WO2020243310A1 - Compositions and methods for thymic regeneration and t-cell reconstitution - Google Patents
Compositions and methods for thymic regeneration and t-cell reconstitution Download PDFInfo
- Publication number
- WO2020243310A1 WO2020243310A1 PCT/US2020/034932 US2020034932W WO2020243310A1 WO 2020243310 A1 WO2020243310 A1 WO 2020243310A1 US 2020034932 W US2020034932 W US 2020034932W WO 2020243310 A1 WO2020243310 A1 WO 2020243310A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- ntecs
- cells
- thymic
- subject
- e40rf1
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/44—Vessels; Vascular smooth muscle cells; Endothelial cells; Endothelial progenitor cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/069—Vascular Endothelial cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2501/00—Active agents used in cell culture processes, e.g. differentation
- C12N2501/10—Growth factors
- C12N2501/155—Bone morphogenic proteins [BMP]; Osteogenins; Osteogenic factor; Bone inducing factor
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2510/00—Genetically modified cells
Definitions
- the thymus supports the development of T cells from hematopoietic progenitor cells migrating from the bone marrow. Legrand et al. (2007);“Human thymus regeneration and T cell reconstitution;” Seminars in Immunology; Vol. 19; No. 5; pp 280-288. Thymic activity gradually declines with age resulting in diminished T-cell output and compromised immune function. Id. The thymus is also very sensitive to insult - it is easily damaged leading to depleted T cell output and immune deficiency in a variety of situations including in response to chemotherapy, radiation exposure, conditioning regimens used before organ transplant (such as bone marrow transplantation), and infection (such as HIV infection). Id.
- thymic tissue can replenish the T cell compartment - restoring immune function. Id. While the thymus does have some intrinsic regenerative capacity, the extent and speed of this thymic regeneration is frequently insufficient, leaving patients severely immuno-compromised and at risk from potentially life-threatening infections. As such, there is a need in the art for compositions and methods that can enhance both thymic regeneration and T-cell reconstitution. The present invention addresses these needs.
- the present invention is based, in part, upon the surprising discovery that thymic regeneration can be induced in vivo by administering to a living subject non-thymic endothelial cells (“ntECs”) engineered to express either an adenovirus E40RF1 polypeptide or both an adenovirus E40RF1 polypeptide and BMP4.
- ntECs non-thymic endothelial cells
- administration of engineered ntECs expressing either E40RF1 alone, or E40RF1 together with BMP4 leads to enhanced thymic regeneration and T-cell reconstitution.
- engineered ntECs expressing E40RF1 alone, or both BMP4 and E40RF1 can be used to induce thymic regeneration and T-cell reconstitution in vivo has several important practical implications, one of which is that it eliminates the need to perform complicated and invasive procedures to obtain and culture endothelial cells from a patient’s thymus. Instead, endothelial cells for use in thymic regeneration and T-cell reconstitution protocols can be obtained from much more accessible sources - such as from adipose tissue, skin tissue or umbilical cord tissue - greatly simplifying the applicability of endothelial cell therapy for thymic regeneration.
- the present invention provides a variety of novel compositions and methods.
- the present invention provides a population of engineered ntECs that express BMP4 (i.e. BMP4+ ntECs).
- the present invention provides a population of engineered ntECs that express an adenovirus E40RF1 polypeptide (i.e. E40RF1+ ntECs).
- the present invention provides a population of engineered ntECs that express BMP4 and an adenovirus E40RF1 polypeptide (i.e. BMP4+E40RF1+ ntECs).
- these populations of engineered ntECs are isolated cell populations.
- the populations of engineered ntECs are substantially pure cell populations. In some embodiments the populations of engineered ntECs are present in vitro , for example in cell culture. In some embodiments the populations of engineered ntECs are present ex vivo. In some embodiments the populations of engineered ntECs are present in vivo. In some embodiments the populations of engineered ntECs are present in a composition, such as a therapeutic composition suitable for administration to a living subject. For example, in some embodiments the present invention provides a therapeutic composition comprising a population of engineered ntECs and a physiological saline suitable for administration to a living subject. Similarly, in some embodiments the present invention provides a therapeutic composition comprising a population of engineered ntECs and a biocompatible matrix material, such as a liquid biocompatible matrix material (e.g. Matrigel) or a solid biocompatible matrix material.
- a biocompatible matrix material such as a liquid biocompatible matrix material (e.g. Matrigel
- the engineered ntECs provided herein, and/or compositions comprising these engineered ntECS may be used in various therapeutic applications, including, methods for enhancing thymic regeneration and/or T-cell reconstitution in a living subject, such as a subject that has a deficiency in thymic tissue mass, thymic function, or T- cell production, or that is otherwise immunocompromised.
- a living subject such as a subject that has a deficiency in thymic tissue mass, thymic function, or T- cell production, or that is otherwise immunocompromised.
- such subjects are of advanced age, have a viral infection (e.g. an HIV infection), have been exposed to radiation (e.g. radiation therapy), have been treated with chemotherapy, or have been treated with myeloablative conditioning agents - for example in preparation for an organ transplant such as a bone marrow or hematopoietic stem cell transplant (HSCT).
- HSCT hematopoietic stem cell transplant
- the present invention provides a method for enhancing thymic regeneration and/or T-cell reconstitution in a subject, the method comprising administering to a subject in need thereof an effective amount of ntECs engineered to express E40RF1 or both E40RF1 and BMP4, or a therapeutic composition comprising such ntECs, thereby stimulating thymic regeneration and/or T-cell reconstitution in the subject.
- the endothelial cells can be from any non-thymic source.
- suitable sources of the ECs include, but are not limited to, adipose tissue (i.e. adipose ECs), skin tissue (i.e. skin ECs), cardiac tissue (i.e. cardiac ECs), kidney tissue (i.e. kidney ECs), lung tissue (i.e. lung ECs), liver tissue (i.e. liver ECs), bone marrow tissue (i.e. bone marrow ECs), umbilical vein (i.e. umbilical vein ECs - or“TiVECs”), and the like.
- adipose tissue i.e. adipose ECs
- skin tissue i.e. skin ECs
- cardiac tissue i.e. cardiac ECs
- kidney tissue i.e. kidney ECs
- lung tissue i.e. lung ECs
- liver tissue i.e. liver ECs
- the ntECs are adult ECs. In some embodiments the ntECs are juvenile ECs. In some embodiments the ntECs are fetal ECs. In some embodiments the ntECs are embryonic ECs. In some embodiments the ntECs are differentiated ECs. In some embodiments the ntECs are derived from endothelial progenitor cells. In some embodiments the ntECs are derived from stem cells. In some embodiments the ntECs are from primary tissue cultures. In some embodiments the ntECs are ECs of an endothelial cell line. In cases where the ntECS are to be used in a treatment method as described herein, in some embodiments the ntECs are autologous to the subject to whom the cells are to be
- ntECs are allogeneic to the subject to whom the cells are to be administered.
- the ntECs comprise a recombinant nucleic acid molecule that comprises a nucleotide sequence that encodes the recited molecule or molecules - for example a nucleotide sequence that encodes BMP4 and/or a nucleotide sequence that encodes an adenovirus E40RF1 polypeptide.
- the nucleotide sequence that encodes the BMP4 and the nucleotide sequence that encodes the E40RF1 polypeptide may be provided in the same recombinant nucleic acid molecule or in different recombinant nucleic acid molecules.
- the nucleotide sequence that encodes the BMP4 and/or the nucleotide sequence that encodes the E40RF1 polypeptide is operatively linked to a heterologous promoter.
- the recombinant nucleic acid molecule is a plasmid vector.
- the recombinant nucleic acid molecule is an expression vector.
- the recombinant nucleic acid molecule is a viral vector, such as, for example, a lentiviral vector.
- the nucleotide sequence that encodes the E40RF1 and/or BMP4 polypeptide is transiently expressed in the ntECs.
- nucleotide sequence that encodes the BMP4 and/or E40RF1 polypeptide is stably expressed in the ntECs. In some embodiments the nucleotide sequence that encodes the E40RF1 and/or BMP4 polypeptide is integrated into the genome of the ntECs.
