphocytes as provided herein, being formulated in a delivery solution, for example comprising an aggregating agent to produce the formulation.
- At least 10%, 20%, 25%, 50%, 75%, 90%, 95%, or 99% of the cells in a cell formulation provided herein are aggregated.
- Such aggreggation can be determined, for example, using microscopic counting of individual cells versus cells that are associated with at least one other cell, or by counting the number of cells on average, a cell within a formulation is associated with.
- the cell formulation is designed for controlled or delayed release with tissue expansion to accommodate cell expansion.
- a delivery solution provided herein, for subcutaneous or intramuscular delivery is a depot formulation.
- a depot (i.e. sustained release) formulation is typically an aqueous or oleaginous suspention or solution.
- the delivery solution or cell formulation includes components that form an artificial extracellular matrix such as a hydrogel.
- a depot delivery solution comprises an effective amount of alginate, collagen, and/or dextran to form a depot formulation.
- PEG poly(ethylene glycol)
- aliphatic polyesters such as poly(lactic acid) (PLA), poly(D,L- lactic-co-glycolic acid) (PLGA), poly(e-caprolactone) (PCL) and polyphosphazenes.
- thermosensitive triblock copolymers based on poly(N-(2-hydroxypropyl methacrylamide lactate) and poly(ethylenglycol) (p(HPMAm-lac)-PEG), capable of spontaneous self assembling in physiological environments (Vermonden et. al 2006, Langmuir 22: 10180-10184).
- the hydrogel used in a delivery solution or cell formulation herein contains hyaluronic acid (HA).
- HA can have carboxylic acid groups that can be modified with 1- ethyl-3-(3-dimethyl aminopropyl)-l-carbodiimide hydrochloride to react with amine groups on proteins, peptides, polymers, and linkers, such as those found on modified lyphocytes provided herein, preferentially in the the presence of N-hydroxysuccinimide.
- Antibodies, cytokines and peptides can be chemically conjugated to HA using such methods to produce a hydrogel for co-injection as a cell emulsion in some cell formulation embodiments provided herein.
- HA in delivery solutions and cell formulations is a polymer (e.g. Healon) and/or are cross! inked (e.g. restylane (Abbive/ Allergan)), for example lightly crosslinked, through its -OH groups with agents such as glutaraldehyde to reduce the local catabolism of the material following subcutaneous injection.
- the HA used in delivery solutions and cell formulations herein can be of variable length and viscosity.
- the HA used in delivery solutions and cell formulations herein can further be crosslinked with other glycosaminoglycans such as chondroitin sulfate (e.g. Viscoat) or polymers or surfactants.
- a matrix such as a hydrogel matrix
- a cell formulation herein when used in a cell formulation herein, can be configured for, or adapted to permit migration of cells through the matrix.
- the degree of substitution of the hydrogel and concentration at the time of crosslinking will influence porosity swelling ratio and Youngs Modulus (or stiffness). Initial 1% substitution of HA with tyromine for example at 1 mg/ml when subsequently crosslinked in the presence of peroxide will result in a hydrogel with higher porosity and lower stiffness than 3% substitution and 5 mg/ml solution.
- the sheer modulus is desireable in some circumstances to reduce sheer force during injection and ensure adequate porosity and half life for cells to expand into the matrix subcutaneously over one to two weeks.
- the sheer modulus is or is about 2.5kPa, about 3kPa, about 3.5 kPa, or about 4kPa.
- the delivery solution or the cell formulation includes ctyokines such as IL- 2, IL-7, IL-15, IL-21.
- the cell formulation includes antibodies or polypeptides that are capable of binding CD3, CD28, 0X40, 4-1BB, ICOS, CD9, CD53, CD63, CD81, and/or CD82.
- the EDC-NHS reaction may be used for linking such proteins to HA or through other intermediates described above.
- these cytokines, antibodies, or polypeptides are crosslinked to components of a hydrogel.
- the hydrogel may be mixed with the cell suspension using a syringe connector and two syringes prior to injection. In other embodiments, these cytokines, antibodies, or polypeptides are in solution.
- the antigen can be added to or co-administered with modified and/or genetically modified T cells and/or NK cells.
- the antigen can be soluble.
- the antigen can be immobilized on a surface of the artificial matrix, such as a hydrogel.
- the antigen can be expressed on the surface of a cell, such that the cell is a target cell. In some embodiments, such target cells are present in large numbers in whole blood and are naturally present in the cell formulation without having to be added.
- B cells are present in whole blood, isolated TNCs, and isolated PBMCs and would naturally be present in the cell formulation and could serve as target cells for T cells and/or NK cells expressing a CAR directed to CD 19 or CD22, as non-limiting examples which are both expressed on B cells.
- target cells are not present in whole blood or are not present in large numbers in whole blood and thus are added exogenously.
- target cells can be isolated or enriched from the subject, such as from a tumor sample, using methods known in the art.
- cells from the subject are modified to express the appropriate antigen.
- the antigen expressed on the target cell can include all or a portion of the protein that contains the antigen.
- the antigen expressed on the target cell can include all or a portion of the extracellular domain of the protein that includes the antigen.
- the antigen expressed on the target cell can be a fusion with a transmembrane domain that anchors it to the cell surface. Any of the transmembrane domains disclosed elsewhere herein can be used.
- the antigen expressed on the target cell can be a fusion with a stalk domain. Any of the stalk domains disclosed elsewhere herein can be used.
- the antigen can be a fusion with a CD8 stalk and transmembrane domain (SEQ ID NO:24).
- cells in a first cell mixture are modified with a recombinant nucleic acid vector encoding a target antigen, which can be referred to herein as “articifial antigen presenting cells” or “aAPCs”, and cells in a separate second cell mixture from the same subject are modified to express the CAR that binds the antigen.
- aAPC articifial antigen presenting cells
- T-APC modified T-APC
- Such modified T-APCs can be generated using methods provided herein where reaction mixtures for modification (e.g.
- the transduction include a T cell binding polypeptide, such as a polypeptide directed to CD3.
- the cell mixture is whole blood, isolated TNCs, isolated PBMCs.
- the first cell mixture can be modified with a recombinant nucleic acid vector encoding a fusion protein of the extracellular domain of Her2 and the transmembrane domain of PDGF and the second cell mixture can be modified with a recombinant nucleic acid vector encoding a CAR directed to HER2.
- the cells can then be formulated into the delivery solution or otherwise administered to the subject at varying CAR effector cell-to-tar get-cell ratios.
- the effector- to-tar get ratio at the time of formulation or administration is, or is about 10:1, about 9:1, about 8:1, about 7:1, about 6:1, about 5:1, about 4:1, about 3:1, about 2; 1 , about 1:1, about 1:2, about 1:3, about 1:5, about 1:6, about 1:7, about 1:8, about 1:9, or about 1:10.
- target cells are co-administered with the modified T and/or NK cells subcutaneously or intramuscularly.
- the proliferation and survival of genetically modified T cells and/or NK cells expressing a CAR can also be promoted by CAR signaling initiated by cross-linking the CARs by interactions other than through the CAR’s ASTRs binding to their cognate antigens.
- a small molecule or protein can cross-link and activate CARs on the surface of a cell.
- an antibody can cross-link and activate CARs on the surface of a cell.
- the antibody recognizes an epitope in the extracellular domain of the CAR, such as in the stalk or spacer domain.
- the epitope can be an epitope tag such as His5 (HHHHH; SEQ ID NO:76), HisX6 (HHHHHH; SEQ ID NO:77), c-myc (EQKLISEEDL; SEQ ID NO:75), Flag (DYKDDDDK; SEQ ID NO:74), Strep Tag (WSHPQFEK; SEQ ID NO:78), HA Tag (YPYDVPDYA; SEQ ID NO:73), RYIRS (SEQ ID NO:79), Phe-His-His-Thr (SEQ ID NO:80), or WEAAAREACCRECCARA (SEQ ID NO:81).
- epitope tag such as His5 (HHHHH; SEQ ID NO:76), HisX6 (HHHHHH; SEQ ID NO:77), c-myc (EQKLISEEDL; SEQ ID NO:75), Flag (DYKDDDDK; SEQ ID NO:74), Strep Tag (WSHPQFEK; SEQ ID NO:78), HA Tag (YPY
- the epitope is common to an intracellular antigen that is not reactive to an extracellular receptor.
- the epitope tag is the HisX6 tag (SEQ ID NO:77).
- the CARs can be cross-linked and activated by adding soluble antibodies that bind the epitope tag.
- the CARs can be cross- linked and activated by adding cells expressing antibodies, such as scFvs on their surfaces, that bind the epitope tag, also referred to herein as feeder cells.
- the scFv associates with the cell membrane through a GPI anchor.
- the scFv associates with the cell membrane through a transmembrane domain.
- a stalk or spacer separates the scFv from the transmembrane domain.
- the same feeder cells for example feeder cells expressing an anti-HisX6 scFv attached to a CD8a stalk and transmembrane domain, can be used with cells that express CARs with ASTRs that bind to different antigens but that include the HisX6 epitope tag in their stalk.
- These feeder cells that can be used with cells expressing different CARs containing a common epitope tag are also referred to herein as universal feeder cells.
- the CARs With universal feeder cells, provided the CARs contain the epitope tag, there is no need to generate different feeder cells that express the cognate antigen for CARs containing different ASTRs.
- the epitope tag on the cells expressing a CAR will be crosslinked by the universal feeder cells to engage clustering and proliferation of the CAR.
- the anti-HisX6 universal cells can be used with cells expressing a CAR that binds to Her2 and includes the HisX6 epitope tag and could also be used with cells expressing a CAR that binds to Axl and includes the HisX6 epitope tag.
- the combination of the feeder cell and the CAR can enable CAR-T propagation before the cells engage their cognate antigen. Additionally if the ASTR of the CAR is microenvironment restricted, the use of the feeder cell binding to antigen may enable expansion outside that restrictive environment.
- a cell formulation comprising an aggregate of T cells and/or NK cells, wherein the T cells and/or NK cells are modified with a polynucleotide comprising one or more transcriptional units, wherein each of the transciptional units is operatively linked to a promoter active in T cells and/or NK cells, and wherein the one or more transcriptional units encode a first polypeptide comprising a chimeric antigen receptor (CAR) in a solution, in illustrative embodiments a delivery solution; and further wherein the aggregate comprises at least 4, 5, 6, or 8 T cells and/or NK cells, wherein the cell aggregate is at least 15 uM in its smallest dimension, and/or wherein the cell aggregate is retained by a coarse filter having a diamter of at least 15 um, or a coarse filter having a diameter of between 15 um and 60 um.
- CAR chimeric antigen receptor
- Recombinant retroviral particles are disclosed in methods and compositions provided herein, for example, to modify T cells and/or NK cells to make genetically modified and/or transduced T cells and/or NK cells.
- the recombinant retroviral particles are themselves aspects of the present invention.
- the recombinant retroviral particles included in aspects provided herein are replication incompetent, meaning that a recombinant retroviral particle cannot replicate once it leaves the packaging cell.
- retroviral particles are replication incompetent, and if such retroviral particles include nucleic acids in their genome that are not native to the retrovirus, they are “recombinant retroviral particles.” In illustrative embodiments, the recombinant retroviral particles are lentiviral particles.
- replication incompetent recombinant retroviral particles for use in transducing cells, typically lymphocytes and illustrative embodiments T cells and/or NK cells.
- the replication incompetent recombinant retroviral particles can include any of the pseudotyping elements discussed elsewhere herein.
- the replication incompetent recombinant retroviral particles can include any of the activation elements discussed elsewhere herein.
- a replication incompetent recombinant retroviral particle including a polynucleotide including:
- the T cell activation element can be any of the activation elements discussed elsewhere herein.
- the T cell activation element can be anti-CD3 scFvFc.
- a replication incompetent recombinant retroviral particle including a polynucleotide including one or more transcriptional units operatively linked to a promoter active in T cells and/or NK cells, wherein the one or more transcriptional units encode a first polypeptide including a chimeric antigen receptor (CAR) and a second polypeptide including a lymphoproliferative element.
- the lymphoproliferative element can be a chimeric lymphoproliferative element.
- the lymphoproliferative element does not comprise IL-7 tethered to the IL-7 receptor alpha chain or a fragment thereof.
- the lymphoproliferative element does not comprise IL-15 tethered to the IL-2/IL-15 receptor beta chain.
- a replication incompetent recombinant retroviral particle comprising a polynucleotide comprising one or more transcriptional units operatively linked to a promoter active in T cells and/or NK cells, wherein the one or more transcriptional units encode a first polypeptide comprising a chimeric antigen receptor (CAR) and a second polypeptide comprising a chimeric lymphoproliferative element, for example a constitutively active chimeric lymphoproliferative element.
- the chimeric lymphoproliferative element does not comprise a cytokine tethered to its cognate receptor or tethered to a fragment of its cognate receptor.
- a recombinant retroviral particle that includes (i) a pseudotyping element capable of binding to a T cell and/or NK cell and facilitating membrane fusion of the recombinant retroviral particle thereto; (ii) a polynucleotide having one or more transcriptional units operatively linked to a promoter active in T cells and/or NK cells, wherein the one or more transcriptional units encode a first engineered signaling polypeptide having a chimeric antigen receptor that includes an antigen-specific targeting region, a transmembrane domain, and an intracellular activating domain, and a second engineered signaling polypeptide that includes at least one lymphoproliferative element; wherein expression of the first engineered signaling polypeptide and/or the second engineered signaling polypeptide are regulated by an in vivo control element; and (iii) an activation element on its surface, wherein the activation element is capable of binding to a T cell
- the promoter active in T cells and/or NK cells is not active in the packaging cell line or is only active in the packaging cell line in an inducible manner.
- either of the first and second engineered signaling polypeptides can have a chimeric antigen receptor and the other engineered signaling polypeptide can have at least one lymphoproliferative element.
- replication incompetent recombinant retroviral particles that include a polynucleotide encoding a self-driving CAR. Details regarding such replication incompetent recombinant retroviral particles, and composition and method aspects including a self-driving CAR, are disclosed in more detail herein, for example in the Self-Driving CAR Methods and Compositions section and in the Exemplary Embodiments section.
- RNA molecules include, for example, pseudotyping elements, activation elements, and membrane bound cytokines, as well as nucleic acid sequences that are included in a genome of a replication incompetent, recombinant retroviral particle such as, but not limited to, a nucleic acid encoding a CAR; a nucleic acid encoding a lymphoproliferative element; a nucleic acid encoding a control element, such as a riboswitch; a promoter, especially a promoter that is constitutively active or inducible in a T cell; and a nucleic acid encoding an inhibitory RNA molecule.
- various aspects provided herein such as methods of making recombinant retroviral particles, methods for performing adoptive cell therapy, and methods for transducing T cells, produce and/or include replication incompetent, recombinant retroviral particles.
- Replication incompetent recombinant retroviruses that are produced and/or included in such methods themselves form separate aspects of the present invention as replication incompetent, recombinant retroviral particle compositions, which can be in an isolated form.
- Such compositions can be in dried down (e.g. lyophilized) form or can be in a suitable solution or medium known in the art for storage and use of retroviral particles.
- a replication incompetent recombinant retroviral particle having in its genome a polynucleotide having one or more nucleic acid sequences operatively linked to a promoter active in T cells and/or NK cells that in some instances, includes a first nucleic acid sequence that encodes one or more (e.g. two or more) inhibitory RNA molecules directed against one or more RNA targets and a second nucleic acid sequence that encodes a chimeric antigen receptor, or CAR, as described herein.
- a first nucleic acid sequence that encodes one or more (e.g. two or more) inhibitory RNA molecules directed against one or more RNA targets and a second nucleic acid sequence that encodes a chimeric antigen receptor, or CAR, as described herein.
- a third nucleic acid sequence is present that encodes at least one lymphoproliferative element described previously herein that is not an inhibitory RNA molecule.
- the polynucleotide incudes one or more riboswitches as presented herein, operably linked to the first nucleic acid sequence, the second nucleic acid sequence, and/or the third nucleic acid sequence, if present.
- expression of one or more inhibitory RNAs, the CAR, and/or one or more lymphoproliferative elements that are not inhibitory RNAs is controlled by the riboswitch.
- two to 10 inhibitory RNA molecules are encoded by the first nucleic acid sequence.
- two to six inhibitory RNA molecules are encoded by the first nucleic acid sequence.
- 4 inhibitory RNA molecules are encoded by the first nucleic acid sequence.
- the first nucleic acid sequence encodes one or more inhibitory RNA molecules and is located within an intron.
- the intron includes ah or a portion of a promoter.
- the promoter can be a Pol I, Pol II, or Pol III promoter.
- the promoter is a Pol II promoter.
- the intron is adjacent to and downstream of the promoter active in a T cell and/or NK cell.
- the intron is EFl-a intron A.
- Retroviral particle embodiments herein include those wherein the retroviral particle comprises a genome that includes one or more nucleic acids encoding one or more inhibitory RNA molecules.
- nucleic acids that encode inhibitory RNA molecules that can be included in a genome of a retroviral particle including combinations of such nucleic acids with other nucleic acids that encode a CAR or a lymphoproliferative element other than an inhibitory RNA molecule, are included for example, in the inhibitory RNA section provided herein, as well as in various other paragraphs that combine these embodiments.
- various alternatives of such replication incompetent recombinant retroviruses can be identified by exemplary nucleic acids that are disclosed within packaging cell line aspects disclosed herein.
- disclosure in this section of a recombinant retroviral particle that includes a genome that encodes one or more (e.g. two or more) inhibitory RNA molecules can be combined with various alternatives for such nucleic acids encoding inhibitory RNA molecules provided in other sections herein.
- nucleic acids encoding one or more inhibitory RNA molecules can be combined with various other functional nucleic acid elements provided herein, as for example, disclosed in the section herein that focuses on inhibitory RNA molecules and nucleic acid encoding these molecules.
- the various embodiments of specific inhibitory RNA molecules provided herein in other sections can be used in recombinant retroviral particle aspects of the present disclosure.
- recombinant retroviral vectors such as lentiviral vectors
- These elements are included in the packaging cell line section and in details for making replication incompetent, recombinant retroviral particles provided in the Examples section and as illustrated in WO2019/055946.
- lentiviral particles typically include packaging elements REV, GAG and POL, which can be delivered to packaging cell lines via one or more packaging plasmids, a pseudotyping element, various examples which are provided herein, which can be delivered to a packaging cell line via a pseudotyping plasmid, and a genome, which is produced by a polynucleotide that is delivered to a host cell via a transfer plasmid.
- This polynucleotide typically includes the viral LTRs and a psi packaging signal.
- the 5’ LTR can be a chimeric 5’ LTR fused to a heterologous promoter, which includes 5’ LTRs that are not dependent on Tat transactivation.
- Vpu such as a polypeptide comprising Vpu (sometimes called a “Vpu polypeptide” herein) including but not limited to, Src-FLAG-Vpu
- Vpu polypeptide including but not limited to, Src-FLAG-Vpu
- Vpx such as Src-FLAG-Vpx, is packaged within the retroviral particle.
- Vpx upon transduction of a T cells, Vpx enters the cytosol of the cells and promotes the degradation of SAMF1D1, resulting in an increased pool of cytoplasmic dNTPs available for reverse transcription.
- Vpu and Vpx is packaged within the retroviral particle for any composition or method aspect and embodiment that includes a retroviral particle provided herein.
- Retroviral particles included in various aspects of the present invention are in illustrative embodiments, replication incompetent, especially for safety reasons for embodiments that include introducing cells transduced with such retroviral particles into a subject.
- retroviral particles are not produced from the transduced cell.
- Modifications to the retroviral genome are known in the art to assure that retroviral particles that include the genome are replication incompetent. Flowever, it will be understood that in some embodiments for any of the aspects provided herein, replication competent recombinant retroviral particles can be used.
- expression vectors can be delivered to packaging cells and/or to T cells using different types of vectors, such as expression vectors.
- Illustrative aspects of the invention utilize retroviral vectors, and in some particularly illustrative embodiments lentiviral vectors.
- Other suitable expression vectors can be used to achieve certain embodiments herein.
- Such expression vectors include, but are not limited to, viral vectors (e.g.
- viral vectors based on vaccinia virus; poliovirus; adenovirus see, e.g., Li et al., Invest Opthalmol Vis Sci 35:25432549, 1994; Borras et al., Gene Ther 6:515 524, 1999; Li and Davidson, PNAS 92:77007704, 1995; Sakamoto et al., H Gene Ther 5:1088 1097, 1999; WO 94/12649, WO 93/03769; WO 93/19191; WO 94/28938; WO 95/11984 and WO 95/00655); adeno-associated virus (see, e.g., Ali et al., Hum Gene Ther 9:81 86, 1998, Flannery et al., PNAS 94:6916 6921, 1997; Bennett et al., Invest Opthalmol Vis Sci 38:28572863, 1997; Jomary et al., Gene Ther 4
- a retroviral vector e.g.,
- replication incompetent recombinant retroviral particles are a common tool for gene delivery (Miller, Nature (1992) 357:455-460).
- the ability of replication incompetent recombinant retroviral particles to deliver an unrearranged nucleic acid sequence into a broad range of rodent, primate and human somatic cells makes replication incompetent recombinant retroviral particles well suited for transferring genes to a cell.
- the replication incompetent recombinant retroviral particles can be derived from the Alpharetrovirus genus, the Betaretrovirus genus, the Gammaretrovirus genus, the Deltaretrovirus genus, the Epsilonretrovirus genus, the Lentivirus genus, or the Spumavirus genus.
- retroviruses suitable for use in the methods disclosed herein.
- murine leukemia virus MMV
- human immunodeficiency virus HIV
- equine infectious anaemia virus EIAV
- mouse mammary tumor virus MMTV
- Rous sarcoma virus RSV
- Fujinami sarcoma virus FuSV
- Moloney murine leukemia virus Mo-MLV
- FBR MSV FBR murine osteosarcoma virus
- Mo-MSV Abelson murine leukemia virus
- A-MLV Avian myelocytomatosis virus-29
- AEV Avian erythroblastosis virus
- retroviruses A detailed list of retroviruses may be found in Coffin et al (“Retroviruses” 1997 Cold Spring Harbor Laboratory Press Eds: J M Coffin, S M Hughes, H E Varmus pp 758-763). Details on the genomic structure of some retroviruses may be found in the art. By way of example, details on HIV may be found from the NCBI Genbank (i.e. Genome Accession No. AF033819).
- the replication incompetent recombinant retroviral particles can be derived from the Lentivirus genus. In some embodiments, the replication incompetent recombinant retroviral particles can be derived from HIV, SIV, or FIV. In further illustrative embodiments, the replication incompetent recombinant retroviral particles can be derived from the human immunodeficiency virus (HIV) in the Lentivirus genus. Lentiviruses are complex retroviruses which, in addition to the common retroviral genes gag, pol and env, contain other genes with regulatory or structural function.
- HIV human immunodeficiency virus
- a typical lentivirus is the human immunodeficiency virus (HIV), the etiologic agent of AIDS in vivo, HIV can infect terminally differentiated cells that rarely divide, such as lymphocytes and macrophages.
- HIV human immunodeficiency virus
- replication incompetent recombinant retroviral particles provided herein contain Vpx polypeptide.
- replication incompetent recombinant retroviral particles provided herein comprise and/or contain Vpu polypeptide.
- a retroviral particle is a lentiviral particle.
- Such retroviral particle typically includes a retroviral genome within a capsid which is located within a viral envelope.
- DNA-containing viral particles are utilized instead of recombinant retroviral particles.
- viral particles can be adenoviruses, adeno-associated viruses, herpesviruses, cytomegaloviruses, poxviruses, avipox viruses, influenza viruses, vesicular stomatitis virus (VSV), or Sindbis virus.
- VSV vesicular stomatitis virus
- a skilled artisan will appreciate how to modify the methods disclosed herein for use with different viruses and retroviruses, or retroviral particles.
- functional units can be included in such genomes to induce integration of all or a portion of the DNA genome of the viral particle into the genome of a T cell transduced with such virus.
- the HIV RREs and the polynucleotide region encoding HIV Rev can be replaced with N-terminal RGG box RNA binding motifs and a polynucleotide region encoding ICP27.
- the polynucleotide region encoding HIV Rev can be replaced with one or more polynucleotide regions encoding adenovirus E1B 55-kDa and E4 Orf6.
- replication incompetent recombinant retroviral particles can include nucleic acids encoding a self-driving CAR, as disclosed elsewhere herein.
- retroviral particles whose genome comprises one or more first transcriptional units operably linked to an inducible promoter inducible in at least one of a T cell or an NK cell, and one or more second transcriptional units operably linked to a constitutive T cell or NK cell promoter, wherein the number of nucleotides between the 5’ end of the one or more first transcriptional units and the 5’ end of the one or more second transcriptional units is less than the number of nucleotides between the 3’ end of the one or more first transcriptional units and the 3’ end of the one or more second transcriptional units, a.
- At least one of the one or more first transcriptional units encodes a lymphoproliferative element, b. and wherein at least one of the one or more second transcriptional units encodes a first chimeric antigen receptor (CAR), wherein the CAR comprises an antigen-specific targeting region (ASTR), a transmembrane domain, and an intracellular activating domain.
- CAR chimeric antigen receptor
- the replication incompetent recombinant retroviral particles can further display a T cell activation element.
- T cells contacted and transduced with these replication incompetent recombinant retroviral particles that include nucleic acids encoding a self-driving CAR can receive an initial boost of transcription from the CAR-stimulated inducible promoters as the T cell activation element can stimulate the inducing signal of the CAR-stimulated inducible promoters.
- the binding of the T cell activation element can induce the calcium ion influx that results in dephosphorylation of NFAT and its subsequent nuclear translocation and binding to NFAT-responsive promoters.
- the lymphoproliferative elements transcribed and translated from these CAR- stimulated inducible promoters can give an initial increase in proliferation to these cells.
- the T cell activation element can be a membrane-bound anti-CD3 antibody, and can be GPI-linked or otherwise displayed on virus.
- the membrane-bound anti-CD3 antibody can be fused to a viral envelope protein, such as MuLV or VSV-G.
- the isolated replication incompetent retroviral particles are a large-scale batch contained in a large-scale container.
- Such large-scale batch can have titers, for example of 10 6 - 10 s TU/ml and a total batch size of between lxlO 10 TU and lxlO 13 TU, lxlO 11 TU and lxlO 13 TU, lxlO 12 TU amd lxlO 13 TU, lxlO 10 TU and 5xl0 12 TU, or lxlO 11 TU and 5xl0 12 TU.
- retroviral particles for any aspect or embodiment provided herein are substantially pure, as discussed in more detail herein.
- the recombinant retroviral genomes in non limiting illustrative examples, lentiviral genomes, have a limitation to the number of polynucleotides that can be packaged into the viral particle.
- the polypeptides encoded by the polynucleotide encoding region can be truncations or other deletions that retain a functional activity such that the polynucleotide encoding region is encoded by less nucleotides than the polynucleotide encoding region for the wild-type polypeptide.
- the polypeptides encoded by the polynucleotide encoding region can be fusion polypeptides that can be expressed from one promoter.
- the fusion polypeptide can have a cleavage signal to generate two or more functional polypeptides from one fusion polypeptide and one promoter.
- some functions that are not required after initial ex vivo transduction are not included in the retroviral genome, but rather are present on the surface of the replication incompetent recombinant retroviral particles via the packaging cell membrane. These various strategies are used herein to maximize the functional elements that are packaged within the replication incompetent recombinant retroviral particles.
- the recombinant retroviral genome to be packaged can be between 1,000, 2,000, 3,000, 4,000, 5,000, 6,000, 7,000, and 8,000 nucleotides on the low end of the range and 2,000, 3,000, 4,000, 5,000, 6,000, 7,000, 8,000, 9,000, 10,000, and 11,000 nucleotides on the high end of the range.
- the retroviral genome to be packaged includes one or more polynucleotide regions encoding a first and second engineering signaling polypeptide as disclosed in detail herein.
- the recombinant retroviral genome to be packaged can be less than 5,000, 6,000, 7,000, 8,000, 9,000, 10,000, or 11,000 nucleotides.
- Functions discussed elsewhere herein that can be packaged include required retroviral sequences for retroviral assembly and packaging, such as a retroviral rev, gag, and pol coding regions, as well as a 5' LTR and a 3' LTR, or an active truncated fragment thereof, a nucleic acid sequence encoding a retroviral cis-acting RNA packaging element, and a cPPT/CTS element.
- required retroviral sequences for retroviral assembly and packaging such as a retroviral rev, gag, and pol coding regions, as well as a 5' LTR and a 3' LTR, or an active truncated fragment thereof, a nucleic acid sequence encoding a retroviral cis-acting RNA packaging element, and a cPPT/CTS element.
- a replication incompetent recombinant retroviral particle herein can include any one or more or all of the following, in some embodiments in reverse orientation with respect to a 5’ to 3’ orientation established by the retroviral 5’ LTR and 3’ LTR (as illustrated in WO20 19/055946 as a non-limiting example): one or more polynucleotide regions encoding a first and second engineering signaling polypeptide, at least one of which includes at least one lymphoproliferative element; a second engineered signaling polypeptide that can include a chimeric antigen receptor; an miRNA, a control element, such as a riboswitch, which typically regulates expression of the first and/or the second engineering signaling polypeptide; a safety switch polypeptide, an intron, a promoter that is active in a target cell, such as a T cell, a 2A cleavage signal and/or an IRES.
- a container such as a commercial container or package, or a kit comprising the same, comprising retroviral particles according to any of the replication incompetent recombinant retroviral particle aspects and embodiments provided herein.
- the retroviral particles can comprise in their genome a polynucleotide comprising one or more nucleic acid sequences operatively linked to a promoter active in T cells and/or NK cells.
- a nucleic acid sequence of the one or more nucleic acid sequences can encode a lymphoproliferative element and/or a chimeric antigen receptor (CAR) comprising an antigen-specific targeting region (ASTR), a transmembrane domain, and an intracellular activating domain.
- a nucleic acid sequence of the one or more nucleic acid sequences can encode one, two or more inhibitory RNA molecules directed against one or more RNA targets.
- the container that contains the recombinant retroviral particles in any aspect or embodiment, including commercial container as well as kits, can be a tube, vial, well of a plate, or other vessel for storage of retroviral particles.
- some aspects provided herein comprise a container comprising retroviral particles, wherein such retroviral particles include any nucleic acid(s) or other component(s) disclosed herein.
- Such container in illustrative embodiments includes substantially pure replication incompetent recombinant retroviral particles, sometimes referred to herein for shorthand, as substantially pure retroviral particles.
- a preparation and/or container of substantially pure retroviral particles is sterile, and negative for mycoplasma, replication competent retroviruses of the same type, and adventitious viruses according to standard protocols (see e.g., “Viral Vector Characterization: A Look at Analytical Tools”; October 10, 2018 (available at https://cellculturedish.com/viral-vector- characterization-analytical-tools/)).
- Exemplary methods for generating substantially pure retrovrial particles are provided in the Examples herein. For such methods, viral supernatants were purified by a combination of depth filtration, TFF, benzonase treatment, diafiltration, and formulation.
- substantially pure retroviral particles meet all of the following characteristics based on quality control testing results: a. negative for mycoplasma; b. endotoxin at less than 25 EU/ml, and in certain further illustrative embodiments, less than 10 EU/ml; c. absence of replication competent retroviruses detected of the same type as purposefully in the container (e.g. lentiviruses) detected; d. absence of adventitious viruses detected; e. less than 1 pg host cell DNA/ viral TU, and in certain further illustrative embodiments, less than 0.3 pg / TU; f.
- Retroviral particles are typically tested against release specifications that include some or all of those provided above, before they are released to a customer. Potency of each particle may be defined on the basis of p24 viral capsid protein by ELISA, viral RNA genome copies by q-RT PCR, measurement of reverse transcriptase activity by qPCR-based product-enhanced RT (PERT) assay but can all be converted to infectious titer by measuring functional gene transfer Transducing Units (TUs) in a bioassay.
- TUs functional gene transfer Transducing Units
- Determination of infectious titer of purified bulk retrovirus material and finished product by bioassay and qPCR is an exemplary analytical test method for the determination of infectious titer of retroviruses.
- An indicator cell hank (such as F1XT) may be grown for example in serum free media, seeded at 150,000 cells per well, followed by exposure to serial dilutions of the retrovirus product. Dilutions of purified retrovirus particles are made on indicator cells, for example from 1:200 to 1:1,600.
- a reference standard virus may be added for system suitability. Following 4 days of incubation with retrovirus, the cells are harvested, DNA extracted and purified. A standard curve, for example from 100- 10,000,000 copies/ well, of human genome and unique retroviral genome sequence plasmid pDNA amplicons are used followed by addition of genomic DNA of the cell samples exposed to retrovirus particles. For each PCR reaction, the Cq values of both the retrovirus amplicon and the endogenous control such as hRNAseP are extrapolated back to copies per reaction. From these values the integrated genome copy number is calculated. In some cases, indicator cells such as 293T have been characterized as being triploid, hence 3 copies of a single copy gene per cell should be utilized in the calculation. Using the initial viable cell count per well, the volume of retrovirus added to the cells and the genome copy number ratio a Transducing Unit (TU) per ml retrovirus particles may be determined.
- TU Transducing Unit
- Potency testing can include potency testing against release specifications with purity and specific activity.
- potency release testing of final product can include measurement of the number of Transducing Units (TU) can be compared to viral particle quantity (e.g. by performing an ELISA against a viral protein, for example for lentivirus by performing a p24 capsid protein ELISA with a cutoff of at least 100, 1,000, 2,000 or 2,500 TU/ng p24), and CAR functionality, for example by measuring interferon gamma release by a reporter cell line exposed to gene modified cells.
- TU Transducing Units
- kits or isolated replication incompetent recombinant retroviral particle aspects herein that include a container of such retroviral particles, sufficient recombinant retroviral particles are present in the container to achieve an MOI (the number of Transducing Units, or TUs applied per cell) in a reaction mixture made using the retroviral particles, of between 0.1 and 50, 0.5 and 50, 0.5 and 20, 0.5 and 10, 1 and 25, 1 and 15, 1 and 10, 1 and 5, 2 and 15, 2 and 10, 2 and 7, 2 and 3, 3 and 10, 3 and 15, or 5 and 15 or at least 0.1, 0.5, 1, 2, 2.5, 3, 5, 10 or 15, or to achieve an MOI of at least 0.1, 0.5, 1, 2, 2.5, 3, 5, 10 or 15.
- MOI the number of Transducing Units, or TUs applied per cell
- the Transducing Units of virus particles provided in the kit should enable the use an MOI that prevents producing too many integrants in an individual cell, on average less than 3 lentigenome copies per cellular genome and more preferably 1 copy per cell.
- MOI can based on 1, 2.5, 5, 10, 20, 25, 50, 100, 250, 500, or 1,000 ml of reaction mixture assuming lxlO 6 target cells/ml, for example in the case of whole blood, assuming 1 x 10 6 PBMCs/ml of blood.
- a container of retroviral particles can include between 1 x 10 s and 1 x 10 9 , 1 x 10 s and 1 x 10 8, 1 x 10 s and 5 x 10 7 , 1 x 10 s and 1 x 10 7 , 1 x 10 s and 1 x 10 6 ; 5 x 10 s and 1 x 10 9 ;
- the container can contain betweem 1 x 10 7 and 1 x 10 9 , 5 x 10 6 and 1 x 10 s , 1 x 10 6 and 5 x 10 7 , 1 x 10 6 and 5 x 10 6 or between 5 xlO 7 and 1 xlO 8 retroviral Transducing Units.
- such numbers of particles would support between 1 and 100 ml of blood at an MOI of between 1 and 10.
- an advantage of the present methods is that in some illustrative embodiments, they require far fewer retroviral particle Transducing Units than prior methods that involve nucleic acids encoding a CAR, such as CAR-T methods.
- Each container that contains retroviral particles can have, for example, a volume of between 0.05 ml and 5 ml, 0.05 ml and 1 ml, 0.05 ml and 0.5 ml, 0.1 ml and 5 ml, 0.1 ml and 1 ml, 0.1 ml and 0.5 ml, 0.1 and 10 ml, 0.5 and 10 ml, 0.5 ml and 5 ml, 0.5 ml and 1 ml, 1.0 ml and 10.0 ml, 1.0 ml and 5.0 ml, 10 ml and 100 ml, 1 ml and 20 ml, 1 ml and 10 ml, 1 ml and 5 ml, 1 ml and 2 ml, 2 ml and 20 ml, 2 ml and 10 ml, 2 ml and 5 ml, 0.25 ml to 10 ml, 0.25 to 5 ml, or 0.
- retroviral particles in the container are GMP-grade, or cGMP-grade retroviral particles (i.e. produced under GMP or current GMP requirements according to a regulatory agency), or the product of a retroviral manufacturing process performed using GMP systems.
- retroviral particles are typically made using a USA FDA (i.e. U.S. GMP or U.S. cGMP), EMA (i.e. EMA GMP or EMA cGMP), or National Medical Products Administration (NMPA) of China (i.e. Chinese FDA) (i.e. NMPA GMP or NMPA cGMP) good manufacturing practice (GMP), for example using GMP quality systems and GMP procedural controls.
- GMP-grade retroviral particles are typically sterile. This can be accomplished for example, by filtering retroviral particles, for example substantially pure retroviral particles, with a 0.45 um or a 0.22 um filter. GMP-grade retroviral particles are typically substantially pure, and prepared with control manufacturing test specifications for potency, quality and safety.
- the solution comprising retroviral particles in the container is free of detectable bovine proteins, which can be referred to as “bovine-free”.
- bovine-free such solution of retroviral particles can be bovine free because bovine proteins, such as bovine serum proteins, are not used in culturing the packaging cells during retrovirus production.
- the solution of retroviral particles are GMP-grade and bovine-free.
- Substantially pure nucleic acid solutions are typically bovine-free and manufactured in bovine-free broth.
- kits for modifying NK cells and/or in illustrative embodiments, T cells includes one or a plurality of containers containing polynucleotides, typically substantially pure polynucleotides comprising one or more first transcriptional units operatively linked to a promoter active in T cells and/or NK cells, wherein the one or more first transcriptional units encode a first polypeptide comprising a first chimeric antigen receptor (CAR), sometimes referred to as a first CAR, and one oe more containers of accessory component(s), also called accessory kit components herein.
- the polynucleotides e.g. retroviral paricles
- the polynucleotides encoding the CAR are located in the genome of retroviral particles, typically substantially pure retroviral particles, according to any of the replication incompetent recombinant retroviral particle aspects and embodiments provided herein.
- the replication incompetent recombinant retroviral particles in the kit comprise a polynucleotide comprising one or more transcriptional units operatively linked to a promoter active in T cells and/or NK cells, wherein the one or more first transcriptional units encode a first polypeptide comprising a first chimeric antigen receptor (CAR) and optionally encode a second polypeptide comprising a lymphoproliferative element, according to any of the embodiments provided herein.
- CAR chimeric antigen receptor
- the accessory kit components can include one or more of the following: a. one or more containers containing a delivery solution compatible with, in illustrative embodiments effective for, and in further illustrative embodiments adapted for subcutaneous and/or intramuscular administration as provided herein; b. one or more containers of hyaluronidase as provided herein; c. one or more blood bags such as a blood collection bag, in illustrative embodiments comprising an anticoagulant in the bag, or in a separate container, a blood processing buffer bag, a blood processing waste collection bag, and a blood processing cell sample collection bag; d.
- one or more sterile syringes compatible with, in illustrative embodiments effective for, and in further illustrative embodiments adapted for, subcutaneous or intramuscular delivery of T cells and/or NK cells; e. a T cell activation element as disclosed in detail herein, for example anti-CD3 provided in solution in the container containing the retroviral particle, or in a separate container, or in illustrative embodiments, is associated with a surface of the replication incompetent retroviral particle; f. one or a plurality of leukoreduction filtration assemblies; g.
- retroviral particles found within recombinant retroviral particles according to any embodiment herein), comprising one or more second transcriptional units operatively linked to a promoter active in T cells and/or NK cells, wherein the one or more second transcriptional units encode a polypeptide comprising a second CAR directed against a different target epitope, and in certain embodiments a different antigen, in illustrative embodiments found on a same target cancer cell (e.g. B cell); k. one or more containers containing a cognate antigen for the first CAR and/or the second CAR encoded by the nucleic acids (e.g. retroviral particles); and l.
- kit components for the use thereof, for example for modifying T cells and/or NK cells, for delivering modified T cells and/or NK cells to a subject subcutaneously or intramsucularly, and/or for treating tumor growth or cancer in a subject.
- the blood bags can hold 5, 10, 15, 20, 25, 50, 75, 100, 150, 200, 250, 300, 400, or 500 ml or less of blood. In some embodiments, the blood bags can hold at least 5, 10, 15, 20, 25, 50, 75, 100, 150, 200, 250, 300, 400, or 500 ml of blood. In some embodiments, the blood bags can hold between 1, 2, 3, 4, 5, 10, 15, 20, 25, and 50 ml of blood on the low end of the range and 10, 15, 20, 25,
- the blood bag can hold between 1, 2, 3, 4, 5, 10, 15, 20, 25, and 50 ml of blood on the low end of the range and 10, 15, 20, 25, 50, 75, 100, 150, 200, 250, 300, 400, and 500 ml of blood on the high end of the range.
- the blood bag can hold between 1 and 10 ml, 5 and 25 ml, 10 and 50 ml,
- the blood bags can include heparin. In other embodiments, the blood bags do not include heparin.
- the kit may be a single-pack/use kit, but in other embodiments the kit is a mult-pack or multi-use kit for the processing of more than one blood sample from contacting with nucleic acids encoding a CAR optionally thru subcutaneous administration.
- a container of nucleic acids encoding a CAR (and optionally a paired container of nucleic acids encoding a second CAR in certain embodiments) in the kit is used for one performance of a method for modifying T cells and/or NK cells and optionally subcutaneous administration.
- the container(s) containing nucleic acids encoding a CAR and optionally a second CAR is typically stored and shipped frozen.
- a kit can include sufficient containers (e.g. vials) of nucleic acids encoding a CAR (and optionally paired containers encoding a second CAR in certain eembodiments) for 1, 2, 3, 4, 5, 6, 10, 12, 20, 24, 50 and 100 performances of a method for modifying a T cell and/or NK cell provided herein, and thus can include 1 , 2, 3, 4, 5, 6, 10, 12, 20, 24, 50 and 100 containers (e.g. vials) of nucleic acids encoding the CAR (e.g. retroviral particles), and similarly is considered a 1, 2, 3, 4, 5, 6, 10, 12, 20, 24, 50 and 100 pack, performance, administration or X kit, respectively.
- accessory components in the kit would be provided for similar numbers of performances of a method for modifying T cells and/or NK cells and optionally subcutaneous administration, using the kit.
- the one or more leukoreduction filtration assemblies typically include(s) one or a plurality of leukoreduction filters or leukoreduction filter sets, each typically within a filter enclosure, as exemplified by the illustrative assembly of FIG. 2, as well as a plurality of connected sterile tubes connected or adapted to be connected thereto, and a plurality of valves connected or adapted to be connected thereto, that are adapted for use in a single-use closed blood processing system.
- a 20-pack kit in illustrative embodiments, includes 20 vials of nucleic acids encoding a CAR and 20 leukoreduction filtration assemblies.
- a kit herein comprses one or a plurality of containers containing nucleic acids and one or more leukoreduction filtration assemblies.
- Such a kit can optionally be intended to be used for administration to a subject via any route including for example, infusion or in illustrative embodiments intramuscular and/or in further illustrative embodiments, subcutaneous delivery.
- a kit optionally includes other accessory components that are intended to be used with such route of administration.
- the one or more containers of subcutaneous or intramuscular delivery solution is typically sterile and can include a total combined volume, or individually per container, of 100 ml to 5 L, 1 ml to 1 L, 1 ml to 500 ml, 1 ml to 250 ml, 1 ml to 200 ml, 1 ml to 100 ml, 1 ml to 10 ml, or 1 ml to 5 ml; 5 ml to 1 L, 5 ml to 500 ml, 5 ml to 250 ml, 5 ml to 100 ml, 5 ml to 10 ml, or approximately 5 ml.
- the kit comprises a plurality of containers of subcutaneous delivery solution, with each container having a volume of between 10 ml and 200 ml, 10 ml and 100 ml, 1 ml and 20 ml, 1 ml and 10 ml, 1 ml and 5 ml, 1 ml and 2 ml, 2 ml and 20 ml, 2 ml and 10 ml, 2 ml and 5 ml, 0.25 ml to 10 ml, 0.25 to 5 ml, or 0.25 to 2 ml.
- there is one container of delivery solution for each container of nucleic acid encoding a CAR in a kit there is one container of delivery solution for each container of nucleic acid encoding a CAR in a kit.
- a 20-pack kit in illustrative embodiments, includes 20 vials of nucleic acids encoding a CAR and 20 containers of sterile delivery solution.
- accessory components of the kit can further include one or more of the following: a. one or more containers containing a delivery solution adapted for, compatible with, and/or effective for, intravenous administration as provided herein; and b. Instructions, either physically or digitally associated with other kit components, for the use thereof, for example for delivering modified T cells and/or NK cells to a subject intravenously.
- kits for modifying a T cell or NK cell wherein the use of the kit includes: contacting the T cell or NK cell ex vivo with the replication incompetent recombinant retroviral particle, wherein the replication incompetent recombinant retroviral particle includes a pseudotyping element on a surface and a T cell activation element on the surface, wherein said contacting facilitates transduction of the T cell or NK cell by the replication incompetent recombinant retroviral particle, thereby producing a modified and in illustrative embodiments genetically modified T cell or NK cell.
- aspects that include the use of a replication incompetent recombinant retroviral particle in the manufacture of a kit for modifying a T cell or NK cell. Details regarding polynucleotides, and replication incompetent recombinant retroviral particles that contain such polynucleotides are disclosed in more detail herein, and in the Exemplary Embodiments section.
- the T cell or NK cell can be from a subject.
- the T cell activation element can be membrane-bound.
- the contacting can be performed for between 1, 2, 3, 4, 5, 6, 7, or 8 hours on the low end of the range and 4, 5, 6, 7, 8, 10, 12, 15, 18, 21, and 24 hours on the high end of the range, for example, between 1 and 12 hours.
- the replication incompetent recombinant retroviral particle for use in the manufacture of a kit can include any of the aspects, embodiments, or subembodiments discussed elsewhere herein.
- a container such as a commercial container or package, or a kit comprising the same, comprising isolated packaging cells, in illustrative embodiments isolated packaging cells from a packaging cell line, according to any of the packaging cell and/or packaging cell line aspects provided herein.
- the kit includes additional containers that include additional reagents such as buffers or reagents used in methods provided herein.
- additional reagents such as buffers or reagents used in methods provided herein.
- any replication incompetent recombinant retroviral particle provided herein in any aspect, in the manufacture of a kit for modifying and in illustrative embodiments genetically modifying a T cell or NK cell according to any aspect provided herein.
- any packaging cell or packaging cell line provided herein in any aspect, in the manufacture of a kit for producing the replication incompetent recombinant retroviral particles according to any aspect provided herein.
- a pharmaceutical composition for treating or preventing cancer or tumor growth comprising a replication incompetent recombinant retroviral particle as an active ingredient.
- an infusion composition or other cell formulation for treating or preventing cancer or tumor growth comprising a replication incompetent recombinant retroviral particle.
- the replication incompetent recombinant retroviral particle of the pharmaceutical composition or infusion composition can include any of the aspects, embodiments, or subembodiments discussed above or elsewhere herein.
- PBMCs peripheral blood mononuclear cells
- lymphocytes typically T cells and/or NK cells
- resting T cells and/or resting NK cells in a reaction mixture comprising blood, or a component thereof, and/or an anticoagulant, that includes contacting the lymphocytes with replication incompetent recombinant retroviral particles in the reaction mixture.
- PBMCs peripheral blood mononuclear cells
- lymphocytes typically T cells and/or NK cells
- an anticoagulant that includes contacting the lymphocytes with replication incompetent recombinant retroviral particles in the reaction mixture.
- the reaction mixture in illustrative embodiments comprises the lymphocytes and the replication incompetent recombinant retroviral particles, a T cell activation element and one or more additional blood components set out below that in illustrative embodiments are present because the reaction mixture comprises at least 10% whole blood, wherein the replication incompetent recombinant retroviral particles typically comprises a binding polypeptide and a fusogenic polypeptide, and in illustrative embodiments a pseudotyping element on its surface.
- the contacting facilitates association of the lymphocytes with the replication incompetent recombinant retroviral particles, wherein the recombinant retroviral particles genetically modify and/or transduce the lymphocytes.
- the reaction mixture of these method or reaction mixture aspects comprises at least 10% unfractionated whole blood (e.g. at least 10%, 20%, 25%, 50%, 60%, 70%, 80%, 90%, 95%, or 99% whole blood) and optionally an effective amount of an anticoagulant; or the reaction mixture further comprises at least one additional blood or blood preparation component that is not a PBMC, for example the reaction mixture comprises an effective amount of an anticoagulant and one or more blood preparation component that is not a PBMC.
- a percentage of whole blood is the percent by volume of a reaction mixture that was made using unfractionated whole blood.
- a reaction mixture is formed by adding replication incompetent recombinant retroviral particles to whole blood, and in illustrative embodiments unfractionated whole blood, the percentage of whole blood in the reaction mixture is the volume of whole blood by the total volume of the reaction mixture times 100.
- such blood or blood preparation component that is not a PBMC is one or more (e.g.
- erythrocytes wherein the erythrocytes comprise between 1 and 60% of the volume of the reaction mixture
- neutrophils wherein the neutrophils comprise at least 10% of the white blood cells in the reaction mixture, or wherein the reaction mixture comprises at least 10% as many neutrophils as T cells
- basophils wherein the basophils comprise at least 0.05% of the white blood cells in the reaction mixture
- eosinophils wherein the reaction mixture comprises at least 0.1% of the white blood cells in the reaction mixture
- plasma wherein the plasma comprises at least 1% of the volume of the reaction mixture
- an anticoagulant an anticoagulant
- the percentage is based on volume. For example, in certain embodiments at least 25% of the volume of a reaction mixture can be whole blood. Thus, in such embodiments at least 25 ml of 100 ml of such reaction mixture, would be whole blood.
- the one or more additional blood components that is not a PBMC that is found in certain embodiments herein, are present in certain illustrative embodiments of the reaction mixture (including related use, cell formulation, modified and in illustrative embodiments genetically modified T cell or NK cell, or method for modifying T cells and/or NK cells aspects provided herein) because in these illustrative embodiments the reaction mixture comprises at least 10% whole blood, and in certain illustrative embodiments, at least 25%, 50%, 75%, 90%, or 95% whole blood, or for example between 25% and 95% whole blood.
- reaction mixtures are formed by combining whole blood with an anticoagulant (for example by collecting whole blood into a blood collection tube comprising an anticoagulant), and adding a solution of recombinant retroviruses to the blood with anticoagulant.
- an anticoagulant for example by collecting whole blood into a blood collection tube comprising an anticoagulant
- the reaction mixture comprises an anticoagulant as set out in more detail herein, for example in the Exemplary Embodiments section.
- the whole blood is not, or does not comprise, cord blood.
- the reaction mixture in illustrative embodiments of these aspects is formed by some volume of whole blood added directly to other reaction mixture components to form the reaction mixture.
- the reaction mixture in such embodiments is formed by a method that typically does not include a PBMC enrichment procedure.
- typically such reaction mixtures include additional components listed in a)-f) above, which are not PBMCs.
- the reaction mixture comprises all of the additional components listed in a) to e) above, because the reaction mixture comprises substantially whole blood, or whole blood.
- “Substantially whole blood” is blood that was isolated from an individual(s), has not been subjected to a PBMC enrichment procedure, and is diluted by less than 50% with other solutions.
- this dilution can be from addition of an anticoagulant as well as addition of a volume of fluid comprising retroviral particles.
- Further reaction mixture embodiments for methods and compositions that relate to transducing lymphocytes in whole blood, are provided herein.
- [0208] in yet another aspect provided herein, is use of replication incompetent recombinant retroviral particles in the manufacture of a kit for modifying lymphocytes, in illustrative embodiments T cells and/or NK cells of a subject, wherein the use of the kit comprises the above method of transducing, genetically modifying, and/or modifying lymphocytes in whole blood.
- kits for transducing, genetically modifying, and/or modifying lymphocytes in whole blood
- uses of such a method in the manufacture of a kit, reaction mixtures formed in such a method, cell formulations made by such methods, modified lymphocytes made by such a method, and methods for administering a modified and in illustrative embodiments genetically modified lymphocyte made by such a method are referred to herein as “composition and method aspects for transducing lymphocytes in whole blood.”
- composition and method aspects for transducing lymphocytes in whole blood are referred to herein as “composition and method aspects for transducing lymphocytes in whole blood.”
- illustrative embodiments for such aspects involve contacting T cells and/or NK cells with retroviral particles in whole blood
- such aspects also include other embodiments, where one or more of additional components a-f above, are present in transduction reaction mixtures at higher concentrations than is
- such aspects arise when blood is fractionated using a filter that separates blood into components that include T cells and/or NK cells and additional blood components that are not present in PBMC preparations, for example the use of leukoreduction filters and the resulting presence of neutrophils in the cell-fraction that includes T cells and NK cells that is retained by the filter.
- a filter that separates blood into components that include T cells and/or NK cells and additional blood components that are not present in PBMC preparations, for example the use of leukoreduction filters and the resulting presence of neutrophils in the cell-fraction that includes T cells and NK cells that is retained by the filter.
- embodiments of any of the composition and method aspects for transducing lymphocytes in whole blood can include any of the embodiments of replication incompetent recombinant retroviral particles provided herein, including those that include one or more polypeptide lymphoproliferative element, inhibitory RNA, CAR, pseudotyping element, riboswitch, activation element, membrane-bound cytokine, miRNA, Kozak-type sequence, WPRE element, triple stop codon, and/or other element disclosed herein, and can be combined with methods herein for producing retroviral particles using a packaging cell.
- any aspect and embodiment of the composition e.g.
- reaction mixture and method aspects for transducing lymphocytes in whole blood, can be combined with any composition and method aspect including a self driving CAR provided herein. Details regarding any composition and method aspects including a self driving CAR are disclosed in more detail herein, for example in the Self-Driving CAR Methods and Compositions section and in the Exemplary Embodiments section.
- the retroviral particle is a lentiviral particle.
- a method for modifying and in illustrative embodiments genetically modifying a lymphocyte, such as a T cell and/or NK cell in whole blood can be performed in vitro or ex vivo.
- Anticoagulants are included in reaction mixtures for certain embodiments of the composition (e.g. reaction mixtures) and method aspects for transducing lymphocytes in whole blood provided herein.
- blood is collected with the anti-coagulant present in the collection vessel (e.g. tube or bag), for example using standard blood collection protocols known in the art.
- Anticoagulants that can be used in composition and method aspects for transducing lymphocytes in whole blood provided herein include compounds or biologies that block or limit the thrombin blood clotting cascade.
- the anticoagulants include: metal chelating agents, preferably calcium ion chelating agents, such as citrate (e.g.
- citrate containing free citrate ion
- solutions of citrate that contain one or more components such as citric acid, sodium citrate, phosphate, adenine and mono or polysaccharides, for example dextrose, oxalate, and EDTA; heparin and heparin analogues, such as unfraetionated heparin, low molecular weight heparins, and other synthetic saccharides; and vitamin K antagonists such as coumarins.
- Exemplary citrate compositions include: acid citrate dextrose (ACD) (also called anticoagulant citrate dextrose solution A and solution B (United States Pharmacopeia 26, 2002, pp 158)); and a citrate phosphate dextrose (CPD) solution, which can also be prepared as CPD-A1 as is known in the art.
- ACD acid citrate dextrose
- CPD citrate phosphate dextrose
- the anticoagulant composition may also include phosphate ions or monobasic phosphate ion, adenine, and mono or polysaccharides.
- Such anticoagulants can be present in a reaction mixture at concentrations that are effective for preventing coagulation of blood (i.e. effective amounts) as known in the art, or at a concentration that is, for example, 2 times, 1.5 times, 1.25 times, 1.2 times, 1.1 times, or 9/10, 4/5, 7/10, 3/5, 1/2, 2/5, 3/10, 1/5, or 1/10 the effective concentration.
- concentrations of many different anticoagulants is known and can be readily determined empirically by analyzing different concentrations for their ability to prevent blood coagulation, which can be physically observed.
- the effective concentration includes the concentration of any commercially available anticoagulant in a commercially available tube or bag after the anticoagulant is diluted in the volume of blood intended for the tube or bag.
- the concentration of acid citrate dextrose (ACD) in a reaction mixture in certain embodiments of the composition and method aspects for transducing lymphocytes in whole blood provided herein can be between 0.1 and 5X, or between 0.25 and 2.5X, between 0.5 and 2X, between 0.75 and 1.5X, between 0.8 and 1.2X, between 0.9 and 1.1X, about IX, or IX the concentration of ACD in a commercially available ACD blood collection tube or bag.
- blood can be collected into tubes or bags containing 3.2% (109 mM) sodium citrate (109 mM) at a ratio of 9 parts blood and 1 part anticoagulant.
- the citrate concentration can be between for example, 25% to 0.4%, or 0.30% to 0.35%.
- 15 ml of ACD Solution A are present in a blood bag for collecting 100 mL of blood.
- the ACD before addition of blood contains Citric acid (anhydrous) 7.3 g/F (0.73%), Sodium citrate (dihydrate) 22.0 g/F (2.2 %), and Dextrose (monohydrate) 24.5 g/F [USP] (2.4%).
- the concentration of ACD components in a reaction mixture can be between 0.05 and 0.1%, or 0.06 and 0.08% Citric acid (anhydrous), 0.17 and 0.27, or 0.20 and 0.24 Sodium citrate (dihydrate), 0.2 and 0.3, or 0.20 and 0.28, or 0.22 and 0.26% Dextrose (monohydrate).
- sodium citrate is used at a concentration of between 0.001 and 0.02 M in the reaction mixture.
- heparin is present in the reaction mixtures, for example at a concentration between 0.1 and 5X, or between 0.25 and 2.5X, between 0.5 and 2X, between 0.75 and 1.5X, between 0.8 and 1.2X, between 0.9 and 1.1X, about IX, or IX the concentration of heparin in a commercially available heparin blood collection tube.
- Heparin is a glycosaminoglycan anticoagulant with a molecular weight ranging from 5,000-30,000 daltons.
- heparin is used at a concentration of about 1.5 to 45, 5 to 30, 10 to 20, or 15 USP units/ml of reaction mixture.
- the effective concentration for EDTA, for example as K2EDTA, in the reaction mixtures herein can be between 0.15 and 5 mg/ml, between 1 and 3 mg/ml between 1.5-2.2 mg/ml of blood, or between 1 and 2 mg/ml, or about 1.5 mg/ml.
- the reaction mixtures in composition and method aspects for transducing lymphocytes in whole blood provided herein can include two or more anticoagulants whose combined effective dose prevents coagulation of the blood prior to formation of the reaction mixture and/or of the reaction mixture itself.
- the anticoagulant can be administered to a subject before blood is collected from the subject for ex vivo transduction, such that coagulation of the blood when it is collected in inhibited, at least partially and at least through a contacting step and optional incubation period thereafter.
- acid citrate dextrose can be administered to the subject at between 80 mg/kg/day and 5 mg/kg/day (mg refer to the mg of citric acid and kg applies to the mammal to be treated).
- Heparin can be delivered for example, at a dose of between 5 units/kg/hr to 30 units/kg/hr.
- Reaction mixtures in certain illustrative embodiments herein can include blood or blood preparation component that is not a PBMC, as provided herein.
- blood or blood preparation component that is not a PBMC, as provided herein.
- Non-limiting exemplary concentrations of such components are provided in the following paragraphs. It will be understood that resulting cell formulations from methods using these reaction mixtures, in illustrative embodiments will include these additional components, and in some embodiments at the same ratios or percentages relative to other cells, provided below for reaction mixtures.
- erythrocytes are present in reaction mixtures and cell formulations herein, in some embodiments at a relative amount to T cells that is greater than after a typical PBMC isolation, and in some embodiments erythrocytes can comprise between 0.1, 0.5, 1, 5, 10, 25, 35 or 40% of the volume of the reaction mixture on the low end of the range, and between 25, 50, 60, or 75% of the volume of the reaction mixture on the high end of the range.
- erythrocytes comprise between 1 and 60%, between 10 and 60%, between 20 and 60%, between 30 and 60%, between 40 and 60%, between 40 and 50%, between 42 and 48%, between 44 and 46%, about 45% or 45% of the reactio nmixture. In some embodiments, more erythrocytes are present than T cells in a reaction mixture or cell formulation.
- neutrophils are present in reaction mixtures and cell formulations provided herein, in some embodiments at a relative amount to T cells that is greater than after a typical PBMC isolation, and in some embodiments, neutrophils can comprise between 0.1, 0.5, 1, 5, 10, 20, 25, 35 or 40% of the white blood cells of the reaction mixture or cell formulation on the low end of the range, and between 25, 50, 60, 70, 75 and 80% of the white blood cells of the reaction mixture or cell formulation on the high end of the range, for example between 25% and 70%, or between 30% and 60%, or between 40% and 60% of the white blood cells of the reaction mixture or cell formulation. In some embodiments, more neutrophils are present than T cells and/or NK cells, in reaction mixtures and cell formulations herein.
- eosinophils are present in a reaction mixture or a cell formulation, in some embodiments at a relative amount to T cells that is greater than after a typical PBMC isolation, and in some embodiments eosinophils can comprise between 0.05, 0.1, 0.2, 0.4, 0.6, 0.8, 1.0, 1.2, 1.4, 1.6, and 1.8 % of the white blood cells of the reaction mixture or cell formulation on the low end of the range, and between 2.0, 2.2, 2.4, 2.6, 2.8, 3.0, 3.5, 4, 5, 6, 8 and 10 % of the white blood cells of the reaction mixture or cell formulation on the high end of the range.
- eosinophils comprise between 0.05 and 10.0 %, between 0.1 and 9%, between 0.2 and 8%, between 0.2 and 6%, between 0.5 and 4%, between 0.8 and 4%, or between 1 and 4% of the white blood cells of the reaction mixture or cell formulation.
- basophils are present in a reaction mixture or cell formulation, in some embodiments at a relative amount to T cells that is greater than after a typical PBMC isolation, and in some embodiments basophils can comprise between 0.05, 0.1, 0.2, 0.4, 0.45, and 0.5 % of the white blood cells of the reaction mixture on the low end of the range, and between 0.8, 0.9, 1.0, 1.1, 1.2, 1.5, and 2.0% of the white blood cells of the reaction mixture on the high end of the range.
- basophils comprise between 0.05 and 1.4%, between 0.1 and 1.4%, between 0.2 and 1.4%, between 0.3 and 1.4%, between 0.4 and 1.4%, between 0.5 and 1.4%, between 0.5 and 1.2%, between 0.5 and 1.1%, or between 0.5 and 1.0 % of the white blood cells of the reaction mixture.
- plasma components are present in a reaction mixture or cell formulation, and in some embodiments plasma can comprise between 0.1, 0.5, 1, 5, 10,
- plasma comprise between 0.1 and 80%, between 1 and 80%, between 5 and 80%, between 10 and 80%, between 30 and 80%, between 40 and 80%, between 45 and 70%, between 50 and 60%, between 52 and 58%, between 54 and 56%, about 55% or 55% of the reaction mixture.
- platelets are present in a reaction mixture or cell formulation, in some embodiments at a relative amount to T cells that is greater than after a typical PBMC isolation, .and in some embodiments they can comprise between 1x10 s , lxlO 6 , lxlO 7 , or lxlO 8 platelets/mL of the reaction mixture on the low end of the range, and between lxlO 9 , lxlO 10 , lxlO 11 , lxlO 12 , 2xl0 13 , or 2xl0 14 platelets /mL of the reaction mixture on the high end of the range.
- platelets comprise between 1x10 s and lxlO 12 platelets, between lxlO 6 and lxlO 11 platelets, between lxlO 7 and lxlO 10 platelets, between 1x10 s , and lxl0 9 platelets/mL, or between 1x10 s and 5x10 s platelets/ml of the reaction mixture., in some embodiments at a relative amount to T cells that is greater than after a typical PBMC isolation, and in some embodiments at between 0.1% and 9%, 0.1% and 1%, or between 1 % and 9% of white blood cells in the reaction mixture or cell formulation.
- a method of transducing, transfecting, genetically modifying, and/or modifying a lymphocyte such as a (typically a population of) peripheral blood mononuclear cell (PBMC), typically a T cell and/or an NK cell, and in certain illustrative embodiments a resting T cell and/or resting NK cell, that includes contacting the lymphocyte with a (typically a population of) recombinant nucleic acid vector, which in illustrative embodiments is a replication incompetent recombinant retroviral particle, wherein said contacting (and incubation under contacting conditions) facilitates membrane association, membrane fusion or endocytosis, and optionally transduction or transfection of the resting T cell and/or NK cell by the recombinant nucleic acid vector, thereby producing the modified and in illustrative embodiments genetically modified T cell and/or NK cell.
- PBMC peripheral blood mononuclear cell
- the recombinant nucleic acid vector is a replication incompetent recombinant retroviral particle
- the replication incompetent recombinant retroviral particle typically comprises a fusogenic element and a binding element, which can be part of a pseudotyping element, on its surface.
- pre activation of the T cell and/or NK cell is not required, and an activation element, which can be any activation element provided herein, is present in a reaction mixture in which the contacting takes place.
- the activation element is present on a surface of the replication incompetent recombinant retroviral particle.
- the activation element is anti- CD3, such as anti-CD3 scFv, or anti-CD3 scFvFc.
- Many of the method aspects provided herein include the following steps: 1) an optional step of collecting blood from a subject; 2) a step of contacting cells, such as NK cells and/or in illustrative embodiments T cells, which can be from the collected blood, with a recombinant vector (typically many copies thereof), in illustrative embodiments a replication incompetent recombinant retroviral particle, encoding a CAR and/or a lymphoproliferative element, in a reaction mixture, where the contacting can include an optional incubation; 3) typically a step of washing unbound recombinant vector away from the cells in the reaction mixture; 4) typically a step of collecting modified cells, such as modified NK cells and/or in illustrative embodiments modified T cells in a solution, which in illustrative embodiments can be a delivery solution, to form a cell suspension, that in illustrative embodiments is a cell formulation; and 5) an optional step of delivering the cell
- the reaction mixture includes unfractionated whole blood or includes one or more cell type that is not a PBMC, and can include all or many cell types found in whole blood, including total nucleated cells (TNCs).
- the recombinant vector comprises a self-driving CAR, which encodes both a CAR and a lymphoproliferative element.
- the collected, unfractionated blood/isolated cells are passed through a leukoreduction filter to isolate TNCs on top of the filter; replication incompetent recombinant retroviral particles are added to the TNCs on top of the leukoreduction filter to a total reaction mixture volume of 500 m ⁇ to 10 ml to form a reaction mixture and initiate contacting; the reaction mixture is optionally incubated for any of the contacting times provided herein, as a non-limiting example, for 1-4 hours; the non-associated replication incompetent recombinant retroviral particles are washed away from cells in the reaction mixture by filtering the reaction mixture with 10 to 120 ml of wash solution; and the cells, including modified T cells and NK cells, which are retained on the TNC filter,
- Some embodiments of any methods used in any aspects provided herein can include a step of collecting blood from a subject.
- the blood includes blood components including blood cells such as lymphocytes (e.g. T cells and NK cells) that can be used in methods and compositions provided herein.
- the subject is a human subject afflicted with cancer (i.e. a human cancer subject). It is noteworthy that certain embodiments do not include such a step.
- blood can be collected or obtained from a subject by any suitable method known in the art as discussed in more detail herein, and as such the collected blood or blood-derived component can be referred to as a “blood-derived product” and typically is a “peripheral blood-derived product,” since typically it is isolated from peripheral blood.
- the blood- derived product can be collected by venipuncture or any other blood collection method known in the art, by which a sample of unfractionated whole blood is collected in a vessel, for example a blood bag, or by which leukocytes and lymphocytes are isolated from blood, such as by aphersis (e.g. leukapheresis or lymphoplasmapharesis).
- the volume of blood (e.g. unfractionated whole blood) collected is between 1 and 5 ml, 5 and 10 ml, 10 and 15 ml, 15 and 20 ml, 20 and 25 ml, 5 and 25 ml, 25 ml and 250 ml, 25 ml and 125 ml, 50 ml and 100 ml, or 50 ml and 250 ml, 75 ml and 125 ml, 90 ml and 120 ml, or between 95 and 110 ml.
- the volume of blood collected can be between 1 and 5 ml, 5 and 10 ml, 10 and 15 ml, 15 and 20 ml, 20 and 25 ml, 5 and 25 ml, 25 ml and 250 ml, 25 ml and 125 ml, 50 ml and 100 ml, or 50 ml and 250 ml, 75 ml and 125 ml, 90 ml and 120 ml, or between 95 and 110 m
- the volume of blood collected is less than 250 ml, 100 ml, 75 ml, 20 ml, 15 ml, 10 ml, or 5 ml.
- lymphocytes e.g. T cells and/or NK cells
- the volume of blood taken and processed during apheresis e.g.
- leukapheresis or lymphoplasmapharesis is between 0.5, 0.6, 0.7, 0.75, 0.8, 0.9, 1, 1.25, or 1.5 total blood volumes of a subject on the low end of the range and 0.6, 0.7, 0.75, 0.8, 0.9, 1, 1.25, 1.5 1.75, 2, 2.25, or 2.5 total blood volumes of a subject on the high end of the range, for example between 0.5 and 2.5, 0.5 and 2, 0.5 and 1.5, or between 1 and 2 total blood volumes.
- the total blood volume of a human typically ranges from 4.5 to 6 L and thus much more blood is typically taken and processed during apheresis than if unfractionated whole blood is collected.
- target blood cells e.g.
- T cells are obtained by apheresis or unfractionated whole blood is collected for example into a blood bag
- target blood cells e.g T cells
- target blood cells e.g T cells
- aphersis e.g. leukapheresis or lymphoplasmapharesis
- NK cells e.g.
- apheresis e.g. leukapheresis or lymphoplasmapharesis
- blood cells e.g. White blood cells or lymphocytes
- a population of lymphocytes are typically contacted with many copies of a recombinant vector, which in some embodiments are copies of a non-viral vector, and in illustrative embodiments are identical replication incompetent recombinant retroviral particles, in a reaction mixture.
- the contacting in any embodiment provided herein can be performed for example in a chamber of a closed system adapted for processing of blood cells, for example within a blood bag, as discussed in more detail herein.
- the blood bag can have 5, 10, 15, 20, 25, 50, 75, 100, 150, 200, 250, 300, 400, or 500 ml or less of blood during the contacting. In some embodiments, the blood bag can have at least 5, 10, 15, 20, 25, 50, 75, 100, 150, 200, 250, 300, 400, or 500 ml of blood during the contacting.
- the blood bag can have between 1, 2, 3, 4, 5, 10, 15, 20, 25, and 50 ml of blood on the low end of the range and 10, 15, 20, 25, 50, 75, 100, 150, 200, 250, 300, 400, and 500 ml of blood on the high end of the range during the contacting.
- the blood bag can have between 1 and 10 ml, 5 and 25 ml, 10 and 50 ml, 25 and 100 ml, 50 and 200 ml, or 100 and 500 ml of blood during the contacting.
- the mixure inide the blood bag can include heparin. In other embodiments, the mixture inside the blood bag does not include heparin.
- the transduction reaction mixture can include one or more buffers, ions, and a culture media.
- lentiviral particles in certain exemplary reaction mixtures provided herein, between 0.1 and 50, 0.5 and 50, 0.5 and 20, 0.5 and 10, 1 and 25, 1 and 15, 1 and 10, 1 and 5, 2 and 15, 2 and 10, 2 and 7, 2 and 3, 3 and 10, 3 and 15, or 5 and 15, multiplicity of infection (MOI); or at least 1 and less than 6, 11, or 51 MOI; or in some embodiments, between 5 and 10 MOI units of replication incompetent recombinant retroviral particles are present.
- the MOI can be at least 0.1, 0.5, 1, 2, 2.5, 3, 5, 10 or 15.
- compositions and methods for transducing lymphocytes in blood in certain embodiments higher MOI can be used than in methods wherein PBMCs are isolated and used in the reaction mixtures.
- illustrative embodiments of compositions and methods for transducing lymphocytes in whole blood assuming lxlO 6 PBMCs/ml of blood, can use retroviral particles with an MOI of between 1 and 50, 2 and 25, 2.5 and 20, 2.5 and 10, 4 and 6, or about 5, and in some embodiments between 5 and 20, 5 and 15, 10 and 20, or 10 and 15.
- this contacting, and the reaction mixture in which the contacting occurs takes place within a closed cell processing system, as discussed in more detail herein.
- a packaging cell and in illustrative embodiments a packaging cell line, and in particularly illustrative embodiments a packaging cell provided in certain aspects herein, can be used to produce the replication incompetent recombinant retroviral particles.
- the cells in the reaction mixture can be PBMCs or TNCs, and/or in reaction mixture aspects herein that provide compositions and methods for transducing lymphocytes in whole blood, an anticoagulant and/or an additional blood component, including additional types of blood cells that are not PBMCs, can be present as discussed herein.
- the reaction mixture can essentially be whole blood, and typically an anticoagulant, retroviral particles, and a relatively small amount of the solution in which the retroviral particles were delivered to the whole blood.
- lymphocytes including NK cells and T cells, can be present at a lower percent of blood cells, and at a lower percentage of white blood cells, in the reaction mixture than methods that involve a PBMC enrichment procedure before forming the reaction mixture.
- T cells can be for example, between 10, 20, 30, or 40% of the lymphocytes of the reaction mixture on the low end of the range, and between 40, 50, 60, 70, 80, or 90% of the lymphocytes of the reaction mixture on the high end of the range.
- T cells comprise between 10 and 90%, between 20 and 90%, between 30 and 90%, between 40 and 90%, between 40 and 80%, or between 45% to 75% of the lymphocytes.
- NK cells can be present at between 1, 2, 3, 4, or 5 % of the lymphocytes of the reaction mixture on the low end of the range, and between 5, 6, 7, 8, 9, 10, 11, 12, 13, or 14% of the lymphocytes of the reaction mixture on the high end of the range.
- T cells comprise between 1 and 14%, between 2 and 14%, between 3 and 14%, between 4 and 14%, between 5 and 14%, between 5 to 13%, between 5 to 12%, between 5 to 11% or between 5 to 10% of the lymphocytes of the reaction mixture.
- composition and method aspects for transducing lymphocytes in whole blood typically do not involve any blood fractionation such as a PBMC enrichment step of a blood sample, before lymphocytes from the blood sample are contacted with recombinant nucleic acid vectors, for example retroviral particles, in the reaction mixtures disclosed herein for those aspects.
- lymphocytes in unfractionated whole blood are contacted with recombinant retroviral particles.
- neutrophils/granulocytes are separated away from other blood cells before the cells are contacted with replication incompetent recombinant retroviral particles.
- peripheral blood mononuclear cells including peripheral blood lymphocytes (PBLs) such as T cell and/or NK cells
- PBLs peripheral blood lymphocytes
- T cell and/or NK cells are isolated away from other components of a blood sample using for example, a PBMC enrichment procedure, before they are combined into a reaction mixture with retroviral particles.
- a PBMC enrichment procedure is a procedure in which PBMCs are enriched at least 25-fold, and typically at least 50-fold from other blood cell types. For example, it is believed that PBMCs make up less than 1% of blood cells in whole blood. After a PBMC enrichment procedure, at least 30%, and in some examples as many as 70% of cells isolated in the PBMC fraction are PBMCs. It is possible that even higher enrichment of PBMCs is achieved using some PBMC enrichment procedures. Various different PBMC enrichment procedures are known in the art.
- a PBMC enrichment procedure is a ficoll density gradient centrifugation process that separates the main cell populations, such as lymphocytes, monocytes, granulocytes, and red blood cells, throughout a density gradient medium.
- the aqueous medium includes ficoll, a hydrophilic polysaccharide that forms the high density solution. Layering of whole blood over or under a density medium without mixing of the two layers followed by centrifugation will disperse the cells according to their densities with the PBMC fraction forming a thin white layer at the interface between the plasma and the density gradient medium (see e.g. Panda and Ravindran (2013) Isolation of Fiuman PBMCs. BioProtoc. Vol. 3(3)).
- centripetal forces can be used to separate PBMCs from other blood components, in ficoll using the spinning force of a Sepax cell processing system.
- apheresis for example leukapheresis
- PBMCs can be used to isolate cells, such as PBMCs.
- AMICUS RBCX Frsenius-Kabi
- Trima Accel Tuumo BCT
- Cells isolated by apheresis typically contain T cells, B cells, NK cells, monocytes, granulocytes, other nucleated white blood cells, red blood cells, and/or platelets.
- the cells collected by apheresis can be washed to remove the plasma fraction and to place the cells in an appropriate buffer or media, such as phosphate buffered saline (PBS) or wash solution lacks calcium and may lack magnesium or may lack many if not all divalent cations, for subsequent processing steps.
- PBS phosphate buffered saline
- the cells collected by apheresis can be genetically modified by any of the methods provided herein.
- the cells collected by apheresis can be used to prepare any of the cell formulations provided herein.
- the cells collected by apheresis can be resuspended in a variety of biocompatible buffers, such as, for example, Ca-free, Mg-free PBS.
- leukopheresis can be used to isolate cells, such as lymphocytes.
- a leukopak can be used in any embodiment that includes TNCs.
- a huffy coat can be used in another PBMC enrichment method.
- an automated leukapheresis collection system such as SPECTRA OPTIA® APHERESIS SYSTEM from Terumo BCT, Inc.
- Lakewood, CO 80215, USA is used to separate the inflow of whole blood from the target PBMC fraction using high-speed centrifugation while typically returning the outflow material, such as plasma, red blood cells, and granulocytes, back to the donor, although this returning would be optional in methods provided herein. Further processing may be necessary to remove residual red blood cells and granulocytes. Both methods include a time intensive purification of the PBMCs, and the leukapheresis method requires the presence and participation of the patient during the PBMC enrichment step.
- PBMCs are isolated using a Sepax or Sepax 2 cell processing system (BioSafe).
- the PBMCs are isolated using a CliniMACS Prodigy cell processor (Miltenyi Biotec).
- an automated apheresis separator is used which takes blood from the subject, passes the blood through an apparatus that sorts out a particular cell type (such as, for example, PBMCs), and returns the remainder back into the subject. Density gradient centrifugation can be performed after apheresis.
- the PBMCs are isolated using a leukoreduction filter assembly.
- magnetic bead activated cell sorting is then used for purifying a specific cell population from PBMCs, such as, for example, PBLs or a subset thereof, according to a cellular phenotype (i.e. positive selection), before they are used in a reaction mixture herein.
- Other methods for purification can also be used, such as, for example, substrate adhesion, which utilizes a substrate that mimics the environment that a T cell encounters during recruitment, to purify T cells before adding them to a reaction mixture, or negative selection can be used, in which unwanted cells are targeted for removal with antibody complexes that target the unwanted cells for removal before a reaction mixture for a contacting step is formed.
- substrate adhesion which utilizes a substrate that mimics the environment that a T cell encounters during recruitment
- negative selection can be used, in which unwanted cells are targeted for removal with antibody complexes that target the unwanted cells for removal before a reaction mixture for a contacting step is formed.
- red blood cell rosetting can be used to remove red blood cells before forming a reaction mixture.
- hematopoietic stem cells can be removed before a contacting step, and thus in these embodiments, are not present during the contacting step.
- an ABC transporter inhibitor and/or substrate is not present before, during, or both before and during the contacting (i.e. not present in the reaction mixture in which contacting takes place) with or without optional incubating, or any step of the method.
- lymphocytes are modified and in illustrative embodiments genetically modified and/or transduced without prior activation or stimulation, and/or without requiring prior activation or stimulation, whether in vivo, in vitro, or ex-vivo and/or furthermore, in some embodiments, without ex vivo or in vitro activation or stimulation after an initial contacting with or without an optional incubation, or without requiring ex vivo or in vitro activation or stimulation after an initial contacting with or without an optional incubation.
- the cell is activated during the contacting and is not activated at all or not activated for more than 15 minutes, 30 minutes, 1, 2, 4, or 8 hours before the contacting.
- activation by elements that are not present on the retroviral particle surface is not required for modifying, genetically modifying, and/or transducing the cell. Accordingly, such activation or stimulation elements are not required other than on the retroviral particle, before, during, or after the contacting.
- these illustrative embodiments that do not require pre-activation or stimulation provide the ability to rapidly perform in vitro experiments aimed at better understanding T cells and the biologicals mechanisms, therein.
- lymphocytes e.g. NK cells and especially T cells
- rPOC rapid point-of-care
- some, most, at least 25%, 50%, 60%, 70%, 75%, 80%, 90%, 95%, or 99%, or all of the lymphocytes are resting when they are combined with retroviral particles to form a reaction mixture, and typically are resting when they are contacted with retroviral viral particles in a reaction mixture.
- lymphocytes can be contacted in the typically resting state they were in when present in the collected blood in vivo immediately before collection.
- the T cells and/or NK cells consist of between 95 and 100% resting cells (Ki-67 ).