- the recombinant nucleic acid molecule where a recombinant nucleic acid molecule that comprises a nucleotide sequence that encodes an E40RF1 polypeptide is used, the recombinant nucleic acid molecule is not an adenovirus genome. In some embodiments, where a recombinant nucleic acid molecule that comprises a nucleotide sequence that encodes an E40RF1 polypeptide is used, the recombinant nucleic acid molecule is not a naturally occurring adenovirus genome.
- the recombinant nucleic acid molecule is not an adenoviral vector.
- Fig. 1 In vitro expansion assay of 4 cell lines derived from same umbilical cord.
- FIG. 2A-C BMP4+ E40RF1+ ntECs stimulate thymic regeneration. Results from experiments described in Example. 2.
- Each graph shows the numbers of live thymic cells (Fig 2. A) live medullar epithelial cells (mTEC) (Fig. 2B), and recovered live cortical epithelial cells (cTEC) (Fig. 2C) for the following treatment groups: (1) NoRad, No ECs, (2) Rad. No ECs, (3) Rad, Mu Thymic ECs, (4) Rad Mu BMEC, and (5) Rad. Mu BMEC/BMP4.
- the y axis shows the number of total cells isolated from the thymus of each individual animal.
- Mu murine (i.e. mouse).
- BMECs are bone marrow endothelial cells.
- Mu BMEC/BMP4 cells express both E40RF1 and BMP4.
- Fig. 3A-F BMP4+ E40RF1+ ntECs stimulate thymic regeneration. Results from experiments described in Example. 2. The graphs show the number of cells of the indicated types isolated from the thymus of each individual animal.
- Fig. 3A overall thymic epithelial content measured by number of CD45- EpCam+ cells.
- Fig. 3B actively proliferating thymic epithelial cell content measured by number of CD45- EpCam+ Ki67+ cells.
- Fig. 3C thymic epithelial progenitor cell (TEPC) content measured by number of EpCam+ alpha6 integrin+ Scal+ cells.
- 3D actively proliferating TPEC content measured by number of EpCam+ alpha6 integrin+ Scal+ Ki67+ cells.
- Fig. 3E thymic epithelial progenitor cell (TEPC) content measured by number of CD45- K5+ K8+ cells.
- Fig. 3F actively proliferating TEPC content measured by number of CD45- K5+ K8+ Ki67+ cells.
- a no EC control (“650 cGy No ECs”) and a group treated with BMP4+ E40RF1+ human umbilical vein endothelial cells (HUVECs) (“650 cGy 500K AB245 cells”). Significant differences between control and treatment groups are indicated by their P values.
- Fig. 4 Total thymic cellularity 3 weeks after transplant. Total thymic cellularity 3 weeks (3W) after lethal (100 cGy) total body irradiation and cell transplant.
- the co-infusion of rescue murine bone marrow (marrow-only) with BMP4+ E40RF1+ HUVEC (E4/BMP4) tended to give a numerically greater effect on recovery of thymic cells than their E40RF1+ HUVEC (E4), non-BMP4 expressing parent.
- the statistical significance between groups was tested with Kruskal Wallis One Way ANOVA and Dunn's multiple comparisons tests when the Marrow-only group was compared with other irradiated groups, i.e. groups treated with human cells.
- Fig. 5 Number of donor CD45+ cells in the thymus. See Example 5 for further description of data in this figure.
- FIG. 6A-B Recovery of CD3 + cells in the thymus. See Example 5 for further description of data in this figure.
- Fig. 7A-B Recovery of T lymphocytes expressing either CD4 or CD8. See Example 5 for further description of data in this figure.
- Fig. 8A-B Relative contribution of CD4+ and CD8+ cells to total CD3+ cells. See Example 5 for further description of data in this figure.
- FIG. 9 T-Lymphocyte maturation - schematic representation. See Example 5 for further description of information in this figure.
- FIG. 10 A-B Number (Fig. 10A) and percentage (Fig. 10B) of live CD3+ donor Double positive (DP) T-cells 3 weeks after 1000 cGY TBI. See Example 5 for further description of data in this figure.
- FIG. 11 A-B Number (Fig. 11 A) and percentage (Fig. 11B) of live Double Negative (DN) donor CD45+ cells 3 weeks after 1000 cGY TBI. See Example 5 for further description of data in this figure.
- Fig. 12 A-D Number of DN subpopulation cells in recovering thymus. Fig.
- FIG. 13 A-D Distribution of DN subpopulations within DN CD3 cells.
- Fig. 14 Number of live CD45 negative/ EpCam+ cells 3 weeks after 1000 cGY TBI. See Example 5 for further description of data in this figure.
- FIG. 21 BMP4+ E40RF1+ ntECs Enhance Survival Following Total Body Irradiation and Bone Marrow Transplant. Percentage survival (y axis) is plotted against time in days (x axis) for the indicated treatment groups.
- the ECs are BMP4+ E40RF1+ human umbilical vein endothelial cells (HUVECs). Animal survival 5 weeks after lethal total body irradiation is shown. Animals received 200,000 or 500,000 rescue murine bone marrow dose (BM) with/without BMP4+ E40RF1+ HUVEC.
- BM bone marrow dose
- “and/or” is to be taken as specific disclosure of each of the two specified features or components with or without the other.
- the term“and/or” as used in a phrase such as“A and/or B” is intended to include A and B, A or B, A (alone), and B (alone).
- the term“and/or” as used in a phrase such as“A, B, and/or C” is intended to include A, B, and C; A, B, or C; A or B; A or C; B or C; A and B; A and C; B and C; A (alone); B (alone); and C (alone).
- Units, prefixes, and symbols are denoted in their Systeme International de Unites (SI) accepted form. Numeric ranges are inclusive of the numbers defining the range, and any individual value provided herein can serve as an endpoint for a range that includes other individual values provided herein. For example, a set of values such as 1, 2, 3, 8, 9, and 10 is also a disclosure of a range of numbers from 1-10.
- SI Systeme International de Unites
- the term“allogeneic” means deriving from, originating in, or being members of the same species, where the members are genetically related or genetically unrelated but genetically similar.
- the allogeneic cells are obtained from a donor of the same species as the subject to whom the cell will be administered (i.e. the recipient).
- the allogeneic cells are obtained from a donor having the same MHC/HLA type as the subject to whom the cells will be administered (i.e. the recipient) - i.e. the donor of the cells and the recipient of the cells are MHC-matched or HLA-matched.
- cells e.g.
- ntECs are: (a) obtained from a donor, (b) maintained and/or cultured and/or expanded and/or genetically modified ex vivo , and (c) subsequently administered into a subject of the same species as the donor.
- ntECs are obtained from a donor, genetically modified ex vivo to render them BMP4+ and/or E40RF1+, and then administered to a recipient subject of the same species as the donor.
- ntECs are obtained from a donor, genetically modified ex vivo to render them BMP4+ and/or E40RF1+, and then administered to a recipient subject of the same species and same MHC/HLA type as the donor.
- the term“autologous” means deriving from or originating in the same subject.
- the autologous ntECs are obtained from the subject to whom the ntECs will be administered (i.e. the donor and recipient of the ntECs are the same individual).
- cells e.g. ntECs
- ntECs are: (a) obtained from a subject, (b) maintained and/or cultured and/or expanded and/or genetically modified ex vivo , and (c) subsequently administered to the same subject.
- ntECs are obtained from a subject, genetically modified ex vivo to render them BMP4+ and/or E40RF1+, and then administered to the same subject.
- BMP4 refers to bone morphogenetic protein 4 or a nucleotide sequence that encodes that protein - as will be clear from the context of use.
- the abbreviation“EC(s)” refers to an endothelial cell(s).
- the abbreviation“ntEC(s)” refers to non-thymic endothelial cell(s).
- E40RF1 refers to open reading frame (ORF) 1 of the early 4 (E4) region of an adenovirus genome, or a polypeptide/protein encoded by that ORF - as will be clear from the context of use.