- the T cell and/or NK cells that are contacted by replication incompetent recombinant retroviral particles include between 90, 91, 92, 93, 94, and 95% resting cells on the low end of the range and 96, 97, 98, 99, or 100% resting cells on the high end of the range.
- the T cells and/or NK cells include naive cells.
- the subembodiments in this paragraph are included in composition and method aspects for transducing lymphocytes in whole blood.
- contact between the T cells and/or NK cells and the replication incompetent recombinant retroviral particles can facilitate transduction of the T cells and/or NK cells by the replication incompetent recombinant retroviral particles.
- the replication incompetent recombinant retroviral particles identify and bind to T cells and/or NK cells and the T cells and NK cells are “modified” as the term is used herein.
- the retroviral and host cell membranes start to fuse, and any retroviral pseudotyping elements and/or T cell activation elements, including anti-CD3 antibodies, become integrated into the surface of the modified T cells and/or NK cells.
- genetic material from the replication incompetent recombinant retroviral particles enters the T cells and/or NK cells at which time the T cells and/or NK cells are “genetically modified” as the phrase is used herein.
- the genetic material is typically integrated into the genomic DNA of the T cells and/or NK cells, at which time the T cells and/or NK cells are now “transduced” as the term is used herein.
- cells can be modified, genetically modified, and/or transduced by recombinant vectors other than replication incompetent recombinant retroviral particles. Cells may also internalize and integrate genetic material into the genomic DNA of the T cells and/or NK cells after transfection, at which time the T cells and/or NK cells are now “stably transfected” as the term is used herein.
- any method for modifying and/or genetically modifying lymphocytes is a method for transducing lymphocytes (e.g. T cells and/or NK cells). It is believed that by day 6 in vivo or ex vivo, after contacting is initiated, the vast majority of modified and genetically modified cells have been transduced. Methods of lentiviral transduction are known. Exemplary methods are described in, e.g., Wang et al. (2012) J. Immunother. 35(9): 689-701; Cooper et al. (2003) Blood. 101:1637-1644; Verhoeyen et al. (2009) Methods Mol Biol.
- a transduced, or in some embodiments a stably transfected, T cell and/or NK cell includes progeny of ex vivo transduced cells that retain at least some of the nucleic acids or polynucleotides that are incorporated into the genome of a cell during the ex vivo transduction.
- methods herein that recite “reintroducing” a transduced cell it will be understood that such cell is typically not in a transduced state when it is collected from the blood of a subject.
- a T cell activation element in illustrative embodiments is present in the reaction mixture where initial contacting of a recombinant retrovirus and lymphocytes occurs.
- T cell activation element can be in solution in the reaction mixture.
- soluble anti-CD3 antibodies can be present in the reaction mixture during the contacting and optional incubation thereafter, at 25-200, 50-150, 75-125, or 100 ng/ml.
- the T cell activation element is associated with the retroviral surface.
- the T cell activation element can be any T cell activation element provided herein.
- the T cell activation element can be anti-CD3, such as anti-CD3 scFv, or anti-CD3 scFvFc.
- the replication incompetent recombinant retroviral particle can further include a T cell activation element, which in further illustrative examples is associated with the external side of the surface of the retrovirus.
- the contacting step of a method for transducing and/or a method for modifying or genetically modifying lymphocytes in whole blood typically includes an initial step in which the retroviral particle, typically a population of retroviral particles, are brought into contact with blood cells, typically a population of blood cells that includes an anticoagulant and/or additional blood components other than PBMCs, that are not present after a PBMC enrichment procedure, while in suspension in a liquid buffer and/or media to form a transduction reaction mixture.
- This contacting can be followed by an optional incubating period in this reaction mixture that includes the retroviral particles and the blood cells comprising lymphocytes (e.g. T cells and/or NK cells) in suspension.
- the reaction mixture can include at least one, two, three, four, five, or all additional blood components as disclosed herein, and in illustrative embodiments includes one or more anticoagulants.
- the transduction reaction mixture in any of the aspects provided herein can be incubated at between 23 and 39 °C, and in some illustrative embodiments at 37 °C, in an optional incubation step after the initial contacting of retroviral particles and lymphocytes.
- the transduction reaction can be carried out at 37-39 °C for faster fusion/transduction.
- the contacting step is a cold contacting step as discussed elsewhere herein, with an optional incubating step.
- the cold contacting step is performed at temperatures less than 37 °C, such as between 1 °C and 25 °C or 2 °C and 6 °C.
- the optional incubating associated with the contacting step at these temperatures can be performed for any length of time discussed herein, for example in the Exemplary Embodiments section. In illustrative embodiments, the optional incubating associated with these temperatures is performed for 1 hour or less.
- the contacting is carried out at a lower temperature, for example between 2 °C and 25 °C, referred to herein as cold contacting, and then retroviral particles that remain unassociated in suspension are removed from the reaction mixture, for example by washing the reaction mixture over a filter, such as a leukoreduction filter, that retains leukocytes including T cells and NK cells, but not free, unassociated viral particles.
- a filter such as a leukoreduction filter, that retains leukocytes including T cells and NK cells, but not free, unassociated viral particles.
- the cells and retroviral particles when brought into contact in the transduction reaction mixture can be immediately processed to remove the retroviral particles that remain free in suspension and not associated with cells, from the cells.
- the cells in suspension and retroviral particles whether free in suspension or associated with the cells in suspension can be incubated for various lengths of time, as provided herein for a contacting step in a method provided herein.
- a wash can be performed, regardless of whether such cells will be studied in vitro, ex vivo or introduced into a subject.
- Such suspension can include allowing cells and retroviral particles to settle or causing such settling through application of a force, such as a centrifugal force, to the bottom of a vessel or chamber, as discussed in further detail herein.
- a force such as a centrifugal force
- such g force is lower than the g forces used successfully in spinoculation procedures.
- the methods provided herein allow for rapid ex vivo processing of lymphocytes, and in certain illustrative embodiments, PBMCs, and in other illustrative embodiments, total nucleated cells (TNCs), without an ex vivo expansion step, fundamentally simplifying the delivery of adoptive cell therapies, for example by providing such point-of-care methods, and in some illustrative embodiments, in shorter periods of time (rapid point-of-care (rPOC)).
- rPOC rapid point-of-care
- Illustrative methods are disclosed herein for modifying lymphocytes, especially NK cells and in illustrative embodiments, T cells, that are much shorter and simpler than prior methods.
- the contacting step in any method provided herein of transducing, genetically modifying, and/or modifying a PBMC or a lymphocyte, typically a T cell and/or an NK cell can be performed (or can occur) for any of the time periods provided in this specification, included, but not limited to those provided in the Exemplary Embodiments section.
- said contacting can be for less than 24 hours, for example, less than 12 hours, less than 8 hours, less than 4 hours, less than 2 hours, less than 1 hour, less than 30 minutes or less than 15 minutes, but in each case there is at least an initial contacting step in which retroviral particles and cells come into contact in suspension in a transduction reaction mixture before retroviral particles that remain in suspension not associated with a cell, are separated from cells and typically discarded, as discussed in further detail herein. It should be noted, but not intending to be limited by theory, that it is believed that contacting begins at the time that retroviral particles and lymphocytes are combined together, typically by adding a solution containing the retroviral particles into a solution containing lymphocytes (e.g. T cells and/or NK cells).
- a solution containing the retroviral particles e.g. T cells and/or NK cells
- initial contacting including initial cold contacting
- recombinant nucleic acid vectors which in illustrative embodiments are retroviral particles, in suspension for a specified time period without removing recombinant nucleic acid vectors (e.g. retroviral particles) that remain free in solution and not associated with cells.
- This incubating is sometimes referred to herein as an optional incubation.
- the contacting can be performed (or can occur) for between 15 minutes and 12 hours, between 15 minutes and 10 hours, or between 15 minutes and 8 hours, or any of the times included in the Exemplary Embodiments section.
- a secondary incubation is performed by suspending cells after an optional wash step such that recombinant nucleic acid vectors, and in illustrive embodiments retroviral particles, that are not associated with a cell are washed away.
- the secondary incubation is performed at temperatures between 32 °C and 42 °C, such as at 37 °C.
- the optional secondary incubation can be performed for any length of time discussed herein. In illustrative embodiments, the optional secondary incubation is performed for 6 hours or less.
- the contacting can be performed (or can occur) (where as indicated in general herein the low end of a selected range is less than the high end of the selected range) for between 30 seconds or 1, 2, 5, 10, 15, 30, or 45 minutes, or 1, 2, 3, 4, 5, 6, 7, or 8 hours on the low end of the range, and between 10 minutes, 15 minutes, 30 minutes, or 1,
- the reaction mixture can be incubated for between 5 minutes on the low end of the range and 10, 15, or 30 minutes or 1, 2, 3, 4, 5, 6, 8, 10 or 12 hours on the high end of the range.
- the reaction mixture can be incubated for between 15 minutes and 12 hours, 15 minutes and 10 hours, 15 minutes and 8 hours, 15 minutes and 6 hours, 15 minutes and 4 hours, 15 minutes and 2 hours, 15 minutes and 1 hour, 15 minutes and 45 minutes, or 15 minutes and 30 minutes.
- the reaction mixture can be incubated for between 30 minutes and 12 hours, 30 minutes and 10 hours, 30 minutes and 8 hours, 30 minutes and 6 hours, 30 minutes and 4 hours, 30 minutes and 2 hours, 30 minutes and 1 hour, or 30 minutes and 45 minutes. In other embodiments, the reaction mixture can be incubated for between 1 hour and 12 hours, 1 hour and 8 hours, 1 hour and 4 hours, or lhour and 2 hours. In another illustrative embodiment, the contacting is performed for between an initial contacting step only (without any further incubating in the reaction mixture including the retroviral particles free in suspension and cells in suspension) without any further incubation in the reaction mixture, or a 5 minute, 10 minute, 15 minute, 30 minute, or 1 hour incubation in the reaction mixture.
- blood cells or a T cell and/or NK cell-containing fraction thereof in the reaction mixture are separated from retroviral particles that are not associated with such cells.
- a PBMC enrichment procedure e.g. a Ficoll gradient in a Sepax unit
- this can be performed using a PBMC enrichment procedure (e.g. a Ficoll gradient in a Sepax unit), or in certain illustrative embodiments provided herein, by filtering the reaction mixture over a leukocyte depletion filter set assembly, and then collecting the leukocytes, which include T cells and NK cells.
- this can be performed by centrifugation of the reaction mixture at a relative centrifugal force less than 500 g, for example 400g, or between 300 and 490 g, or 350 and 450 g.
- centrifugation to separate retroviral particles from cells can be performed for example, for between 5 minutes and 15 minutes, or between 5 minutes and 10 minutes.
- g force is typically lower than the g forces used successfully in spinoculation procedures.
- a method provided herein in any aspect does not involve performing a spinoculation.
- the cell or cells are not subjected to a spinoculation of at least 400g, 500g, 600g, 700g, or 800g for at least 15 minutes.
- the cell or cells are not subjected to a spinoculation of at least 800g for at least 10, 15, 20, 25, 30, 35, 40, or 45 minutes.
- spinoculation is included as part of a contacting step.
- the spinoculation can be performed for example, for 30 minutes to 120 minutes, typically for at least 60 minutes, for example for 60 minutes to 180 minutes, or 60 minutes to 90 minutes.
- the spinoculation is typically performed in a centrifuge with a relative centrifugal force of at least 800g, and more typically at least 1200g, for example between 800g and 2400g, 800g and 1800g, 1200g and 2400g, or 1200g and 1800g.
- a relative centrifugal force typically at least 800g, and more typically at least 1200g, for example between 800g and 2400g, 800g and 1800g, 1200g and 2400g, or 1200g and 1800g.
- such methods typically involve an additional step of resuspending the pelleted cells and retroviral particles, and then removing retroviral particles that are not associated with cells according to steps discussed above when spinoculation is not performed.
- the contacting step including the optional incubation therein, and the spinoculation, in embodiments that include spinoculation, can be performed at between 4 °C and 42 °C or 20 °C and 37 °C. In certain illustrative embodiments, spinoculation is not performed and the contacting and associated optional incubation are carried out at 20-25 °C for 4 hours or less, 2 hours or less, 1 hour or less, 30 minutes or less, 15 minutes or less, or 15 minutes to 2 hours, 15 minutes to 1 hour, or 15 minutes to 30 minutes.
- Methods of genetically modifying lymphocytes typically include insertion into the cell of a polynucleotide comprising one or more transcriptional units encoding any transgene, for example a CAR or a lymphoproliferative element, or in illustrative embodiments encoding both a CAR and a lymphoproliferative element according to any of the CAR and lymphoproliferative element embodiments provided herein.
- a polynucleotide comprising one or more transcriptional units encoding any transgene, for example a CAR or a lymphoproliferative element, or in illustrative embodiments encoding both a CAR and a lymphoproliferative element according to any of the CAR and lymphoproliferative element embodiments provided herein.
- Such CAR and lymphoproliferative elements can be provided to support the shorter and more simplified methods provided herein, which can support expansion of modified, genetically modified, and/or transduced T cells and/or NK cells after
- lymphoproliferative elements can be delivered from the genome of the retroviral particles inside genetically modified, and/or transduced T cells and/or NK cells, such that those cells have the characteristics of increased proliferation and/or survival disclosed in the Lymphoproliferative Elements section herein.
- the genetically modified T cell or NK cell is capable of engraftment in vivo in mice and/orenrichment in vivo in mice for at least 7, 14, or 28 days.
- mice may be treated or otherwise genetically modified so that any immunological differences between the genetically modified T cell and/or NK cell do not result in an immune response being elicited in the mice against any component of the lymphocyte transduced by the replication incompetent recombinant retroviral particle.
- Media that can be included in a contacting step for example when the cells and retroviral particles are initially brought into contact, or in any aspects provided herein, during optional incubation periods with the reaction mixture thereafter that include retroviral particles and cells in suspension in the media, or media that can be used during cell culturing and/or during various wash steps in any aspects provided herein, can include base media such as commercially available media for ex vivo T cell and/or NK cell culture.
- Non-limiting examples of such media include, X-VIVOTM 15 Chemically Defined, Serum-free Hematopoietic Cell Medium (Lonza) (2018 catalog numbers BE02-060F, BE02-00Q, BE-02- 061Q, 04-744Q, or 04-418Q), ImmunoCulfTM-XF T Cell Expansion Medium (STEMCELL Technologies) (2018 catalog number 10981), PRIME-XV ® T Cell Expansion XSFM (Irvine Scientific) (2018 catalog number 91141), AIM V ® Medium CTSTM (Therapeutic Grade) (Thermo Fisher Scientific (Referred to herein as “Thermo Fisher”), or CTSTM OptimizerTM media (Thermo Fisher) (2018 catalog numbers A10221-01 (basal media (bottle)), and A10484-02 (supplement), A10221-03 (basal media (bag)), A1048501 (basal media and supplement kit (bottle)) and, A1048503 (basal media
- Such media can be a chemically defined, serum-free formulation manufactured in compliance with cGMP, as discussed herein for kit components.
- the media can be xeno-free and complete.
- the base media has been cleared by regulatory agencies for use in ex vivo cell processing, such as an FDA 510(k) cleared device.
- the media is the basal media with or without the supplied T cell expansion supplement of 2018 catalog number A1048501 (CTSTM OpTmizerTM T Cell Expansion SFM, bottle format) or A1048503 (CTSTM OpTmizerTM T Cell Expansion SFM, bag format) both available from Thermo Fisher (Waltham, MA).
- Additives such as human serum albumin, human AB+ serum, and/or serum derived from the subject can be added to the transduction reaction mixture.
- Supportive cytokines can be added to the transduction reaction mixture, such as IL2, IL7, or IL 15, or those found in human sera.
- dGTP can be added to the transduction reaction in certain embodiments.
- the cells can be contacted with a retroviral particle without prior activation.
- the T cells and/or NK cells have not been incubated on a substrate that adheres to monocytes for more than 4 hours in one embodiment, or for more than 6, hours in another embodiment, or for more than 8 hours in another embodiment before the transduction.
- the T cells and/or NK cells have been incubated overnight on an adherent substrate to remove monocytes before the transduction.
- the method can include incubating the T cells and/or NK cells on an adherent substrate that binds monocytes for no more than 30 minutes, 1 hour, or 2 hours before the transduction.
- the T cells and/or NK cells are exposed to no step of removing monocytes by an incubation on an adherent substrate before said transduction step.
- the T cells and/or NK cells are not incubated with or exposed to a bovine serum, such as a cell culturing bovine serum, for example fetal bovine serum before or during a contacting step and/or a modifying and/or a genetically modifying and/or transduction step.
- a closed system is a cell processing system that is generally closed or fully closed to an environment, such as an environment within a room or even the environment within a hood, outside of the conduits such as tubes, and chambers, of the system in which cells are processed and/or transported.
- An environment such as an environment within a room or even the environment within a hood, outside of the conduits such as tubes, and chambers, of the system in which cells are processed and/or transported.
- One of the greatest risks to safety and regulatory control in the cell processing procedure is the risk of contamination through frequent exposure to the environment as is found in traditional open cell culture systems.
- the methods are performed on T cells, for example to provide modified and in illustrative embodiments genetically modified T cells.
- Such closed system methods can be performed with commercially available devices. Different closed system devices can be used at different steps within a method and the cells can be transferred between these devices using tubing and connections such as welded, luer, spike, or clave ports to prevent exposure of the cells or media to the environment.
- blood can be collected into an IV bag or syringe, optionally including an anticoagulant, and in some aspects, transferred to a Sepax 2 device (Biosafe) for PBMC enrichment and isolation.
- whole blood can be filtered to collect leukocytes using a leukoreduction filter assembly.
- the isolated PBMCs or isolated leukocytes can be transferred to a chamber of a G-Rex device for an optional activation, a transduction and optional expansion.
- collected blood can be transduced in a blood bag, for example, the bag in which it was collected.
- the cells can be harvested and collected into another bag using a Sepax 2 device.
- the methods can be carried out in any device or combination of devices adapted for closed system T cell and/or NK cell production.
- Non-limiting examples of such devices include G-Rex devices (Wilson Wolf), GatheRex (Wilson Wolf), Sepax 2 (Biosafe), WAVE Bioreactors (General Electric), a CuItiLife Cell Culture bag (Takara), a PermaLife bag (OriGen), CliniMACS Prodigy (Miltenyi Biotec), and VueLife bags (Saint-Gobain).
- the optional activating, the transducing and optional expanding can be performed in the same chamber or vessel in the closed system.
- the chamber can be a chamber of a G-Rex device and PBMCs or leukocytes can be transferred to the chamber of the G-Rex device after they are enriched and isolated, and can remain in the same chamber of the G-Rex device until harvesting.
- Methods provided herein can include transferring blood and cells therein and/or fractions thereof, as well as lymphocytes before or after they are contacted with retroviral particles, between vessels within a closed system, which thus is without environmental exposure.
- Vessels used in the closed system can be a tube, bag, syringe, or other container.
- the vessel is a vessel that is used in a research facility.
- the vessel is a vessel used in commercial production.
- the vessel can be a collection vessel used in a blood collection process.
- Methods for modifying herein typically involve a contacting step wherein lymphocytes are contacted with a replication incompetent recombinant retroviral particle.
- the contacting in some embodiments, can be performed in the vessel, for example, within a blood bag. Blood and various lymphocyte-containing fractions thereof, can be transferred from the vessel to another vessel (for example from a first vessel to a second vessel) within the closed system for the contacting.
- the second vessel can be a cell processing compartment of a closed device, such as a G-Rex device.
- genetically modified (e.g. transduced) cells can be transferred to a different vessel within the closed system (i.e. without exposure to the environment). Either before or after this transfer the cells are typically washed within the closed system to remove substantially all or all of the retroviral particles.
- a process disclosed herein, from collection of blood, to contacting (e.g. transduction), optional incubating, and post-incubation isolation and optional washing, is performed for between 15 minutes, 30 minutes, or 1, 2, 3, or 4 hours on the low end of the range, and 4, 8, 10, or 12 hours on the high end of the range.
- a T cell can include any of the embodiments of replication incompetent recombinant retroviral particles provided herein, including those that include one or more lymphoproliferative element, CAR, pseudotyping element, control element, activation element, membrane
- the retroviral particle is a lentiviral particle.
- a method for modifying, genetically modifying, and/or transducing a PBMC or a lymphocyte, such as a T cell and/or NK cell can be performed in vitro or ex vivo.
- a skilled artisan will recognize that details provided herein for transducing, genetically modifying, and/or modifying PBMCs or lymphocytes, such as T cell(s) and/or NK cell(s) can apply to any aspect that includes such step(s).
- Introduction or reintroduction also referred to herein as administration and readministration, of modified and in illustrative embodiments genetically modified lymphocytes into a subject in methods provided herein can be via any route known in the art.
- introduction or reintroduction typically involves suspending i) modified and/or ii) genetically modified and/or iiia) transduced or iiib) transfected cells, in a delivery solution to form a cell formulation that can be introduced or reintroduced into a subject as discussed in further detail herein.
- introduction or reintroduction can be delivery via infusion into a blood vessel of the subject.
- modified lymphocytes e.g. T cells and/or NK cells
- Some administered cells are modified with a nucleic acid encoding a lymphoproliferative element.
- a nucleic acid encoding a lymphoproliferative element is not limited by theory, in non-limiting illustrative methods, the delivery of a polynucleotide encoding a lymphoproliferative element, to a resting T cell and/or NK cell ex vivo, which can integrate into the genome of the T cell or NK cell, provides that cell with a driver for in vivo expansion without the need for lymphodepleting the host.
- the subject is not exposed to a lymphodepleting agent within 1, 2, 3, 4, 5, 6, 7, 10, 14, 21, or 28 days, or within 1 month, 2 months, 3 months or 6 months of performing the contacting, during the contacting, and/or within 1, 2, 3, 4, 5, 6, 7, 10, 14, 21, or 28 days, or within 1 month, 2 months, 3 months or 6 months after the modified T cells and/or NK cells are reintroduced back into the subject.
- methods provided herein can be performed without exposing the subject to a lymphodepleting agent during a step wherein a replication incompetent recombinant retroviral particle is in contact with resting T cells and/or resting NK cells of the subject and/or during the entire ex vivo method.
- methods of expanding modified and in illustrative embodiments genetically modified T cells and/or NK cells in a subject in vivo is a feature of some embodiments of the present disclosure. In illustrative embodiments, such methods are ex vivo propagation-free or substantially propagation-free.
- This entire method/process from blood draw from a subject to reintroduction of modified and in illustrative embodiments genetically modified lymphocytes into the subject after ex vivo transduction of T cells and/or NK cells can occur over a time period less than 48 hours, less than 36 hours, less than 24 hours, less than 12 hours, less than
- introduction or reintroduction of the modified lymphocytes can be performed by intravenous injection, subcutaneous administration, or intramuscular administration.
- the entire method/process from blood draw/collection from a subject to reintroduction of modified lymphocytes into the subject after ex vivo transduction of T cells and/or NK cells occurs over a time period between 1 hour and 12 hours, 2 hours and 8 hours, 1 hour and 3 hours, 2 hours and 4 hours, 2 hours and 6 hours, 4 hours and 12 hours, 4 hours and 24 hours, 8 hours and 24 hours, 8 hours and 36 hours, 8 hours and 48 hours, 12 hours and 24 hours,
- the entire method/process from blood draw/collection from a subject to reintroduction of modified and in illustrative embodiments genetically modified lymphocytes into the subject after ex vivo transduction of T cells and/or NK cells occurs over a time period between 1, 2, 3, 4, 6, 8, 10, and 12 hours on the low end of the range, and 8, 9, 10, 11, 12, 14, 18, 24, 36, or 48 hours on the high end of the range.
- the modified and genetically modified T cells and/or NK cells are separated from the non-associated replication incompetent recombinant retroviral particles after the time period in which contact occurs.
- methods provided herein for modifying lymphocytes, and associated methods for performing adoptive cell therapy can be performed in significantly less time than prior methods, fundamental improvements in patient care and safety as well as product manufacturability are made possible. Therefore, such processes are expected to be favorable in the view of regulatory agencies responsible for approving such processes when carried out in vivo for therapeutic purposes.
- the subject in non-limiting examples of any aspects provided herein that include a subject can remain in the same building (e.g. infusion clinic) or room as the instrument processing their blood or sample for the entire time that the sample is being processed before modified T cells and/or NK cells are reintroduced into the patient.
- a subject remains within line of site and/or within 100, 50, 25, or 12 feet or arm’s distance of their blood or cells that are being processed, for the entire method/process from blood draw/collection from the subject to reintroduction of blood to the subject after ex vivo transduction of T cells and/or NK cells.
- a subject remains awake and/or at least one person can continue to monitor the blood or cells of the subject that are being processed, throughout and/or continuously for the entire method/process from blood draw/collection from the subject to reintroduction of blood to the subject after ex vivo transduction of T cells and/or NK cells.
- the entire method/process for adoptive cell therapy and/or for transducing resting T cells and/or NK cells from blood draw/collection from the subject to reintroduction of blood to the subject after ex vivo transduction of T cells and/or NK cells can be performed with continuous monitoring by a human.
- the entire method/process from blood draw/collection from the subject to reintroduction of blood to the subject after ex vivo transduction of T cells and/or NK cells are blood cells incubated in a room that does not have a person present.
- the entire method/process from blood draw/collection from the subject to reintroduction of blood to the subject after ex vivo transduction of T cells and/or NK cells is performed next to the subject and/or in the same room as the subject and/or next to the bed or chair of the subject.
- sample identity mix-ups can be avoided, as well as long and expensive incubations over periods of days or weeks.
- methods provided herein are readily adaptable to closed and automated blood processing systems, where a blood sample and its components that will be reintroduced into the subject, only make contact with disposable, single-use components.
- Methods for modifying, genetically modifying, and/or transducing lymphocytes such as T cells and/or NK cells can be part of a method for performing adoptive cell therapy.
- methods for performing adoptive cell therapy include steps of collecting blood from a subject, and returning modified, genetically modified, and/or transduced lymphocytes (e.g T cells and/or NK cells) to the subject.
- the present disclosure provides various treatment methods using a CAR.
- a CAR of the present disclosure when present in a T lymphocyte or an NK cell, can mediate cytotoxicity toward a target cell.
- a CAR of the present disclosure binds to an antigen present on a target cell, thereby mediating killing of a target cell by a T lymphocyte or an NK cell genetically modified to produce the CAR.
- the ASTR of the CAR binds to an antigen present on the surface of a target cell.
- the present disclosure provides methods of killing, or inhibiting the growth of, a target cell, the method involving contacting a cytotoxic immune effector cell (e.g., a cytotoxic T cell, or an NK cell) that is genetically modified to produce a subject CAR, such that the T lymphocyte or NK cell recognizes an antigen present on the surface of a target cell, and mediates killing of the target cell.
- a cytotoxic immune effector cell e.g., a cytotoxic T cell, or an NK cell
- the target cell can be a cancer cell, for example, and autologous cell therapy methods herein, can be methods for treating cancer, in some illustrative embodiments.
- the subject can be a an animal or human suspected of having cancer, or more typically, a subject that is known to have cancer.
- cells are introduced or reintroduced into the subject by infusion into a vein or artery, especially when neutrophils are not present in a preparation of lymphocytes that have been contacted with retroviral particles and are ready to be reintroduced, or by subcutaneous or intramuscular administration, for embodiments where at least 1%, 2%, 3%, 4%, 5%, 7.5%, 10%, 15%, 20% or 25% of the cells, or between 1% and 90%, 1% and 75%, 1% and 50%, 1% and 25%, 1% and 20%, 1% and 10%, 5% and 90%, 5% and 75%, 5% and 50%, 5% and 25%, 5% and 20%, 5% and 10%, 10% and 90%, 10% and 75%, 10% and 50%, 10% and 25%, or 10% and 20%, of the cells in a cell formulation to be administered are neutrophils.
- the number of lymphocytes, and in illustrative embodiments T cells and/or NK cells, present in cell formulations provided herein and optionally reinfused or subcutaneously delivered into a subject can be between 1 x 10 3 , 2.5 x 10 3 , 5 x 10 3 , 1 x 10 4 , 2.5 x 10 4 , 5 x 10 4 , 1 x 10 s , 2.5 x 10 s , 5 x 10 s , 1 x 10 6 , 2.5 x 10 6 , 5 x 10 6 , and 1 x 10 7 cells/kg on the low end of the range and 5 x 10 4 , 1 x 10 s , 2.5 x 10 s , 5 x 10 s , 1 x 10 6 , 2.5 x 10 6 , 5 x 10 6 , 1 x 10 7 , 2.5
- the number of lymphocytes, and in illustrative embodiments T cells and/or NK cells, present in cell formulations herein and optionally reinfused or otherwise delivered into a subject can be between 1 x 10 4 , 2.5 x 10 4 , 5 x 10 4 , and 1 x 10 s cells/kg on the low end of the range and 2.5 x 10 4 , 5 x 10 4 , 1 x 10 s , 2.5 x 10 s , 5 x 10 s , and 1 x 10 6 cells/kg on the high end of the range.
- the number of lymphocytes, and in illustrative embodiments T cells and/or NK cells present in cell formulations herein and optionally reinfused or otherwise delivered into a subject can be between 5 x 10 s , 1 x 10 6 , 2.5 x 10 6 , 5 x 10 6 , 1 x 10 7 , 2.5 x 10 7 , 5 x 10 7 , and 1 x 10 s cells on the low end of the range and 2.5 x 10 6 , 5 x 10 6 , 1 x 10 7 , 2.5 x 10 7 , 5 x 10 7 , 1 x 10 s , 2.5 x 10 s , 5 x 10 s , and 1 x 10 9 cells on the high end of the range.
- the number of lymphocytes, and in illustrative embodiments T cells and/or NK cells, present in cell formulations herein and available for infusion, reinfusion, or other delivery means (e.g. subcutaneous delivery) into a 70 kg subject or patient is between 7 x 10 s and 2.5 x 10 s cells.
- the number of lymphocytes, and in illustrative embodiments T cells and/or NK cells present in cell formulations herein and available for transduction is approximately 7 x 10 6 plus or minus 10%.
- the cell can be an autologous cell or an allogeneic cell.
- the allogeneic cell can be a genetically engineered allogeneic cell. Allogeneic cells, such as allogeneic T cells, and methods for genetically engineering allogeneic cells, are known in the art.
- the allogeneic cell is a T cell
- the T cell has been genetically engineered such that at least one component of the TCR complex is functionally impaired and/or is at least partially deleted.
- the T cell has been genetically engineered such that the expression of at least one component of the TCR complex has been reduced or eliminated.
- the allogeneic cell can be modified such that it is missing all or part of the B2 microglobulin gene.
- allogeneic cells can include any of the lymphoproliferative elements and/or CLEs disclosed herein. The use of lymphoproliferative elements and CLEs can reduce the required number of cells and can facilitate cell manufacturing of T cells, NK cells, B cells, or stem cells.
- the allogeneic cell can be an immortalized cell. In any of the aspects or embodiments herein that include an allogeneic cell, steps that include collecting blood or contacting a cell with a replication incompetent recombinant retroviral particle can be eliminated.
- a T cell may have been previously genetically modified, and the genetically modified allogeneic CAR-T cell is administered to the subject without collecting blood from the subject.
- the allogeneic cell is administered subcutaneously.
- the allogeneic cell is administered intravenously.
- the modified, genetically modified, and/or transduced lymphocyte e.g. T cell and/or NK cell
- introduction or reintroduction of the modified and in illustrative embodiments genetically modified lymphocytes into a subject can be via any route known in the art.
- introduction or reintroduction can be delivery via infusion into a blood vessel of the subject.
- the modified, genetically modified, and/or transduced lymphocyte e.g. T cell and/or NK cell
- the lymphocyte(s) used in such a method are resting T cells and/or resting NK cells that are in contact with the replication incompetent recombinant retroviral particles for between 1 hour and 12 hours.
- all steps after the blood is collected and before the blood is reintroduced, are performed in a closed system in which a person monitors the closed system throughout the processing.
- the modified and in illustrative embodiments genetically modified T cells and/or NK cells are introduced back, reintroduced, reinfused or otherwise delivered into the subject without additional ex vivo manipulation, such as stimulation and/or activation of T cells and/or NKs.
- ex vivo manipulation is used for stimulation/activation of T cells and/or NK cells and for expansion of genetically modified T cells and/or NK cells prior to introducing the genetically modified T cells and/or NK cells into the subject.
- this generally takes days or weeks and requires a subject to return to a clinic for a blood infusion days or weeks after an initial blood draw.
- T cells and/or NK cells are not stimulated ex vivo by exposure to anti-CD3 alone or anti-CD3 in combination with co-stimulation by, for example, anti-CD28, either in solution or attached to a solid support such as, for example, beads coated with anti-CD3/anti-CD28, prior to contacting the T cells and/or NK cells with the replication incompetent recombinant retroviral particles.
- modified and in illustrative embodiments genetically modified T cells and/or NK cells are not expanded ex vivo, or only expanded for a small number of cell divisions (e.g. 1, 2, 3, 4, or 5 rounds of cell division), but are rather expanded, or predominantly expanded, in vivo, i.e. within the subject.
- no additional media is added to allow for further expansion of the cells.
- no cell manufacturing of the primary blood lymphocytes (PBLs) occurs while the PBLs are contacted with the replication incompetent recombinant retroviral particles.
- no cell manufacturing of the PBLs occurs while the PBLs are ex vivo.
- subjects are lymphodepleted prior to reinfusion with genetically modified T cells and or NK cells.
- patients or subjects are not lymphodepleted prior to infusion or reinfusion with modified and/or genetically modified T cells and or NK cells.
- embodiments of the methods and compositions disclosed herein can be used on pre-activated or pre-stimulated T cells and/or NK cells as well.
- T cells and/or NK cells can be stimulated ex vivo by exposure to anti-CD3 with or without anti-CD28 solid supports prior to contacting the T cells and/or NK cells with the replication incompetent recombinant retroviral particles.
- the T cells and/or NK cells can be exposed to anti-CD3/anti-CD28 solid supports for less than 1, 2, 3, 4, 6, 8, 10, 12, 14, 16, 18, or 24 hours, including no exposure, before the T cells and/or NK cells are contacted the replication incompetent recombinant retroviral particles.
- the T cells and/or NK cells can be exposed to anti-CD3/anti-CD28 solid supports for less than 1, 2, 3, 4, 6, or 8 hours before the T cells and/or NK cells are contacted the replication incompetent recombinant retroviral particles.
- any cell in a cell mixture that is useful in adoptive cell therapy can be enriched prior to formulation for delivery.
- the one or more cell populations can be enriched by positive selection prior to being contacted with a recombinant nucleic acid vector, such as a replication incompetent retroviral particle.
- the one or more cell populations can be enriched by positive selection after the cell mixture is contacted with a recombinant nucleic acid vector, such as a replication incompetent retroviral particle.
- enriching the one or more cell populations can be performed at the same time as any of the methods of genetic modification disclosed herein, and in illustrative embodiments genetic modification with a replication incompetent retroviral particle.
- Mononuclear cells such as PBMCs
- TNCs can be isolated from a more complex cell mixture such as whole blood by density-gradient centrifugation or reverse perfusion of a leukoreduction filter assembly, respectively, as described in more detail herein.
- specific cell lineages such as NK cells, T cells, and/or T cell subsets including naive, effector, memory, suppressor T-cells, and/or regulatory T cells can be enriched through the selection of cells expressing one or more surface molecules.
- the one or more surface molecules can include CD4, CD8, CD16, CD25, CD27, CD28, CD44, CD45RA, CD45RO, CD56, CD62L, CCR7, KIRs, FoxP3, and/or TCR components such as CD3.
- Methods using beads conjugated to antibodies directed to one or more surface molecules can be used to enrich for the desired cells using magnetic, density, and size-based separation.
- binding of the one or more cell surface molecules can lead to signal transduction and alteration of the biology of the bound cell. For example, selection of T cells using beads with attached antibodies to CD3 may lead to CD3 signal transduction and T cell activation.
- binding and signal transduction may lead to further cell differentiation of cells such as naive or memory T cells.
- positive selection is not used to enrich for desired cells such as when it is preferred that the desired cells are not contacted but rather are left untouched. Enrichment of desired cells by depletion of unwanted cells
- the cell mixture from whole blood, isolated TNCs, or isolated PBMCs can contain one or more unwanted cell populations that are depleted, such that the desired cells in the cell mixture are enriched.
- the one or more cell populations can be depleted by negative selection prior to being contacted with a recombinant nucleic acid vector, such as a replication incompetent retroviral particle, for example as provided in methods for genetically modifying a T cell or NK cell provided herein.
- the one or more cell populations can be depleted by negative selection after the cell mixture is contacted with a recombinant nucleic acid vector, such as a replication incompetent retroviral particle, for example as provided in methods for genetically modifying a T cell or NK cell provided herein.
- depleting the one or more cell populations can be performed at the same time as any of the methods of genetic modification disclosed herein, and in illustrative embodiments genetic modification with a replication incompetent retroviral particle.
- the unwanted cells can include any non-T or non-NK cell.
- the unwanted cells can include T or NK cell subsets, such as regulatory T cells or suppressor T cells.
- the unwanted cells include monocytes.
- the unwanted cells include granulocytes.
- the unwanted cells include cells that express the cognate antigen to a CAR that is or will be expressed on a population of the cells that will be formulated for delivery.
- the unwanted cells include cancer cells. Cancer cells from many types of cancer can enter the blood and could be unintentionally genetically modified at a low frequency along with the lymphocytes using the methods provided herein.
- the cancer cell can be derived from any cancer, including, but not limited to: renal cell carcinoma, gastric cancer, sarcoma, breast cancer, B cell lymphoma, Hodgkin’s lymphoma, non-Hodgkin’s B-cell lymphoma (B-NHL), neuroblastoma, glioma, glioblastoma, medulloblastoma, colorectal cancer, ovarian cancer, prostate cancer, mesothelioma, lung cancer (e.g., small cell lung cancer), melanoma, leukemia, chronic lymphocytic leukemia, acute lymphocytic leukemia, or chronic myelogenous leukemia.
- lung cancer e.g., small cell lung cancer
- melanoma leukemia, chronic
- the CAR-cancer cell can be derived from a B-cell lymphoma.
- a cancer cell that expresses a CAR with an ASTR that binds to an antigen expressed on its own cell surface i.e., the CAR-expressing cancer cell is itself a target cell (CAR-cancer cell)
- CAR-cancer cell can block CAR- T cells from binding to the antigen, also known as epitope masking, and thereby prevent the killing of the CAR-cancer cell.
- the CAR-cancer cell can result in recurrence of the cancer, with immunity to CAR-T, even after initial successful treatment with CAR-T (see, e.g., Ruella et al. Nat Med. 2018 Oct;24(10): 1499-1503).
- Methods and compositions provided herein for depleting unwanted cancer cells overcome this risk posed by genetically modifying cells, such as blood cells or PBMCs, isolated from a cancer patient.
- Monocytes can be depleted by incubation of the cell mixture with an immobilized monocyte binding substrate such as a standard plastic tissue culture plate, nylon or glass wool, or sephadex resin. Not to be limited by theory, monocytes adhere preferentially to the immobilized monocyte-binding substrate versus other cells in the cell mixture, which adhere at a lower frequency or strength or do not adhere at all.
- the incubations can performed at 37 °C for at least 1 hour or by passing the cell mixture through a resin After the incubation, the desired non-adherent cells in suspension are collected for further processing.
- the whole blood, TNCs, or PBMCs are not incubated for at least 8, 7, 6, 5, 4, 3, 2, or 1 hours with an immobilized monocyte-binding substrate and the monocytes are not depleted by such an incubation.
- methods herein include depleting unwanted cells by negative selection of cells expressing one or more surface molecules using methods known in the art for removing such cells.
- the surface molecule is a tumor-associated antigen, a tumor-specific antigen, or is otherwise expressed on cancer cells.
- Such surface molecules include Axl, ROR1, ROR2, Her2, prostate stem cell antigen (PSCA), PSMA (prostate-specific membrane antigen), B cell maturation antigen (BCMA), alpha-fetoprotein (AFP), carcinoembryonic antigen (CEA), cancer antigen- 125 (CA-125), CA19-9, MUC-1, epithelial membrane protein (EMA), epithelial tumor antigen (ETA), melanoma-associated antigen (MAGE), CD34, CD45, CD99, CD117, placental alkaline phosphatase, thyroglobulin, CD19, CD22, CD27, CD30, CD70, GD2 (ganglioside G2), EphA2, CSPG4, CD138, FAP (Fibroblast Activation Protein), CD171, kappa, lambda, 5T4, anb6 integrin, integrin anb3 (CD61), galactin, B7-H3, B7-H6, CAIX, CD20, CD33
- unwanted cells can be depleted from a cell mixture such as whole blood, PBMCs, or TNCs, by bead or column-based separation.