- culturing refers to the propagation of cells on or in media of various kinds.
- Co-culturing refers to the propagation of two or more distinct types of cells on or in media of various kinds.
- the term“effective amount” refers to an amount of ntECs, or a therapeutic composition comprising ntECs, that is sufficient to achieve the stated treatment outcome to a detectable level - for example as assessed using one or the methods described in the Examples section of this patent application for measuring treatment outcomes. Treatment outcomes are described further below (see“treatment” definition - which refers to various parameters / treatment outcomes).
- An appropriate“effective amount” in any individual case may be determined empirically, for example using standard techniques known in the art, such as dose escalation studies, and may be determined taking into account such factors as the planned route of administration, desired frequency of administration, etc. Furthermore, an “effective amount” may be determined using assays such as those described in the Examples section of this patent disclosure.
- an effective amount is about 5 x 10 6 ntECs per kg of the subject’s body weight. In some embodiments an effective amount is from about 1 x 10 6 to about 50 x 10 6 ntECs per kg of the subject’s body weight. In some embodiments an effective amount is from about 5 x 10 6 to about 25 x 10 6 ntECs per kg of the subject’s body weight. In some embodiments an effective amount is about 5 x 10 6 ntECs per kg of the subject’s body weight. In some embodiments an effective amount is about 10 x 10 6 ntECs per kg of the subject’s body weight. In some embodiments an effective amount is about 15 x 10 6 ntECs per kg of the subject’s body weight.
- an effective amount is about 20 x 10 6 ntECs per kg of the subject’s body weight. In some embodiments an effective amount is about 25 x 10 6 ntECs per kg of the subject’s body weight. In some embodiments an effective amount is about 30 x 10 6 ntECs per kg of the subject’s body weight. In some embodiments an effective amount is about 35 x 10 6 ntECs per kg of the subject’s body weight. In some embodiments an effective amount is about 40 x 10 6 ntECs per kg of the subject’s body weight. In some embodiments an effective amount is about 45 x 10 6 ntECs per kg of the subject’s body weight. In some embodiments an effective amount is about 50 x 10 6 ntECs per kg of the subject’s body weight.
- ntECs non-thymic endothelial cells
- engineered when used in relation to non-thymic endothelial cells (ntECs) refers to ntECS cells that have been engineered by man to result in the recited phenotype (e.g. E40RF1 expression, BMP4 expression, or E40RF1 and BMP4 expression), or to express a recited nucleic acid molecule or polypeptide.
- engineered cells is not intended to encompass naturally occurring cells, but is, instead, intended to encompass, for example, cells that comprise a recombinant nucleic acid molecule, or cells that have otherwise been altered artificially (e.g.
- genetic modification for example so that they express a polypeptide that they would not otherwise express, or so that they express a polypeptide at substantially higher levels than that observed in non-engineered endothelial cells (e.g. so that they over express BMP4).
- the terms“genetic modification” and/or“genetically modified” and/or“gene- modified” refer to any addition, deletion, alteration or disruption of or to a nucleotide sequence or to a cell’s genome or to a cell’s content of genetic material.
- the endothelial cells described herein may, in addition to being genetically modified to provide a nucleic acid molecule that encodes E40RF1 and/or a nucleic acid molecule that encodes BMP4, may also comprise one or more other genetic modifications - as desired.
- genetic modification encompass both transient and stable genetic modification and encompass the use of various different gene delivery vehicles and methods including, but not limited to, transduction (viral mediated transfer of nucleic acid to a recipient, either in vivo or in vitro ), transfection (uptake by cells of isolated nucleic acid), liposome mediated transfer and others means of gene delivery that are well known in the art.
- transduction viral mediated transfer of nucleic acid to a recipient, either in vivo or in vitro
- transfection uptake by cells of isolated nucleic acid
- liposome mediated transfer and others means of gene delivery that are well known in the art.
- isolated refers to a population of cells that is separated from at least one other cell population, product, compound, or composition with which it is associated in its usual state, and/or refers to a population of cells that are not in the body of a living subject.
- the term“recombinant” refers to nucleic acid molecules that are isolated, generated and/or designed by man (including by a machine) using methods of molecular biology and genetic engineering (such as molecular cloning), and that either comprise nucleotide sequences that do not exist in nature, or are comprised within nucleotide sequences that do not exist in nature, or are provided in association with nucleotide sequences that they would not be associated with in nature, or that are provided in the absence of nucleotide sequences with which they would ordinarily be associated in nature.
- recombinant nucleic acid molecules are to be distinguished from nucleic acid molecules that exist in nature - for example in the genome of an organism.
- a nucleic acid molecule that comprises a complementary DNA or“cDNA” copy of an mRNA sequence, without any intervening intronic sequences such as would be found in the corresponding genomic DNA sequence would thus be considered a recombinant nucleic acid molecule.
- a recombinant E40RF1 nucleic acid molecule might comprise an E40RF1 coding sequence operatively linked to a promoter and/or other genetic elements with which that coding sequence is not ordinarily associated in a naturally-occurring adenovirus genome.
- a recombinant BMP4 nucleic acid molecule might comprise BMP4-coding sequences operatively linked to a promoter and/or other genetic elements with which that coding sequence is not ordinarily associated in the genome of an organism.
- the term“subject” includes mammals - such as humans and non-human primates, as well as other mammalian species including rabbits, rats, mice, cats, dogs, horses, cows, sheep, goats, pigs and the like. In some embodiments the subjects are mammalian subjects.
- the subjects are humans. In some embodiments the subjects are non human primates.
- the phrase“substantially pure” as used herein in relation to a cell population refers to a population of cells of a specified type (e.g. as determined by expression of one or more specified cell markers, morphological characteristics, or functional characteristics), that is at least about 50%, preferably at least about 75%, more preferably at least about 85%, and most preferably at least about 95% of the cells making up the total cell population.
- a “substantially pure cell population” refers to a population of cells that contain fewer than about 50%, preferably fewer than about 25%, more preferably fewer than about 15%, and most preferably fewer than about 5% of cells that are not of the specified type or types.
- thymic cells or conditions affecting the thymus refer to increasing or accelerating, or methods that increase or accelerate
- ntECs of the invention are administered to living subjects: (a) number of or proliferation of total thymic cells (CD45+ thymocytes and CD45- thymic stromal cells, (b) thymic mass, (c) output of self-restricted and/or self-tolerant and/or immunocompetent and/or naive T cells, (d) thymic function (such as the support for lymphoid cells such as T cells), (e) number of or proliferation of T cell progenitors, immature T cells or mature T cells, (f) number of or proliferation of CD45 + cells, (g) number of or proliferation of CD3 + cells, (h) number of or proliferation of CD3 + CD4 + cells, (i) number of or proliferation
- EpCAM + cells (medullary thymic epithelial cells (mTEC), (s) number of or proliferation of thymic CD45 EpCAM + Ki67 + (proliferating mTEC cells), and (t) number of or proliferation of one or more of the cell types listed in Table A (see below).
- mTEC medullary thymic epithelial cells
- s number of or proliferation of thymic CD45 EpCAM + Ki67 +
- t number of or proliferation of one or more of the cell types listed in Table A (see below).
- mTEC medullary thymic epithelial cells
- s number of or proliferation of thymic CD45 EpCAM + Ki67 +
- t number of or proliferation of one or more of the cell types listed in Table A (see below).
- a subject is successfully“treated,” or successful“regeneration” or“recovery” of the thymus or a specified thymic cell type or types is achieved, if there is a permanent or trans
- the detection of, and/or determination of the amount / level of enhancement (increase, or acceleration) of such parameters / treatment outcomes is assessed in comparison to a suitable baseline or a suitable control - such as in comparison to the level of the parameter before the treatment method is commenced, or in comparison to the level of the parameter in a comparable control subject in which the method is not performed, or in comparison to the level of the parameter if the method is performed in the absence of ntECS (e.g. using a delivery vehicle but not ntECs), or in comparison to the level of the parameter if the method is performed using non-engineered ntECs (e.g. ntECs not expressing BMP4 and/or not expressing E40RF1).
- a suitable baseline or a suitable control - such as in comparison to the level of the parameter before the treatment method is commenced, or in comparison to the level of the parameter in a comparable control subject in which the method is not performed, or in comparison to the level of the parameter if the method is performed in the absence of
- the amount of enhancement (increase or acceleration) of the one or more parameters / treatment outcomes may be any detectable amount. In some embodiments the amount of enhancement (increase or acceleration) of the one or more parameters / treatment outcomes may be any statistically significant amount. In some embodiments the amount of enhancement (increase or acceleration) of the one or more of parameters may be about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 150%, 200%, 250%, 300%, 400%, 500%, or more, as compared to a suitable baseline or suitable control. In some embodiments the amount of enhancement (increase or acceleration) of the one or more of parameters may be such that the parameter / treatment outcome is at about the“normal” level for the subject - i.e.
- the amount of enhancement (increase or acceleration) of the one or more of parameters may be such that the parameter is at a level that is greater than the“normal” level. In some embodiments the amount of enhancement (increase or acceleration) of the one or more of parameters may be such that the parameter is about 50%, or more preferably about 60%, or more preferably about 70%, or more preferably about 80%, or more preferably about 90% of the“normal” level.
- thymic cells refers to cells that ordinarily form part of, or are located in, the thymus, including, but not limited to, those listed in Table A, below.
- thymic stromal cells and cells of hematopoietic origin (such as T cell progenitors, immature T cells, and mature T cells) that reside within the thymus for at least some period of time - for example as part of the T cell maturation and T cell education processes that occur within the thymus.
- thymic regeneration includes both regeneration of thymic stromal cells and regeneration of cells of hematopoietic origin and includes the term“T cell reconstitution.”
- the effects on cells of hematopoietic origin that occur as part of the thymic regeneration process can be observed based on assessing the cells of hematopoietic origin residing within the thymus and/or by assessing such cells in the circulation - e.g. an enhancement of T cell output from the thymus following administration of the engineered ntECs of the invention can be detected by assessing such cells in the circulation.
- ntECs engineered endothelial cells
- BMP4+ engineered endothelial cells
- E40RF1+ BMP4+ - i.e. cells that express an E40RF1 polypeptide, a BMP4 polypeptide, or both an
- E40RF1 polypeptide and a BMP4 polypeptide are referred to collectively herein as“polypeptides of the invention.”
- The“polypeptides of the invention” are encoded by nucleic acid molecules.
- the present invention involves nucleic acid molecules that encode an adenovirus E40RF1 polypeptide, nucleic acid molecules that encode a BMP4 polypeptide, and/or nucleic acid molecules that encode both an adenovirus E40RF1 polypeptide and a BMP4 polypeptide.
- nucleic acid molecules of the invention are referred to collectively herein as “nucleic acid molecules of the invention.”
- polypeptides of the invention and the nucleic acid molecules of the invention may have amino acid sequences or nucleotide sequences that are specified herein or known in the art, or may have amino acid or nucleotide sequences that are variants, derivatives, mutants, or fragments of such amino acid or nucleotide sequences - provided that such a variants, derivatives, mutants, or fragments comprise, or encode, a polypeptide that has, one or more of the functional properties described herein (which include, but are not limited to, an ability to an ability to induce thymic regeneration and/or T-cell reconstitution when expressed in ntECs and administered to subjects in need of thymic regeneration and/or T-cell reconstitution).
- the BMP4 polypeptide may be any mammalian BMP4 polypeptide, such as a human, non-human primate, rabbit, rat, mouse, goat, or pig BMP4 polypeptide.
- the polypeptide may be a human BMP4 polypeptide.
- Amino acid sequences of such polypeptides, and nucleic acid sequences that encode such polypeptides, are well known in the art and available in well- known publicly available databases, such as the Genbank database.
- suitable human amino acid sequences for human BMP4 include those have the following accession numbers: NP_001 193.2 GI: 157276593 NP_57091 1.2 GI: 157276595, NP_570912.2
- the human BMP4 polypeptides used was encoded by the nucleotide sequence:
- This nucleotide sequence encodes the following BMP4 amino acid sequence: MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRD FEATLLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEQfflSTGLEYPERPASRA NTVRSFHHEEHLENIPGTSENS AFRFLFNLS SIPENEVIS SAELRLFREQVDQGPDWER GFHRINIYEVMKPPAEVVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQP NY GL AIEVTHLHQTRTHQGQHVRISRSLPQGSGNW AQLRPLL VTF GHDGRGHALTR RRRAKRSPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDC PFPL ADHLNSTNHAIVQTLVN S VN S SIPK ACC VPTELS AISMLYLDEYDKVV
- the polypeptide sequence used may be from any suitable adenovirus type or strain, such as human adenovirus type 2, 3, 5, 7, 9, 11, 12, 14, 34, 35, 46, 50, or 52.
- the polypeptide sequence used is from human adenovirus type 5.
- Amino acid sequences of such adenovirus polypeptides, and nucleic acid sequences that encode such polypeptides are well known in the art and available in well-known publicly available databases, such as the Genbank database.
- suitable sequences include the following: human adenovirus 9 (Genbank Accession No.
- human adenovirus 7 (Genbank Accession No. AAR89977), human adenovirus 46 (Genbank Accession No. AAX70946), human adenovirus 52 (Genbank Accession No. ABK35065), human adenovirus 34 (Genbank Accession No. AAW33508), human adenovirus 14 (Genbank Accession No. AAW33146), human adenovirus 50 (Genbank Accession No. AAW33554), human adenovirus 2 (Genbank Accession No. AP. sub.— 000196), human adenovirus 12 (Genbank Accession No. AP.sub.— 000141), human adenovirus 35 (Genbank Accession No. AP.
- human adenovirus 7 (Genbank Accession No. AP. sub.—000570), human adenovirus 1 (Genbank Accession No. AP. sub.—000533), human adenovirus 11 (Genbank Accession No. AP.sub.— 000474), human adenovirus 3 (Genbank Accession No. ABB 17792), and human adenovirus type 5 (Genbank accession number D 12587).
- the polypeptides and nucleic acid molecules of the invention have the same amino acid or nucleotide sequences as those specifically recited herein or known in the art (for example in public sequence databases, such as the Genbank database).
- the polypeptides and nucleic acid molecules of the invention may have amino acid or nucleotide sequences that are variants, derivatives, mutants, or fragments of such sequences, for example variants, derivatives, mutants, or fragments having greater than 85% sequence identity to such sequences.
- the variants, derivatives, mutants, or fragments have about an 85% identity to the known sequence, or about an 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the known sequence.
- a variant, derivative, mutant, or fragment of a known nucleotide sequence is used that varies in length by about 50 nucleotides, or about 45 nucleotides, or about 40 nucleotides, or about 35 nucleotides, or about 30 nucleotides, or about 28 nucleotides, 26 nucleotides, 24 nucleotides, 22 nucleotides, 20 nucleotides, 18 nucleotides, 16 nucleotides, 14 nucleotides, 12 nucleotides, 10 nucleotides, 9 nucleotides, 8 nucleotides, 7 nucleotides, 6 nucleotides, 5 nucleotides, 4 nucleotides, 3 nucleotides, 2 nucleotides, or 1 nucleotide relative to the known nucleotide sequence.
- a variant, derivative, mutant, or fragment of a known amino sequence is used that varies in length about 50 amino acids, or about 45 amino acids, or about 40 amino acids, or about 35 amino acids, or about 30 amino acids, or about 28 amino acids, 26 amino acids, 24 amino acids, 22 amino acids, 20 amino acids, 18 amino acids, 16 amino acids, 14 amino acids, 12 amino acids, 10 amino acids, 9 amino acids, 8 amino acids, 7 amino acids, 6 amino acids, 5 amino acids, 4 amino acids, 3 amino acids, 2 amino acids, or 1 amino acid relative to the known amino acid sequence.
- E40RF1 nucleic acid or amino acid sequence in some embodiments are used without other sequences from the adenovirus E40RF1 region - for example not in the context of the nucleotide sequence of the entire E40RF1 region or not together with other polypeptides encoded by the E40RF1 region.