- ligand or antibody to a cell surface molecule is attached to the beads or column.
- the antibodies attached to the beads can bind the same antigen as a CAR that is used, for example expressed by T cells and/or NK cells, in a method in which the unwanted cells are removed.
- the antibodies attached to the beads can bind a different epitope of the same antigen as the CAR that will be expressed later in the patient.
- the antibodies attached to the beads can bind the same epitope of the same antigen as the CAR.
- the beads can have more than one attached antibody that binds to antigens on the surface of the unwanted cells.
- beads with different antibodies attached to them can be used in combination.
- the beads can be magnetic beads.
- the unwanted cells can be depleted by magnetic separation after incubation of the cell mixture with the magnetic beads with attached antibodies.
- the beads are not magnetic.
- unwanted cells expressing one or more surface molecules are depleted from a cell mixture such as whole blood, PBMCs, or TNCs, by antibody coated beads and separated by size.
- the beads are polystyrene.
- the beads are at least about 30 pm, about 35 pm, about 40 pm, about 50 pm, about 60 pm, about 70 pm, or about 80 pm in diameter.
- the antibody coated beads are added to the cell mixture during the time that the recombinant nucleic acid vectors, which in illustrative embodiments are replication incompetent recombinant retroviral particles, are incubated with the cell mixture.
- a reaction mixture is formed that includes: (A) a cell mixture, such as from whole blood, enriched TNCs, or enriched PBMCs; (B) recombinant nucleic acid vectors, such as replication incompetent recombinant retroviral particles, encoding a transgene of interest, such as a CAR; and (C) antibody coated beads that bind to one or more surface molecules, or antigens, expressed on the surfaces of the unwanted cells.
- the reaction mixture can be incubated for less than 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, or 45 minutes or less than 1, 2, 3, 4, 5, 6, 7, or 8 hours.
- a density-gradient centrifugation-based cell enrichment procedure can be performed to enrich total mononuclear cells depleted of the unwanted cells complexed to the antibody coated beads which will pellet.
- the reaction mixture can be passed through a pre-filter of larger diameter mesh to deplete the unwanted cells complexed to the antibody coated beads.
- the filter can have a pore diameter that is or is about 5 pm, 10 pm, or 15 pm smaller than the diameter of the beads.
- the beads may be magnetic beads and the pre-filter can be a magnet. Such filters can capture the unwanted cells bound to the beads and allow the desired cells to flow through downstream to the leukoreduction filter assembly which has a smaller pore diameter.
- unwanted cells are depleted or removed from a cell mixture that contains lymphocytes and erythrocytes, such as whole blood, by erythrocyte antibody rosetting (EA-rosetting).
- EA-rosetting antibodies that bind to antigens on the cell surfaces of unwanted cells are incubated with the cell mixture to crosslink the unwanted cells to red blood cells, which are then separated from the desired cells by density gradient centrifugation, such as provided for in RosetteSepTM kits (Stemcell Technologies).
- the antibodies that mediate EA-rosetting are added to the cell mixture during the time that the recombinant nucleic acid vectors, which in illustrative embodiments are replication incompetent recombinant retroviral particles, are incubated with the cell mixture.
- a reaction mixture is formed that includes: (A) a cell mixture of lymphocytes and erythrocytes, such as from whole blood; (B) replication incompetent recombinant retroviral particles encoding a transgene of interest, and in further illustrative embodiments a CAR; (C) a first antibody to an antigen on the surface of the unwanted cells, for example a tumor antigen such as the blood cancer antigens CD19, CD20, CD22, CD25, CD32, CD34, CD38, CD123, BCMA, or TIM3; (D) a second antibody to an antigen on the surface of an erythrocyte, such as glycophorin A; and (E) a third antibody that cross links the first and second antibodies.
- A a cell mixture of lymphocytes and erythrocytes, such as from whole blood
- B replication incompetent recombinant retroviral particles encoding a transgene of interest
- CAR CAR
- C a first antibody to
- the reaction mixture can include antibodies to more than one antigen on the surface of unwanted cells.
- the antibodies can bind to the same antigen as does the CAR.
- this reaction mixture is incubated for less than 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, or 45 minutes or less than 1, 2, 3, 4, 5, 6, 7, or 8 hours.
- a density-gradient centrifugation-based PBMC enrichment procedure is performed to isolate total PBMCs minus the population depleted or removed by EA-rosetting which will pellet with the erythrocytes.
- T cell-specific promoters can be used to express the CAR and can help prevent non-T cells that contain an exogenous nucleic acid(s) encoding a CAR from actually expressing the CAR.
- the antigen will not be masked by a CAR expressed in cis, and CAR-T cells can bind to and kill the target cell containing an exogenous nucleic acid(s) encoding the CAR.
- Another method to reduce the potential effects of CAR-cancer cells is to use two or more separate CARs, and in illustrative embodiments, two CARs expressed in two populations of cells, to kill target cells that could mask one of the epitopes.
- a populations of cells such as blood cells or PBMCs, are genetically modified separately so each population expresses either a first CAR or a second CAR.
- a target cell expressing the first or second CAR does not mask the epitope that the second and first CAR, respectively, bind to. Therefore, a target cell expressing the first or second CAR can be killed by an effector T or NK cell expressing the second or first CAR, respectively.
- the first and second CARs can bind to different epitopes of the same antigen expressed on a target cell. In other embodiments, the first and second CARs can bind to different antigens expressed on the same target cell, including any of the antigens disclosed elsewhere herein. In some embodiments, the first and second CARs can bind to different epitopes of, or different antigens selected from CD19, CD20, CD22, CD25, CD32, CD34, CD38, CD123, BCMA, TACI or TIM3. In further illustrative embodiments, the first CAR can bind to CD 19 and the second CAR can bind to CD22, both of which are expressed on B cells.
- the CAR can be an extracellular ligand of a cancer antigen.
- the modified cell populations are formulated separately.
- the separate cell formulations are introduced or reintroduced back into the subject at different sites in the body.
- separate cell formulations are separately introduced or reintroduced back into the subject at the same site.
- the modified cell populations are combined into one formulation that is optionally introduced or reintroduced back into the subject together at the same site.
- the cell populations are not combined until after a washing step in which the cells are washed away from the recombinant nucleic acid vectors.
- a CAR-cancer cell expressing a first or second CAR that binds and masks its cognate epitope in cis will be killed by a CAR-T cell expressing the second or first CAR, respectively.
- the replication incompetent recombinant retroviral particles used to contact T cells and/or NK cells have a polynucleotide or nucleic acid having one or more transcriptional units that encode one or more engineered signaling polypeptides.
- an engineered signaling polypeptide includes any combination of an extracellular domain (e.g. an antigen-specific targeting region or ASTR), a stalk and a transmembrane domain, combined with one or more intracellular activating domains, optionally one or more modulatory domains (such as a co-stimulatory domain), and optionally one or more T cell survival motifs.
- At least one, two, or all of the engineered signaling polypeptides is a chimeric antigen receptor (CAR) or a lymphoproliferative element (LE) such as a chimeric lymphoproliferative element (CLE).
- at least one, two, or all of the engineered signaling polypeptides is an engineered T cell receptor (TCR).
- TCR T cell receptor
- when two signaling polypeptides are utilized one encodes a lymphoproliferative element and the other encodes a chimeric antigen receptor (CAR) that includes an antigen-specific targeting region (ASTR), a transmembrane domain, and an intracellular activating domain.
- ASTR antigen-specific targeting region
- engineered signaling polypeptides For any domain of an engineered signaling polypeptide disclosed herein, exemplary sequences can be found in WO2019/055946, incorporated herein in its entirety by reference. A skilled artisan will recognize that such engineered polypeptides can also be referred to as recombinant polypeptides.
- the engineered signaling polypeptides such as CARs, engineered TCRs, LEs, and CLEs provided herein, are typically transgenes with respect to lymphocytes, especially T cells and NK cells, and most especially T cells and/or NK cells that are engineered using methods and compositions provided herein, to express such signaling polypeptides.
- an engineered signaling polypeptide includes an extracellular domain that is a member of a specific binding pair.
- the extracellular domain can be the extracellular domain of a cytokine receptor, or a mutant thereof, or a hormone receptor, or a mutant thereof.
- Such mutant extracellular domains in some embodiments have been reported to be constitutively active when expressed at least in some cell types.
- such extracellular and transmembrane domains do not include a ligand binding region. It is believed that such domains do not bind a ligand when present in an engineered signaling polypeptide and expressed in B cells, T cells, and/or NK cells.
- Mutations in such receptor mutants can occur in the extracellular juxtamembrane region.
- a mutation in at least some extracellular domains (and some extracellular- transmembrane domains) of engineered signaling polypeptides provided herein are responsible for signaling of the engineered signaling polypeptide in the absence of ligand, by bringing activating chains together that are not normally together.
- extracellular domains that comprise mutations in extracellular domains can be found, for example, in the Lymphoproliferative Element section herein.
- the extracellular domain comprises a dimerizing motif.
- the dimerizing motif comprises a leucine zipper.
- the leucine zipper is from a jun polypeptide, for example c-jun. Further embodiments regarding extracellular domains that comprise a dimerizing motif can be found, for example, in the Lymphoproliferative Element section herein.
- the extracellular domain is an antigen-specific targeting region (ASTR), sometimes called an antigen binding domain herein.
- ASTR antigen-specific targeting region
- Specific binding pairs include, but are not limited to, antigen-antibody binding pairs; ligand-receptor binding pairs; and the like.
- a member of a specific binding pair suitable for use in an engineered signaling polypeptide of the present disclosure includes an ASTR that is an antibody, an antigen, a ligand, a receptor binding domain of a ligand, a receptor, a ligand binding domain of a receptor, and an affibody.
- An ASTR suitable for use in an engineered signaling polypeptide of the present disclosure can be any antigen-binding polypeptide.
- the ASTR is an antibody such as a full-length antibody, a single-chain antibody, an Fab fragment, an Fab' fragment, an (Fab')2 fragment, an Fv fragment, and a divalent single-chain antibody or a diabody.
- the ASTR is a single chain Fv (scFv).
- the heavy chain is positioned N-terminal of the light chain in the engineered signaling polypeptide.
- the light chain is positioned N-terminal of the heavy chain in the engineered signaling polypeptide.
- the heavy and light chains can be separated by a linker as discussed in more detail herein.
- the heavy or light chain can be at the N-terminus of the engineered signaling polypeptide and is typically C-terminal of another domain, such as a signal sequence or peptide.
- cAb VHH camelid antibody variable domains
- IgNAR VH shk antibody variable domains
- sdAb VH single domain antibody variable domains
- camelized antibody variable domains are suitable for use with the engineered signaling polypeptides and methods using the engineered signaling polypeptides of the present disclosure.
- T cell receptor (TCR) based recognition domains are suitable for use with the engineered signaling polypeptides and methods using the engineered signaling polypeptides of the present disclosure.
- TCR T cell receptor
- Naturally-occurring T cell receptors include an a-subunit and a b-subunit, separately produced by unique recombination events in a T cell's genome.
- Libraries of TCRs may be screened for their selectivity to a target antigen, for example, any of the antigens disclosed herein. Screens of natural and/or engineered TCRs can identify TCRs with high avidities and/or reactivities towards a target antigen.
- TCRs can be selected, cloned, and a polynucleotide encoding such a TCR can be included in a replication incompetent recombinant retroviral particle to genetically modify a lymphocyte, or in illustrative embodiments, T cell or NK cell, such that the lymphocyte expresses the engineered TCR.
- the TCR can be a single chain TCR (scTv, single chain two-domain TCR containing nanb).
- a CAR include CARs having extracellular domains engineered to co-opt the endogenous TCR signaling complex and CD3Z signaling pathway.
- a chimeric antigen receptor ASTR is fused to one of the endogenous TCR complex chains (e.g. TCR alpha, CD3E etc) to promote incorporation into the TCR complex and signaling through the endogenous CD3Z chains.
- a CAR contains a first scFv or protein that binds to the TCR complex and a second scFv or protein that binds to the target antigen (e.g. tumor antigen).
- the TCR can be a single chain TCR (scTv, single chain two-domain TCR containing nanb).
- scFv’s may also be generated to recognize the specific MHC/peptide complex, thereby acting as a surrogate TCR.
- Such peptide/MHC scFv-binders may be used in many similar configurations as CARs.
- the ASTR can be multispecific, e.g. bispecific antibodies. Multispecific antibodies have binding specificities for at least two different sites. In certain embodiments, one of the binding specificities is for one target antigen and the other is for another target antigen. In certain embodiments, bispecific antibodies may bind to two different epitopes of a target antigen. Bispecific antibodies may also be used to localize cytotoxic agents to cells which express a target antigen. Bispecific antibodies can be prepared as full-length antibodies or antibody fragments.
- An ASTR suitable for use in an engineered signaling polypeptide of the present disclosure, or an engineered TCR, can have a variety of antigen-binding specificities.
- the antigen-binding domain is specific for an epitope present in an antigen that is expressed by (synthesized by) a target cell.
- the target cell is a cancer cell associated antigen.
- the cancer cell associated antigen can be an antigen associated with, e.g., a breast cancer cell, a B cell lymphoma such as diffuse large B cell lymphoma (DLBCL), a Hodgkin lymphoma cell, an ovarian cancer cell, a prostate cancer cell, a mesothelioma, a lung cancer cell (e.g., a small cell lung cancer cell), a non-Hodgkin B-cell lymphoma (B- NHL) cell, an ovarian cancer cell, a prostate cancer cell, a mesothelioma cell, a lung cancer cell (e.g., a small cell lung cancer cell), a melanoma cell, a chronic myelogenous leukemia cell, a chronic lymphocytic leukemia cell, an acute lymphocytic leukemia cell, a neuroblastoma cell, a glioma, a glioblastoma, a medulloblastoma
- Non-limiting examples of antigens to which an ASTR of an engineered signaling polypeptide can bind, or an engineered T cell receptor can bind include, e.g., CD19, CD20, CD38, CD30, ERBB2, CA125, MUC-1, prostate-specific membrane antigen (PSMA), CD44 surface adhesion molecule, mesothelin, carcinoembryonic antigen (CEA), epidermal growth factor receptor (EGFR), EGFRvIII, vascular endothelial growth factor receptor-2 (VEGFR2), high molecular weight-melanoma associated antigen (HMW-MAA), MAGE-A1, IL-13R-a2, GD2, Axl, Ror2, New York esophageal squamous cell carcinoma antigen (NYESOl), and the like.
- PSMA prostate-specific membrane antigen
- CEA carcinoembryonic antigen
- EGFR epidermal growth factor receptor
- EGFRvIII vascular endothelial
- a member of a specific binding pair suitable for use in an engineered signaling polypeptide is an ASTR that is a ligand for a receptor.
- Ligands include, but are not limited to, hormones (e.g. erythropoietin, growth hormone, leptin, etc.); cytokines (e.g., interferons, interleukins, certain hormones, etc.); growth factors (e.g., heregulin; vascular endothelial growth factor (VEGF); and the like); an integrin-binding peptide (e.g., a peptide comprising the sequence Arg-Gly-Asp (SEQ ID NO:l)); and the like.
- hormones e.g. erythropoietin, growth hormone, leptin, etc.
- cytokines e.g., interferons, interleukins, certain hormones, etc.
- growth factors e.g., heregulin; vascular
- the engineered signaling polypeptide can be activated in the presence of a second member of the specific binding pair, where the second member of the specific binding pair is a receptor for the ligand.
- the second member of the specific binding pair can be a VEGF receptor, including a soluble VEGF receptor.
- the member of a specific binding pair that is included in an engineered signaling polypeptide is an ASTR that is a receptor, e.g., a receptor for a ligand, a co-receptor, etc.
- the receptor can be a ligand-binding fragment of a receptor.
- Suitable receptors include, but are not limited to, a growth factor receptor (e.g., a VEGF receptor); a killer cell lectin-like receptor subfamily K, member 1 (NKG2D) polypeptide (receptor for MICA, MICB, and ULB6); a cytokine receptor (e.g., an IL-13 receptor; an IL-2 receptor; etc.); CD27; a natural cytotoxicity receptor (NCR) (e.g., NKP30 (NCR3/CD337) polypeptide (receptor for HLA-B -associated transcript 3 (BAT3) and B7-H6); etc.); etc.
- a growth factor receptor e.g., a VEGF receptor
- a killer cell lectin-like receptor subfamily K, member 1 (NKG2D) polypeptide receptor for MICA, MICB, and ULB6
- a cytokine receptor e.g., an IL-13 receptor; an IL-2 receptor; etc
- the ASTR can be directed to an intermediate protein that links the ASTR with a target molecule expressed on a target cell.
- the intermediate protein may be endogenously expressed or introduced exogenously and may be natural, engineered, or chemically modified.
- the ASTR can be an anti-tag ASTR such that at least one tagged intermediate, typically an antibody-tag conjugate, is included between a tag recognized by the ASTR and a target molecule, typically a protein target, expressed on a target cell. Accordingly, in such embodiments, the ASTR binds a tag and the tag is conjugated to an antibody directed against an antigen on a target cell, such as a cancer cell.
- Non-limiting examples of tags include fluorescein isothiocyanate (FITC), streptavidin, biotin, histidine, dinitrophenol, peridinin chlorophyll protein complex, green fluorescent protein, phycoerythrin (PE), horse radish peroxidase, palmitoylation, nitrosylation, alkaline phosphatase, glucose oxidase, and maltose binding protein.
- FITC fluorescein isothiocyanate
- streptavidin biotin
- biotin histidine
- dinitrophenol dinitrophenol
- peridinin chlorophyll protein complex green fluorescent protein
- PE phycoerythrin
- horse radish peroxidase palmitoylation
- nitrosylation alkaline phosphatase
- glucose oxidase glucose oxidase
- maltose binding protein a binds the tag.
- the engineered signaling polypeptide includes a stalk which is located in the portion of the engineered signaling polypeptide lying outside the cell and interposed between the ASTR and the transmembrane domain.
- the stalk has at least 85, 90, 95, 96, 97, 98, 99, or 100% identity to a wild-type CD 8 stalk region (TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGG AVHTRGLDFA (SEQ ID NO:2), has at least 85, 90, 95, 96, 97, 98, 99, or 100% identity to a wild-type CD28 stalk region (FCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP (SEQ ID NO:3)), or has at least 85, 90, 95, 96, 97, 98, 99, or 100% identity to a wild-type immunoglobulin heavy chain stalk region.
- the stalk employed allows the antigen-specific targeting region, and typically the entire engineered signaling polypeptide, to retain increased binding to a target antigen.
- the stalk region can have a length of from about 4 amino acids to about 50 amino acids, e.g., from about 4 aa to about 10 aa, from about 10 aa to about 15 aa, from about 15 aa to about 20 aa, from about 20 aa to about 25 aa, from about 25 aa to about 30 aa, from about 30 aa to about 40 aa, or from about 40 aa to about 50 aa.
- the stalk of an engineered signaling polypeptide includes at least one cysteine.
- the stalk can include the sequence Cys-Pro-Pro-Cys (SEQ ID NO:4). If present, a cysteine in the stalk of a first engineered signaling polypeptide can be available to form a disulfide bond with a stalk in a second engineered signaling polypeptide.
- Stalks can include immunoglobulin hinge region amino acid sequences that are known in the art; see, e.g., Tan et al. (1990) Proc. Natl. Acad. Sci. USA 87:162; and Huck et al. (1986) Nucl. Acids Res. 14:1779.
- an immunoglobulin hinge region can include a domain with at least 50, 60, 70, 75, 80, 85, 90, 95, 96, 97, 98, 99 or 100% sequence identity to a stretch of at least 10, 15, 20, or all of the amino acids of any of the following amino acid sequences: DKTHT (SEQ ID NO:5); CPPC (SEQ ID NO:4); CPEPKSCDTPPPCPR (SEQ ID NO:6) (see, e.g., Glaser et al. (2005) J. Biol. Chem.
- ELKTPLGDTTHT SEQ ID NO:7
- KSCDKTHTCP SEQ ID NO:8
- KCCVDCP SEQ ID NO:9
- KYGPPCP SEQ ID NO: 10
- EPKSCDKTHTCPPCP SEQ ID NO: 11
- ERKCCVECPPCP SEQ ID NO: 12
- ELKTPLGDTTHTCPRCP SEQ ID NO: 13
- SPNMVPHAHHAQ SEQ ID NO: 14
- the stalk can include a hinge region with an amino acid sequence of a human IgGl, IgG2, IgG3, or IgG4, hinge region.
- the stalk can include one or more amino acid substitutions and/or insertions and/or deletions compared to a wild-type (naturally-occurring) hinge region.
- His229 of human IgG 1 hinge can be substituted with Tyr, so that the stalk includes the sequence EPKSCDKTYTCPPCP (SEQ ID NO:15), (see, e.g., Yan et al. (2012) J. Biol. Chem. 287:5891).
- the stalk can include an amino acid sequence derived from human CD8; e.g., the stalk can include the amino acid sequence: TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD (SEQ ID NO: 16), or a variant thereof.
- An engineered signaling polypeptide of the present disclosure can include transmembrane domains for insertion into a eukaryotic cell membrane.
- the transmembrane domain can be interposed between the ASTR and the co-stimulatory domain.
- the transmembrane domain can be interposed between the stalk and the co-stimulatory domain, such that the chimeric antigen receptor includes, in order from the amino terminus (N-terminus) to the carboxyl terminus (C-terminus): an ASTR; a stalk; a transmembrane domain; and an activating domain.
- Any transmembrane (TM) domain that provides for insertion of a polypeptide into the cell membrane of a eukaryotic (e.g., mammalian) cell is suitable for use in aspects and embodiments disclosed herein.
- Non-limiting examples of TM domains suitable for any of the aspects or embodiments provided herein, include a domain with at least 50, 60, 70, 75, 80, 85, 90, 95, 96, 97, 98, 99 or 100% sequence identity to a stretch of at least 10, 15, 20, or all of the amino acids of any of the following TM domains or combined stalk and TM domains: a) CD8 alpha TM (SEQ ID NO:17); b) CD8 beta TM (SEQ ID NO:18); c) CD4 stalk (SEQ ID NO: 19); d) CD3Z TM (SEQ ID NO:20); e) CD28 TM (SEQ ID NO:21); f) CD134 (0X40) TM: (SEQ ID NO:22); g) CD7 TM (SEQ ID NO:23); h) CD 8 stalk and TM (SEQ ID NO:24); and i) CD28 stalk and TM (SEQ ID NO:25).
- a transmembrane domain of an aspect of the invention can have at least 80%, 90%, or 95% or can have 100% sequence identity to the SEQ ID NO: 17 transmembrane domain, or can have 100% sequence identity to any of the transmembrane domains from the following genes respectively: the CD8 beta transmembrane domain, the CD4 transmembrane domain, the CD3 zeta transmembrane domain, the CD28 transmembrane domain, the CD 134 transmembrane domain, or the CD7 transmembrane domain.
- Intracellular activating domains suitable for use in an engineered signaling polypeptide of the present disclosure when activated typically induce the production of one or more cytokines; increase cell death; and/or increase proliferation of CD8 + T cells, CD4 + T cells, NKT cells, gd T cells, and/or neutrophils.
- Activating domains can also be referred to as activation domains herein.
- Activating domains can be used in CARs or in lymphoproliferative elements provided herein.
- the intracellular activating domain includes at least one (e.g., one, two, three, four, five, six, etc.) IT AM motifs as described below.
- an intracellular activating domain of an aspect of the invention can have at least 80%, 90%, or 95% or can have 100% sequence identity to the CD3Z, CD3D, CD3E, CD3G, CD79A, CD79B, DAP12, FCER1G, FCGR2A, FCGR2C, DAP10/CD28, or ZAP70 domains as described below.
- Intracellular activating domains suitable for use in an engineered signaling polypeptide of the present disclosure include immunoreceptor tyrosine-based activation motif (ITAM)-containing intracellular signaling polypeptides.
- ITAM immunoreceptor tyrosine-based activation motif
- An IT AM motif is YX1X2L/I, where Xi and X2 are independently any amino acid.
- the intracellular activating domain of an engineered signaling polypeptide includes 1, 2, 3, 4, or 5 IT AM motifs.
- an IT AM motif is repeated twice in an intracellular activating domain, where the first and second instances of the IT AM motif are separated from one another by 6 to 8 amino acids, e.g., (YXiX 2 L/I)(X 3 ) n (YXiX 2 L/I), where n is an integer from 6 to 8, and each of the 6-8 X 3 can be any amino acid.
- the intracellular activating domain of an engineered signaling polypeptide includes 3 IT AM motifs.
- a suitable intracellular activating domain can be an IT AM motif-containing portion that is derived from a polypeptide that contains an IT AM motif.
- a suitable intracellular activating domain can be an IT AM motif-containing domain from any IT AM motif-containing protein.
- a suitable intracellular activating domain need not contain the entire sequence of the entire protein from which it is derived.
- IT AM motif-containing polypeptides include, but are not limited to: CD3Z (CD3 zeta); CD3D (CD3 delta); CD3E (CD3 epsilon); CD3G (CD3 gamma); CD79A (antigen receptor complex-associated protein alpha chain); CD79B (antigen receptor complex-associated protein beta chain)DAP12; and FCER1G (Fc epsilon receptor I gamma chain).
- the intracellular activating domain is derived from T cell surface glycoprotein CD3 zeta chain (also known as CD3Z, T cell receptor T3 zeta chain, CD247, CD3-ZETA, CD3H, CD3Q, T3Z, TCRZ, etc.).
- a suitable intracellular activating domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all amino acids in the following sequences or to a contiguous stretch of from about 100 amino acids to about 110 amino acids (aa), from about 110 aa to about 115 aa, from about 115 aa to about 120 aa, from about 120 aa to about 130 aa, from about 130 aa to about 140 aa, from about 140 aa to about 150 aa, or from about 150 aa to about 160 aa, of either of the following amino acid sequences (2 isoforms):
- a suitable intracellular activating domain polypeptide can include an ITAM motif- containing a portion of the full length CD3 zeta amino acid sequence.
- a suitable intracellular activating domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all amino acids in the following sequences or to a contiguous stretch of from about 100 amino acids to about 110 amino acids (aa), from about 110 aa to about 115 aa, from about 115 aa to about 120 aa, from about 120 aa to about 130 aa, from about 130 aa to about 140 aa, from about 140 aa to about 150 aa, or from about 150 aa to about 160 aa, of either of the following amino acid sequences:
- RVKFSRS AD AP A Y QQGQN QL [ YNELNLGRREE YD VL] DKRRGRDPEMGGKPRRKNPQEGL [ YNE LQKDKMAEAYSEI]GMKGERRRGKGHDGL[YQGLSTATKDTYDAL]HMQALPPR (SEQ ID NO:28);
- RVKFSRS AD AP AY QQGQN QL [YNELNLGRREE YD VL] DKRRGRDPEMGGKPQRRKNPQEGL [ YN ELQKDKMAEAYSEI]GMKGERRRGKGHDGL[YQGLSTATKDTYDAL]HMQALPPR (SEQ ID NO:29); N QL [YNELNLGRREE YD VL] DKR SEQ ID NO:30); EGL[ YNELQKDKMAEAY SEI] GMK (SEQ ID NO:31); or DGL [ Y QGLST ATKDT YD AL] HMQ (SEQ ID NO:32), where the IT AM motifs are set out in brackets.
- the intracellular activating domain is derived from T cell surface glycoprotein CD3 delta chain (also known as CD3D; CD3-DELTA; T3D; CD3 antigen, delta subunit; CD3 delta; CD3d antigen, delta polypeptide (TiT3 complex); OKT3, delta chain; T cell receptor T3 delta chain; T cell surface glycoprotein CD3 delta chain; etc.).
- T cell surface glycoprotein CD3 delta chain also known as CD3D; CD3-DELTA; T3D; CD3 antigen, delta subunit; CD3 delta; CD3d antigen, delta polypeptide (TiT3 complex); OKT3, delta chain; T cell receptor T3 delta chain; T cell surface glycoprotein CD3 delta chain; etc.
- a suitable intracellular activating domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all amino acids in the following sequences or to a contiguous stretch of from about 100 amino acids to about 110 amino acids (aa), from about 110 aa to about 115 aa, from about 115 aa to about 120 aa, from about 120 aa to about 130 aa, from about 130 aa to about 140 aa, from about 140 aa to about 150 aa, or from about 150 aa to about 160 aa, of either of the following amino acid sequences:
- a suitable intracellular activating domain polypeptide can comprise an IT AM motif- containing portion of the full length CD3 delta amino acid sequence.
- a suitable intracellular activating domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all amino acids in the following sequence: DQV[Y QPLRDRDD AQYSHL] GGN (SEQ ID NO:35), where the ITAM motifs are set out in brackets.
- the intracellular activating domain is derived from T cell surface glycoprotein CD3 epsilon chain (also known as CD3e, T cell surface antigen T3/Leu-4 epsilon chain, T cell surface glycoprotein CD3 epsilon chain, AI504783, CD3, CD3epsilon, T3e, etc.).
- T cell surface glycoprotein CD3 epsilon chain also known as CD3e, T cell surface antigen T3/Leu-4 epsilon chain, T cell surface glycoprotein CD3 epsilon chain, AI504783, CD3, CD3epsilon, T3e, etc.
- a suitable intracellular activating domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all amino acids in the following sequences or to a contiguous stretch of from about 100 amino acids to about 110 amino acids (aa), from about 110 aa to about 115 aa, from about 115 aa to about 120 aa, from about 120 aa to about 130 aa, from about 130 aa to about 140 aa, from about 140 aa to about 150 aa, or from about 150 aa to about 160 aa, of the following amino acid sequence:
- a suitable intracellular activating domain polypeptide can comprise an IT AM motif- containing portion of the full length CD3 epsilon amino acid sequence.
- a suitable intracellular activating domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all amino acids in the following sequence: NPD [ YEPIRKGQRDL Y SGL] N QR (SEQ ID NO:37), where the ITAM motifs are set out in brackets.
- the intracellular activating domain is derived from T cell surface glycoprotein CD3 gamma chain (also known as CD3G, T cell receptor T3 gamma chain, CD3-GAMMA, T3G, gamma polypeptide (TiT3 complex), etc.).
- a suitable intracellular activating domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all amino acids in the following sequences or to a contiguous stretch of from about 100 amino acids to about 110 amino acids (aa), from about 110 aa to about 115 aa, from about 115 aa to about 120 aa, from about 120 aa to about 130 aa, from about 130 aa to about 140 aa, from about 140 aa to about 150 aa, or from about 150 aa to about 160 aa, of the following amino acid sequence:
- a suitable intracellular activating domain polypeptide can comprise an ITAM motif- containing portion of the full length CD3 gamma amino acid sequence.
- a suitable intracellular activating domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all amino acids in the following sequence: DQL [ Y QPLKDREDD Q Y SHL] QGN (SEQ ID NO:39), where the ITAM motifs are set out in brackets.
- the intracellular activating domain is derived from CD79A (also known as B-cell antigen receptor complex-associated protein alpha chain; CD79a antigen (immunoglobulin- associated alpha); MB-1 membrane glycoprotein; Ig-alpha; membrane-bound immunoglobulin-associated protein; surface IgM-associated protein; etc.).
- CD79A also known as B-cell antigen receptor complex-associated protein alpha chain
- CD79a antigen immunoglobulin- associated alpha
- MB-1 membrane glycoprotein Ig-alpha
- membrane-bound immunoglobulin-associated protein surface IgM-associated protein; etc.
- a suitable intracellular activating domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all amino acids in the following sequences or to a contiguous stretch of from about 100 amino acids to about 110 amino acids (aa), from about 110 aa to about 115 aa, from about 115 aa to about 120 aa, from about 120 aa to about 130 aa, from about 130 aa to about 140 aa, from about 140 aa to about 150 aa, or from about 150 aa to about 160 aa, of either of the following amino acid sequences:
- a suitable intracellular activating domain polypeptide can comprise an ITAM motif- containing portion of the full length CD79A amino acid sequence.
- a suitable intracellular activating domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all amino acids in the following sequence: ENL[YEGLNLDDCSMYEDI]SRG (SEQ ID NO:42), where the ITAM motifs are set out in brackets.
- the intracellular activating domain is derived from DAP 12 (also known as TYROBP; TYRO protein tyrosine kinase binding protein; KARAP; PLOSL; DNAX-activation protein 12; KAR-associated protein; TYRO protein tyrosine kinase-binding protein; killer activating receptor associated protein; killer-activating receptor-associated protein; etc.).
- DAP 12 also known as TYROBP; TYRO protein tyrosine kinase binding protein; KARAP; PLOSL; DNAX-activation protein 12; KAR-associated protein; TYRO protein tyrosine kinase-binding protein; killer activating receptor associated protein; killer-activating receptor-associated protein; etc.
- a suitable intracellular activating domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all amino acids in the following sequences or to a contiguous stretch of from about 100 amino acids to about 110 amino acids (aa), from about 110 aa to about 115 aa, from about 115 aa to about 120 aa, from about 120 aa to about 130 aa, from about 130 aa to about 140 aa, from about 140 aa to about 150 aa, or from about 150 aa to about 160 aa, of either of the following amino acid sequences (4 isoforms):
- a suitable intracellular activating domain polypeptide can comprise an ITAM motif- containing portion of the full length DAP12 amino acid sequence.
- a suitable intracellular activating domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all amino acids in the following sequence: ESP[ YQELQGQRSD VYSDL] NTQ (SEQ ID NO:47), where the ITAM motifs are set out in brackets.
- the intracellular activating domain is derived from FCER1G (also known as FCRG; Fc epsilon receptor I gamma chain; Fc receptor gamma-chain; fc-epsilon Rl-gamma; fcRgamma; fceRI gamma; high affinity immunoglobulin epsilon receptor subunit gamma; immunoglobulin E receptor, high affinity, gamma chain; etc.).
- FCER1G also known as FCRG
- Fc epsilon receptor I gamma chain Fc receptor gamma-chain
- fcRgamma fceRI gamma
- high affinity immunoglobulin epsilon receptor subunit gamma immunoglobulin E receptor, high affinity, gamma chain; etc.
- a suitable intracellular activating domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all amino acids in the following sequences or to a contiguous stretch of from about 50 amino acids to about 60 amino acids (aa), from about 60 aa to about 70 aa, from about 70 aa to about 80 aa, or from about 80 aa to about 88 aa, of the following amino acid sequence:
- a suitable intracellular activating domain polypeptide can comprise an ITAM motif- containing portion of the full length FCER1G amino acid sequence.
- a suitable intracellular activating domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all amino acids in the following sequence: DGV[YTGLSTRNQETYETL]KHE (SEQ ID NO:49), where the ITAM motifs are set out in brackets.
- Intracellular activating domains suitable for use in an engineered signaling polypeptide of the present disclosure include a DAP10/CD28 type signaling chain.
- a suitable intracellular activating domain includes a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all amino acids in SEQ ID NO:50.
- a CD28 signaling chain is the amino acid sequence is SEQ ID NO:51.
- a suitable intracellular domain includes a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all amino acids of SEQ ID NO:51.
- Intracellular activating domains suitable for use in an engineered signaling polypeptide of the present disclosure include a ZAP70 polypeptide
- a suitable intracellular activating domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all amino acids in the following sequences or to a contiguous stretch of from about 300 amino acids to about 400 amino acids, from about 400 amino acids to about 500 amino acids, or from about 500 amino acids to 619 amino acids, of SEQ ID NO:52.
- Modulatory domains can change the effect of the intracellular activating domain in the engineered signaling polypeptide, including enhancing or dampening the downstream effects of the activating domain or changing the nature of the response.
- Modulatory domains suitable for use in an engineered signaling polypeptide of the present disclosure include co-stimulatory domains.
- a modulatory domain suitable for inclusion in the engineered signaling polypeptide can have a length of from about 30 amino acids to about 70 amino acids (aa), e.g., a modulatory domain can have a length of from about 30 aa to about 35 aa, from about 35 aa to about 40 aa, from about 40 aa to about 45 aa, from about 45 aa to about 50 aa, from about 50 aa to about 55 aa, from about 55 aa to about 60 aa, from about 60 aa to about 65 aa, or from about 65 aa to about 70 aa.
- modulatory domain can have a length of from about 70 aa to about 100 aa, from about 100 aa to about 200 aa, or greater than 200 aa.
- Co-stimulatory domains typically enhance and/or change the nature of the response to an activation domain.
- Co-stimulatory domains suitable for use in an engineered signaling polypeptide of the present disclosure are generally polypeptides derived from receptors. In some embodiments, co stimulatory domains homodimerize.
- a subject co-stimulatory domain can be an intracellular portion of a transmembrane protein (i.e., the co-stimulatory domain can be derived from a transmembrane protein).
- co-stimulatory polypeptides include, but are not limited to, 4-1BB (CD 137), CD27, CD28, CD28 deleted for Lck binding (ICA), ICOS, 0X40, BTLA, CD27, CD30, GITR, and HVEM.
- a co-stimulatory domain of an aspect of the invention can have at least 80%, 90%, or 95% sequence identity to the co-stimulatory domain of 4-1BB (CD137), CD27, CD28, CD28 deleted for Lck binding (ICA), ICOS, 0X40, BTLA, CD27, CD30, GITR, or HVEM.
- a co stimulatory domain of an aspect of the invention can have at least 80%, 90%, or 95% sequence identity to the co-stimulatory domain of non-limiting examples of suitable co-stimulatory polypeptides include, but are not limited to, 4-1BB (CD137), CD27, CD28, CD28 deleted for Lck binding (ICA), ICOS, 0X40, BTLA, CD27, CD30, GITR, and HVEM.
- 4-1BB CD137
- CD27, CD28, CD28 deleted for Lck binding (ICA), ICOS, 0X40, BTLA, CD27, CD30, GITR, and HVEM include, but are not limited to, 4-1BB (CD137), CD27, CD28, CD28 deleted for Lck binding (ICA), ICOS, 0X40, BTLA, CD27, CD30, GITR, and HVEM.
- a co-stimulatory domain of an aspect of the invention can have at least 80%, 90%, or 95% sequence identity to the co-stimulatory domain of 4-1BB (CD 137), CD27, CD28, CD28 deleted for Lck binding (ICA), ICOS, 0X40, BTLA, CD27, CD30, GITR, or HVEM.
- 4-1BB CD 137
- CD27, CD28, CD28 deleted for Lck binding (ICA), ICOS, 0X40, BTLA, CD27, CD30, GITR, or HVEM 4-1BB (CD 137), CD27, CD28, CD28 deleted for Lck binding (ICA), ICOS, 0X40, BTLA, CD27, CD30, GITR, or HVEM.
- a co-stimulatory domain suitable for inclusion in an engineered signaling polypeptide can have a length of from about 30 amino acids to about 70 amino acids (aa), e.g., a co-stimulatory domain can have a length of from about 30 aa to about 35 aa, from about 35 aa to about 40 aa, from about 40 aa to about 45 aa, from about 45 aa to about 50 aa, from about 50 aa to about 55 aa, from about 55 aa to about 60 aa, from about 60 aa to about 65 aa, or from about 65 aa to about 70 aa.
- the co-stimulatory domain can have a length of from about 70 aa to about 100 aa, from about 100 aa to about 200 aa, or greater than 200 aa.
- the co-stimulatory domain is derived from an intracellular portion of the transmembrane protein CD137 (also known as TNFRSF9; CD137; 4-1BB; CDwl37; ILA; etc.).
- a suitable co-stimulatory domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all of the amino acids in SEQ ID NO:53.
- the co-stimulatory domain has a length of from about 30 aa to about 35 aa, from about 35 aa to about 40 aa, from about 40 aa to about 45 aa, from about 45 aa to about 50 aa, from about 50 aa to about 55 aa, from about 55 aa to about 60 aa, from about 60 aa to about 65 aa, or from about 65 aa to about 70 aa.
- the co-stimulatory domain is derived from an intracellular portion of the transmembrane protein CD28 (also known as Tp44).
- a suitable co-stimulatory domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all of the amino acids in SEQ ID NO:54.
- the co-stimulatory domain has a length of from about 30 aa to about 35 aa, from about 35 aa to about 40 aa, from about 40 aa to about 45 aa, from about 45 aa to about 50 aa, from about 50 aa to about 55 aa, from about 55 aa to about 60 aa, from about 60 aa to about 65 aa, or from about 65 aa to about 70 aa.
- the co-stimulatory domain is derived from an intracellular portion of the transmembrane protein CD28 deleted for Lck binding (ICA).
- a suitable co-stimulatory domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all of the amino acids in SEQ ID NO:55.
- the co-stimulatory domain has a length of from about 30 aa to about 35 aa, from about 35 aa to about 40 aa, from about 40 aa to about 45 aa, from about 45 aa to about 50 aa, from about 50 aa to about 55 aa, from about 55 aa to about 60 aa, from about 60 aa to about 65 aa, or from about 65 aa to about 70 aa.