- sequences may be used in conjunction with one or more other nucleic acid or amino acid sequences from the E40RFlregion, such as E40RF2, E40RF3, E40RF4, or E40RF5 sequences, or variants, mutants or fragments thereof.
- E40RF1 sequences can be used in constructs (such as a viral vectors) that contain other sequences, genes, or coding regions (such as promoters, marker genes, antibiotic resistance genes, and the like), in certain embodiments, the E40RF1 sequences are used in constructs that do not contain the entire E40RF1 region, or that do not contain other ORFs from the entire E40RFlregion, such as E40RF2, E40RF3, E40RF4, and/or E40RF5.
- nucleic acid molecules of the invention can be used in constructs or vectors that contain various other nucleic acid sequences, genes, or coding regions, depending on the desired use, for example, promoters, enhancers, antibiotic resistance genes, reporter genes or expression tags (such as, for example nucleotides sequences encoding GFP), or any other nucleotide sequences or genes that might be desirable.
- the polypeptides of the invention can be expressed alone or as part of fusion proteins.
- nucleic acid molecules of the invention can be under the control of one or more promoters to allow for expression.
- Any promoter able to drive expression of the nucleic acid sequences in the desired cell type can be used.
- suitable promoters include, but are not limited to, the CMV, SV40, RSV, HIV-Ltr, and MML promoters.
- the promoter can also be a promoter from the adenovirus genome, or a variant thereof.
- the promoter may be a promoter that drives expression of E40RF1 in nature in an adenovirus genome.
- the promoter is not one that drives expression of E40RF1 in nature in an adenovirus genome.
- nucleic acid molecules of the invention can be placed under the control of an inducible promoter, so that expression of the nucleic acid sequences can be turned on or off as desired.
- Any suitable inducible expression system can be used, such as, for example, a tetracycline inducible expression system, or a hormone inducible expression system.
- the nucleic acid molecules of the invention can be expressed while they are needed and then switched off when the desired outcome has been achieved, for example when there has been sufficient growth or proliferation of the endothelial cells. The ability to turn on or turn off expression could be particularly useful for in vivo applications.
- the nucleic acid molecules of the invention may comprise naturally occurring nucleotides, synthetic nucleotides, or a combination thereof.
- the nucleic acid molecules of the invention can comprise RNA, such as synthetic modified RNA that is stable within cells and can be used to direct protein expression/production directly within cells.
- the nucleic acid molecules of the invention can comprise DNA.
- the DNA sequences may be operably linked to one or more suitable promoters and/or regulatory elements to allow (and/or facilitate, enhance, or regulate) expression within cells, and may be present in one or more suitable vectors or constructs.
- the nucleic acid molecules of the invention can be introduced into endothelial cells in the same nucleic acid construct or they can be introduced in separate nucleic acid constructs.
- nucleic acid molecules of the invention can be introduced into endothelial cells using any suitable system known in the art, including, but not limited to, transfection techniques and viral-mediated transduction techniques.
- Transfection methods that can be used in accordance with the present invention include, but are not limited to, liposome- mediated transfection, polybrene-mediated transfection, DEAE dextran-mediated
- Viral-mediated transduction methods that can be used include, but are not limited to, lentivirus-mediated transduction, adenovirus-mediated transduction, retrovirus-mediated transduction, adeno-associated virus-mediated transduction and herpesvirus-mediated transduction.
- the present invention also provides vectors, including expression vectors that contain nucleic acid molecules of the invention.
- the present invention provides an expression vector comprising a nucleotide sequence encoding BMP4 and/or an E40RF1 polypeptide.
- the expression vector is a viral vector.
- the expression vector is a lentivirus vector.
- a nucleotide sequence encoding BMP4 and a nucleotide sequence encoding E40RF1 are provided in the same construct or vector, and may be under the control of separate promoters or may be under the control of separate promoters, for example with an internal ribosome entry site sequence (IRES) between the BMP4 and E40RF1 sequences.
- IRS internal ribosome entry site sequence
- a peptidomimetic may be used.
- a peptidomimetic is a small protein-like chain designed to mimic a polypeptide.
- Such a molecule could be designed to mimic any of the polypeptides of the invention (e.g. a BMP4 or E40RF1 polypeptide).
- the non-thymic endothelial cells (ntECs) described herein can be from any suitable non-thymic source of vascular endothelial cells known in the art.
- the ntECS do not express one or more markers (or marker profiles) that are specific to thymic endothelial cells.
- the endothelial cells are primary endothelial cells.
- the endothelial cells are mammalian cells, such as human or non-human primate cells, or rabbit, rat, mouse, goat, pig, or other mammalian cells. In some
- the endothelial cells are primary human endothelial cells. In some embodiments the endothelial cells are primary human endothelial cells.
- the endothelial cells are umbilical vein endothelial cells (UVECs), such as human umbilical vein endothelial cells (HUVECs).
- UVECs umbilical vein endothelial cells
- HUVECs human umbilical vein endothelial cells
- the endothelial cells are adipose ECs.
- the endothelial cells are skin ECs.
- the endothelial cells are cardiac ECs.
- the endothelial cells are kidney ECs.
- the endothelial cells are lung ECs.
- the endothelial cells are liver ECs.
- the endothelial cells are bone marrow ECs.
- Other suitable endothelial cells that can be used include those described previously as being suitable for E40RF1 -expression in U.S. Patent No. 8,465,732, the contents of which are hereby incorporated by reference.
- the endothelial cells are gene-modified such that they comprise one or more genetic modifications in addition to and apart from the expression of the specific recited molecules (e.g. BMP4 and/or E40RF1).
- the endothelial cells may also be engineered to express ETV2.
- the ntECs may also express ETV2.
- the ntECs described herein may comprise a corrected version of a gene known to be involved in, or suspected of being involved in, a disease or disorder that affects endothelial cells, or any other gene, such as a therapeutically useful gene, that it may be desired to provide in endothelial cells or administer or deliver using engineered endothelial cells.
- the endothelial cells of the invention may exist in, or be provided in the form of, a population of endothelial cells or a composition comprising such a population of endothelial cells.
- the present invention provides a population of engineered BMP4+E40RF1+ non-thymic endothelial cells (ntECs).
- ntECs engineered BMP4+E40RF1+ non-thymic endothelial cells
- such populations of engineered ntECs are in vitro or ex vivo.
- such populations of engineered ntECs are in vivo.
- such populations of engineered ntECs are isolated populations.
- such populations are substantially pure populations of ntECs cells. For example, in some embodiments at least about 50%, preferably at least about 75%, more preferably at least about 85%, and most preferably at least about 95% of the cells making up a total cell population will be the engineered ntECs of the invention.
- the ntECs in the population of engineered ntECs are umbilical vein endothelial cells (UVECs), adipose endothelial cells, skin endothelial cells, lung endothelial cells, heart endothelial cells, kidney endothelial cells or bone marrow endothelial cells.
- the ntECs are human umbilical vein endothelial cells (HUVECs).
- compositions comprising the populations of ntECs described above, or elsewhere herein.
- compositions comprise a carrier solution, such as a physiological saline solution, cell suspension medium, cell culture medium, or the like.
- compositions are therapeutic compositions comprising a population of ntECs as described herein and a solution suitable for administration to a subject, such as a
- compositions and therapeutic compositions may comprise a population of ntECs as described herein and a biocompatible matrix material (such as a biocompatible matrix material that is liquid or solid at room temperature or at body temperature).
- compositions described herein may comprise additional cell types - such as, for example, additional cell types that can be maintained, cultured, or expanded in the presence of the ntECs (e.g. using the ntECs as“feeder” cells), or
- additional cell types include, but are not limited to, stem or progenitor cells, such as thymic stem or progenitor cells, hematopoietic cells, hematopoietic stem cells (HSCs), hematopoietic progenitor cells (HPCs) and hematopoietic stem and progenitor cells (HSPCs).