- the co-stimulatory domain is derived from an intracellular portion of the transmembrane protein ICOS (also known as AILIM, CD278, and CVIDl).
- a suitable co stimulatory domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%,
- the co-stimulatory domain has a length of from about 30 aa to about 35 aa, from about 35 aa to about 40 aa, from about 40 aa to about 45 aa, from about 45 aa to about 50 aa, from about 50 aa to about 55 aa, from about 55 aa to about 60 aa, from about 60 aa to about 65 aa, or from about 65 aa to about 70 aa.
- the co-stimulatory domain is derived from an intracellular portion of the transmembrane protein 0X40 (also known as TNFRSF4, RP5-902P8.3, ACT35, CD134, OX-40, TXGP1L).
- 0X40 contains a p85 PI3K binding motif at residues 34-57 and a TRAF binding motif at residues 76-102, each of SEQ ID NO: 296 (of Table 1).
- the costimulatory domain can include the p85 PI3K binding motif of 0X40.
- the costimulatory domain can include the TRAF binding motif of 0X40.
- Lysines corresponding to amino acids 17 and 41 of SEQ ID NO: 296 are potentially negative regulatory sites that function as parts of ubiquitin targeting motifs.
- one or both of these Lysines in the costimulatory domain of 0X40 are mutated Arginines or another amino acid.
- a suitable co-stimulatory domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all of the amino acids in SEQ ID NO:57.
- the co-stimulatory domain has a length of from about 20 aa to about 25 aa, about 25 aa to about 30 aa, 30 aa to about 35 aa, from about 35 aa to about 40 aa, from about 40 aa to about 45 aa, or from about 45 aa to about 50 aa.
- the co-stimulatory domain has a length of from about 20 aa to about 50 aa, for example 20 aa to 45 aa, or 20 aa to 42 aa.
- the co-stimulatory domain is derived from an intracellular portion of the transmembrane protein CD27 (also known as S 152, T 14, TNFRSF7, and Tp55).
- a suitable co-stimulatory domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all of the amino acids in SEQ ID NO:58.
- the co-stimulatory domain has a length of from about 30 aa to about 35 aa, from about 35 aa to about 40 aa, from about 40 aa to about 45 aa, or from about 45 aa to about 50 aa.
- the co-stimulatory domain is derived from an intracellular portion of the transmembrane protein BTLA (also known as BTLA1 and CD272).
- BTLA also known as BTLA1 and CD272.
- a suitable co stimulatory domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%,
- the co-stimulatory domain is derived from an intracellular portion of the transmembrane protein CD30 (also known as TNFRSF8, D1S166E, and Ki-1).
- a suitable co stimulatory domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%,
- the co-stimulatory domain is derived from an intracellular portion of the transmembrane protein GITR (also known as TNFRSF18, RP5-902P8.2, AITR, CD357, and GITR-D).
- GITR also known as TNFRSF18, RP5-902P8.2, AITR, CD357, and GITR-D.
- a suitable co-stimulatory domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all of the amino acids in SEQ ID NO:61.
- the co-stimulatory domain has a length of from about 30 aa to about 35 aa, from about 35 aa to about 40 aa, from about 40 aa to about 45 aa, from about 45 aa to about 50 aa, from about 50 aa to about 55 aa, from about 55 aa to about 60 aa, from about 60 aa to about 65 aa, or from about 65 aa to about 70 aa.
- the co-stimulatory domain derived from an intracellular portion of the transmembrane protein HVEM also known as TNFRSF14, RP3-395M20.6, ATAR, CD270, HVEA, HVEM, EIGHTR, and TR2.
- a suitable co-stimulatory domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all of the amino acids in SEQ ID NO:62.
- the co-stimulatory domain of both the first and the second polypeptide has a length of from about 30 aa to about 35 aa, from about 35 aa to about 40 aa, from about 40 aa to about 45 aa, from about 45 aa to about 50 aa, from about 50 aa to about 55 aa, from about 55 aa to about 60 aa, from about 60 aa to about 65 aa, or from about 65 aa to about 70 aa.
- the engineered signaling polypeptide includes a linker between any two adjacent domains.
- a linker can be between the transmembrane domain and the first co stimulatory domain.
- the ASTR can be an antibody and a linker can be between the heavy chain and the light chain.
- a linker can be between the ASTR and the transmembrane domain and a co-stimulatory domain.
- a linker can be between the co-stimulatory domain and the intracellular activating domain of the second polypeptide.
- the linker can be between the ASTR and the intracellular signaling domain.
- the linker peptide may have any of a variety of amino acid sequences. Proteins can be joined by a spacer peptide, generally of a flexible nature, although other chemical linkages are not excluded.
- a linker can be a peptide of between about 1 and about 100 amino acids in length, or between about 1 and about 25 amino acids in length. These linkers can be produced by using synthetic, linker-encoding oligonucleotides to couple the proteins. Peptide linkers with a degree of flexibility can be used.
- the linking peptides may have virtually any amino acid sequence, bearing in mind that suitable linkers will have a sequence that results in a generally flexible peptide. The use of small amino acids, such as glycine and alanine, are of use in creating a flexible peptide. The creation of such sequences is routine to those of skill in the art.
- Suitable linkers can be readily selected and can be of any of a suitable of different lengths, such as from 1 amino acid (e.g., Gly) to 20 amino acids, from 2 amino acids to 15 amino acids, from 3 amino acids to 12 amino acids, including 4 amino acids to 10 amino acids, 5 amino acids to 9 amino acids, 6 amino acids to 8 amino acids, or 7 amino acids to 8 amino acids, and may be 1, 2, 3, 4, 5, 6, or 7 amino acids.
- Exemplary flexible linkers include glycine polymers (G) n , glycine-serine polymers (including, for example, (GS) n , GSGGS n , GGGS n , and GGGGS n where n is an integer of at least one), glycine-alanine polymers, alanine-serine polymers, and other flexible linkers known in the art. Glycine and glycine-serine polymers are of interest since both of these amino acids are relatively unstructured, and therefore may serve as a neutral tether between components.
- Glycine polymers are of particular interest since glycine accesses significantly more phi-psi space than even alanine, and is much less restricted than residues with longer side chains (see Scheraga, Rev. Computational Chem. 11173-142 (1992)).
- Exemplary flexible linkers include, but are not limited GGGGSGGGGSGGGGS (SEQ ID NO:63), GGGGSGGGGSGGGGSGGGGSGGGGSGGGGS (SEQ ID NO:64), GGGGSGGGSGGGGS (SEQ ID NO:65), GGSG (SEQ ID NO:66), GGSGG (SEQ ID NO:67), GSGSG (SEQ ID NO:68), GSGGG (SEQ ID NO:69), GGGSG (SEQ ID NO:70), GSSSG (SEQ ID NO:71), and the like.
- the ordinarily skilled artisan will recognize that design of a peptide conjugated to any elements described above can include linkers that are all or partially flexible, such that the linker can include a flexible linker as well as one or more portions that confer less flexible structure.
- a polynucleotide provided by the replication incompetent recombinant retroviral particles has one or more transcriptional units that encode certain combinations of the one or more engineered signaling polypeptides.
- modified and in illustrative embodiments genetically modified T cells include the combinations of the one or more engineered signaling polypeptides after transduction of T cells by the replication incompetent recombinant retroviral particles. It will be understood that the reference of a first polypeptide, a second polypeptide, a third polypeptide, etc. is for convenience and elements on a “first polypeptide” and those on a “second polypeptide” means that the elements are on different polypeptides that are referenced as first or second for reference and convention only, typically in further elements or steps to that specific polypeptide.
- the first engineered signaling polypeptide includes an extracellular antigen binding domain, which is capable of binding an antigen, and an intracellular signaling domain. In other embodiments, the first engineered signaling polypeptide also includes a T cell survival motif and/or a transmembrane domain. In some embodiments, the first engineered signaling polypeptide does not include a co-stimulatory domain, while in other embodiments, the first engineered signaling polypeptide does include a co-stimulatory domain.
- a second engineered signaling polypeptide includes a lymphoproliferative gene product and optionally an extracellular antigen binding domain.
- the second engineered signaling polypeptide also includes one or more of the following: a T cell survival motif, an intracellular signaling domain, and one or more co-stimulatory domains.
- at least one is a CAR.
- the one or more engineered signaling polypeptides are expressed under a T cell specific promoter or a general promoter under the same transcript wherein in the transcript, nucleic acids encoding the engineered signaling polypeptides are separated by nucleic acids that encode one or more internal ribosomal entry sites (IREs) or one or more protease cleavage peptides.
- IREs internal ribosomal entry sites
- the polynucleotide encodes two engineered signaling polypeptides wherein the first engineered signaling polypeptide includes a first extracellular antigen binding domain, which is capable of binding to a first antigen, and a first intracellular signaling domain but not a co stimulatory domain, and the second polypeptide includes a second extracellular antigen binding domain, which is capable of binding VEGF, and a second intracellular signaling domain, such as for example, the signaling domain of a co-stimulatory molecule.
- the first antigen is PSCA, PSMA, or BCMA.
- the first extracellular antigen binding domain comprises an antibody or fragment thereof (e.g., scFv), e.g., an antibody or fragment thereof specific to PSCA, PSMA, or BCMA.
- the second extracellular antigen binding domain that binds VEGF is a receptor for VEGF, i.e., VEGFR.
- the VEGFR is VEGFR1, VEGFR2, or VEGFR3. In a certain embodiment, the VEGFR is VEGFR2.
- the polynucleotide encodes two engineered signaling polypeptides wherein the first engineered signaling polypeptide includes an extracellular tumor antigen binding domain and a CD3z signaling domain, and the second engineered signaling polypeptide includes an antigen binding domain, wherein the antigen is an angiogenic or vasculogenic factor, and one or more co stimulatory molecule signaling domains.
- the angiogenic factor can be, e.g., VEGF.
- the one or more co stimulatory molecule signaling motifs can comprise, e.g., co-stimulatory signaling domains from each of CD27, CD28, 0X40, ICOS, and 4-1BB.
- the polynucleotide encodes two engineered signaling polypeptides wherein the first engineered signaling polypeptide includes an extracellular tumor antigen-binding domain and a O ⁇ 3z signaling domain, the second polypeptide comprises an antigen-binding domain, which is capable of binding to VEGF, and co-stimulatory signaling domains from each of CD27, CD28, 0X40, ICOS, and 4- IBB.
- the first signaling polypeptide or second signaling polypeptide also has a T cell survival motif.
- the T cell survival motif is, or is derived from, an intracellular signaling domain of IL-7 receptor (IL-7R), an intracellular signaling domain of IL-12 receptor, an intracellular signaling domain of IL-15 receptor, an intracellular signaling domain of IL-21 receptor, or an intracellular signaling domain of transforming growth factor b (TOHb) receptor or the T ⁇ Rb decoy receptor (TGF-b — dominant-negative receptor II (DNRII)).
- IL-7R IL-7 receptor
- TOHb transforming growth factor b
- the polynucleotide encodes two engineered signaling polypeptides wherein the first engineered signaling polypeptide includes an extracellular tumor antigen-binding domain and a CD3z signaling domain, and the second engineered signaling polypeptide includes an antigen-binding domain, which is capable of binding to VEGF, an IL-7 receptor intracellular T cell survival motif, and co-stimulatory signaling domains from each of CD27, CD28, 0X40, ICOS, and 4- 1BB.
- more than two signaling polypeptides are encoded by the polynucleotide.
- only one of the engineered signaling polypeptides includes an antigen binding domain that binds to a tumor-associated antigen or a tumor-specific antigen; each of the remainder of the engineered signaling polypeptides comprises an antigen binding domain that binds to an antigen that is not a tumor-associated antigen or a tumor-specific antigen.
- two or more of the engineered signaling polypeptides include antigen binding domains that bind to one or more tumor- associated antigens or tumor-specific antigens, wherein at least one of the engineered signaling polypeptides comprises an antigen binding domain that does not bind to a tumor-associated antigen or a tumor-specific antigen.
- the tumor-associated antigen or tumor-specific antigen is Axl, ROR1, ROR2, Her2, prostate stem cell antigen (PSCA), PSMA (prostate-specific membrane antigen), B cell maturation antigen (BCMA), alpha-fetoprotein (AFP), carcinoembryonic antigen (CEA), cancer antigen- 125 (CA-125), CA19-9, calretinin, MUC-1, epithelial membrane protein (EMA), epithelial tumor antigen (ETA), tyrosinase, melanoma-associated antigen (MAGE), CD34, CD45, CD99, CD117, chromogranin, cytokeratin, desmin, glial fibrillary acidic protein (GFAP), gross cystic disease fluid protein (GCDFP-15), HMB-45 antigen, protein melan-A (melanoma antigen recognized by T lymphocytes; MART-1), myo- Dl, muscle-specific actin (MSA), neurofilament, neurofilament, neurofilament
- the first engineered signaling polypeptide includes a first extracellular antigen binding domain that binds a first antigen, and a first intracellular signaling domain; and a second engineered signaling polypeptide includes a second extracellular antigen binding domain that binds a second antigen, or a receptor that binds the second antigen; and a second intracellular signaling domain, wherein the second engineered signaling polypeptide does not comprise a co-stimulatory domain.
- the first antigen-binding domain and the second antigen-binding domain are independently an antigen-binding portion of a receptor o r an antigen-binding portion of an antibody.
- first antigen binding domain or the second antigen binding domain are scFv antibody fragments.
- first engineered signaling polypeptide and/or the second engineered signaling polypeptide additionally comprises a transmembrane domain.
- the first engineered signaling polypeptide or the second engineered signaling polypeptide comprises a T cell survival motif, e.g., any of the T cell survival motifs described herein.
- the first engineered signaling polypeptide includes a first extracellular antigen binding domain that binds HER2 and the second engineered signaling polypeptide includes a second extracellular antigen binding domain that binds MUC-1.
- the second extracellular antigen binding domain of the second engineered signaling polypeptide binds an interleukin.
- the second extracellular antigen binding domain of the second engineered signaling polypeptide binds a damage associated molecular pattern molecule (DAMP; also known as an alarmin).
- DAMP is a heat shock protein, chromatin-associated protein high mobility group box 1 (HMGB1), S100A8 (also known as MRP8, or calgranulin A), S100A9 (also known as MRP14, or calgranulin B), serum amyloid A (SAA), deoxyribonucleic acid, adenosine triphosphate, uric acid, or heparin sulfate.
- HMGB1 chromatin-associated protein high mobility group box 1
- S100A8 also known as MRP8, or calgranulin A
- S100A9 also known as MRP14, or calgranulin B
- SAA serum amyloid A
- said second antigen is an antigen on an antibody that binds to an antigen presented by a tumor cell.
- signal transduction activation through the second engineered signaling polypeptide is non-antigenic, but is associated with hypoxia.
- hypoxia is induced by activation of hypoxia-inducible factor-la (HIF-la), HIF-Ib, HIF-2a, HIH-2b, HIF-3a, or HIR-3b.
- HIF-la hypoxia-inducible factor-la
- HIF-Ib hypoxia-inducible factor-la
- HIF-2a HIF-2a
- HIF-3a HIR-3b
- expression of the one or more engineered signaling polypeptides is regulated by a control element, which is disclosed in more detail herein.
- the engineered signaling polypeptides can further include one or more additional polypeptide domains, where such domains include, but are not limited to, a signal sequence; an epitope tag; an affinity domain; and a polypeptide whose presence or activity can be detected (detectable marker), for example by an antibody assay or because it is a polypeptide that produces a detectable signal.
- Non limiting examples of additional domains for any of the aspects or embodiments provided herein include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to any of the following sequences as described below: a signal sequence, an epitope tag, an affinity domain, or a polypeptide that produces a detectable signal.
- Signal sequences that are suitable for use in a subject CAR include any eukaryotic signal sequence, including a naturally-occurring signal sequence, a synthetic (e.g., man-made) signal sequence, etc.
- the signal sequence can be the CD8 signal sequence M ALP VT ALLLPLALLLHAARP (SEQ ID NO:72).
- Suitable epitope tags include, but are not limited to, hemagglutinin (HA; e.g., YPYDVPDYA; SEQ ID NO:73); FLAG (e.g., DYKDDDDK; SEQ ID NO:74); c-myc (e.g., EQKLISEEDL; SEQ ID NO:75), and the like.
- Affinity domains include peptide sequences that can interact with a binding partner, e.g., such as one immobilized on a solid support, useful for identification or purification.
- DNA sequences encoding multiple consecutive single amino acids, such as histidine, when fused to the expressed protein, may be used for one-step purification of the recombinant protein by high affinity binding to a resin column, such as nickel sepharose.
- affinity domains include His5 (HHHHH; SEQ ID NO:76), HisX6 (HHHHHH; SEQ ID NO:77), c-myc (EQKLISEEDL; SEQ ID NO:75), Flag (DYKDDDDK; SEQ ID NO:74), Strep Tag (WSHPQFEK; SEQ ID NO:78), hemagglutinin, e.g., HA Tag (YPYDVPDYA; SEQ ID NO:73), GST, thioredoxin, cellulose binding domain, RYIRS (SEQ ID NO:79), Phe-His-His-Thr (SEQ ID NO: 80), chitin binding domain, S-peptide, T7 peptide, SH2 domain, C-end RNA tag, WEAAAREACCRECCARA (SEQ ID NO:81), metal binding domains, e.g., zinc binding domains or calcium binding domains such as those from calcium-binding proteins, e.g., calmodulin, troponin C, calc
- Suitable detectable signal-producing proteins include, e.g., fluorescent proteins; enzymes that catalyze a reaction that generates a detectable signal as a product; and the like.
- Suitable fluorescent proteins include, but are not limited to, green fluorescent protein (GFP) or variants thereof, blue fluorescent variant of GFP (BFP), cyan fluorescent variant of GFP (CFP), yellow fluorescent variant of GFP (YFP), enhanced GFP (EGFP), enhanced CFP (ECFP), enhanced YFP (EYFP), GFPS65T, Emerald, Topaz (TYFP), Venus, Citrine, mCitrine, GFPuv, destabilized EGFP (dEGFP), destabilized ECFP (dECFP), destabilized EYFP (dEYFP), mCFPm, Cerulean, T-Sapphire, CyPet, YPet, mKO, HcRed, t-HcRed, DsRed, DsRed2, DsRed-monomer, J-Red, dimer2, t-dimer2(12), mRFPl, pocilloporin, Renilla GFP, Monster GFP, paGFP
- fluorescent proteins include mHoneydew, mBanana, mOrange, dTomato, tdTomato, mTangerine, mStrawberry, mCherry, mGrapel, mRaspberry, mGrape2, m PI urn (Shaner et al. (2005) Nat. Methods 2:905-909), and the like. Any of a variety of fluorescent and colored proteins from Anthozoan species, as described in, e.g., Matz et al. (1999) Nature Biotechnol. 17:969-973, is suitable for use.
- Suitable enzymes include, but are not limited to, horse radish peroxidase (HRP), alkaline phosphatase (AP), beta-galactosidase (GAL), glucose-6-phosphate dehydrogenase, beta-N- acetylglucosaminidase, b-glucuronidase, invertase, Xanthine Oxidase, firefly luciferase, glucose oxidase (GO), and the like.
- HRP horse radish peroxidase
- AP alkaline phosphatase
- GAL beta-galactosidase
- glucose-6-phosphate dehydrogenase beta-N- acetylglucosaminidase
- b-glucuronidase invertase
- Xanthine Oxidase firefly luciferase
- glucose oxidase GO
- Safety switches have been developed for use with cellular therapies to effect the reduction or elimination of infused cells in the case of adverse events.
- Any of the replication incompetent recombinant retroviral particles provided herein can include nucleic acids that encode a safety switch as part of, or separate from, nucleic acids encoding any of the engineered signaling polypeptides provided herein.
- any of the engineered signaling polypeptides provided herein for example engineered signaling polypeptides in modifed, genetically modified, and/or transduced lymphocytes to be introduced or reintroduced by subcutaneous injection, can include a safety switch.
- any of the engineered T cells disclosed herein can include a safety switch.
- Safety switch technologies can be broadly categorized into three groups based on their mechanism of action; metabolic (gene-directed enzyme prodrug therapy, GDEPT), dimerization induced apoptotic signals, and antibody mediated cytotoxicity.
- metabolic gene-directed enzyme prodrug therapy, GDEPT
- dimerization induced apoptotic signals dimerization induced apoptotic signals
- antibody mediated cytotoxicity antibody mediated cytotoxicity
- the safety switch is a GDEPT.
- the GDEPT can be a polynucleotide that encodes a viral thymidine kinase, such as that derived from the herpes simplex virus (HSV-TK).
- HSV-TK is a 376 amino acid protein with the sequence SEQ ID NO:368.
- the GDEPT is a fragment of HSK-TV capable of converting the non-toxic drug ganciclovir (GCV) into GCV-triphosphate and leading to cell dealth by halting DNA replication.
- the GDEPT can be a polynucleotide that encodes cytosine deaminase. Cytosine deaminase converts 5-fluorocytosine (5-FC) into the cytotoxic 5-fluorouracil (5-FU).
- the safety switch is based on dimerization induced apoptotic signals.
- the safety switch is a chimeric protein comprised of an inducible dimerization domain linked in frame with components of an apoptotic pathway, such that conditional dimerization mediated by the binding of a cell-permeable chemical inducer of dimerization (CID) results in apoptosis of the cell.
- the safety switch is inducible FAS (iFAS) comprised of one or more inducible dimerization domains fused to the cytoplasmic tail of the Fas receptor and localized to the membrane by a myristoyl group.
- the safety switch is an inducible Caspase comprised of one or more inducible dimerization domains fused to a caspase, such as caspase- 1 or caspase-9.
- the inducible dimerization domain is a cyclophilin and the CID is cyclosporin or a cyclosporin derivative.
- the inducible dimerization domain is a FKBP and the CID is an FK-506 dimer or derivative thereof, such as AP1903.
- the safety switch is based on antibody mediated cytotoxicity upon antibody binding to a recombinant polypeptide expressed on the cell surface (referred to herein as a cell tag).
- the antibody binds to the cell tag and induces complement-dependent cytotoxicity (CDC) and/or antibody-dependent cell-mediated cytotoxicity (ADCC).
- the cell tag is a myc or FLAG tag.
- the cell tag polypeptide is non-immunogenic.
- the cell tag comprises an endogenous cell-surface molecule or a modified endogenous cell-surface molecule.
- the endogenous cell-surface molecule can be any cell-surface receptor, ligand, glycoprotein, cell adhesion molecule, antigen, integrin, or cluster of differentiation.
- Modifications to endogenous cell-surface molecules include modifications to the extracellular domain that reduce the ability of the cell-surface molecule to bind its cognate ligand or receptor, and/or modifications to the intracellular domain that reduce the natural signaling activity of the endogenous cell- surface molecule. Modifications to endogenous cell-surface molecules also include the removal of certain domains and/or the inclusion of domains from heterologous proteins or synthetic domains.
- the modified endogenous cell-surface molecule is a truncated tyrosine kinase receptor.
- the truncated tyrosine kinase receptor is a member of the epidermal growth factor receptor (EGFR) family (e.g., ErbBl (HER1), ErbB2, ErbB3, and ErbB4), for example as disclosed in U.S. Patent 8,802,374 or WO2018226897.
- the cell tag can be a polypeptide that is recognized by an antibody that recognizes the extracellular domain of an EGFR member.
- the cell tag can be at least 20 contiguous amino acids of an EGFR family member, or for example, between 20 and 50 contiguous amino acids of an EGFR family member.
- a gene encoding an EGFR polypeptide including human epidermal growth factor receptor (EGFR) is constructed by removal of nucleic acid sequences that encode polypeptides including the membrane distal EGF-binding domain and the cytoplasmic signaling tail, but retaining the extracellular membrane proximal epitope recognized by an anti-EGFR antibody.
- SEQ ID NO: 82 is an exemplary polypeptide that is recognized by, and under the appropriate conditions bound by an antibody that recognizes the extracellular domain of an EGFR member.
- eTags Such truncated EGFR polypeptides are sometimes referred to herein as eTags.
- eTags are recognized by monoclonal antibodies that are commercially available such as matuzumab, necitumumab panitumumab, and in illustrative embodiments, cetuximab.
- eTAG was demonstrated to have suicide gene potential through Erbitux® mediated antibody dependent cellular cytotoxicity (ADCC) pathways.
- ADCC antibody dependent cellular cytotoxicity
- the inventors of the present disclosure have successfully expressed eTag in PBMCs using lentiviral vectors, and have found that expression of eTag in vitro by PBMCs exposed to Cetuximab, provided an effective elimination mechanism for PBMCs.
- the modified endogenous cell-surface molecule is a truncated version of a member of the TNF receptor superfamily.
- LNGFR low affinity nerve growth factor receptor
- Human LNGFR is a single pass type I transmembrane glycoprotein with the amino acid sequence of (SEQ ID NO:369) that comprises a 28aa residue signal peptide, a 222aa extracellular domain comprising 4 cysteine rich domains, a 22aa transmembrane domain and a 155aa intracellular domain.
- the cell-surface molecule comprises an epitope has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identify to the amino acid sequence of the entire extracellular domain of LNGFR or to a truncated fragment of the extracellular domain such as residues 29-250, 65-250, or 108-250 of SEQ ID NO:369.
- the modified endogenous cell-surface molecule is a version of CD20.
- the human CD20 polypeptide is a multi-pass transmembrane protein encoded by a membrane-spanning 4- domains subfamily A member (MS4A1) gene with the amino acid sequence of SEQ ID NO:370.
- CD20 comprises 4 transmembrane domain passes encompassing amino acids 57-78, 85- 105, 121-141, and 189-209.
- CD20 comprises 2 extracellular domains encompassing amino acids 79-84 and 142-188.
- CD20 comprises 3 cytoplasmic domains encompassing amino acids 1-56, 106-120 and 210-297.
- a CD20 polypeptide can be missing multiple domains or multiple portions of a domain relative to the wildtype polypeptide.
- a CD20 polypeptide comprises M1-E263, M117-N214, M1-N214, V82- N214, or V82-I186 of endogenous CD20.
- a CD20 polypeptide has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity to an amino acid sequence selected from K142-S185, P160-S185, or C167-C183 of SEQ ID NO:370.
- the truncated CD20 version comprises at least one copy of an epitope recognized by a monoclonal antibody such as ocrelizumab, obinutuzumab, ofatumumab, ibritumomab tiuxetan, tositumomab, ublituximab, and in further illustrative embodiments rituximah.
- a monoclonal antibody such as ocrelizumab, obinutuzumab, ofatumumab, ibritumomab tiuxetan, tositumomab, ublituximab, and in further illustrative embodiments rituximah.
- the modified endogenous cell-surface molecule is a version of CD52.
- CD52 occurs endogenously in humans as a peptide of 12 amino acids linked at its C-terminus to a GPI anchor.
- GPI can be used to anchor the polypeptide to the cell surface.
- CD52 can be attached to the cell surface using a heterologous transmembrane domain.
- the truncated CD52 polypeptide can incorporate one or more epitopes recognized by an antibody such as HI186 (BioRad), YTH34.5(BioRad), YTH66.9(BioRad), or in illustrative embodiments, alemtuzumab.
- the CD52 epitope has at least 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identify to the amino acid sequence of SEQ ID NO:371.
- the cell tag is itself an antibody that binds a predetermined binding partner antibody.
- the cell tag antibody is an anti-idiotypic antibody.
- the anti-idiotypic antibody (Ab2) recognizes an epitope on the predetermined binding partner antibody (Abl) that is distinct from the antigen binding site on Abl.
- Ab2 binds the variable region of Abl. In other illustrative embodiments, Ab2 binds the antigen-binding site of Abl.
- Ab2 may be from any animal including human and murine, or humanized or chimeric antibody or antibody derivative including antibody fragments (Fab, Fab’, F(ab’)2, scFv, diabodies, bispecific antibodies, and antibody fusion proteins.
- Ab2 is associated with the cell surface via its endogenous transmembrane domain.
- Ab2 is associated with the cell surface via a heterologous transmembrane domain or membrane attachment sequence such as GPI.
- Abl is a commercially available monoclonal antibody.
- Abl is a commercially available monoclonal antibody therapeutic.
- Abl is capable of mediating ADCC and/or CDC as described below.
- safety switches also function as flags that label or mark polynucleotides, polypeptides, or cells as being engineered.
- Such safety switches can be detected using standard laboratory techniques including PCR, Southern Blots, RT-PCR, Northern Blots, Western Blots, histology, and flow cytomertry.
- detection of eTAG by flow cytometry was used herein as an in vivo tracking marker for T cell engraftment in mice.
- cell tags are used to enrich for engineered cells using antibodies or ligands optionally bound to a solid substrate such as a column or beads.
- biotinylated-cetuximab to immunomagnetic selection in combination with anti-biotin microheads successfully enriches T cells that have been lentivirally transduced with eTAG containing constructs from as low as 2% of the population to greater than 90% purity without observable toxicity to the cell preparation.
- the safety switch is expressed as part of a single polynucleotide that also includes the CAR, or as part of a single polynucleotide that includes the lymphoproliferative element, or as a single polynucleotide that encodes both the CAR and the lymphoproliferative element.
- the polynucleotide encoding the safety swtich is separated from the polynucleotide encoding the CAR and/or the polynucleotide encoding the lymphoproliferative element, by an internal ribosome entry site (IRES) or a ribosomal skip sequence and/or cleavage signal.
- IRS internal ribosome entry site
- the ribosomal skip and/or cleavage signal can be any ribosomal skip sequence and/or cleavage signal known in the art.
- the ribosomal skip sequence can be, for example, T2A with amino acid sequence GSGEGRGSLLTCGDVEENPGP (SEQ ID NO:83).
- Other examples of cleavage signals and ribosomal skip sequences include FMDV 2A (F2A); equine rhinitis A virus 2A (abbreviated as E2A); porcine teschovirus-1 2A (P2A); and Thoseaasigna virus 2A (T2A).
- a safety switch and in illustrative embodiments, a cell tag, is expressed as part of a fusion polypeptide, fused to a CAR.
- a safety swtich and as exemplified empirically herein, a cell tag, is expressed fused to a lymphoproliferative element.
- Such constructs provide the advantage, especially in combination with other “space saving” elements provided herein, of taking up less genomic space on an RNA genome compared to separate polypeptides.
- an eTag is expressed as a fusion polypeptide, fused the 5’ terminus of the c-Jun domain (SEQ ID NO: 104), a transmembrane domain from CSF2RA (SEQ ID NO: 129), a first intracellular domain from MPL (SEQ ID NO:283), and a second intracellular domain from CD40 (SEQ ID NO:208).
- the cell tag may be associated with the cell membrane via its natural membrane attachment sequence or via a heterologous membrane attachment sequence such as a GPI-anchor or transmembrane sequence.
- cell tags are expressed on the T cell and/or NK cell but are not expressed on the replication incompetent recombinant retroviral particles.
- polynucleotides, polypeptides, and cells comprise 2 or more safety switches.
- an engineered signaling polypeptide is a chimeric antigen receptor (CAR) or a polynucleotide encoding a CAR, which, for simplicity, is referred to herein as “CAR.”
- a CAR of the present disclosure includes: a) at least one antigen-specific targeting region (ASTR); b) a transmembrane domain; and c) an intracellular activating domain.
- the antigen-specific targeting region of the CAR is an scFv portion of an antibody to the target antigen.
- the intracellular activating domain is from CD3Z, CD3D, CD3E, CD3G, CD79A, CD79B, DAP12, FCER1G, FCGR2A, FCGR2C, DAP10/CD28, or ZAP70, and some further illustrative embodiments, from CD3z.
- the CAR further comprises a co-stimulatory domain, for example any of the co-stimulatory domains provided above in the Modulatory Domains section, and in further illustrative embodiments the co-stimulatory domain is the intracellular co-stimulatory domain of 4-1BB (CD137), CD28, ICOS, OX-40, BTLA, CD27, CD30, GITR, and HVEM.
- the CAR includes any of the transmembrane domains listed in the Transmembrane Domain section above.
- a CAR of the present disclosure can be present in the plasma membrane of a eukaryotic cell, e.g., a mammalian cell, where suitable mammalian cells include, but are not limited to, a cytotoxic cell, a T lymphocyte, a stem cell, a progeny of a stem cell, a progenitor cell, a progeny of a progenitor cell, and an NK cell, an NK-T cell, and a macrophage.
- a CAR of the present disclosure is active in the presence of one or more target antigens that, in certain conditions, binds the ASTR.
- the target antigen is the second member of the specific binding pair.
- the target antigen of the specific binding pair can be a soluble (e.g., not bound to a cell) factor; a factor present on the surface of a cell such as a target cell; a factor presented on a solid surface; a factor present in a lipid bilayer; and the like.
- the antigen can be a soluble (e.g., not bound to a cell) antigen; an antigen present on the surface of a cell such as a target cell; an antigen presented on a solid surface; an antigen present in a lipid bilayer; and the like.
- the ASTR of a CAR is expressed as a separate polypeptide from the intracellular signaling domain.
- one or both of the polypeptides can include any of the transmembrane domains disclosed herein.
- one or both of the polypeptides can include a heterologous signal sequence and/or a heterologous membrane attachment sequence.
- the heterologous membrane attachment sequence is a GPI anchor attachment sequence.
- a CAR of the present disclosure when present in the plasma membrane of a eukaryotic cell, and when activated by the one or more target antigens, increases expression of at least one nucleic acid in the cell by at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 40%, at least about 50%, at least about 75%, at least about 2-fold, at least about 2.5-fold, at least about 5-fold, at least about 10-fold, or more than 10- fold, compared with the level of transcription of the nucleic acid in the absence of the one or more target antigens.
- the CAR of the present disclosure can include an immunoreceptor tyrosine-based activation motif (IT AM) -containing intracellular signaling polypeptide.
- IT AM immunoreceptor tyrosine-based activation motif
- a CAR of the present disclosure when present in the plasma membrane of a eukaryotic cell, and when activated by one or more target antigens, can, in some instances, result in increased production of one or more cytokines by the cell.
- a CAR of the present disclosure when present in the plasma membrane of a eukaryotic cell, and when activated by the one or more target antigens, can increase production of a cytokine by the cell by at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 40%, at least about 50%, at least about 75%, at least about 2-fold, at least about 2.5-fold, at least about 5-fold, at least about 10-fold, or more than 10- fold, compared with the amount of cytokine produced by the cell in the absence of the one or more target antigens.
- Cytokines whose production can be increased include, but are not limited to interferon gamma (IFN-g), tumor necrosis factor-alpha (TNF-a), IL-2, IL-15, IL-12, IL-4, IL-5, IL-10; a chemokine; a growth factor; and the like.
- IFN-g interferon gamma
- TNF-a tumor necrosis factor-alpha
- IL-2 tumor necrosis factor-alpha
- IL-15 IL-12
- IL-4 IL-5
- IL-10 a chemokine
- chemokine a growth factor
- a CAR of the present disclosure when present in the plasma membrane of a eukaryotic cell, and when activated by one or more target antigens, can result in both an increase in transcription of a nucleic acid in the cell and an increase in production of a cytokine by the cell.
- a CAR of the present disclosure when present in the plasma membrane of a eukaryotic cell, and when activated by one or more target antigens, results in cytotoxic activity by the cell toward a target cell that expresses on its cell surface an antigen to which the antigen-binding domain of the first polypeptide of the CAR binds.
- a CAR of the present disclosure when present in the plasma membrane of the cell, and when activated by the one or more target antigens, increases cytotoxic activity of the cell toward a target cell that expresses on its cell surface the one or more target antigens.
- a CAR of the present disclosure when present in the plasma membrane of the cell, and when activated by the one or more target antigens, increases cytotoxic activity of the cell by at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 40%, at least about 50%, at least about 75%, at least about 2-fold, at least about 2.5-fold, at least about 5-fold, at least about 10-fold, or more than 10-fold, compared to the cytotoxic activity of the cell in the absence of the one or more target antigens.
- a CAR of the present disclosure when present in the plasma membrane of a eukaryotic cell, and when activated by one or more target antigens, can result in other CAR activation related events such as proliferation and expansion (either due to increased cellular division or anti- apoptotic responses).
- a CAR of the present disclosure when present in the plasma membrane of a eukaryotic cell, and when activated by one or more target antigens, can result in other CAR activation related events such as intracellular signaling modulation, cellular differentiation, or cell death.
- CARs of the present disclosure are microenvironment restricted. This property is typically the result of the microenvironment restricted nature of the ASTR domain of the CAR.
- CARs of the present disclosure can have a lower binding affinity or, in illustrative embodiments, can have a higher binding affinity to one or more target antigens under a condition(s) in a microenvironment than under a condition in a normal physiological environment.
- CARs provided herein comprise a co-stimulatory domain in addition to an intracellular activating domain, wherein the co-stimulatory domain is any of the intracellular signaling domains provided herein for lymphoproliferative elements (LEs), such as, for example, intracellular domains of CLEs.
- Ls lymphoproliferative elements
- the co-stimulatory domains of CARs herein are first intracellular domains (P3 domains) identified herein for CLEs or P4 domains that are shown as effective intracellular signaling domains of CLEs herein in the absence of a P3 domain.
- co-stimulatory domains of CARs can comprise both a P3 and a P4 intracellular signaling domain identified herein for CLEs.
- Certain illustrative subembodiments include especially effective P3 and P4 partner intracellular signaling domains as identified herein for CLEs.
- the co-stimulatory domain is other than an ITAM-containing intracellular domain of a CAR either as part of the co-stimulatory domain, or in further illustrative embodiments as the only co-stimulatory domain.
- the co-stimulatory domain of a CAR can be any intracellular signaling domain in Table 1 provided herein. Active fragments of any of the intracellular domains in Table 1 can be a co-stimulatory domain of a CAR.
- the ASTR of the CAR comprises an scFV.
- these CARs comprise an intracellular activating domain that in illustrative embodiments is a CD3Z, CD3D, CD3E, CD3G, CD79A, CD79B, DAP 12, FCER1G, FCGR2A, FCGR2C.
- DAP10/CD28, or ZAP70 intracellular activating domain or in further illustrative embodiments is a CD3z intracellular activating domain.
- the co-stimulatory domain of a CAR can comprise an intracellular domain or a functional signaling fragment thereof that includes a signaling domain from CSF2RB, CRLF2, CSF2RA, CSF3R, EPOR, GHR, IFNAR1, IFNAR2, IFNGR1, IFNGR2, IFNLR1, IL1R1, IL1RAP, IL1RL1, IL1RL2, IL2RA, IL2RB, IL2RG, IL3RA, IL5RA, IL6R, IL6ST, IL7RA, IL9R, IL10RA, IL10RB, IL11RA, IL12RB1, IL12RB2, IL13RA1, IL13RA2, IL15RA, IL17RB, IL17RC, IL17RD, IL18R1, IL18RAP, IL20RA, IL20RB, IL21R, IL22RA1, IL23R, IL27RA,
- the co-stimulatory domain of a CAR can include an intracellular domain or a functional signaling fragment thereof that includes a signaling domain from CSF2RB, CRLF2, CSF2RA, CSF3R, EPOR, GHR, IFNAR1, IFNAR2, IFNGR1, IFNGR2, IFNLR1, IL1R1, IL1RAP, IL1RL1, IL1RL2, IL2RA, IL2RB, IL2RG, IL3RA, IL5RA, IL6R, IL6ST, IL9R, IL10RA, IL10RB, IL11RA, IL13RA1, IL13RA2, IL17RB, IL17RC, IL17RD, IL18R1, IL18RAP, IL20RA, IL20RB, IL22RA1, IL31RA, LEPR, LIFR, LMP1, MPL, MyD88, OSMR, or PRLR.
- the co-stimulatory domain of a CAR can include an intracellular domain or a functional fragment thereof that includes a signaling domain from CSF2RB, CSF2RA, CSF3R, EPOR, IFNGR1, IFNGR2, IL1R1, IL1RAP, IL1RL1, IL2RA, IL2RG, IL5RA, IL6R, IL9R, IL10RB, IL11RA, IL12RB1, IL12RB2, IL13RA2, IL15RA, IL17RD, IL21R, IL23R, IL27RA, IL31RA, LEPR, MPL, MyD88, or OSMR.
- the co-stimulatory domain of a CAR can include an intracellular domain or a fragment thereof that includes a signaling domain from CSF2RB, CSF2RA, CSF3R, EPOR, IFNGR1, IFNGR2, IL1R1, IL1RAP, IL1RL1, IL2RA, IL2RG, IL5RA, IL6R, IL9R, IL10RB, IL11RA, IL13RA2, IL17RD, IL31RA, LEPR, MPL, MyD88, or OSMR.
- the co-stimulatory domain of a CAR can include an intracellular domain or a functional signaling fragment thereof that includes a signaling domain from CSF2RB, CSF3R, IFNAR1, IFNGR1, IL2RB, IL2RG, IL6ST, IL10RA, IL12RB2, IL17RC, IL17RE, IL18R1, IL27RA, IL31RA, MPL, MyD88,
- the co-stimulatory domain of a CAR can include an intracellular domain or a functional signaling fragment thereof that includes a signaling domain from CSF2RB,
- CSF3R CSF3R, IFNGR1, IL2RB, IL2RG, IL6ST, IL10RA, IL17RE, IL31RA, MPL, or MyD88.
- the co-stimulatory domain of a CAR can include an intracellular domain or a fragment thereof that includes a signaling domain from CSF3R, IL6ST, IL27RA, MPL, and MyD88.
- the intracellular activating domain of the CAR is derived from CD3z.
- TCRs T Cell Receptors
- T Cell Receptors recognize specific protein fragments derived from intracellular as well as extracellular proteins. When proteins are broken into peptide fragments, they are presented on the cell surface with another protein called major histocompatibility complex, or MHC, which is called the HLA (human leukocyte antigen) complex in humans.
- MHC major histocompatibility complex
- HLA human leukocyte antigen
- Such combinations are formed by dimerization between members of dimerizing subtypes, such as an a TCR subunit and a b TCR subunit, a g TCR subunit and a d TCR subunit, and for pre-TCRs, a pTa subunit and a b TCR subunit.
- a set of TCR subunits dimerize and recognize a target peptide fragment presented in the context of an MHC.
- the pre-TCR is expressed only on the surface of immature ab T cells while the ab TCR is expressed on the surface of mature ab T cells and NK T cells, and ydTCR is expressed on the surface of gdT cells.
- o ⁇ TCRs on the surface of a T cell recognize the peptide presented by MHCI or MHCII and the ab TCR on the surface of NK T cells recognize lipid antigens presented by CD1.
- ydTCRs can recognize MHC and MHC-like molecules, and can also recognize non-MHC molecules such as viral glycoproteins.
- o ⁇ TCRs and ydTCRs transmit activation signals through the CD3zeta chain that stimulate T cell proliferation and cytokine secretion.
- TCR molecules belong to the immunoglobulin superfamily with its antigen-specific presence in the V region, where CDR3 has more variability than CDR1 and CDR2, directly determining the antigen binding specificity of the TCR.
- CDR3 has more variability than CDR1 and CDR2 directly determining the antigen binding specificity of the TCR.
- the CDR1 and CDR2 recognize and bind the sidewall of the MHC molecule antigen binding channel, and the CDR3 binds directly to the antigenic peptide.
- Recombinant TCRs may thus be engineered that recognize a tumor-specific protein fragment presented on MHC.
- Recombinant TCR such as those derived from human TCRa and TCR pairs that recognize specific peptides with common HLAs can thus be generated with specificity to a tumor specific protein (Schmitt, TM et al., 2009).
- the target of recombinant TCRs may be peptides derived from any of the antigen targets for CAR ASTRs provided herein, but are more commonly derived from intracellular tumor specific proteins such as oncofetal antigens, or mutated variants of normal intracellular proteins or other cancer specific neoepitopes. Libraries of TCR subunits may be screened for their selectivity to a target antigen.
- TCR subunits Screens of natural and/or recombinant TCR subunits can identify sets of TCR subunits with high avidities and/or reactivities towards a target antigen. Members of such sets of TCR subunits can be selected and cloned to produce one or more polynucleotide encoding the TCR subunit.
- Polynucleotides encoding such a set of TCR subunits can be included in a replication incompetent recombinant retroviral particle to genetically modify a lymphocyte, or in illustrative embodiments, a T cell or an NK cell, such that the lymphocyte expresses the recombinant TCR.
- the CAR can be replaced by a set of ydTCR chains, or in illustrative embodiments o ⁇ TCR chains.
- TCR chains that form a set may be co-expressed using a number of different techniques to co-express the two TCR chains as is disclosed herein for expressing two or more other engineered signaling polypeptides such as CARs and lymphoproliferative elements.
- protease cleavage epitopes such as 2A protease, internal ribosomal entry sites (IRES), and separate promoters may be used.
- this involves modification of the constant (C) domains of the TCRa and TCR chains to promote the preferential pairing of the introduced TCR chains with each other, while rendering them less likely to successfully pair with endogenous TCR chains.
- C constant domains of the TCRa and TCR chains
- One approach that has shown some promise in vitro involves replacement of the C domain of human TCRa and TCR chains with their mouse counterparts.
- Another approach involves mutation of the human TCRa common domain and TCR chain common regions to promote self-pairing, or the expression of an endogenous TCR alpha and TCR beta miRNA within the viral gene construct.
- each member of the set of TCR chains in illustrative embodiments a TCR chains, comprises a modified constant domain that promotes preferential pairing with each other.
- each member of a set of TCR chains in illustrative embodiments a TCR chains, comprises a mouse constant domain from the same TCR chain type, or a constant domain from the same TCR chain subtype with enough sequences derived from a mouse constant domain from the same TCR chain subtype, such that dimerization of the set of TCR chains to each other is preferred over, or occurs to the exclusion of, dimerization with human TCR chains.
- each member of a set of TCR chains in illustrative embodiments o ⁇ TCR chains, comprises corresponding mutations in its constant domain, such that dimerization of the set of TCR chains to each other is preferred over, or occurs to the exclusion of, dimerization with TCR chains that have human constant domains.
- dimerization in illustrative embodiments, is under physiological conditions.
- the constant regions of the members of each of the one or more sets of TCR chains are swapped.
- the a TCR subunit of the set has a b TCR constant region
- the b TCR subunit of the set has a a TCR constant region.
- Peripheral T lymphocyte numbers are maintained at remarkably stable levels throughout adulthood, despite the continuing addition of cells, due to emigration from the thymus and proliferation in response to antigen encounter, and loss of cells owing to the removal of antigen-specific effectors after antigen clearance (Marrak, P. et al. 2000. Nat Immunol 1:107-111; Freitas, A. A. et al. 2000. Annu Rev Immunol 18:83-111).
- the size of the peripheral T cell compartment is regulated by multiple factors that influence both proliferation and survival. However, in a lymphopenic environment, T lymphocytes divide independently of cognate antigen, due to “acute homeostatic proliferation” mechanisms that maintain the size of the peripheral T cell compartment.
- lymphodepletion of a subject is not desirable because it can cause serious side effects, including immune dysfunction and death.
- lymphodepletion removes endogenous lymphocytes functioning as cellular sinks for homeostatic cytokines, thereby freeing cytokines to induce survival and proliferation of adoptively transferred cells.
- Some cytokines such as for example, IL-7 and IL-15, are known to mediate antigen-independent proliferation of T cells and are thus capable of eliciting homeostatic proliferation in non-lymphopenic environments.
- these cytokines and their receptors have intrinsic control mechanisms that prevent lymphoproliferative disorders at homeostasis.
- Many of the embodiments provided herein include a lymphoproliferative element, or a nucleic acid encoding the same, typically as part of an engineered signaling polypeptide.
- an engineered signaling polypeptide is a lymphoproliferative element (LE) such as a chimeric lymphoproliferative element (CLE).
- LE comprises an extracellular domain, a transmembrane domain, and at least one intracellular signaling domain that drives proliferation, and in illustrative embodiments a second intracellular signaling domain.
- the lymphoproliferative element can include a first and/or second intracellular signaling domain.
- the first and/or second intracellular signaling domain can include CD2, CD3D, CD3E, CD3G, CD4, CD8A, CD8B, CD27, mutated Delta Lck CD28, CD28, CD40, CD79A, CD79B, CRLF2, CSF2RB, CSF2RA, CSF3R, EPOR, FCER1G, FCGR2C, FCGRA2, GHR, ICOS, IFNAR1, IFNAR2, IFNGR1, IFNGR2, IFNLR1, IL1R1, IL1RAP, IL1RL1, IL1RL2, IL2RA, IL2RB, IL2RG, IL3RA, IL4R, IL5RA, IL6R, IL6ST, IL7RA, IL9R, IL10RA, IL10RB, IL11RA, IL12RB1, IL12RB2, IL13RA1, IL13RA2, IL15RA, IL17RA, IL17RB, IL17
- the first intracellular signaling domain can include MyD88, or a functional mutant and/or fragment thereof.
- the first intracellular signaling domain can include MyD88, or a functional mutant and/or fragment thereof
- the second intracellular signaling domain can include ICOS, TNFRSF4, or TNSFR18, or functional mutants and/or fragments thereof.
- the first intracellular domain is MyD88 and the second intracellular domain is an ITAM-containing intracellular domain, for example, an intracellular domain from CD3Z, CD3D, CD3E, CD3G, CD79A, CD79B, DAP12, FCER1G, FCGR2A, FCGR2C, DAP10/CD28, or ZAP70.
- the second intracellular signaling domain can include TNFRSF18, or a functional mutant and/or fragment thereof.
- the lymphoproliferative element can include a fusion of an extracellular domain and a transmembrane domain.
- the fusion of an extracellular domain and a transmembrane domain can include eTAG IL7RA Ins PPCL (interleukin 7 receptor), Myc LMP1, LMP1, eTAG CRLF2, eTAG CSF2RB, eTAG CSF3R, eTAG EPOR, eTAG GHR, eTAG truncated after Fn F523C IL27RA, or eTAG truncated after Fn S505N MPL, or functional mutants and/or fragments thereof.
- the lymphoproliferative element can include an extracellular domain.
- the extracellular domain can include cell tag with 0, 1, 2, 3, or 4 additional alanines at the carboxy terminus.
- the extracellular domain can include Myc or an eTAG with 0, 1, 2, 3, or 4 additional alanines at the carboxy terminus, or functional mutants and/or fragments thereof.
- a lymphoproliferative element disclosed herein that includes a cell tag there is a corresponding embodiment that is identical but lacks the cell tag and optionally lacks any linker sequence that connected the cell tag to the lymphoproliferative element.
- the lymphoproliferative element can include a transmembrane domain.
- the transmembrane domain can include CD2, CD3D, CD3E, CD3G, CD3Z CD247, CD4, CD8A, CD8B, CD27, CD28, CD40, CD79A, CD79B, CRLF2, CSF2RA, CSF2RB, CSF3R, EPOR, FCER1G, FCGR2C, FCGRA2, GHR, ICOS, IFNAR1, IFNAR2, IFNGR1, IFNGR2, IFNLR1, IL1R1, IL1RAP, IL1RL1, IL1RL2, IL2RA, IL2RB, IL2RG, IL3RA, IL4R, IL5RA, IL6R, IL6ST, IL7RA, IL7RA Ins PPCL, IL9R, IL10RA, IL10RB, IL11RA, IL12RB1,
- CLEs for use in any aspect or embodiment herein can include any CLE disclosed in WO2019/055946 (incorporated by reference herein, in its entirety), the vast majority of which were designed to be and are believed to be constitutively active.
- the constitutively active signaling pathways include activation of Jak/Stat pathways including Jakl, Jak2, Jak3, and Tyk2 and STATs such as STAT1, STAT2, STAT3, STAT4, STAT5, STAT6, and in illustrative embodiments, STAT3 and/or STAT5.
- a CLE includes one or more STAT-activation domains.
- a CLE includes two or more, three or more, four or more, five or more, or six or more STAT-activation domains.
- at least one of the one or more STAT-activation domains is, or is derived from BLNK, IL2RG, EGFR, EpoR, GHR, IFNAR1, IFNAR2, IFNAR1/2, IFNLR1, IL10R1, IL12Rbl, IL12Rb2, IL21R, IL2Rb, IL2small, IL7R, IL7Ra, IL9R, IL15R, and IL21R, as are known in the art.
- two or more STAT-activation domains are, or are derived from two or more different receptors.
- the constitutively active signaling pathways include activation of a TRAF pathway through activation of TNF receptor associated factors such as TRAF3, TRAF4, TRAF7, and in illustrative embodiments TRAF1, TRAF2, TRAF5, and/or TRAF6.
- lymphoproliferative elements for use in any of the kits, methods, uses, or compositions herein are constitutively active and comprise an intracellular signaling domain that activates a Jak/Stat pathway and/or a TRAF pathway As illustrated therein, where there is a first and a second intracellular signaling domain of a CLE, the first intracellular signaling domain is positioned between the membrane associating motif and the second intracellular domain.
- the LE provides, is capable of providing and/or possesses the property of (or a cell modified, genetically modified, and/or transduced with the LE is capable of providing, is adapted for, possesses the property of, and/or is modified for) driving T cell expansion in vivo.
- the lymphoproliferative element can include any of the sequences listed in Table 1 (SEQ ID NOs: 84-302).
- Table 1 shows the parts, names (including gene names), and amino acid sequences for domains that were tested in CLEs.
- CLEs can include in certain illustrative embodiments, an extracellular domain (denoted PI), a transmembrane domain (denoted P2), a first intracellular domain (denoted P3), and a second intracellular domain (denoted P4).
- the lymphoproliferative element includes a first intracellular domain.
- the first intracellular domain can include any of the parts listed as S036 to S0216 or in Table 1, or functional mutants and/or fragments thereof.
- the lymphoproliferative element can include a second intracellular domain.
- the second intracellular domain can include any of the parts listed as S036 to S0216 or in Table 1, or functional mutants and/or fragments thereof.
- the lymphoproliferative element can include an extracellular domain.
- the extracellular domain can include any of the sequences of parts listed as M001 to M049 or E006 to E015 in Table 1, or functional mutants and/or fragments thereof.
- the lymphoproliferative element can include a transmembrane domain.
- the transmembrane domain can include any of the parts listed as M001 to M049 or T001 to T082 in Table 1, or functional mutants and/or fragments thereof.
- the lymphoproliferative element can be of fusion of an extracellular/transmembrane domain (M001 to M049 in Table 1), a first intracellular domain (S036 to S0216 in Table 1), and a second intracellular domain (S036 to S216 in Table 1).
- the lymphoproliferative element can be a fusion of an extracellular domain (E006 to E015 in Table 1), a transmembrane domain (T001 to T082 in Table 1), a first intracellular domain (S036 to S0216 in Table 1), and a second intracellular domain (S036 to S0216 in Table 1).
- the lymphoproliferative element can be a fusion of E006, T001, S036, and S216, also written as E006-T001-S036-S216).
- the lymphoproliferative element can be the fusion E010-T072-S192-S212, E007-T054-S197-S212, E006-T006-S194-S211, E009-T073-S062-S053, E008-T001-S121-S212, E006-T044-S 186-S053, or E006-T016-S186-S050.
- the intracellular domain of an LE is other than a functional intracellular activating domain from an ITAM-containing intracellular domain, for example, an intracellular domain from CD3Z, CD3D, CD3E, CD3G, CD79A, CD79B, DAP 12, FCER1G, FCGR2A, FCGR2C, DAP10/CD28, or ZAP70, and in a further illustrative subembodiment, CD3z.
- a second intracellular domain of an LE is other than a co-stimulatory domain of 4-1BB (CD137), CD28, ICOS, OX-40, BTLA, CD27, CD30, GITR, and HVEM.
- the extracellular domain of an LE does not comprise a single-chain variable fragment (scFv).
- the extracellular domain of an LE that upon binding to a binding partner activates an LE does not comprise a single-chain variable fragment (scFv).
- a CLE does not comprise both an ASTR and an activation domain from CD3Z, CD3D, CD3E, CD3G, CD79A, CD79B, DAP 12, FCER1G, FCGR2A, FCGR2C, DAP10/CD28, or ZAP70.
- the extracellular domain and transmembrane domain are believed to play support roles in LEs, assuring that the intracellular signaling domain(s) is in an effective conformation/orientation/localization for driving proliferation.
- the ability of an LE to drive proliferation is believed to be provided by the intracellular domain(s) of the LE, and the extracellular and transmembrane domains are believed to play secondary roles relative to the intracellular domain(s).
- a lymphoproliferative element includes an intracellular domain that is a signaling polypeptide that is capable of driving proliferation of T cells or NK cells that is associated with a membrane through a membrane-associating motif (e.g. a transmembrane domain) and is oriented in, or capable of being oriented into, an active conformation.
- the ASTR of an LE in illustrative embodiments, does not include an scFv.
- Strategies are provided herein for associating an intracellular domain with a membrane, such as by inclusion of a transmembrane domain, a GPI anchor, a myristoylation region, a palmitoylation region, and/or a prenylation region.
- a lymphoproliferative element does not include an extracellular domain.
- the extracellular domains, transmembrane domains, and intracellular domains of LEs can vary in their respective amino acid lengths.
- the overall length of the LE can be between 3 and 4000 amino acids, for example between 10 and 3000, 10 and 2000, 50 and 2000, 250 and 2000 amino acids, and, in illustrative embodiments between 50 and 1000, 100 and 1000 or 250 and 1000 amino acids.
- the extracellular domain when present to form an extracellular and transmembrane domain, can be between 1 and 1000 amino acids, and is typically between 4 and 400, between 4 and 200, between 4 and 100, between 4 and 50, between 4 and 25, or between 4 and 20 amino acids.
- the extracellular region is GGGS for an extracellular and transmembrane domain of this aspect of the invention.
- the transmembrane domains, or transmembrane regions of extracellular and transmembrane domains can be between 10 and 250 amino acids, and are more typically at least 15 amino acids in length, and can be, for example, between 15 and 100, 15 and 75, 15 and 50, 15 and 40, or 15 and 30 amino acids in length.
- the intracellular signaling domains can be, for example, between 10 and 1000, 10 and 750, 10 and 500, 10 and 250, or 10 and 100 amino acids.
- the intracellular signaling domain can be at least 30, or between 30 and 500, 30 and 250, 30 and 150, 30 and 100, 50 and 500, 50 and 250, 50 and 150, or 50 and 100 amino acids.
- an intracellular signaling domain for a particular gene is at least 90%, 95%, 98%, 99% or 100% identical to at least 10, 25, 30, 40, or 50 amino acids from a sequence of that intracellular signaling domain, such as a sequence provided herein for that intracellular domain, up to the size of the entire intracellular domain sequence, and can include for example, up to an additional 1, 2, 3, 4, 5, 10, 20, or 25 amino acids, provided that such sequence still is capable of providing any of the properties of LEs disclosed herein.
- the lymphoproliferative element, and in illustrative embodiments CLE is not covalently attached to a cytokine.
- a lymphoproliferative element, and in illustrative embodiments CLE comprises a cytokine polypeptide covaltently linked to its cognate receptor.
- the CLE can be constitutively active and typically constitutively activates the same Jak/STAT and/or TRAF pathways as the corresponding activated wild-type cytokine receptor.
- the chimeric cytokine receptor is an interleukin.
- the CLE is IL-7 covalently linked to IL7RA.
- the CLE is IL-15 covalently linked to IL15RA. In other embodiments, the CLE is other than IL-15 covalently linked to IL15RA. In other aspects, the CLE comprises a cytokine polypeptide covalently linked to only a portion of its cognate receptor that includes a functional portion of the extracellular domain capable of binding the cytokine polypeptide, the transmembrane domain and/or intracellular domain are from heterologous polypeptides, and the CLE is constitutively active. In one embodiment, the CLE is IL-7 covalently linked to the extracellular and transmembrane domains of IL7RA, and the intracellular domain from IL2RB.
- the CLE is a cytokine polypeptide covalently linked to a portion of its cognate receptor that includes a functional portion of the extracellular domain capable of binding the cytokine polypeptide, a heterologous transmembrane domain, and lymphoproliferative element intracellular domain provided herein
- Modifying and/or genetically modifying a cell such that it expresses a cytokine polypeptide in addition to its cognate receptor requires encoding the amino acid sequences for both in a polynucleotide that will be introduced into the cell.
- the length of the polynucleotide can be limited by the vector that is chosen, and it is sometimes advantageous to use constitutively lymphoproliferative elements that do not include both a cytokine and its cognate cytokine receptor tethered together such that the polynucleotide is shorter.
- the lymphoproliferative element is a cytokine receptor that is not tethered to a cytokine.
- the CLE is other than IL-15 covalently linked to IL15RA.
- the lymphoproliferative element is capable of binding to soluble cytoines or growth factors and such binding is required for activity.
- the lymphoproliferative element is constitutively active, and thus does not require binding to a soluble growth factor or cytokine for activity.
- constitutively active lymphoproliferative elements do not bind soluble cytokines or growth factors.
- the lymphoproliferative element is a chimera comprising an extracellular binding domain from one receptor and the intracellular signaling domain from a different receptor.
- the CLE is an inverted receptor that is activated upon binding of a ligand that would inhibit proliferation and/or survival when bound to its natural receptor, but instead leads to proliferation and/or survival upon activating the CLE.
- inverted receptors include chimeras that comprise an extracellular ligand binding domain from IL4Ra and an intracellular domain from IL7Ra or IL21.
- Other embodiments of inverted cytokine receptors include chimeras that comprise an extracellular ligand binding domain from a recptor that would inhibit proliferation and/or survival when bound to its natural ligand, such as receptors for IL-4, IL-10, IL-13, or TGFb, and any lymphoproliferative element intracellular domain disclosed herein.
- the lymphoproliferative element does not bind a cytokine. In further illustrative aspects, the lymphoproliferative element does not bind any ligand. In illustrative embodiments, the lymphoproliferative elements that do not bind any ligand are constitutively dimerized or otherwise multimerized, and are constitutively active.
- the intracellular domain can be derived from a portion of the protein IL7RA.
- the domains, motifs, and point mutations of IL7RA that induce proliferation and/or survival of T cells and/or NK cells are known in the art and a skilled artisan can identify corresponding domains, motifs, and point mutations in IL7RA polypeptides, some of which are discussed in this paragraph.
- the IL7RA protein has an S region rich in serine residues (359-394 of full-length IL7RA, corresponding to residues 96-133 of SEQ ID NO:248), a T region with three tyrosine residues (residues Y401, Y449, and Y456 of full-length IL7RA, corresponding to residues Y138, Y18, and Y193 of SEQ ID NO:248), and a Boxl motif that can bind the signaling kinase Jakl (residues 272-280 of full-length IL7RA corresponding to residues 9-17 of SEQ ID NOs:248 and 249) (Jiang, Qiong et al. Mol.
- a lymphoproliferative element herein can include one or more, for example ah of the domains and motifs of IL7RA disclosed herein or otherwise known to induce proliferation and/or survival of T cells and/or NK cells.
- a suitable intracellular domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or ah of the amino acids in SEQ ID NOs:248 or 249.
- the intracellular domain derived from IL7RA has a length of from about 30 aa to about 35 aa, from about 35 aa to about 40 aa, from about 40 aa to about 45 aa, from about 45 aa to about 50 aa, from about 50 aa to about 55 aa, from about 55 aa to about 60 aa, from about 60 aa to about 65 aa, from about 65 aa to about 70 aa, from about 70 aa to about 100 aa, from about 100 aa to about 125 aa, from about 125 aa to 150 aa, from about 150 to about 175 aa, or from about 175 aa to about 200 aa.
- the intracellular domain derived from IL7RA has a length of from about 30 aa to about 200 aa.
- the second intracellular domain can be derived from TNFRSF8.
- the intracellular domain can be derived from a portion of the protein IL12RB.
- the domains, motifs, and point mutations of IL12RB that induce proliferation and/or survival of T cells and/or NK cells are known in the art and a skilled artisan can identify corresponding domains, motifs, and point mutations in IL12RB polypeptides, some of which are discussed in this paragraph.
- IL12RB contains at least one Boxl motif PXXP (SEQ ID NO:306) where each X can be any amino acid (residues 10-12 of SEQ ID NOs:254 and 255; and residues 107-110 and 139-142 of SEQ ID NO:256) (Presky DH et al. Proc Natl Acad Sci U S A. 1996 Nov 26;93(24)).
- a lymphoproliferative element that includes an IL12RB intracellular domain can include one or more of the above Boxl motifs or other motifs, domains, or mutations of IL12RB known to induce proliferation and/or survival of T cells and/or NK cells.
- a suitable intracellular domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or ah of the amino acids in SEQ ID NOs:254-256.
- the intracellular domain derived from IL12RB has a length of from about 30 aa to about 35 aa, from about 35 aa to about 40 aa, from about 40 aa to about 45 aa, from about 45 aa to about 50 aa, from about 50 aa to about 55 aa, from about 55 aa to about 60 aa, from about 60 aa to about 65 aa, from about 65 aa to about 70 aa, from about 70 aa to about 100 aa, from about 100 aa to about 125 aa, from about 125 aa to 150 aa, from about 150 to about 175 aa, from about 175 aa to about 200 aa, or from about 200 aa to about 219 aa.
- the intracellular domain derived from IL12RB has a length of from about 30 aa to about 219 aa, for example, 30 aa to 92 aa, or 30 aa to 90 aa.
- the intracellular domain can be derived from a portion of the protein IL31RA.
- the domains, motifs, and point mutations of IL31RA that induce proliferation and/or survival of T cells and/or NK cells are known in the art and a skilled artisan can identify corresponding domains, motifs, and point mutations in IL31RA polypeptides, some of which are discussed in this paragraph.
- IL31RA contains the Boxl motif PXXP (SEQ ID NO:306) where each X can be any amino acid (corresponding to residues 12-15 of SEQ ID NOs:275 and 276) (Cornelissen C et al. Eur J Cell Biol. 2012 Jun-Jul;91(6-7):552-66).
- a lymphoproliferative element that includes an IL31RA intracellular domain can include the Boxl motif.
- Full-length IL31RA also contains three phosphorylatable tyrosine residues that are important for downstream signaling, Y652, Y683, and Y721 (corresponding to residues Y96, Y237, and Y165 of SEQ ID NO:275; these tyrosine residues are not present in SEQ ID NO:276) (Cornelissen C et al. Eur J Cell Biol. 2012 Jun-Jul;91(6-7):552-66). All three tyrosine residues contribute to the activation of STAT1, while Y652 is required for STAT5 activation and Y721 recruits STAT3.
- a lymphoproliferative element with an IL31RA intracellular domain includes the Boxl motif and/or the known phosphorylation sites disclosed herein.
- the Boxl motif and phosphorylatable tyrosines of IL31RA are known in the art and a skilled artisan will be able to identify corresponding motifs and phosphorylatable tyrosines in similar IL31RA polypeptides.
- a lymphoproliferative element with an IL31RA intracellular domain does not include the known phosphorylation sites disclosed herein.
- a suitable intracellular domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all of the amino acids in SEQ ID NOs:275 or 276.
- the intracellular domain derived from IL31RA has a length of from about 30 aa to about 35 aa, from about 35 aa to about 40 aa, from about 40 aa to about 45 aa, from about 45 aa to about 50 aa, from about 50 aa to about 55 aa, from about 55 aa to about 60 aa, from about 60 aa to about 65 aa, from about 65 aa to about 70 aa, from about 70 aa to about 100 aa, from about 100 aa to about 125 aa, from about 125 aa to 150 aa, from about 150 to about 175 aa, or from about 175 aa to about 189 aa.
- the intracellular domain derived from IL31RA has a length of from about 30 aa to about 200 aa, for example, 30 aa to 189 aa, 30 aa to 106 aa.
- the intracellular domain can be derived from an intracellular portion of the transmembrane protein of the TNF receptor family, CD40.
- the domains, motifs, and point mutations of CD40 that induce proliferation and/or survival of T cells and/or NK cells are known in the art and a skilled artisan can identify corresponding domains, motifs, and point mutations in CD40 polypeptides, some of which are discussed in this paragraph.
- the CD40 protein contains several binding sites for TRAF proteins.
- binding sites for TRAF1, TRAF2, and TRAF3 are located at the membrane distal domain of the intracellular portion of CD40 and include the amino acid sequence PXQXT (SEQ ID NO:303) where each X can be any amino acid, (corresponding to amino acids 35-39 of SEQ ID NO:208) (Elgueta et al. Immunol Rev. 2009 May; 229(1): 152-72).
- TRAF2 has also been shown to bind to the consensus sequence SXXE (SEQ ID NO:304) where each X can be any amino acid, (corresponding to amino acids 57-60 of SEQ ID NO:208) (Elgueta et al. Immunol Rev. 2009 May;
- a distinct binding site for TRAF6 is situated at the membrane proximal domain of intracellular portion of CD40 and includes the consensus sequence QXPXEX (SEQ ID NO:305) where each X can be any amino acid (corresponding to amino acids 16-21 of SEQ ID NO:208) (Lu et al. J Biol Chem. 2003 Nov 14; 278(46):45414-8).
- the intracellular portion of the transmembrane protein CD40 can include all the binding sites for the TRAF proteins.
- the TRAF binding sites are known in the art and a skilled artisan will be able to identify corresponding TRAF binding sites in similar CD40 polypeptides.
- a suitable intracellular domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all of the amino acids in SEQ ID NO:208 or SEQ ID NO:209.
- the intracellular domain derived from CD40 has a length of from about 30 amino acids (aa) to about 35 aa, from about 35 aa to about 40 aa, from about 40 aa to about 45 aa, from about 45 aa to about 50 aa, from about 50 aa to about 55 aa, from about 55 aa to about 60 aa, or from about 60 aa to about 65 aa.
- the intracellular domain derived from CD40 has a length of from about 30 aa to about 66 aa, for example, 30 aa to 65 aa, or 50 aa to 66 aa.
- the second intracellular domain can be other than an intracellular domain derived from MyD88, a CD28 family member (e.g. CD28, ICOS), Pattern Recognition Receptor, a C-reactive protein receptor (i.e., Nodi, Nod2, PtX3-R), a TNF receptor, CD40, RANK/TRANCE-R, 0X40, 4- IBB), an HSP receptor (Lox-1 and CD91), or CD28.
- a CD28 family member e.g. CD28, ICOS
- Pattern Recognition Receptor e., a C-reactive protein receptor (i.e., Nodi, Nod2, PtX3-R), a TNF receptor, CD40, RANK/TRANCE-R, 0X40, 4- IBB), an HSP receptor (Lox-1 and CD91), or CD28.
- Pattern Recognition Receptors include, but are not limited to endocytic pattern-recognition receptors (i.e., mannose receptors, scavenger receptors (i.e., Mac-1, LRP, peptidoglycan, techoic acids, toxins, CD1 1 c/CR4)); external signal pattern-recognition receptors (Toll like receptors (TLR1, TLR2, TLR3, TLR4, TLR5, TLR6, TLR7, TLR8, TLR9, TLR10), peptidoglycan recognition protein, (PGRPs bind bacterial peptidoglycan, and CD 14); internal signal pattern-recognition receptors (i.e., NOD-receptors 1 & 2), and RIG1.
- endocytic pattern-recognition receptors i.e., mannose receptors, scavenger receptors (i.e., Mac-1, LRP, peptidoglycan, techoic acids, toxins, CD1 1
- the intracellular domain can be derived from an intracellular portion of CD27.
- the domains, motifs, and point mutations of CD27 that induce proliferation and/or survival of T cells and/or NK cells are known in the art and a skilled artisan can identify corresponding domains, motifs, and point mutations in CD27 polypeptides, some of which are discussed in this paragraph.
- the serine at amino acid 219 of full-length CD27 (corresponding to the serine at amino acid 6 of SEQ ID NO:205) has been shown to be phosphorylated.
- a suitable intracellular domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all of the amino acids in SEQ ID NO:205.
- the intracellular domain derived from CD27 has a length of from about 30 amino acids (aa) to about 35 aa, from about 35 aa to about 40 aa, from about 40 aa to about 45 aa, or from about 45 aa to about 50 aa.
- the intracellular domain can be derived from an intracellular portion of CSF2RB.
- the domains, motifs, and point mutations of CSF2RB that induce proliferation and/or survival of T cells and/or NK cells are known in the art and a skilled artisan can identify corresponding domains, motifs, and point mutations in CSF2RB polypeptides, some of which are discussed in this paragraph.
- Full-length CSF2RB contains a Boxl motif at amino acids 474-482 (corresponding to amino acids 14-22 of SEQ ID NO:213).
- a suitable intracellular domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all of the amino acids in SEQ ID NO:213.
- the intracellular domain derived from CSF2RB has a length of from about 30 aa to about 35 aa, from about 35 aa to about 40 aa, from about 40 aa to about 45 aa, from about 45 aa to about 50 aa, from about 50 aa to about 55 aa, from about 55 aa to about 60 aa, from about 60 aa to about 65 aa, from about 65 aa to about 70 aa, from about 70 aa to about 100 aa, from about 100 aa to about 125 aa, from about 125 aa to 150 aa, from about 150 to about 175 aa, from about 175 aa to about 200 aa, from about 200 aa to about 250 aa, from about 250 aa to 300 aa, from about 300 aa to 350 aa, from about 350 aa to about 400 aa, or from about 400 aa to about 450 aa.
- the intracellular domain can be derived from an intracellular portion of IL2RB.
- the domains, motifs, and point mutations of IL2RB that induce proliferation and/or survival of T cells and/or NK cells are known in the art and a skilled artisan can identify corresponding domains, motifs, and point mutations in IL2RB polypeptides, some of which are discussed in this paragraph.
- Full- length IL2RB contains a Boxl motif at amino acids 278-286 (corresponding to amino acids 13-21 of SEQ ID NO:240).
- a suitable intracellular domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or ah of the amino acids in SEQ ID NO:240.
- the intracellular domain derived from IL2RB has a length of from about 30 aa to about 35 aa, from about 35 aa to about 40 aa, from about 40 aa to about 45 aa, from about 45 aa to about 50 aa, from about 50 aa to about 55 aa, from about 55 aa to about 60 aa, from about 60 aa to about 65 aa, from about 65 aa to about 70 aa, from about 70 aa to about 100 aa, from about 100 aa to about 125 aa, from about 125 aa to 150 aa, from about 150 to about 175 aa, from about 175 aa to about 200 aa, from about 200 aa to about 250 aa, or from about 250 aa to 300 aa.
- the intracellular domain can be derived from an intracellular portion of IL6ST.
- the domains, motifs, and point mutations of IL6ST that induce proliferation and/or survival of T cells and/or NK cells are known in the art and a skilled artisan can identify corresponding domains, motifs, and point mutations in IL6ST polypeptides, some of which are discussed in this paragraph.
- Full- length IL6ST contains a Boxl motif at amino acids 651-659 (corresponding to amino acids 10-18 of SEQ ID NO:247).
- a suitable intracellular domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all of the amino acids in SEQ ID NO:246 or SEQ ID NO:247.
- the intracellular domain derived from IL6ST has a length of from about 30 aa to about 35 aa, from about 35 aa to about 40 aa, from about 40 aa to about 45 aa, from about 45 aa to about 50 aa, from about 50 aa to about 55 aa, from about 55 aa to about 60 aa, from about 60 aa to about 65 aa, from about 65 aa to about 70 aa, from about 70 aa to about 100 aa, from about 100 aa to about 125 aa, from about 125 aa to 150 aa, from about 150 to about 175 aa, from about 175 aa to about 200 aa, from about 200 aa to about 250 aa, or from about 250 aa to 300 aa.
- the intracellular domain can be derived from an intracellular portion of IL17RE.
- the domains, motifs, and point mutations of IL17RE that induce proliferation and/or survival of T cells and/or NK cells are known in the art and a skilled artisan can identify corresponding domains, motifs, and point mutations in IL17RE polypeptides, some of which are discussed in this paragraph.
- Full- length IL17RE contains a TIR domain at amino acids 372-495 (corresponding to amino acids 13-136 of SEQ ID NO:265).
- a suitable intracellular domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or ah of the amino acids in SEQ ID NO:265.
- the intracellular domain derived from IL17RE has a length of from about 30 aa to about 35 aa, from about 35 aa to about 40 aa, from about 40 aa to about 45 aa, from about 45 aa to about 50 aa, from about 50 aa to about 55 aa, from about 55 aa to about 60 aa, from about 60 aa to about 65 aa, from about 65 aa to about 70 aa, from about 70 aa to about 100 aa, from about 100 aa to about 125 aa, from about 125 aa to 150 aa, from about 150 to about 175 aa, or from about 175 aa to about 200 aa.
- the intracellular domain can be derived from an intracellular portion of IL2RG.
- the domains, motifs, and point mutations of IL2RG that induce proliferation and/or survival of T cells and/or NK cells are known in the art and a skilled artisan can identify corresponding domains, motifs, and point mutations in IL2RG polypeptides, some of which are discussed in this paragraph.
- Full- length IL2RG contains a Boxl motif at amino acids 286-294 (corresponding to amino acids 3-11 of SEQ ID NO:241).
- a suitable intracellular domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all of the amino acids in SEQ ID NO:241.
- the intracellular domain derived from IL2RG has a length of from about 30 aa to about 35 aa, from about 35 aa to about 40 aa, from about 40 aa to about 45 aa, from about 45 aa to about 50 aa, from about 50 aa to about 55 aa, from about 55 aa to about 60 aa, from about 60 aa to about 65 aa, from about 65 aa to about 70 aa, or from about 70 aa to about 100 aa.
- the intracellular domain can be derived from an intracellular portion of IL18R1.
- the domains, motifs, and point mutations of IL18R1 that induce proliferation and/or survival of T cells and/or NK cells are known in the art and a skilled artisan can identify corresponding domains, motifs, and point mutations in IL18R1 polypeptides, some of which are discussed in this paragraph.
- Full- length IL18R1 contains a TIR domain at amino acids 222-364 (corresponding to amino acids 28-170 of SEQ ID NO:266).
- a suitable intracellular domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all of the amino acids in SEQ ID NO:266.
- the intracellular domain derived from IL18R1 has a length of from about 30 aa to about 35 aa, from about 35 aa to about 40 aa, from about 40 aa to about 45 aa, from about 45 aa to about 50 aa, from about 50 aa to about 55 aa, from about 55 aa to about 60 aa, from about 60 aa to about 65 aa, from about 65 aa to about 70 aa, or from about 70 aa to about 100 aa.
- the intracellular domain can be derived from an intracellular portion of IL27RA.
- the domains, motifs, and point mutations of IL27RA that induce proliferation and/or survival of T cells and/or NK cells are known in the art and a skilled artisan can identify corresponding domains, motifs, and point mutations in IL27RA polypeptides, some of which are discussed in this paragraph.
- Full- length IL27RA contains a Boxl motif at amino acids 554-562 (corresponding to amino acids 17-25 of SEQ ID NO:273).
- a suitable intracellular domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all of the amino acids in SEQ ID NO:273 or SEQ ID NO:274.
- the intracellular domain derived from IL27RA has a length of from about 30 aa to about 35 aa, from about 35 aa to about 40 aa, from about 40 aa to about 45 aa, from about 45 aa to about 50 aa, from about 50 aa to about 55 aa, from about 55 aa to about 60 aa, from about 60 aa to about 65 aa, from about 65 aa to about 70 aa, or from about 70 aa to about 100 aa.
- the intracellular domain can be derived from an intracellular portion of IFNGR2.
- the domains, motifs, and point mutations of IFNGR2 that induce proliferation and/or survival of T cells and/or NK cells are known in the art and a skilled artisan can identify corresponding domains, motifs, and point mutations in IFNGR2 polypeptides, some of which are discussed in this paragraph.
- Full- length IFNGR2 contains a dileucine internalization motif at amino acids 276-277 (corresponding to amino acids 8-9 of SEQ ID NO:230).
- a suitable intracellular domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all of the amino acids in SEQ ID NO:230.
- the intracellular domain derived from IFNGR2 has a length of from about 30 aa to about 35 aa, from about 35 aa to about 40 aa, from about 40 aa to about 45 aa, from about 45 aa to about 50 aa, from about 50 aa to about 55 aa, from about 55 aa to about 60 aa, from about 60 aa to about 65 aa, or from about 65 aa to about 70 aa.
- the intracellular domain can be derived from a portion of the protein MyD88.
- the domains, motifs, and point mutations of MyD88 that induce proliferation and/or survival of T cells and/or NK cells are known in the art and a skilled artisan can identify corresponding domains, motifs, and point mutations in MyD88 polypeptides, some of which are discussed in this paragraph.
- the MyD88 protein has an N-terminal death domain that mediates interactions with other death domain- containing proteins (corresponding to amino acids 29-106 of SEQ ID NO:284), an intermediate domain that interacts with IL-1R associated kinase (corresponding to amino acids 107-156 of SEQ ID NO:284), and a C-terminal TIR domain (corresponding to amino acids 160-304 of SEQ ID NO:284) that associates with the TLR-TIR domain (Biol Res. 2007; 40(2): 97- 112).
- MyD88 also has canonical nuclear localization and export motifs.
- Point mutations have been identified in MyD88 and include the loss-of-function mutations L93P and R193C (corresponding to L93P and R196C in SEQ ID NO:284), and the gain-of- function mutation L265P (corresponding to L260P in SEQ ID NO:284) (Deguine and Barton.