- stem or progenitor cells such as thymic stem or progenitor cells, hematopoietic cells, hematopoietic stem cells (HSCs), hematopoietic progenitor cells (HPCs) and hematopoietic stem and progenitor cells (HSPCs).
- HSCs hematopoietic stem cells
- HPCs hematopoietic progenitor cells
- HPCs hematopoietic stem and progenitor cells
- the present invention provides various therapeutic methods, such as methods for treating subjects in need thereof by administering to such subjects an effective amount of the engineered ntECs of the invention (or a composition comprising such engineered ntECs).
- the present invention provides a method of enhancing thymic regeneration, the method comprising administering an effective amount of a therapeutic composition comprising engineered non-thymic endothelial cells (ntECs) to a subject in need of thymic regeneration, wherein the engineered ntECs are either E40RF1+ or BMP4+E40RF1+, thereby enhancing thymic regeneration in the subject.
- ntECs engineered non-thymic endothelial cells
- the present invention provides a method of increasing survival following myeloablative conditioning treatment in a subject, the method comprising administering an effective amount of a therapeutic composition comprising engineered non- thymic endothelial cells (ntECs) to a subject who has undergone myeloablative conditioning, wherein the engineered ntECs are BMP4+E40RF1+.
- a therapeutic composition comprising engineered non- thymic endothelial cells (ntECs) to a subject who has undergone myeloablative conditioning, wherein the engineered ntECs are BMP4+E40RF1+.
- HCT hematopoietic cell transplant
- HSCT hematopoietic stem cell transplant
- a therapeutic composition comprising engineered non- thymic endothelial cells (ntECs) to a subject who has undergone myeloablative conditioning and a subsequent hematopoietic cell transplant (HCT) (e.g. hematopoietic stem cell transplant (HSCT)), wherein the engineered ntECs are BMP4+E40RF1+.
- HCT hematopoietic stem cell transplant
- survival is increased as compared to that in subjects that undergo the same myeloablative conditioning treatment (and/or HCT) but that do not receive the engineered ntECs.
- the engineered non-thymic endothelial cells can be administered to the subject once (a single administration) or multiple times (multiple administrations), for example, 2, 3, or 4 administrations. Where multiple administrations are employed, the schedule of administrations may be any suitable schedule. In some embodiments the multiple administrations are 1 day apart, 2 days apart, 3 days apart, 3 days apart, or 5 days apart. For example, in one embodiment, the ntECs are administered on day 0, day 3 and day 5. The appropriate time for first administering the ntECs to the subject (i.e. day 0) can be selected by a physician based on the subject’s particular circumstances.
- the ntECs are first administered to the subject on the same day that the subject receives the HCT (day 0), and ntECs may or may not be administered to the subject again on subsequent days, for example on days 3 and 5 post HCT.
- the effective amount of the ntECs is administered to the subject once - in a single administration.
- the effective amount of the ntECs is administered to the subject multiple times - i.e. multiple administrations, each of an effective amount of ntECs, are delivered to the subject.
- the effective amount of the ntECs is split amongst multiple administrations - for example, half of the effective amount is administered on one day in a first administration and half of the effective amount is administered on another day in a second administration.
- these administration schemes can be employed, as appropriate. The skilled artisan will be able to select a suitable administration schedule depending on the particular situation.
- thymic regeneration comprises recovery of at least one cell type from among CD45- thymic stromal cells and CD45+ T cells.
- CD45- thymic stromal cells include, but are not limited to, thymic epithelial progenitors (TEPCs), cortical thymic epithelial cells (cTECs), and medullary thymic epithelial cells (mTECs).
- CD45+ T cells include, but are not limited to, CD3+ T cells, CD4+ T cells, CD8+ T cells, double-positive T cells (DP), double-negative T cells (DN), double-negative type 1 (DN1) T cells, double negative type 2 (DN2) T cells, double-negative type 3 (DN3) T cells and double-negative type 4 (DN4) T cells.
- the thymic regeneration comprises recovery of both CD45- thymic stromal cells and CD45+ T cells.
- the thymic regeneration comprises recovery of thymic epithelial progenitors (TEPCs), cortical thymic epithelial cells (cTECs), and medullary thymic epithelial cells (mTECs).
- TEPCs thymic epithelial progenitors
- cTECs cortical thymic epithelial cells
- mTECs medullary thymic epithelial cells
- the thymic regeneration comprises recovery of CD4+ T cells, CD8+ T cells, double-positive T cells (DP), double-negative T cells (DN), Double-negative type 1 (DN1) T cells, Double-negative type 2 (DN2) T cells, and Double-negative type 4 (DN4) T cells.
- DP double-positive T cells
- DN double-negative T cells
- DN1 Double-negative type 1
- DN2 Double-negative type 2
- DN4 T cells Double-negative type 4
- the thymic regeneration comprises recovery of thymic epithelial progenitors (TEPCs), cortical thymic epithelial cells (cTECs), and medullary thymic epithelial cells (mTECs), CD4+ T cells, CD8+ T cells, double-positive T cells (DP), double negative T cells (DN), Double-negative type 1 (DN1) T cells, Double-negative type 2 (DN2) T cells, and Double-negative type 4 (DN4) T cells.
- TEPCs thymic epithelial progenitors
- cTECs cortical thymic epithelial cells
- mTECs medullary thymic epithelial cells
- the ntECs are selected from the group consisting of umbilical vein endothelial cells (UVECs), adipose endothelial cells, skin endothelial cells, lung endothelial cells, heart endothelial cells, kidney endothelial cells and bone marrow endothelial cells.
- the subjects are human.
- the ntECs are human umbilical vein endothelial cells (HUVECs).
- the ntECs are human bone marrow endothelial cells.
- the ntECs are human adipose endothelial cells.
- the ntECs are human skin endothelial cells.
- the ntECs are autologous to the subject.
- the ntECs are allogeneic to the subject. In some embodiments the ntECs are MHC/HLA-matched to the subject.
- the subjects have previously been treated with
- myeloablative conditioning regimens include, but are not limited to, those involving treating subjects with radiation (e.g. total body irradiation) and/or administering etoposide and/or busulfan to the subject.
- the subjects have previously been treated with a
- HCT hematopoietic cell transplantation
- HSCT hematopoietic stem cell transplant
- HPCT hematopoietic stem and/or progenitor cell transplant
- the subject has an immunodeficiency. In some embodiments the subject has an HIV infection. In some embodiments the subject has an ageing-related deficiency in thymic tissue mass, thymic function, or T-cell production.
- the methods further comprise administering to the subject a therapeutic composition comprising hematopoietic cells or hematopoietic stem cells (HSCs) or hematopoietic stem and progenitor cells (HSPCs), e.g. in the context of performing a hematopoietic cell transplant (HCT) (e.g. a hematopoietic stem cell transplant (HSCT) or a hematopoietic stem and/or progenitor cell transplant (HSPCT)) procedure.
- HCT hematopoietic stem cell transplant
- HSCT hematopoietic stem and/or progenitor cell transplant
- the engineered ntECs are administered to the subject by IV infusion.
- the engineered ntECs and the hematopoietic cells are administered concurrently.
- the engineered ntECs and the hematopoietic are administered to the subject in the same infusion.
- the engineered ntECs are administered to the subject in multiple IV infusions over the course of several days or weeks.
- BMP4 protein is administered to the subjects.
- BMP4 protein is added to a composition containing E40RF1+ or BMP4+E40RF1+ ntECs prior to administering such a composition to a subject.
- a separate composition comprising BMP4 protein is administered to the subject as part of the treatment method.
- BMP4 is not administered to the subjects.
- thymic endothelial cells are also administered to the subjects (i.e. both non-thymic ECs (ntECs) and thymic ECs are administered). In some embodiments thymic endothelial cells are not administered to the subjects.
- the ntECs or ntEC-containing compositions can be administered to subjects using any suitable means known in the art, for example by injection (e.g. intravenous (IV) injection, intramuscular injection, subcutaneous injection, local injection), by infusion (e.g. by IV infusion, subcutaneous infusion, local infusion), or by surgical implantation.
- IV intravenous
- the ntECs or ntEC-containing compositions are administered to subjects by IV infusion.