- a lymphoproliferative element herein can include one or more, for example ah of the domains and motifs of MyD88 disclosed herein.
- a suitable intracellular domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or ah of the amino acids in SEQ ID NO:284-293, and in illustrative embodiments includes one or more, in illustrative embodiments ah, of the following MyD88 domains/motifs: the death domain, the intermediate domain, the TIR domain, the nuclear localization and export motifs, an amino acid corresponding to position L93, R193, and L265 or P265.
- the intracellular domain derived from MyD88 has a length of from about 30 aa to about 35 aa, from about 35 aa to about 40 aa, from about 40 aa to about 45 aa, from about 45 aa to about 50 aa, from about 50 aa to about 55 aa, from about 55 aa to about 60 aa, from about 60 aa to about 65 aa, from about 65 aa to about 70 aa, from about 70 aa to about 100 aa, from about 100 aa to about 125 aa, from about 125 aa to 150 aa, from about 150 to about 175 aa, from about 175 aa to about 200 aa, from about 200 aa to about 250 aa, from about 250 aa to 300 aa, or from about 300 aa to 350 aa.
- the intracellular domain derived from MyD88 has a length of from about 30 aa to about 350 aa, for example, 50 aa to 350 aa, or 100 aa to 350 aa, 100 aa to 304 aa, 100 aa to 296 aa, 100 aa to 251 aa, 100 aa to 191 aa, 100 aa to 172 aa, 100 aa to 146 aa, or 100 aa to 127 aa.
- the second intracellular domain can be derived from TNFRSF4 or TNFRSF8.
- the second intracellular domain can be other than an intracellular domain derived from a CD28 family member (e.g. CD28, ICOS), Pattern Recognition Receptor, a C-reactive protein receptor (i.e., Nodi, Nod2, PtX3-R), a TNF receptor (i.e., CD40, RANK/TRANCE-R, 0X40, 4-1BB), an HSP receptor (Lox-1 and CD91), or CD28.
- a CD28 family member e.g. CD28, ICOS
- Pattern Recognition Receptor e.e., a C-reactive protein receptor (i.e., Nodi, Nod2, PtX3-R), a TNF receptor (i.e., CD40, RANK/TRANCE-R, 0X40, 4-1BB), an HSP receptor (Lox-1 and CD91), or CD28.
- CD28 family member e.g. CD28, ICOS
- Pattern Recognition Receptor e.
- the intracellular domain can be derived from a portion of the transmembrane protein MPL.
- the lymphoproliferative element comprises MPL, or is MPL, or a variant and/or fragment thereof, including a variant and/or fragment that includes at least 75, 80, 85, 90, 95, 96, 97, 98, 99, or 100% of the intracellular domain of MPL, with or without a transmembrane and/or extracellular domain of MPL, wherein the variant and/or fragment retains the ability to promote cell proliferation of PBMCs, and in some embodiments T cells.
- a cell expressing the lymphoproliferative element comprising an intracellular and transmembrane domain of MPL can be contacted with, exposed to, or treated with eltrombopag.
- eltrombopag binds to the transmembrane domain of MPL and induces the activation of the intracellular domain of MPL.
- an MPL fragment included in the compositions and methods herein has and/or retains a JAK-2 binding domain.
- an MPL fragment included herein has or retains the ability to activate a STAT.
- the full intracellular domain of MPL is SEQ ID NO:283 (part S186 as illustrated in WO2019/055946).
- MPL is the receptor for thrombopoietin.
- cytokines such as thrombopoietin and EPO are referred to in the literature and herein as either a hormone or a cytokine [0423]
- the domains, motifs, and point mutations of MPL that induce proliferation and/or survival of T cells and/or NK cells are known in the art and a skilled artisan can identify corresponding domains, motifs, and point mutations in MPL polypeptides, some of which are discussed in this paragraph.
- the transmembrane MPL protein contains the Boxl motif PXXP (SEQ ID NO:306) where each X can be any amino acid (corresponding to amino acids 17-20 in SEQ ID NO:283) and the Box2 motif, a region with increased serine and glutamic acid content (corresponding to amino acids 46-64 in SEQ ID NO:283) (Drachman and Kaushansky. Proc Natl Acad Sci U S A. 1997 Mar 18; 94(6):2350-5).
- the Boxl and Box2 motifs are involved in binding to JAKs and signal transduction, although the Box2 motif presence is not always required for a proliferative signal (Murakami et al. Proc Natl Acad Sci U S A.
- cytokine receptors have hydrophobic residues at positions -1, -2, and -6 relative to the Boxl motif (corresponding to amino acids 16, 15, and 11, respectively, of SEQ ID NO:283), that form a “switch motif,” which is required for cytokine-induced JAK2 activation but not for JAK2 binding (Constantinescu et al. Mol Cell. 2001 Feb; 7(2):377-85; and Huang et al. Mol Cell.
- a MPL intracellular signaling domain does not comprise the region comprising amino acids 70-95 in SEQ ID NO:283.
- the lysines K553 corresponding to K40 of SEQ ID NO: 283
- K573 corresponding to K60 of SEQ ID NO: 283
- a MPL intracellular signaling domain does not comprise these ubiquitination targeting motif residues.
- the tyrosines Y521 (corresponding to Y8 of SEQ ID NO: 283), Y542 (corresponding to Y29 of SEQ ID NO:283), Y591 (corresponding to Y78 of SEQ ID NO: 283), Y626 (corresponding to Y113 of SEQ ID NO: 283), and Y631 (corresponding to Y118 of SEQ ID NO: 283) have been shown to be phosphorylated (Varghese et al. Front Endocrinol (Lausanne). 2017 Mar 31; 8:59).
- Y521 and Y591 of full-length MPL are negative regulatory sites that function either as part of a lysosomal targeting motif (Y521) or via an interaction with adaptor protein AP2 (Y591) (Drachman and Kaushansky. Proc Natl Acad Sci U S A. 1997 Mar 18; 94(6):2350-5; and Hitchcock et al. Blood. 2008 Sep 15; 112(6):2222-31).
- Y626 and Y631 of full-length MPL are positive regulatory sites (Drachman and Kaushansky. Proc Natl Acad Sci U S A.
- MPL contains the She phosphotyrosine-binding binding motif NXXY (SEQ ID NO:307) where each X can be any amino acid (corresponding to amino acids 110-113 of SEQ ID NO: 283), and this tyrosine is phosphorylated and important for the TPO-dependent phosphorylation of She, SHIP, and STAT3 (Laminet et al. J Biol Chem. 1996 Jan 5; 271(l):264-9; and van der Geer et al. Proc Natl Acad Sci U S A. 1996 Feb 6; 93(3):963-8).
- MPL also contains the STAT3 consensus binding sequence YXXQ (SEQ ID NO:308) where each X can be any amino acid (corresponding to amino acids 118-121 of SEQ ID NO: 283) (Stahl et al. Science. 1995 Mar 3;
- MPL contains the sequence YLPL (SEQ ID NO: 309) (corresponding to amino acid 113-116 of SEQ ID NO: 283), which is similar to the consensus binding site for STAT5 recruitment pYLXL (SEQ ID NOG 10) where pY is phosphotyrosine and X can be any amino acid (March et al. FEBS Lett. 1996 Sep 30; 394(2):221-6).
- YLPL SEQ ID NO: 309
- pYLXL SEQ ID NOG 10
- the intracellular portion of MPL can include one or more, or all the domains and motifs described herein that are present in SEQ ID NO: 283.
- a transmembrane portion of MPL can include one or more, or all the domains and motifs described herein that are present in SEQ ID NO: 187.
- the domains, motifs, and point mutations of MPL provided herein are known in the art and a skilled artisan would recognize that MPL intracellular signaling domains herein in illustrative embodiments would include one or more corresponding domains, motifs, and point mutations in that have been shown to promote proliferative activity and would not include that that have been shown to inhibit MPLs proliferative activity.
- a suitable intracellular domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all of the amino acids in SEQ ID NO:283.
- the intracellular domain derived from MPL has a length of from about 30 aa to about 35 aa, from about 35 aa to about 40 aa, from about 40 aa to about 45 aa, from about 45 aa to about 50 aa, from about 50 aa to about 55 aa, from about 55 aa to about 60 aa, from about 60 aa to about 65 aa, from about 65 aa to about 70 aa, from about 70 aa to about 100 aa, from about 100 aa to about 125 aa, from about 125 aa to 150 aa, from about 150 to about 175 aa, from about 175 aa to about 200 aa, from about 200 aa to about 250 aa, from about 250 aa to 300 aa, from about 300 aa to 350 aa, from about 350 aa to about 400 aa, from about 400 aa to about 450 aa, from about
- the intracellular domain derived from MPL has a length of from about 30 aa to about 200 aa, for example, 30 aa to 150 aa, 30 aa to 119 aa, 30 aa to 121 aa, 30 aa to 122 aa, or 50 aa to 125 aa.
- the second intracellular domain can be derived from CD79B.
- the intracellular domain can be derived from a portion of the transmembrane protein CD79B, also known as B29; IGB; AGM6.
- CD79B contains an IT AM motif at residues 193-212 (corresponding to amino acids 16-30 of SEQ ID NO:211).
- CD79B has two tyrosines that are known to be phosphorylated, Y196 and Y207 (corresponding to Y16 and Y27 of SEQ ID NO: 211).
- the intracellular portion of the transmembrane protein CD79B includes the IT AM motif and/or the known phosphorylation sites disclosed herein.
- the motif and phosphorylatable tyrosines of CD79B are known in the art and a skilled artisan will be able to identify corresponding motifs and phosphorylatable tyrosines in similar CD79B polypeptides.
- a suitable intracellular domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all of the amino acids in SEQ ID NO: 211.
- the intracellular domain derived from CD79B has a length of from about 30 aa to about 35 aa, from about 35 aa to about 40 aa, from about 40 aa to about 45 aa, or from about 45 aa to about 50 aa.).
- the intracellular domain derived from CD79B has a length of from about 30 aa to about 50 aa.
- a suitable CD79B intracellular activating domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all amino acids of the following sequence: LDKDDSKAGMEEDHT[YEGLDIDQTATYEDI]VTLRTGEVKWSVGEHPGQE (SEQ ID NO: 211), where the IT AM motif is set out in brackets.
- the first intracellular domain can be derived from CSF3R.
- the intracellular domain can be derived from a portion of the transmembrane protein OSMR.
- OSMR transmembrane protein
- the domains, motifs, and point mutations of OSMR that induce proliferation and/or survival of T cells and/or NK cells are known in the art and a skilled artisan can identify corresponding domains, motifs, and point mutations in OSMR polypeptides, some of which are discussed in this paragraph.
- OSMR contains a Boxl motif at amino acids 771-779 of isoform 3 (corresponding to amino acids 16-30 of SEQ ID NO:294).
- OSMR has two serines at amino acids 829 and 890 of isoform 3 that are known to be phosphorylated (serines at amino acids 65 and 128 of SEQ ID NO:294).
- the intracellular portion of the protein OSMR can include the Boxl motif and the known phosphorylation sites disclosed herein.
- the motif and phosphorylatable serines of OSMR are known in the art and a skilled artisan will be able to identify corresponding motifs and phosphorylatable serines in similar OSMR polypeptides.
- a suitable intracellular domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all of the amino acids in SEQ ID NO:294.
- the intracellular domain derived from OSMR has a length of from about 30 aa to about 35 aa, from about 35 aa to about 40 aa, from about 40 aa to about 45 aa, from about 45 aa to about 50 aa., from about 50 aa to about 55 aa, from about 55 aa to about 60 aa, from about 60 aa to about 65 aa, from about 65 aa to about 70 aa, from about 70 aa to about 100 aa, from about 100 aa to about 125 aa, from about 125 aa to 150 aa, from about 150 to about 175 aa, from about 175 aa to about 200 aa, or from about 200 aa to about 250 aa.
- the intracellular domain can be derived from a portion of the transmembrane protein PRLR.
- PRLR contains a growth hormone receptor binding domain at amino acids 185-261 of isoform 6 (corresponding to amino acids 28-104 of SEQ ID NO:295).
- a suitable intracellular domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all of the amino acids in SEQ ID NO:295.
- the intracellular domain derived from PRLR has a length of from about 30 aa to about 35 aa, from about 35 aa to about 40 aa, from about 40 aa to about 45 aa, from about 45 aa to about 50 aa, from about 50 aa to about 55 aa, from about 55 aa to about 60 aa, from about 60 aa to about 65 aa, from about 65 aa to about 70 aa, from about 70 aa to about 100 aa, from about 100 aa to about 125 aa, from about 125 aa to 150 aa, from about 150 to about 175 aa, from about 175 aa to about 200 aa, from about 200 aa to about 250 aa, from about 250 aa to 300 aa, from about 300 aa to 350 aa, or from about 350 aa to about 400 aa.
- an intracellular domain of a lymphoproliferative element is derived from an intracellular portion of the transmembrane protein CD30 (also known as TNFRSF8, D1S166E, and Ki ll ⁇
- the intracellular domain can be derived from a portion of the protein CD28.
- the domains, motifs, and point mutations of CD28 that induce proliferation and/or survival of T cells and/or NK cells are known in the art and a skilled artisan can identify corresponding domains, motifs, and point mutations in CD28 polypeptides, some of which are discussed in this paragraph.
- Full- length CD28 contains a PI3-K- and Grb2-binding motif that corresponds to residues 12-15 of SEQ ID NOs:206 and 207 (Harada et al. J Exp Med. 2003 Jan 20;197(2):257-62).
- a lymphoproliferative element that includes a CD28 intracellular domain can include the PI3-K- and Grb2- binding motif.
- a suitable intracellular domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or ah of the amino acids in SEQ ID NOs:206 or 207.
- the intracellular domain derived from CD28 has a length of from about 5 aa to about 10 aa, from about 10 aa to about 15 aa, from about 15 aa to about 20 aa, from about 20 aa to about 25 aa, from about 25 aa to about 30 aa, from about 30 aa to about 35 aa, or from about 35 aa to about 42 aa.
- the intracellular domain can be derived from a portion of the protein ICOS.
- the domains, motifs, and point mutations of ICOS that induce proliferation and/or survival of T cells and/or NK cells are known in the art and a skilled artisan can identify corresponding domains, motifs, and point mutations in ICOS polypeptides, some of which are discussed in this paragraph.
- ICOS binds PI3-K and not Grb2.
- the PI3-K-binding motif of full-length ICOS corresponds to residues 19-22 of SEQ ID NO:225.
- a single amino acid substitution in this motif can lead to Grb2 binding by ICOS and increased IL-2 production (Harada et al. J Exp Med. 2003 Jan 20;197(2):257-62).
- This mutation corresponds to mutating phenylalanine 21 of SEQ ID NO:225 to an asparagine.
- a skilled artisan will understand how to mutate this residue in SEQ ID NO:225 and generate an ICOS intracellular domain that binds Grb2 in addition to PI3-K.
- a lymphoproliferative element that includes an ICOS intracellular domain can include the PI3-K-binding motif.
- a lymphoproliferative element that includes an ICOS intracellular domain can include the PI3-K-binding motif that has been mutated to additionally bind Grb2.
- ICOS also contains a membrane proximal motif in the cytoplasmic tail that is essential for ICOS-assisted calcium signaling (Leconte et al. Mol Immunol. 2016 Nov; 79:38-46). This calcium signaling-motif corresponds to residues 5-8 of SEQ ID NO:225.
- a lymphoproliferative element that includes an ICOS intracellular domain can include the calcium-signaling motif. Two other conserved motifs have been identified in full-length ICOS.
- a lymphoproliferative element that includes an ICOS intracellular domain can include at least one of the first or second conserved motifs.
- a lymphoproliferative element that includes an ICOS intracellular domain does not include the first conserved motif, does not include the second conserved motif, or does not include the first and second conserved motifs.
- a suitable intracellular domain can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all of the amino acids in SEQ ID NO: 225.
- the intracellular domain derived from ICOS has a length of from about 5 aa to about 10 aa, from about 10 aa to about 15 aa, from about 15 aa to about 20 aa, from about 20 aa to about 25 aa, from about 25 aa to about 30 aa, from about 30 aa to about 35 aa, or from about 35 aa to about 38 aa.
- an intracellular domain of a chimeric lymphoproliferative element is derived from an intracellular portion of the transmembrane protein 0X40 (also known as TNFRSF4, RP5-902P8.3, ACT35, CD134, OX-40, TXGP1L).
- 0X40 also known as TNFRSF4, RP5-902P8.3, ACT35, CD134, OX-40, TXGP1L.
- the domains, motifs, and point mutations of 0X40 that induce proliferation and/or survival of T cells and/or NK cells are known in the art and a skilled artisan can identify corresponding domains, motifs, and point mutations in 0X40 polypeptides, some of which are discussed in this paragraph.
- 0X40 contains a TRAF binding motif at residues 256-263 of full- length 0X40 (corresponding to residues 20-27 of SEQ ID NO:296) that are important for binding TRAF1, TRAF2, TRAF3, and TRAF5 (Kawamata, S, et al. J Biol Chem. 1998 Mar 6;273(10):5808-14; Hori, T. Int J Hematol. 2006 Jan;83(l): 17-22).
- Full-length 0X40 also contains a p85 PI3K binding motif at residues 34-57.
- 0X40 when 0X40 is present as an intracellular domain of a lymphoproliferative element, it includes the p85 PI3K binding motif of 0X40.
- an intracellular domain of 0X40 can include the TRAF binding motif of 0X40. In some embodiments, an intracellular domain of 0X40 can bind TRAF1, TRAF2, TRAF3, and TRAF5. Lysines corresponding to amino acids 17 and 41 of SEQ ID NO: 296 are potentially negative regulatory sites that function as parts of ubiquitin targeting motifs. In some embodiments, one or both of these lysines in the intracellular domain of 0X40 are mutated arginines or another amino acid.
- a suitable intracellular domain of a lymphoproliferative element can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all of the amino acids in SEQ ID NO:57.
- the intracellular domain of 0X40 has a length of from about 20 aa to about 25 aa, about 25 aa to about 30 aa, 30 aa to about 35 aa, from about 35 aa to about 40 aa, from about 40 aa to about 45 aa, or from about 45 aa to about 50 aa.
- the intracellular domain of 0X40 has a length of from about 20 aa to about 50 aa, for example 20 aa to 45 aa, or 20 aa to 42 aa.
- an intracellular domain of a chimeric lymphoproliferative element is derived from an intracellular portion of the transmembrane protein IFNAR2.
- the domains, motifs, and point mutations of IFNAR2 that induce proliferation and/or survival of T cells and/or NK cells are known in the art and a skilled artisan can identify corresponding domains, motifs, and point mutations in IFNAR2 polypeptides, some of which are discussed in this paragraph.
- Full-length IFNAR2 contains a Boxl motif and two Box2 motifs (known as Box2A and Box2B). (Usacheva A et al. J Biol Chem. 2002 Dec 13;277(50):48220-6).
- a lymphoproliferative element that includes a IFNAR2 intracellular domain can include one or more of the Boxl or Box2 motifs.
- the IFNAR2 intracellular domain can include one or more of the Boxl, Box2A, or Box2B motifs.
- IFNAR2 contains a JAKl-binding site (Gauzzi MC et al. Proc Natl Acad Sci U S A. 1997 Oct 28;94(22):11839-44; Schindler et al. J Biol Chem. 2007 Jul 13;282(28):20059-63).
- a lymphoproliferative element that includes a IFNAR2 intracellular domain can include the JAKl-binding site.
- a suitable intracellular domain of a lymphoproliferative element can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all of the amino acids in SEQ ID NOs:227 or 228.
- the intracellular domain of IFNAR2 has a length of from about 30 aa to about 35 aa, from about 35 aa to about 40 aa, from about 40 aa to about 45 aa, from about 45 aa to about 50 aa, from about 50 aa to about 55 aa, from about 55 aa to about 60 aa, from about 60 aa to about 65 aa, from about 65 aa to about 70 aa, from about 70 aa to about 100 aa, from about 100 aa to about 125 aa, from about 125 aa to 150 aa, from about 150 to about 175 aa, from about 175 aa to about 200 aa, or from about 200 aa to about 251 aa.
- the intracellular domain of 0X40 has a length of from about 30 aa to about 251 aa, for example 30 aa to 67 aa.
- an intracellular domain of a chimeric lymphoproliferative element is derived from an intracellular portion of the transmembrane protein CSF3R.
- the domains, motifs, and point mutations of CSF3R that induce proliferation and/or survival of T cells and/or NK cells are known in the art and a skilled artisan can identify corresponding domains, motifs, and point mutations in CSF3R polypeptides, some of which are discussed in this paragraph.
- Full-length CSF3R contains a Boxl and Box2 motif as well as a Box3 motif (Nguyen-Jackson HT et al. G-CSF Receptor Structure, Function, and Intracellular Signal Transduction.
- a lymphoproliferative element that includes a CSF3R intracellular domain can include one or more of the Boxl, Box2, or Box3 motifs.
- CSF3R contains four tyrosine residues, Y704, Y729, Y744, and Y764 in full-length CSF3R, that are important for binding STAT3 (Y704 and Y744), SOCS3 (Y729), and Grb2 and p21Ras (Y764).
- a lymphoproliferative element that includes a CSF3R intracellular domain can include one, two, three, or all of the tyrosine residues corresponding to Y704, Y729, Y744, and Y764 of full-length CSF3R.
- CSF3R contains two threonine residues, T615 and T618 in full-length CSF3R, that can increase receptor dimerization and activity when mutated to alanine and isoleucine, respectively (T615A and T618I) (Maxson et al. J Biol Chem. 2014 Feb 28;289(9):5820-7).
- a lymphoproliferative element that includes a CSF3R intracellular domain can include one or more of the mutations corresponding to T615A and T618I.
- a suitable intracellular domain of a lymphoproliferative element can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all of the amino acids in SEQ ID NOs:216, 217, or 218.
- the intracellular domain of CSF3R has a length of from about 30 aa to about 35 aa, from about 35 aa to about 40 aa, from about 40 aa to about 45 aa, from about 45 aa to about 50 aa, from about 50 aa to about 55 aa, from about 55 aa to about 60 aa, from about 60 aa to about 65 aa, from about 65 aa to about 70 aa, from about 70 aa to about 100 aa, from about 100 aa to about 125 aa, from about 125 aa to 150 aa, from about 150 to about 175 aa, from about 175 aa to about 200 aa, or from about 200 aa to about 213 aa.
- the intracellular domain of CSF3R has a length of from about 30 aa to about 213 aa, for example from about 30 aa to about 186 or from about 30 aa to about 133 aa.
- an intracellular domain of a chimeric lymphoproliferative element is derived from an intracellular portion of the transmembrane protein EPOR.
- the domains, motifs, and point mutations of EPOR that induce proliferation and/or survival of T cells and/or NK cells are known in the art and a skilled artisan can identify corresponding domains, motifs, and point mutations in EPOR polypeptides, some of which are discussed in this paragraph.
- EPOR contains a Boxl (residues 257-264 of full-length EPOR) and Box2 (residues 303-313 of full-length EPOR) motif (Constantinescu SN. Trends Endocrinol Metab.
- a lymphoproliferative element that includes an EPOR intracellular domain can include one or more of the Boxl, Box2, or extended Box2 motifs.
- EPOR also contains a short segment important for EPOR internalization (residues 267-276 of full-length EPOR).
- a lymphoproliferative element that includes an EPOR intracellular domain does not include the internalization segment.
- a suitable intracellular domain of a lymphoproliferative element can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all of the amino acids in SEQ ID NOs:219 or 220.
- the intracellular domain of EPOR has a length of from about 30 aa to about 35 aa, from about 35 aa to about 40 aa, from about 40 aa to about 45 aa, from about 45 aa to about 50 aa, from about 50 aa to about 55 aa, from about 55 aa to about 60 aa, from about 60 aa to about 65 aa, from about 65 aa to about 70 aa, from about 70 aa to about 100 aa, from about 100 aa to about 125 aa, from about 125 aa to 150 aa, from about 150 to about 175 aa, from about 175 aa to about 200 aa, or from about 200 aa to about 235 aa.
- the intracellular domain of EPOR has a length of from about 30 aa to about 235 aa.
- an intracellular domain of a chimeric lymphoproliferative element is derived from an intracellular portion of the transmembrane protein CD3G.
- the domains, motifs, and point mutations of CD3G that induce proliferation and/or survival of T cells and/or NK cells are known in the art and a skilled artisan can identify corresponding domains, motifs, and point mutations in CD3G polypeptides, some of which are discussed in this paragraph.
- Two serine residues, S123 and S126 of full- length CD3G have been shown to be phosphorylated in T cells in response to ionomycin (Davies et al. J Biol Chem. 1987 Aug 15;262(23):10918-21).
- a lymphoproliferative element that includes a CD3G intracellular domain can include one or more of the serine residues corresponding to full-length S123 and S126. Furthermore, phosphorylation at S126 but not S123 was shown to be required for PKC-mediated down-regulation (Dietrich J et al. EMBO J. 1994 May 1;13(9):2156- 66). In some embodiments, a lymphoproliferative element that includes a CD3G intracellular domain can include the serine residue corresponding to full-length SI 23 and not include serine residue corresponding to full-length S126.
- a lymphoproliferative element that includes a CD3G intracellular domain can include a non-phosphorylatable amino acid substitution at the serine residue corresponding to full-length S126.
- the amino acid substitution can be a serine to alanine mutation.
- leucine to alanine mutations of either leucine of a di-leucine motif can include a non-phosphorylatable amino acid substitution at the serine residue corresponding to full-length S126.
- a lymphoproliferative element that includes a CD3G intracellular domain can include at least one amino acid substitution at the leucine residues corresponding to LI 31 or LI 32 of full-length CD3G.
- the amino acid substitution can be a leucine to alanine mutation.
- a suitable intracellular domain of a lymphoproliferative element can include a domain with at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a stretch of at least 10, 15, 20, or all of the amino acids in SEQ ID NO: 199.
- the intracellular domain of CD3G has a length of from about 20 aa to about 25 aa, from about 25 aa to about 30 aa, from about 30 aa to about 35 aa, from about 35 aa to about 40 aa, or from about 40 aa to about 45 aa.
- the intracellular domain of CD3D has a length of from about 30 aa to about 45 aa.
- TNFRs TNF receptors
- TNFRSF4 TNF receptor-associated factors
- DD death domain
- the domains, motifs, and point mutations of TNFRs that induce proliferation and/or survival of T cells and/or NK cells are known in the art and a skilled artisan can identify corresponding domains, motifs, and point mutations in TNFR polypeptides, some of which are discussed in this paragraph.
- TRAFs TNF receptor-associated factors
- DD death domain
- the domains, motifs, and point mutations of TNFRs that induce proliferation and/or survival of T cells and/or NK cells are known in the art and a skilled artisan can identify corresponding domains, motifs, and point mutations in TNFR polypeptides, some of which are discussed in this paragraph.
- mammals there are at least six TRAF molecules and a number of nonreceptor DD molecules.
- TRAF-binding motif is a roughly 60 amino acid globular bundle of 6 conserved a-helices that is also known in the art (Focksley RM et al. Cell. 2001 Feb 23;104(4):487-501).
- a skilled artisan will be able to identify the TRAF- and/or DD-binding motif in the different TNFR families using, for example, sequence alignments to known binding motifs.
- TNFRs can recruit TRADD and TRAF2, resulting in the activation of NF-KB, MAPK, and JNK (Sedger and McDermott. Cytokine Growth Factor Rev. 2014 Aug;25(4):453-72).
- a lymphoproliferative element that includes a TNFR intracellular domain can include one or more TRAF-binding motifs.
- a lymphoproliferative element that includes a TNFR intracellular domain does not include a DD-binding motif, or has one or more DD-binding motifs deleted or mutated within the intracellular domain.
- a lymphoproliferative element that includes a TNFR intracellular domain can recruit TRADD and/or TRAF2.
- TNFRs also include cysteine -rich domains (CRDs) that are important for ligand binding (Focksley RM et al. Cell. 2001 Feb 23;104(4):487-501).
- CRDs cysteine -rich domains
- a lymphoproliferative element that includes a TNFR intracellular domain does not include a TNFR CRD.
- Fymphoproliferative elements and CFEs that can be included in any of the aspects disclosed herein can be any of the FEs or CFEs disclosed in WO2019/055946.
- CLEs were disclosed therein that promoted proliferation in cell culture of PBMCs that were transduced with lentiviral particles encoding the CFEs between day 7 and day 21, 28, 35 and/or 42 after transduction.
- CFEs were identified therein, that promoted proliferation in vivo in mice in the presence or absence of an antigen recognized by a CAR, wherein T cells expressing one of the CLEs and the CAR were introduced into the mice.
- tests and/or criteria can be used to identify whether any test polypeptide, including LEs, or test domains of an LE, such as a first intracellular domain, or a second intracellular domain, or both a first and second intracellular domain, are indeed LEs or effective intracellular domains of LEs, or especially effective LEs or intracellular domains of LEs.
- any aspect or other embodiment provided herein that includes an LE or a polynucleotide or nucleic acid encoding an LE can recite that the LE meets, or provides the property of, or is capable of providing and/or possesses the property of, any one or more of the identified tests or criteria for identifying an LE provided herein, or that a cell genetically modified, transduced, and/or stably transfected with a recombinant nucleic acid vector, such as a cell that is transduced with a lentiviral particle encoding the LE, is capable of providing, is adapted for, possesses the property of, and/or is modified for achieving the results of one or more of the recited tests.
- the LE provides, is capable of providing and/or possesses the property of, (or a cell genetically modified and/or transduced with a retroviral particle encoding the LE is capable of providing, is adapted for, possesses the property of, and/or is modified for) improved expansion to pre-activated PBMCs transduced with a lentivirus comprising a nucleic acid encoding the LE and an anti-CD 19 CAR comprising a CD3 zeta intracellular activating domain but no co-stimulatory domain, between day 7 and day 21, 28, 35, and/or 42 of in vitro culturing post-transduction in the absence of exogenously added cytokines, compared to a control retroviral particle, e.g.
- a lymphoproliferative element test for improved or enhanced survival, expansion, and/or proliferation of cells transduced with a retroviral particle e.g. lentiviral particle
- a retroviral particle e.g. lentiviral particle
- test cells can be performed based on a comparison to control cells, which can be, for example, either untransduced cells or cells transduced with a control retroviral (e.g.
- control cells are transduced with a retroviral particle (e.g. lentiviral particle) having a genome encoding a lymphoproliferative element or intracellular domain(s) thereof, identified herein as exemplifying a lymphoproliferative element.
- a retroviral particle e.g. lentiviral particle having a genome encoding a lymphoproliferative element or intracellular domain(s) thereof, identified herein as exemplifying a lymphoproliferative element.
- the test criteria can include that there is at least as much enrichment, survival and/or expansion, or no statistical difference of enrichment, survival, and/or expansion when the test is performed using a retroviral particle (e.g. lentiviral particle) having a genome encoding a test construct versus encoding the control lymphoproliferative element, typically by analyzing cells transcribed therewith.
- a retroviral particle e.g. lentiviral particle
- Exemplary or illustrative embodiments of lymphoproliferative elements herein, in some embodiments, are illustrative embodiments of control lymphoproliferative elements for such a test.
- this test for an improved property of a putative or test lymphoproliferative element is performed by performing replicates and/or performing a statistical test.
- a skilled artisan will recognize that many statistical tests can be used for such a lymphoproliferative element test.
- the statistical test can be a T-test or a Mann-Whitney-Wilcoxon test.
- the normalized enrichment level of a test construct is significant at a p-value of less than 0.1 , or less than 0.05, or less than 0.01.
- the LE provides, is capable of providing and/or possesses the property of (or a cell genetically modified and/or transduced with the LE is capable of providing, is adapted for, possesses the property of, and/or is modified for) at least a 1.5-fold, 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, or 10-fold expansion, or between 1.5 fold and 25-fold expansion, or between 2-fold and 20-fold expansion, or between 2-fold and 15-fold expansion, or between 5-fold and 25-fold expansion, or between 5-fold and 20-fold expansion, or between 5-fold and 15-fold expansion, of pre activated PBMCs transduced with a nucleic acid encoding the LE when transduced along with an anti- CD 19 CAR comprising a CD3 zeta intracellular activating domain but no co-stimulatory domain, between day 7 and day 21, 28, 35, and/or 42 of in vitro culturing in the absence of exogenously added cyto
- the test is performed in the presence of PBMCs, for example at a 1:1 ratio of transduced cells to PBMCs, which can be for example, from a matched donor, and in some embodiments, the test is performed in the absence of PBMCs.
- the analysis of expansion for any of these tests is performed as illustrated in WO2019/055946.
- the test can include a further statistical test and a cut-off such as a P value below 0.1, 0.05, or 0.01, wherein a test polypeptide or nucleic acid encoding the same, needs to meet one or both thresholds (i.e. fold expansion and statistical cutoff).
- the number of test cells and the number of control cells can be compared between day 7 and day 14, 21, 28, 35, 42 or 60 post transduction.
- the numbers of test and control cells can be determined by sequencing DNA and counting the occurrences of unique identifiers present in each construct.
- the numbers of test and control cells can be counted directly, for example with a hemocytometer or a cell counter.
- all the test cells and control cells can be grown within the same vessel, well or flask.
- test cells can be seeded in one or more wells, flasks or vessels, and the control cells can be seeded in one or more flasks or vessels.
- test and control cells can be seeded individually into wells or flasks, e.g., one cell per well.
- the numbers of test cells and control cells can be compared using enrichment levels.
- the enrichment level for a test or control construct can be calculated by dividing the number of cells at a later time point (day 14, 21, 28, 35, or day 45) by the number of cells at day 7 for each construct.
- the enrichment level for a test or control construct can be calculated by dividing the number of cells at a time point (day 14, 21, 28, 35, or day 45) by the number of cells at that time point for untransduced cells.
- the enrichment level of each test construct can be normalized to the enrichment level of the respective control construct to generate a normalized enrichment level.
- a LE encoded in the test construct provides (or a cell genetically modified and/or transduced with a retroviral particle (e.g.
- lentiviral particle) having a genome encoding the LE is capable of providing, is adapted for, possesses the property of, and/or is modified for) at least a 1.5-fold, 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, or 10-fold normalized enrichment level, or between 1.5 fold and 25-fold normalized enrichment level, or between 3-fold and 20- fold normalized enrichment level, or between 5-fold and 25-fold normalized enrichment level, or between 5-fold and 20-fold normalized enrichment level, or between 5-fold and 15-fold normalized enrichment level.
- Enrichment can be measured, for example, by direct cell counting.
- Cutoff values can be based on a single test, or two, three, four, or five repeats, or based on many repeats. The cutoff can be met when a lymphoproliferative element meets one or more repeat tests, or meets or exceeds a cutoff for all repeats.
- the enrichment is measured as log2((normalized count data on the test day + l)/(normalized count data on day 7 + 1)).
- CLEs were identified from libraries of constructs that included constructs that encoded test chimeric polypeptides that were designed to comprise an intracellular domain believed to induce proliferation and/or survival of lymphoid or myeloid cells, and an anti-CD 19 CAR that comprised an intracellular activating domain but not a co-stimulatory domain.
- Preactivation which was performed overnight at 37 °C, was performed in a preactivation reaction mixture comprising PBMCs, a commercial media for lymphocytes (Complete OpTmizerTM CTSTM T-Cell Expansion SFM), recombinant human interleukin-2 (lOOIU/ml) and anti-CD3 Ab (OKT3) (50ng/ml).
- transduction was performed overnight at 37 °C after addition of test and control lentiviral particles to the preactivation reaction mixtures at a multiplicity of infection (MOI) of 5.
- MOI multiplicity of infection
- Some control lentiviral particles contained constructs encoding polypeptides with extracellular and transmembrane domains but no intracellular domains.
- the test lentiviral particles contained constructs encoding polypeptides with extracellular and transmembrane domains and either one or two intracellular domains.
- Complete OpTmizerTM CTSTM T-Cell Expansion SFM was added to dilute the reaction mixture 5- to 20-fold and the cells were cultured for up to 45 days at 37 °C.
- cultures were either “fed” additional untransduced donor matched PBMCs or not (“unfed”).
- No additional cytokines e.g. IL-2, IL-7, or IL-15 and no other lymphoid mitogenic agent
- Expansion was measured by analyzing enrichment of cell counts actually counted as nucleic acid sequence counts of unique identifiers for each construct in the mixed cultured PBMC cell populations, such that enrichment was positive as calculated as the logarithm in base 2 of the ratio between normalized count at the last day for analysis plus one to the count at day 7 plus one.
- test constructs were identified as CLEs because the CLEs induced proliferation/expansion in these fed or unfed cultures without added cytokines such as IL-2 between days 7 and day 21, 28, 35, and/or 42.
- effective CLEs were identified by identifying test CLEs that provided increased expansion of these in vitro cultures, whether fed or unfed with untransduced PBMCs, between day 7 and day 21, 28, 35, and/or 42 post-transduction, compared to control constructs that did not include any intracellular domains.
- WO2019/055946 discloses that at least one and typically more than one test CLE that included an intracellular domain from a test gene provided more expansion than every control construct that was present at day 7 post-transduction, that did not include an intracellular domain.
- WO2019/055946 further provides a statistical method that was used to identify exceptionally effective genes with respect to a first intracellular domain, and one or more exemplary intracellular domain(s) from these genes. The method used a Mann-Whitney-Wilcoxon test and a false discovery cutoff rate of less than 0.1 or less than 0.05.
- WO2019/055946 identified especially effective genes for the first intracellular domain or the second intracellular domain, for example, by analyzing scores for genes calculated as combined score for all constructs with that gene. Such analysis can use a cutoff of greater than 1 , or greater than negative control constructs without any intracellular domains, or greater than 2, as shown for some of the tests disclosed in WO2019/055946.
- the LE provides, is capable of providing and/or possesses the property of (or a cell genetically modified and/or transduced with the LE is capable of providing, is adapted for, possesses the property of, and/or is modified for) driving T cell expansion in vivo.
- the in vivo test can utilize a mouse model and measure T cell expansion at 15 to 25 days in vivo, or at 19 to 21 days in vivo, or at approximately 21 days in vivo, after T cells are contacted with lenti viral vectors encoding the LEs, are introduced into the mice, as disclosed in WO2019/055946,
- the genetically modified cell is modified so as to possess new properties not previously possessed by the cell before genetic modification and/or transduction.
- a property can be provided by genetic modification with a nucleic acid encoding a CAR or a LE, and in illustrative embodiments both a CAR and a LE.
- the genetically modified and/or transduced cell is capable of, is adapted for, possesses the property of, and/or is modified for survival and/or proliferation in ex vivo culture for at least 7, 14, 21, 28, 35, 42, or 60 days or from between day 7 and day 14, 21, 28, 35, 42 or 60 post-transduction, in the absence of added IL-2 or in the absence of added cytokines such as IL-2, IL-15, or IL-7, and in certain illustrative embodiments, in the presence of the antigen recognized by the CAR where the method comprises modifying using a retroviral particle having a pseudotyping element and optionally a separate or fused activation domain on its surface and typically does not require pre activation.
- the genetically modified and/or transduced cell exhibits, is capable of, is adapted for, possesses the property of, and/or is modified for improved survival or expansion in ex vivo or in vitro culture in culture media in the absence of one or more added cytokines such as IL-2, IL-15, or IL-7, or added lymphocyte mitogenic agent, compared to a control cell(s) identical to the genetically modified and/or transduced cell(s) before it was genetically modified and/or transduced or to a control cell that was transduced with a retroviral particle identical to an on-test retroviral particle that comprises an LE or a putative LE, but without the LE or the intracellular domains of the LE, wherein said survival or proliferation of said control cell(s) is promoted by adding said one or more cytokines, such as IL-2, IL-15, or IL-7, or said lymphocyte mitogenic agent to the culture media.
- cytokines such as IL-2, IL-15, or IL-7
- cytokine or lymphocyte mitogenic agent By added cytokine or lymphocyte mitogenic agent, it is meant that cytokine or lymphocyte mitogenic agent is added from an exogenous source to a culture media such that the concentration of said cytokine or lymphocyte mitogenic agent is increased in the culture media during culturing of the cell(s) compared to the initial culture media, and in some embodiments can be absent from the initial culture media before said adding.
- added or exogenously added it is meant that such cytokine or lymphocyte mitogenic agent is added to a lymphocyte media used to culture the modified, genetically modified, and/or transduced cell after the modifying, where the culture media may or may not already possess the cytokine or lymphocyte mitogenic agent.
- All or a portion of the media that includes a mixture of multiple media components is typically stored and in illustrative embodiments has been shipped to a site where the culturing takes place, without the exogenously added cytokine(s) or lymphocyte mitogenic agent(s).
- the lymphocyte media in some embodiments is purchased from a supplier, and a user such as a technician not employed by the supplier and not located within a supplier facility, adds the exogenously added cytokine or lymphocyte mitogenic agent to the lymphocyte media and then the genetically modified and/or transduced cells are cultured in the presence or absence of such exogenously added cytokine or lymphocyte mitogenic agent.
- improved or enhanced survival, expansion, and/or proliferation can be shown as an increase in the number of cells determined by sequencing DNA from cells transduced with retroviral particle (e.g. lentiviral particle) having a genome encoding CLEs and counting the occurrences of sequences present in unique identifiers from each CLE.
- retroviral particle e.g. lentiviral particle
- improved survival and/or improved expansion can be determined by counting the cells directly, for example with a hemocytometer or a cell counter, at each time point.
- improved survival and/or improved expansion and/or enrichment can be calculated by dividing the number of cells at the later time point (day 21, 28, 35, and/or day 45) by the number of cells at day 7 for each construct.
- the cells can be counted by hemocytometer or cell counters.
- the enrichment level determined using the nucleic acid counts or the cell counts of each specific test construct can be normalized to the enrichment level of the respective control construct, i.e., the construct with the same extracellular domain and transmembrane domain but lacking the intracellular domains present in the test construct.
- the LE encoded in the construct provides (or a cell genetically modified and/or transduced with a retroviral particle (e.g.
- lentiviral particle) having a genome encoding the LE is capable of providing, is adapted for, possesses the property of, and/or is modified for) at least a 1.5-fold, 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, or 10-fold normalized enrichment level, or between 1.5 fold and 25-fold normalized enrichment level, or between 3-fold and 20-fold normalized enrichment level, or between 5-fold and 25-fold normalized enrichment level, or between 5- fold and 20-fold normalized enrichment level, or between 5-fold and 15-fold normalized enrichment level.
- the lymphoproliferative element can include a cytokine receptor or a fragment that includes a signaling domain thereof.
- the cytokine receptor can be CD27, CD40, CRLF2, CSF2RA, CSF2RB, CSF3R, EPOR, GHR, IFNAR1, IFNAR2, IFNGR1, IFNGR2, IFNLR1, IL1R1, IL1RAP, IL1RL1, IL1RL2, IL2R, IL2RA, IL2RB, IL2RG, IL3RA, IL4R, IL5RA, IL6R, IL6ST, IL7R, IL7RA, IL9R, IL10RA, IL10RB, IL11RA, IL12RB1, IL13R, IL13RA1, IL13RA2, IL15R, IL15RA, IL17RA, IL17RB, IL17RC, IL17RE, IL18R1,
- the cytokine receptor can be CD27, CD40, CRLF2, CSF2RA, CSF2RB, CSF3R, EPOR, GHR, IFNAR1, IFNAR2, IFNGR1, IFNGR2, IFNLR1, IL1R1, IL1RAP, IL1RL1, IL1RL2, IL2RA, IL2RB, IL2RG, IL3RA, IL4R, IL5RA, IL6R, IL6ST, IL7RA, IL9R, IL10RA, IL10RB, IL11RA, IL13RA1, IL13RA2, IL15RA, IL17RA, IL17RB, IL17RC, IL17RE, IL18R1, IL18RAP, IL20RA, IL20RB, IL22RA1, IL27RA, IL31RA, LEPR, LIFR, MPL, OSMR, PRLR, TNFRSF4, TNFRSF8, TNFRSF9, TNFR
- the lymphoproliferative element can comprise an intracellular domain from the cytokine receptors CD27, CD40, CRLF2, CSF2RA, CSF3R, EPOR, GHR, IFNAR1, IFNAR2, IFNGR2, IL1R1, IL1RL1, IL2RA, IL2RG, IL3RA, IL5RA, IL6R, IL7R, IL9R, IL10RB, IL11RA, IL12RB1, IL13RA1, IL13RA2, IL15RA, IL17RB, IL18R1, IL18RAP, IL20RB, IL22RA1, IL27RA, IL31RA, LEPR, MPL, OSMR, PRLR, TNFRSF4, TNFRSF8, TNFRSF9, TNFRSF14, or TNFRSF18In illustrative embodiments, the intracellular domain in a lymphoproliferative element comprises a domain from CD40,
- the lymphoproliferative element can comprise a costimulatory domain from CD27, CD28, 0X40 (also referred to as TNFRSF4), GITR (also referred to as TNFRSF18), or HVEM (also referred to as TNFRSF14).
- a lymphoproliferative element comprising a costimulatory domain from 0X40 does not comprise an intracellular domain from CD3Z, CD28, 4-1BB, ICOS, CD27, BTLA, CD30, GITR, or HVEM.
- a lymphoproliferative element comprising a costimulatory domain from GITR does not comprise an intracellular domain from CD3Z, CD28, 4-1BB, ICOS, CD27, BTLA, CD30, or HVEM.
- a lymphoproliferative element comprising a costimulatory domain from CD28 does not comprise an intracellular domain from CD3Z, 4-1BB, ICOS, CD27, BTLA, CD30, or HVEM.
- a lymphoproliferative element comprising a costimulatory domain from 0X40, CD3Z, CD28, 4-1BB, ICOS, CD27, BTLA, CD30, GITR, or HVEM does not comprise a coiled-coil spacer domain N-terminal of the transmembrane domain.
- a lymphoproliferative element comprising a costimulatory domain from GITR does not comprise an intracellular domain from CD3Z that is N-terminal of the costimulatory domain of GITR.
- the lymphoproliferative element comprises an intracellular domain of any two of CD40, MPL an IL2Rb.
- the lymphoproliferative element can be other than a cytokine receptor.
- the lymphoproliferative element other than a cytokine receptor can include an intracellular signaling domain from CD2, CD3D, CD3G, CD3Z, CD4, CD8RA, CD8RB, CD28, CD79A, CD79B, FCER1G, FCGR2A, FCGR2C, or ICOS.
- a lymphoproliferative element comprising an intracellular activating domain as disclosed hereinabove.
- a lymphoproliferative element is a CLE comprising an intracellular activating domain comprising an ITAM-containing domain, as such, the CLE can comprise an intracellular activating domain having at least 80%, 90%, 95%, 98%, or 100% sequence identity to the CD3Z, CD3D, CD3E, CD3G, CD79A, CD79B, DAP12, FCER1G, FCGR2A, FCGR2C, DAP10/CD28, or ZAP70 domains provided herein wherein the CLE does not comprise an ASTR.
- the intracellular activating domain is an ITAM-containing domain from CD3D, CD3G, CD3Z, CD79A, CD79B,
- FCER1G FCGR2A, or FCGR2C.
- CLEs comprising these intracellular activating domains are illustrated in WO2019/055946, as being effective at promoting proliferation of PBMCs ex vivo in cultures in the absence of exogenous cytokines such as exogenous IL-2.
- one or more domains of a lymphoproliferative element is fused to a modulatory domain, such as a co-stimulatory domain, and/or an intracellular activating domain of a CAR.
- a modulatory domain such as a co-stimulatory domain
- an intracellular activating domain of a CAR can be part of the same polypeptide as a CAR or can be fused and optionally functionally connected to some components of CARs.
- an engineered signaling polypeptide can include an ASTR, an intracellular activation domain (such as a CD3 zeta signaling domain), a co-stimulatory domain, and a lymphoproliferative domain. Further details regarding co-stimulatory domains, intracellular activating domains, ASTRs and other CAR domains, are disclosed elsewhere herein.
- Lymphoproliferative elements typically include a transmembrane domain.
- the transmembrane domain can have 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% sequence identity to any one of the transmembrane domains from the following genes and representative sequences disclosed in WO2019/055946: CD 8 beta, CD4, CD3 zeta, CD28, CD134, CD7, CD2, CD3D, CD3E, CD3G, CD3Z, CD4, CD8A CD8B, CD27, CD28, CD40, CD79A, CD79B, CRLF2, CRLF2, CSF2RA, CSF2RB, CSF2RB, CSF3R, EPOR, FCER1G, FCGR2C, FCGRA2, GHR, GHR, ICOS, IFNAR, IFNAR2, IFNGR1, IFNGR2, IFNLR1, IL1R1, IL1RAP, IL1RL1, IL1RL2, IL
- Transmembrane (TM) domains suitable for use in any engineered signaling polypeptide include, but are not limited to, constitutively active cytokine receptors, the TM domain from LMP1, and TM domains from type 1 TM proteins comprising a dimerizing motif, as discussed in more detail herein.
- the transmembrane domain can be a Type I growth factor receptor, a hormone receptor, a T cell receptor, or a TNF-family receptor.
- Eltrombopag is a small molecule activator of the thrombopoietin receptor MPL (also known as TPOR).
- a cell expressing an LE comprising a MPL transmembrane domain can be exposed to or contacted with eltrombopag, or a patient or subject to which such a cell has been infused, can be treated with eltrombopag.
- the proliferative and/or survival properties of the LE are activated and provided to the cell, thereby increasing survival and/or proliferation of the cell compared to the absence of the eltrombopag.
- binding of eltrombopag occurs in the transmembrane domain and can activate one or more intracellular domains that are part of the same polypeptide.
- a skilled artisan will understand the amount of eltrombopag to be used to activate a CLE comprising a MPL transmembrane domain.
- CLEs include both an extracellular portion and a transmembrane portion that is from the same protein, in illustrative embodiments the same receptor, either of which in illustrative embodiments is a mutant, thus forming an extracellular and transmembrane domain.
- These domains can be from a cytokine receptor, or a mutant thereof, or a hormone receptor, or a mutant thereof in some embodiments that have been reported to be constitutively active when expressed at least in some cell types.
- such extracellular and transmembrane domains do not include a ligand binding region.
- a mutation in at least some extracellular - transmembrane domains of CLEs provided herein are responsible for signaling of the CLE in the absence of ligand, by bringing activating chains together that are not normally together, or by changing the confirmation of a linked transmembrane and/or intracellular domain.
- Exemplary extracellular and transmembrane domains for CLEs of embodiments that include such domains are extracellular regions, typically less than 30 amino acids of the membrane -proximal extracellular domains along with transmembrane domains from mutant receptors that have been reported to be constitutive, that is not require ligand binding for activation of an associated intracellular domain.
- extracellular and transmembrane domains include IL7RA Ins PPCL, CRLF2 F232C, CSF2RB V449E, CSF3R T640N, EPOR L251C I252C, GHR E260C I270C, IL27RA F523C, and MPL S505N.
- the extracellular and transmembrane domain does not comprise more than 10, 20, 25 30 or 50 consecutive amino acids that are identical in sequence to a portion of the extracellular and/or transmembrane domain of IL7RA, or a mutant thereof.
- the extracellular and transmembrane domain is other than IL7RA Ins PPCL.
- the extracellular and transmembrane does not comprise more than 10, 20, 25, 30, or 50 consecutive amino acids that are identical in sequence to a portion of the extracellular and/or transmembrane domain of IL15R.
- an LE provided herein comprises an extracellular domain, and in illustrative embodiments, the extracellular domain comprises a dimerizing motif.
- the extracellular domain comprises a leucine zipper.
- the leucine zipper is from a jun polypeptide, for example c-jun.
- the c-jun polypeptide is the c-jun polypeptide region of ECD-11.
- the transmembrane domain is a type I transmembrane protein
- the transmembrane domain can be a Type I growth factor receptor, a hormone receptor, a T cell receptor, or a TNF-family receptor.
- the chimeric polypeptide comprises an extracellular domain and wherein the extracellular domain comprises a dimerizing motif
- the transmembrane domain can be a Type I cytokine receptor, a hormone receptor, a T cell receptor, or a TNF-family receptor.
- transmembrane domains include any transmembrane domain that was illustrated in WO2019/055946.
- the transmembrane domain is from CD4, CD8RB, CD40, CRLF2, CSF2RA, CSF3R, EPOR, FCGR2C, GHR, ICOS, IFNAR1, IFNGR1, IFNGR2, IL1R1,
- the transmembrane domain is from CD40, ICOS, FCGR2C, PRLR, IL3RA, or IL6ST.
- the extracellular and transmembrane domain is the viral protein LMP1, or a mutant and/or fragment thereof.
- LMP1 is a multispan transmembrane protein that is known to activate cell signaling independent of ligand when targeted to lipid rafts or when fused to CD40 (Kaykas et al. EMBO J. 20: 2641 (2001)).
- a fragment of LMP1 is typically long enough to span a plasma membrane and to activate a linked intracellular domain(s).
- the LMP1 can be between 15 and 386, 15 and 200, 15 and 150, 15 and 100, 18 and 50, 18 and 30, 20 and 200, 20 and 150, 20 and 50, 20 and 30, 20 and 100, 20 and 40, or 20 and 25 amino acids.
- the extracellular domain includes at least 1 , but typically at least 4 amino acids and is typically linked to another functional polypeptide, such as a clearance domain, for example, an eTag.
- the lymphoproliferative element comprises an LMP1 transmembrane domain.
- the lymphoproliferative element comprises an LMP1 transmembrane domain and the one or more intracellular domains do not comprise an intracellular domain from TNFRSF proteins (i.e. CD40, 4- IBB, RANK, TACI, 0X40, CD27, GITR, LTR, and BAFFR), TLR1 to TLR13, integrins, FcyRIII, Dectinl, Dectin2, NODI, NOD2, CD 16, IL-2R, Type I II interferon receptor, chemokine receptors such as CCR5 and CCR7, G-protein coupled receptors, TREM1, CD79A, CD79B, Ig-alpha, IPS-1, MyD88, RIG- 1, MDA5, CD3Z, MyD88ATIR, TRIF, TRAM, TIRAP, MAL, BTK, RTK, RAC1, SYK, NALP3 (NLRP3), NALP3ALRR, NALP1, CARD9, DAI
- TNFRSF proteins
- the extracellular domain includes a dimerizing moiety.
- dimerizing moieties disclosed herein can be used for these embodiments.
- the dimerizing moieties are capable of homodimerizing.
- dimerizing moieties can provide an activating function on intracellular domains connected thereto via transmembrane domains. Such activation can be provided, for example, upon dimerization of a dimerizing moiety, which can cause a change in orientation of intracellular domains connected thereto via a transmembrane domain, or which can cause intracellular domains to come into proximity.
- An extracellular domain with a dimerizing moiety can also serve a function of connecting a cell tag polypeptide to a cell expressing a CLE.
- the dimerizing agent can be located intracellularly rather than extracellularly. In some embodiments, more than one or multiples of dimerizing domains can be used.
- Extracellular domains for embodiments where extracellular domains have a dimerizing motif are long enough to form dimers, such as leucine zipper dimers.
- extracellular domains that include a dimerizing moiety can be from 15 to 100, 20 to 50, 30 to 45, or 35 to 40 amino acids, of in illustrative embodiments is a c-Jun portion of a c-Jun extracellular domain.
- Extracellular domains of polypeptides that include a dimerizing moiety may not retain other functionalities.
- leucine zippers embodiments such leucine zippers are capable of forming dimers because they retain a motif of leucines spaced 7 residues apart along an alpha helix.
- leucine zipper moieties of certain embodiments of CLEs provided herein may or may not retain their DNA binding function.
- a spacer of between 1 and 4 alanine residues can be included in CLEs between the extracellular domain that has a dimerizing moiety, and the transmembrane domain. Not to be limited by theory, it is believed that the alanine spacer affects signaling of intracellular domains connected to the leucine zipper extracellular region via the transmembrane domain, by changing the orientation of the intracellular domains.
- the first and optional second intracellular domains of CLEs provided herein are intracellular signaling domains of genes that are known in at least some cell types, to promote proliferation, survival (anti-apoptotic), and/or provide a co-stimulatory signal that enhances proliferative potential or resistance to cell death.
- these intracellular domains can be intracellular domains from lymphoproliferative elements and co-stimulatory domains provided herein.
- Many of the intracellular domains of lymphoproliferative elements provided herein activate a jak/stat pathway and thus jak/stat signaling, such as JAK1/JAK2, JAK3, TYK2 (a Jak family member), STAT1, STAT2, STAT3, STAT4, STAT5, and STAT6 signaling.
- Activation of STAT can include recruitment of STAT, phosphoyration of STAT, dimerization of STAT, andor translocation of STAT.
- these lymphoproliferative elements are constitutively active.
- the lymphoproliferative elements provided herein include one or more JAK binding domains.
- the JAK- binding domain is, or is derived from, EPOR, GP130, PRLR, GHR, GCSFR, or TPOR/MPLR. JAK- binding domains from these proteins are known in the art and a skilled artisan will understand how to use them. For example, residues 273-338 of EpoR and residues 478-582 of TpoR are known to be JAK- binding domains.
- a lymphoproliferative element herein is a transgenic Boxl -containing cytokine receptor that includes an intracellular domain of a cytokine receptor comprising a Boxl Janus kinase (JAK)-binding motif, optionally a Box2 JAK-binding motif, and a Signal Transducer and Activator of Transcription (STAT) binding motif comprising a tyrosine residue.
- a lymphoproliferative element includes two or more JAK-binding motifs, for example three or more or four or more JAK-binding motifs.
- cytokine receptors have hydrophobic residues at positions -1, -2, and -6 relative to the Boxl motif, that form a “switch motif,” which is required for cytokine-induced JAK2 activation but not for JAK2 binding (Constantinescu et al. Mol Cell. 2001 Feb; 7(2):377-85; and Huang et al. Mol Cell.
- transgenic B OX1 -containing cytokine receptor lymphoproliferative element has a switch motif, which in illustrative embodiments has one or more, and preferably ah hydrophobic residues at positions -1, -2, and -6 relative to the Boxl motif.
- the Boxl motif an ICD of a lymphoproliferative element is located proximal to the transmembrane (TM) domain (for example between 5 and 15 or about 10 residues downstream from the TM domain) relative to the Box2 motif, which is located proximal to the transmembrane domain (for example between 10 and 50 residues downstream from the TM domain) relative to the STAT binding motif.
- the STAT binding motif typically comprising a tyrosine residue, the phosphorylation of which affects binding of a STAT to the STAT binding motif of the lymphoproliferative element.
- the ICDs comprising multiple STAT binding motifs where multiple STAT binding motifs are present in a native ICD (e.g.
- Intracellular domains from IFNAR1, IFNGR1, IFNLR1, IL2RB, IL4R, IL5RB, IL6R, IL6ST, IL7RA, IL9R, IL10RA, IL21R, IL27R, IL31RA, LIFR, and OSMR are known in the art to activate JAK1 signaling.
- Intracellular domains from CRLF2, CSF2RA, CSF2RB, CSF3R, EPOR, GHR, IFNGR2, IL3RA, IL5RA, IL6ST, IL20RA, IL20RB, IL23R, IL27R, LEPR, MPL, and PRLR are known in the art to activate JAK2.
- Intracellular domains from IL2RG are known in the art to activate JAK3.
- Intracellular domains from GHR, IFNAR1, IFNAR2, IFNGR1, IFNGR2, IL2RB, IL2RG, IL4R, IL5RA, IL5RB, IL7RA, IL9R, IL21R, IL22RA1, IL31RA, LIFR, MPL, and OSMR are known in the art to activate STATL
- Intracellular domains from IFNAR1 and IFNAR2 are known in the art to activate STAT2.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Biomedical Technology (AREA)
- Zoology (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Biotechnology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Epidemiology (AREA)
- Immunology (AREA)
- General Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- Microbiology (AREA)
- Cell Biology (AREA)
- Molecular Biology (AREA)
- Hematology (AREA)
- Biophysics (AREA)
- Medicinal Chemistry (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Virology (AREA)
- Pharmacology & Pharmacy (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Toxicology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Mycology (AREA)
- Oncology (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Developmental Biology & Embryology (AREA)
Priority Applications (19)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020227010243A KR20220070449A (ko) | 2019-09-01 | 2020-08-31 | 림프구의 변형 및 전달을 위한 방법 및 조성물 |
| MX2022002521A MX2022002521A (es) | 2019-09-01 | 2020-08-31 | Metodos y composiciones para la modificacion y administracion de linfocitos. |
| JP2022513645A JP2022546101A (ja) | 2019-09-01 | 2020-08-31 | リンパ球の改変および送達のための方法および組成物 |
| US17/639,281 US20220340927A1 (en) | 2019-09-01 | 2020-08-31 | Methods and compositions for the modification and delivery of lymphocytes |
| CN202080076199.XA CN116057181A (zh) | 2019-09-01 | 2020-08-31 | 用于修饰和递送淋巴细胞的方法和组合物 |
| AU2020336230A AU2020336230B2 (en) | 2019-09-01 | 2020-08-31 | Methods and compositions for the modification and delivery of lymphocytes |
| EP20857656.1A EP4022035A4 (en) | 2019-09-01 | 2020-08-31 | Methods and compositions for the modification and delivery of lymphocytes |
| BR112022003617A BR112022003617A2 (pt) | 2019-09-01 | 2020-08-31 | Métodos e composições para a modificação e distribuição de linfócitos |
| CA3152780A CA3152780A1 (en) | 2019-09-01 | 2020-08-31 | Methods and compositions for the modification and delivery of lymphocytes |
| EP21765536.4A EP4114400A4 (en) | 2020-03-05 | 2021-03-04 | Methods and compositions for the delivery of modified lymphocyte aggregates |
| CN202180017933.XA CN115243713A (zh) | 2020-03-05 | 2021-03-04 | 用于递送修饰的淋巴细胞聚集体的方法和组合物 |
| US17/905,649 US20230111159A1 (en) | 2020-03-05 | 2021-03-04 | Methods and compositions for the delivery of modified lymphocyte aggregates |
| PCT/US2021/020922 WO2021178701A1 (en) | 2020-03-05 | 2021-03-04 | Methods and compositions for the delivery of modified lymphocyte aggregates |
| US18/043,465 US20230357436A1 (en) | 2016-03-19 | 2021-08-31 | Anti-idiotype compositions and methods of use thereof |
| CN202180052913.6A CN116249559A (zh) | 2020-08-31 | 2021-08-31 | 抗独特型组合物及其使用方法 |
| EP21862987.1A EP4204004A4 (en) | 2020-08-31 | 2021-08-31 | ANTI-IDIOTYPE COMPOSITIONS AND METHODS OF USE |
| PCT/US2021/048532 WO2022047417A1 (en) | 2020-08-31 | 2021-08-31 | Anti-idiotype compositions and methods of use thereof |
| US17/684,405 US20230044451A1 (en) | 2016-03-19 | 2022-03-01 | Methods and compositions for the delivery of modified lymphocytes and/or retroviral particles |
| JP2025185504A JP2026054469A (ja) | 2019-09-01 | 2025-11-04 | リンパ球の改変および送達のための方法および組成物 |
Applications Claiming Priority (14)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201962894849P | 2019-09-01 | 2019-09-01 | |
| US201962894853P | 2019-09-01 | 2019-09-01 | |
| US201962894852P | 2019-09-01 | 2019-09-01 | |
| US62/894,849 | 2019-09-01 | ||
| US62/894,853 | 2019-09-01 | ||
| US62/894,852 | 2019-09-01 | ||
| US201962894926P | 2019-09-02 | 2019-09-02 | |
| USPCT/US2019/049259 | 2019-09-02 | ||
| PCT/US2019/049259 WO2020047527A2 (en) | 2018-09-02 | 2019-09-02 | Methods and compositions for genetically modifying lymphocytes in blood or in enriched pbmcs |
| US62/894,926 | 2019-09-02 | ||
| US201962943207P | 2019-12-03 | 2019-12-03 | |
| US62/943,207 | 2019-12-03 | ||
| US202062985741P | 2020-03-05 | 2020-03-05 | |
| US62/985,741 | 2020-03-05 |
Related Parent Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2019/049259 Continuation-In-Part WO2020047527A2 (en) | 2016-03-19 | 2019-09-02 | Methods and compositions for genetically modifying lymphocytes in blood or in enriched pbmcs |
Related Child Applications (4)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2021/020922 Continuation-In-Part WO2021178701A1 (en) | 2016-03-19 | 2021-03-04 | Methods and compositions for the delivery of modified lymphocyte aggregates |
| US17/905,649 Continuation-In-Part US20230111159A1 (en) | 2020-03-05 | 2021-03-04 | Methods and compositions for the delivery of modified lymphocyte aggregates |
| US18/043,465 Continuation-In-Part US20230357436A1 (en) | 2016-03-19 | 2021-08-31 | Anti-idiotype compositions and methods of use thereof |
| PCT/US2021/048532 Continuation-In-Part WO2022047417A1 (en) | 2016-03-19 | 2021-08-31 | Anti-idiotype compositions and methods of use thereof |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2021042072A1 true WO2021042072A1 (en) | 2021-03-04 |
Family
ID=74686079
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2020/048843 Ceased WO2021042072A1 (en) | 2016-03-19 | 2020-08-31 | Methods and compositions for the modification and delivery of lymphocytes |
Country Status (10)
| Country | Link |
|---|---|
| US (1) | US20220340927A1 (https=) |
| EP (1) | EP4022035A4 (https=) |
| JP (2) | JP2022546101A (https=) |
| KR (1) | KR20220070449A (https=) |
| CN (1) | CN116057181A (https=) |
| AU (1) | AU2020336230B2 (https=) |
| BR (1) | BR112022003617A2 (https=) |
| CA (1) | CA3152780A1 (https=) |
| MX (1) | MX2022002521A (https=) |
| WO (1) | WO2021042072A1 (https=) |
Cited By (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11325948B2 (en) | 2016-03-19 | 2022-05-10 | Exuma Biotech Corp. | Methods and compositions for genetically modifying lymphocytes to express polypeptides comprising the intracellular domain of MPL |
| WO2023015310A3 (en) * | 2021-08-06 | 2023-03-23 | Seattle Children's Hospital D/B/A Seattle Children's Research Institute | T-cell manufacturing methods |
| WO2023133595A2 (en) | 2022-01-10 | 2023-07-13 | Sana Biotechnology, Inc. | Methods of ex vivo dosing and administration of lipid particles or viral vectors and related systems and uses |
| WO2023168305A1 (en) * | 2022-03-01 | 2023-09-07 | Exuma Biotech Corp. | Viral particles with membrane-bound hyaluronidase |
| WO2024026377A1 (en) | 2022-07-27 | 2024-02-01 | Sana Biotechnology, Inc. | Methods of transduction using a viral vector and inhibitors of antiviral restriction factors |
| WO2024081167A1 (en) * | 2022-10-10 | 2024-04-18 | Kite Pharma, Inc. | New large scale car-t immune cell manufacturing method utilizing lentiviral vector transfection |
| EP4149966A4 (en) * | 2020-05-14 | 2024-08-07 | Seattle Children's Hospital (DBA Seattle Children's Research Institute) | DOUBLE PROMOTOR SYSTEMS |
| US12258574B2 (en) | 2016-03-19 | 2025-03-25 | Exuma Biotech Corp. | Methods and compositions for transducing lymphocytes and regulating the activity thereof |
| US12590321B2 (en) | 2016-03-19 | 2026-03-31 | Exuma Biotech Corp. | Methods and compositions for genetically modifying and expanding lymphocytes and regulating the activity thereof |
Families Citing this family (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN113840911A (zh) * | 2018-09-02 | 2021-12-24 | 埃克苏马生物技术公司 | 用于在血液中或在富集pbmc中基因修饰淋巴细胞的方法和组合物 |
| IL326194A (en) * | 2023-07-31 | 2026-03-01 | Bio4T2 Llc | Methods for the expansion and in vivo uptake of CAR cells mediated by blood cells |
| EP4589007A1 (en) * | 2024-01-17 | 2025-07-23 | Revvity Gene Delivery GmbH | Production of viral vectors |
| WO2025213071A1 (en) * | 2024-04-05 | 2025-10-09 | Baylor College Of Medicine | Synthetic gene expression regulatory switches |
Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20160340691A1 (en) * | 2014-04-09 | 2016-11-24 | Dna2.0, Inc. | Enhanced nucleic acid constructs for eukaryotic gene expression |
| US20180021378A1 (en) * | 2014-12-31 | 2018-01-25 | Anthrogenesis Corporation | Methods of treating hematological disorders, solid tumors, or infectious diseases using natural killer cells |
| WO2018075978A1 (en) * | 2016-10-20 | 2018-04-26 | Alpine Immune Sciences, Inc. | Secretable variant immunomodulatory proteins and engineered cell therapy |
| US20190008985A1 (en) * | 2016-08-17 | 2019-01-10 | Factor Bioscience Inc. | Nucleic acid products and methods of administration thereof |
| WO2019055946A1 (en) * | 2017-09-18 | 2019-03-21 | F1 Oncology, Inc. | METHODS AND COMPOSITIONS FOR THE GENETIC MODIFICATION AND EXPANSION OF LYMPHOCYTES AND THE REGULATION OF THE ACTIVITY THEREOF |
| US20190134091A1 (en) * | 2015-06-12 | 2019-05-09 | Lentigen Technology, Inc. | Method to Treat Cancer with Engineered T-Cells |
| US20190161542A1 (en) * | 2016-08-01 | 2019-05-30 | Novartis Ag | Treatment of cancer using a chimeric antigen receptor in combination with an inhibitor of a pro-m2 macrophage molecule |
Family Cites Families (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EA022752B1 (ru) * | 2008-12-09 | 2016-02-29 | Галозим, Инк. | Длинные растворимые полипептиды рн20 и их использование |
| CU24649B1 (es) * | 2016-03-19 | 2023-02-13 | Exuma Biotech Corp | Retrovirus recombinantes incompetentes de replicación para la transducción de linfocitos y expansión regulada de los mismos |
| US11325948B2 (en) * | 2016-03-19 | 2022-05-10 | Exuma Biotech Corp. | Methods and compositions for genetically modifying lymphocytes to express polypeptides comprising the intracellular domain of MPL |
| EP3439675A4 (en) * | 2016-04-08 | 2019-12-18 | Purdue Research Foundation | METHOD AND COMPOSITIONS FOR CAR-T CELL THERAPY |
| CN107400664A (zh) * | 2016-05-20 | 2017-11-28 | 蔡胜和 | 透明质酸酶的细胞表达及其在实体瘤细胞治疗中的应用 |
| CA3030003A1 (en) * | 2016-07-08 | 2018-01-11 | F1 Oncology, Inc. | Methods and compositions for transducing lymphocytes and regulating the activity thereof |
| CN107988183A (zh) * | 2017-11-17 | 2018-05-04 | 杭州惠博士生物科技有限公司 | 一种重组人透明质酸及其生产方法 |
| CN109913422A (zh) * | 2017-12-13 | 2019-06-21 | 苏州康聚生物科技有限公司 | 一种包含肿瘤抗原识别受体的免疫细胞及其应用 |
| EP3755347B1 (en) * | 2018-02-21 | 2025-06-25 | Board of Regents, The University of Texas System | Universal antigen presenting cells and uses thereof |
-
2020
- 2020-08-31 US US17/639,281 patent/US20220340927A1/en active Pending
- 2020-08-31 EP EP20857656.1A patent/EP4022035A4/en active Pending
- 2020-08-31 KR KR1020227010243A patent/KR20220070449A/ko active Pending
- 2020-08-31 MX MX2022002521A patent/MX2022002521A/es unknown
- 2020-08-31 CA CA3152780A patent/CA3152780A1/en active Pending
- 2020-08-31 AU AU2020336230A patent/AU2020336230B2/en active Active
- 2020-08-31 CN CN202080076199.XA patent/CN116057181A/zh active Pending
- 2020-08-31 BR BR112022003617A patent/BR112022003617A2/pt unknown
- 2020-08-31 JP JP2022513645A patent/JP2022546101A/ja active Pending
- 2020-08-31 WO PCT/US2020/048843 patent/WO2021042072A1/en not_active Ceased
-
2025
- 2025-11-04 JP JP2025185504A patent/JP2026054469A/ja active Pending
Patent Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20160340691A1 (en) * | 2014-04-09 | 2016-11-24 | Dna2.0, Inc. | Enhanced nucleic acid constructs for eukaryotic gene expression |
| US20180021378A1 (en) * | 2014-12-31 | 2018-01-25 | Anthrogenesis Corporation | Methods of treating hematological disorders, solid tumors, or infectious diseases using natural killer cells |
| US20190134091A1 (en) * | 2015-06-12 | 2019-05-09 | Lentigen Technology, Inc. | Method to Treat Cancer with Engineered T-Cells |
| US20190161542A1 (en) * | 2016-08-01 | 2019-05-30 | Novartis Ag | Treatment of cancer using a chimeric antigen receptor in combination with an inhibitor of a pro-m2 macrophage molecule |
| US20190008985A1 (en) * | 2016-08-17 | 2019-01-10 | Factor Bioscience Inc. | Nucleic acid products and methods of administration thereof |
| WO2018075978A1 (en) * | 2016-10-20 | 2018-04-26 | Alpine Immune Sciences, Inc. | Secretable variant immunomodulatory proteins and engineered cell therapy |
| WO2019055946A1 (en) * | 2017-09-18 | 2019-03-21 | F1 Oncology, Inc. | METHODS AND COMPOSITIONS FOR THE GENETIC MODIFICATION AND EXPANSION OF LYMPHOCYTES AND THE REGULATION OF THE ACTIVITY THEREOF |
Non-Patent Citations (1)
| Title |
|---|
| See also references of EP4022035A4 * |
Cited By (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11325948B2 (en) | 2016-03-19 | 2022-05-10 | Exuma Biotech Corp. | Methods and compositions for genetically modifying lymphocytes to express polypeptides comprising the intracellular domain of MPL |
| US12258574B2 (en) | 2016-03-19 | 2025-03-25 | Exuma Biotech Corp. | Methods and compositions for transducing lymphocytes and regulating the activity thereof |
| US12325728B2 (en) | 2016-03-19 | 2025-06-10 | Exuma Biotech Corp. | Methods and compositions for genetically modifying lymphocytes to express polypeptides comprising the intracellular domain of CD79A and CD79B |
| US12590321B2 (en) | 2016-03-19 | 2026-03-31 | Exuma Biotech Corp. | Methods and compositions for genetically modifying and expanding lymphocytes and regulating the activity thereof |
| EP4149966A4 (en) * | 2020-05-14 | 2024-08-07 | Seattle Children's Hospital (DBA Seattle Children's Research Institute) | DOUBLE PROMOTOR SYSTEMS |
| WO2023015310A3 (en) * | 2021-08-06 | 2023-03-23 | Seattle Children's Hospital D/B/A Seattle Children's Research Institute | T-cell manufacturing methods |
| WO2023133595A2 (en) | 2022-01-10 | 2023-07-13 | Sana Biotechnology, Inc. | Methods of ex vivo dosing and administration of lipid particles or viral vectors and related systems and uses |
| WO2023168305A1 (en) * | 2022-03-01 | 2023-09-07 | Exuma Biotech Corp. | Viral particles with membrane-bound hyaluronidase |
| WO2024026377A1 (en) | 2022-07-27 | 2024-02-01 | Sana Biotechnology, Inc. | Methods of transduction using a viral vector and inhibitors of antiviral restriction factors |
| WO2024081167A1 (en) * | 2022-10-10 | 2024-04-18 | Kite Pharma, Inc. | New large scale car-t immune cell manufacturing method utilizing lentiviral vector transfection |
Also Published As
| Publication number | Publication date |
|---|---|
| AU2020336230A1 (en) | 2022-03-31 |
| AU2020336230B2 (en) | 2026-04-16 |
| BR112022003617A2 (pt) | 2022-09-13 |
| JP2026054469A (ja) | 2026-03-26 |
| US20220340927A1 (en) | 2022-10-27 |
| MX2022002521A (es) | 2022-06-14 |
| EP4022035A1 (en) | 2022-07-06 |
| CA3152780A1 (en) | 2021-03-04 |
| EP4022035A4 (en) | 2024-03-27 |
| KR20220070449A (ko) | 2022-05-31 |
| CN116057181A (zh) | 2023-05-02 |
| JP2022546101A (ja) | 2022-11-02 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12325728B2 (en) | Methods and compositions for genetically modifying lymphocytes to express polypeptides comprising the intracellular domain of CD79A and CD79B | |
| AU2020336230B2 (en) | Methods and compositions for the modification and delivery of lymphocytes | |
| CN111479921B (zh) | 用于以基因方式修饰且扩增淋巴细胞以及调节其活性的方法及组合物 | |
| AU2019333324B2 (en) | Methods and compositions for genetically modifying lymphocytes in blood or in enriched PBMCs | |
| US12590321B2 (en) | Methods and compositions for genetically modifying and expanding lymphocytes and regulating the activity thereof | |
| US20230111159A1 (en) | Methods and compositions for the delivery of modified lymphocyte aggregates | |
| US20230044451A1 (en) | Methods and compositions for the delivery of modified lymphocytes and/or retroviral particles | |
| EP3589733A1 (en) | Methods and compositions for transducing and expanding lymphocytes and regulating the activity thereof | |
| WO2020047527A2 (en) | Methods and compositions for genetically modifying lymphocytes in blood or in enriched pbmcs | |
| US20250099612A1 (en) | Viral particles with membrane-bound hyaluronidase | |
| WO2022047417A1 (en) | Anti-idiotype compositions and methods of use thereof | |
| WO2022187289A1 (en) | Methods and compositions for the delivery of retroviral particles | |
| US20230357436A1 (en) | Anti-idiotype compositions and methods of use thereof | |
| EP4301862A1 (en) | Methods and compositions for the delivery of retroviral particles | |
| CN117043346A (zh) | 用于递送逆转录病毒颗粒的方法和组合物 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20857656 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3152780 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2022513645 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112022003617 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2020336230 Country of ref document: AU Date of ref document: 20200831 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2020857656 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2020857656 Country of ref document: EP Effective date: 20220401 |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: 112022003617 Country of ref document: BR Free format text: - APRESENTAR NOVO CONTEUDO ELETRONICO DE LISTAGEM DE SEQUENCIAS BIOLOGICAS, UMA VEZ QUE O APRESENTADO TEM DIVERGENCIA NO CAMPO 110;- APRESENTAR DOCUMENTACAO COMPROBATORIA EM RELACAO A DIVERGENCIA EM RELACAO AO NOME DO DEPOSITANTE NA FASE NACIONAL, UMA VEZ QUE FORAM VERIFICADOS DOCUMENTOS COM TITULARES DISTINTOS AO PEDIDO. |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01Y Ref document number: 112022003617 Country of ref document: BR Free format text: ANULADA A PUBLICACAO CODIGO 1.5 NA RPI NO 2681 DE 24/05/2022 POR TER SIDO INDEVIDA. |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: 112022003617 Country of ref document: BR Free format text: 1) APRESENTAR NOVO CONTEUDO ELETRONICO DE LISTAGEM DE SEQUENCIAS BIOLOGICAS, UMA VEZ QUE OAPRESENTADO TEM DIVERGENCIA NO CAMPO 110. 2) APRESENTAR, EM ATE 60 (SESSENTA) DIAS, ATRADUCAO SIMPLES DA FOLHA DE ROSTO DA CERTIDAO DE DEPOSITO DAS PRIORIDADES US 62/894,849, US62/894,852, US 62/894,853, US 62/894,926, US 62/943,207, US 62/985,741 EPCT/US2019/049259 OU DECLARACAO SUBSTITUTIVA CONTENDO, OBRIGATORIAMENTE, TODOS OS DADOSIDENTIFICADORES DESTA CONFORME O PARAGRAFO UNICO DO ART. 15 DA PORTARIA INPI 39/2021. 3) EFETUARO PAGAMENTO DE GRU CODIGO DE SERVICO 260 PARA A REGULARIZACAO DO PEDIDO, CONFORME ART. 2O 1O DA RESOLUCAO 189/2017 E NOTA DE ESCLARECIMENTO PUBLICADA NA RPI 2421 DE 30/05/2017,UM |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: 112022003617 Country of ref document: BR Free format text: 1) APRESENTAR NOVO CONTEUDO ELETRONICO DE LISTAGEM DE SEQUENCIAS BIOLOGICAS, UMA VEZ QUE O APRESENTADO NA PETICAO NO 870220063631 NAO POSSUI O CAMPO 140 E 141 (NUMERO DO PEDIDO DE PATENTE EM TRAMITE E DATA DE DEPOSITO) E TODOS OS CAMPOS RELACIONADOS A DATAS ESTAO FORA DO FORMATO CORRETO. 2) APRESENTAR, EM ATE 60 (SESSENTA) DIAS, A TRADUCAO SIMPLES DA FOLHA DE ROSTO DA CERTIDAO DE DEPOSITO DA PRIORIDADE US 62/894,849 OU DECLARACAO SUBSTITUTIVA CONTENDO, OBRIGATORIAMENTE, TODOS OS DADOS IDENTIFICADORES DESTA, CONFORME O PARAGRAFO UNICO DO ART. 15 DA PORTARIA INPI 39/2021, VISTO QUE NAO FOI APRESENTADA NA PETICAO NO 870220063631. |
|
| ENP | Entry into the national phase |
Ref document number: 112022003617 Country of ref document: BR Kind code of ref document: A2 Effective date: 20220224 |