- the engineered ntECs of the present invention may be administered directly into, or in the vicinity of, the thymus.
- the engineered ntECs of the present invention may be administered to subjects by intra-thymic injection or intra-thymic infusion. In some embodiments the engineered ntECs of the present invention may be administered to subjects by injection or infusion into the inferior thyroid artery. In some embodiments the engineered ntECs of the present invention may be administered to subjects by injection or infusion into the internal thoracic artery. The skilled artisan will be able to select a suitable route of administration depending on the particular situation.
- the thymus can be made more permissive to homing of the engineered ntECs to the thymus via mechanical, magnetic, ultrasound, or other stimulatory methods.
- the engineered ntECs of the present invention can be created in vivo, for example for research purposes or for therapeutic applications.
- the present invention provides various therapeutic methods, such as methods for treating subjects in need thereof, which comprise administering to such subjects an effective amount of a nucleic acid molecule that encodes BMP4 and/or a nucleic acid molecule that encodes E40RF1 (for example in a suitable vector, and/or under the control of a suitable promoter) such that non-thymic endothelial cells in the subject are transfected or transduced with such nucleic acid molecules and become engineered ntECs in vivo.
- the nucleotide molecules can be administered to subjects using any suitable means known in the art.
- the nucleotide molecules (for example in a suitable vector) can be administered by injection or infusion into the blood stream or tissue at a desired location.
- the nucleic acid molecules can be administered in a single dose or in multiple doses. The skilled artisan will be able to select a suitable method of administration according and a suitable dosing regimen depending on the desired use.
- the engineered ntECs of the invention are mitotically inactivated prior to use (e.g. therapeutic use) such that they cannot replicate. This can be achieved, for example, by using a chemical agent such as mitomycin C or by irradiating the engineered endothelial cells.
- the treatment methods of the present invention further comprise an initial step of genetically modifying ntECs by transducing or transfecting the ntECs in vitro or ex vivo with a nucleic acid molecule encoding E40RF1 and optionally a nucleic acid molecule encoding BMP4, prior to administering the ntECs to the subject.
- any of the various treatments methods described herein can be used to enhance thymic regeneration (including stimulating T-cell reconstitution) and/or achieve any one or more of the parameters or treatment outcomes listed in the“treatment” definition section above - in a living subject in need thereof.
- the engineered ntECs of the invention can be cultured using methods known to be useful for culturing other endothelial cells, or, methods known to be useful for culturing E40RF1 -expressing endothelial cells, for example as described in U.S. Patent No. 8,465,732, the contents of which are hereby incorporated by reference.
- the engineered endothelial cells of the invention can be cultured in the absence of serum, or in the absence of exogenous growth factors, or in the absence of both serum and exogenous growth factors.
- the engineered endothelial cells of the invention can also be cryopreserved.
- Various methods for cell culture and cell cryopreservation are known to those skilled in the art, such as the methods described in Culture of Animal Cells: A Manual of Basic Technique, 4th Edition (2000) by R. Ian Freshney (“Freshney”), the contents of which are hereby incorporated by reference.
- kits for carrying out the various methods described herein or for producing the engineered endothelial cells provided herein.
- Such kits may contain any of the components described herein, including, but not limited to, nucleotide sequences (for example in a vector), ntECs, populations of engineered ntECS, control non- engineered ntECs, sample/standard engineered ntECs, means or compositions for detection of engineered ntECs or the proteins or nucleic acid molecules expressed therein, (e.g.
- kits may optionally comprise instructions for use, containers, culture vessels and the like.
- a label may accompany the kit and may include any writing or recorded material, which may be electronic or computer readable form (e.g., disk, optical disc, memory chip, or tape) providing instructions or other information for use of the kit contents.
- Non-thymic endothelial cells are isolated from a desired tissue, such as from umbilical cord / umbilical veins, adipose tissue, skin, lung, heart, kidney or bone marrow, or any other desired non-thymic tissue source. Endothelial cells are isolated from the desired tissue using standard established protocols. An exemplary protocol for isolation of ntECS from umbilical cord is provided below. Similar protocols are known for the isolation of endothelial cells from other tissue sources and can be used.
- the following is an exemplary protocol for the isolation of ntECs from umbilical cord veins from any desired species, such as humans.
- This protocol generates populations of umbilical vein endothelial cells or“UVECs” - which, if derived from human umbilical vein, are referred to as“HUVECs.” All steps are performed using aseptic technique and aseptic materials.
- Umbilical cords are maintained at 2-8 °C until they are processed for isolation of endothelial cells.
- UVECs are isolated from the umbilical vein of the umbilical cords by enzymatic digestion with collagenase.
- the umbilical vein can be flushed with a physiological saline or other solution suitable for living cells (e.g. culture medium) and then filled with a solution of 0.2% (w/v) collagenase in a physiological saline or other solution suitable for living cells (e.g. culture medium) and clamped at both ends.
- the cord is incubated at a suitable temperature (e.g.
- the detached cells are flushed out of the vein and retained in a suitable container such as a conical tube.
- the umbilical vein may be washed again with a physiological saline or other solution suitable for living cells (e.g. culture medium) and the wash volume also retained - for example in the same container.
- the contents of the container are centrifuged, and the supernatant is aspirated.
- the cell pellet comprising UVECs is gently resuspended in an EC culture medium.
- An exemplary culture medium that can be used is an EC growth medium comprising Ml 99 base medium supplemented with 10% fetal bovine serum, 20 ng/mL FGF-2, 10 U/mL heparin, 5 pg/mL Gentamicin, lOmM HEPES and IX Glutamax.
- UVECs in EC culture medium are transferred to a suitable tissue culture vessel and placed in an incubator at 37 °C, 5% C02 to begin the in vitro culture process.
- a suitable tissue culture vessel and placed in an incubator at 37 °C, 5% C02 to begin the in vitro culture process.
- This protocol can be made to achieve isolation of UVECs.
- This protocol can be made to isolate ntECs from other tissue sources.
- ntECs isolated as described above, or isolated or obtained by any other means are transfected or transduced with a nucleic acid molecule (e.g. in an expression vector, viral vector, etc.) containing a selectable marker and the desired coding sequence(s) (e.g. an E40RF1 coding sequence (e.g. from Ad5) or a BMP4 coding sequence) under the control of a suitable promoter.
- a nucleic acid molecule e.g. in an expression vector, viral vector, etc.
- the desired coding sequence(s) e.g. an E40RF1 coding sequence (e.g. from Ad5) or a BMP4 coding sequence
- the transfection or transduction is performed using standard transfection or transduction protocols.
- a second coding sequence is to be transfected or transduced (e.g. an E40RF1 coding sequence (e.g.
- the ntECs are transfected or transduced with a second nucleic acid molecule (e.g. in an expression vector, viral vector, etc.) containing a selectable marker and the second coding sequence under the control of a suitable promoter - again using standard transfection or transduction protocols.
- a suitable period of time e.g. the next day
- the order of the transfections/transductions can be as desired (e.g. E40RF1 first or second).
- the two coding sequences can also be delivered at the same time - whether in the same nucleic acid molecule or in separate nucleic acid molecules.
- the ntECs cells are maintained in EC culture medium for several days (e.g. 3 days) before switching to a suitable selection medium containing an appropriate selection agent or agents.
- a suitable selection medium containing an appropriate selection agent or agents.
- the delivered nucleic acid molecule comprises a gene that confers resistance to a given antibiotic
- a suitable amount of that antibiotic is provided in the selection medium - such that cells that do not comprise the nucleic acid molecule die and cells that do comprise the nucleic acid molecule survive.
- the ntECs are also subjected to serum starvation culture (E40RF1 expression confers on the ntECs an ability to survive in serum free culture) for a certain period of time.
- the ntECs are then expanded in a suitable EC culture medium using standard EC culture protocols for sufficient time to produce a sufficient number of cells for the desired use.
- a suitable EC culture medium using standard EC culture protocols for sufficient time to produce a sufficient number of cells for the desired use.
- an expansion phase of 14-21 days can readily yield around 200-300 x 10 6 E40RF1+ UVECs from one umbilical cord.
- the amount of starting material and the expansion phase can be adjusted as need be to yield the desired amount of ntECs. If desired bioreactor systems can be used to produce large quantities of ntECs under controlled conditions.
- Quantum Cell Expansion System Quantum, Terumo BCT
- ntECs engineered ntECs for the desired use (e.g. E40RF1+, BMP4+ or BMP4+E40RF1+ ntECs).
- ntECs generated as above, or generated using other means can be used immediately, or maintained in culture until they are to be used, in some situations it may be desirable to cryopreserve the ntECS and/or to generate an ntEC cell bank - for example so that the ntECs can be used at a later time.
- cryopreservation protocols and cryopreservation reagents that are suitable for use with endothelial cells are known in the art, and any such methods/reagents can be used.
- engineered ntECs can be cryopreserved using CryoStor CS5 cryopreservation reagent (BioLife Solutions, Seattle, Washington), optionally supplemented with Human Serum Albumin (HSA: from Griffols) to a final concentration of about 20% HSA.
- CryoStor CS5 cryopreservation reagent BioLife Solutions, Seattle, Washington
- HSA Human Serum Albumin
- the cryopreserved ntECs can be stored frozen until needed.
- the ntECs will be thawed, transferred to an EC culture medium, and expanded in culture to the desired degree.
- Quality control tests can be performed on the engineered ntECS at any step during the production process and/or prior to use - if desired.
- quality control assays can be performed to evaluate and confirm cell viability, lack of contamination, presence of BMP4 expression (e.g. by RT PCR), presence of BMP4 secretion (e.g. by ELISA), presence of E40RF1 expression (e.g. by RT PCR), and the like.
- an exemplary quality control data assessment was performed based on detection of secreted BMP4 protein as detected by ELISA. Conditioned media was harvested from wells containing BMP4+ E40RF1+ HUVECs.
- the mean concentration of BMP4 in the conditioned medium was approximately 29,104pg/mL for the first line, approximately 4,542pg/mL for the second line, approximately l,798pg/mL for the third line, and approximately 3,21 lpg/mL for the fourth line.
- Example 2
- BMP4+E40RF1+ ntECs were generated essentially as described in the previous Examples. C57B1/6 mice were exposed to 650 Rads of total body irradiation (TBI), a sub- lethal dose that is sufficient to induce systemic hematopoietic and thymic damage. Mice were injected with lxlO 6 mouse thymic endothelial cells (mutECs) or with BMP4+E40RF1+ bone marrow endothelial cells (referred to as“muBMECs+BMP4” in Fig. 2) suspended in a physiological saline (phosphate buffered saline -“PBS”) 6 hours post-irradiation.
- TBI total body irradiation
- mice There was also a“no EC” infusion control group of mice injected with PBS alone. Tissues were harvested 9 days post TBI. The number of live thymic cells, live medullar thymic epithelial cells (mTEC), and recovered live cortical thymic epithelial cells (cTEC) was determined.
- mTEC live medullar thymic epithelial cells
- cTEC recovered live cortical thymic epithelial cells
- Fig. 2 The results are presented in Fig. 2 in which the number of live thymic cells (Fig. 2A), live medullar epithelial cells (mTEC) (Fig. 2B), and live cortical epithelial cells (cTEC) (Fig. 2C) recovered is plotted on each graph.
- the data shows that mouse BMP4+ E40RF1+ bone marrow endothelial cells accelerate thymic recovery after sub-lethal irradiation.
- TECs thymic epithelial cells
- mTECs and cTECs thymic epithelial cells
- HUVECs at days 1 and 3 post-irradiation. Animals were sacrificed at day 4 post irradiation to observe the effects of the BMP4+ E40RF1+ HUVEC transplants. At this early time point, transplanted animals exhibited nearly double the amount of overall thymic epithelial content (measured by number of CD45- EpCam+ cells) as compared to non-transplanted animals. (Fig. 3A), with a near four-fold increase in the total number of these cells actively
- TEPCs thymic epithelial progenitor cells identified by markers EpCam+, alpha6 integrin+, and Scal+
- Fig. 3E CD45-,K5+,K8+ cells
- Tables 4A and 4B show (in a relative form) the ability of the indicated ntEC types to accelerate recovery of the listed thymic cell type(s) in the thymus following sublethal irradiation (see “treatment outcome” column).
- Table 4A data from Fig. 2 summarizes recovery induced by administration of BMP4+E40RF1+ bone marrow ECs.
- Table 4B summarizes recovery induced by administration of BMP4+E40RF1+ HUVECs.
- The“+” symbols provide an approximate representation of the cell numbers, with more“+” symbols representing greater cell numbers.
- HUVECs and BMP4+ HUVECs could not be grown in sufficient number to use in this in vivo study (see Fig. 1)
- ntECs were generated essentially as described in previous Examples. Animals were assigned to treatment and control groups, as follows:
- Group 1 (control) - Sixteen mice were designated as controls; these animals did not receive irradiation, infusion of bone marrow, or infusion of endothelial cells.
- Groups 2-4 (treatments) - Mice were irradiated with 1,000 cGy total body irradiation. Approximately 10-16 hours after irradiation all irradiated mice received intravenous infusion of 500,000 Bone Marrow (BM) cells.
- the treatment groups were as follows: [0127] Group 2 - Animals received infusion of 500,000 syngeneic bone marrow cells only.
- Group 3 Animals received infusion of 500,000 syngeneic bone marrow cells and 500,000 human umbilical vein endothelial cells engineered to express the E40RF1 region of adenovirus. An additional intravenous infusion of 500,000 of these endothelial cells was infused approximately 48 hours after the first infusion and another approximately 48 hours after the second infusion.
- Group 4 Animals underwent the same procedures as for Group 3 except that the endothelial cells they received at each infusion were transduced with both E40RF1 and BMP4.
- the number of nucleated thymic cells was reduced by more than 90% in irradiated animals receiving bone marrow infusion alone (Fig. 4). While still significantly lower than non-irradiated animals, total cellularity was significantly improved compared to bone marrow alone by co-infusion of ntECs transduced with E40RF1 alone or ntECs transduced with E40RF1 and BMP4 (Fig. 4; p ⁇ 0.05 for the difference with ntECs transduced with E40RF1 alone and p ⁇ 0.01 for the difference with ntECs transduced with both E40RF1 and BMP4).
- Cells in the thymus may be divided into the cells of hematopoietic origin (those derived from CD45 + bone marrow hematopoietic stem cells) and thymic stromal (epithelial) cells.
- T-lymphocytes are characterized by expression of the CD3 surface marker. Recovery of the CD45.1 + /CD3 + T cell population followed the same pattern as that of CD45 recovery (Fig. 6). The association with CD45 recovery is not surprising given that the majority of CD45+ cells in the thymus are T-cells (Fig. 6B). As with CD45+ cells, the greatest number of T-cells was seen in the group treated with ntECs transduced with both E40RF1 and BMP4. The number of T-cells in this group was statistically significantly greater than that of the group treated with ntECs transduced with E40RF1 alone.
- T-lymphocytes within the thymus follows a well- recognized pattern of expression of surface markers (Fig. 9). These markers were applied to allow assessment of the effect of ntEC-treatment on T-lymphocyte development, as described below.
- DN cells The number of double-negative (DN) cells was increased by treatment with both forms of ntEC though, as with other parameters, the improvement over bone marrow alone was numerically greater for ntECs transduced with both E40RFland BMP4 than those transduced with E40RF1 alone (Fig. 11).
- the mean relative number of DN cells (as a percentage of all CD3-positive cells) was slightly lower (closer to normal) in animals treated with ntECs transduced with both E40RFland BMP4 (Fig. 11B).
- double-negative CD3 + DN cells can be further sub-divided into 4 cell types based on their expression of CD25, an a-chain of the interleukin 2 (IL-2) receptor, and CD44, an adhesive molecule that participates in a wide variety of cellular functions such as lymphocyte activation, recirculation homing, and hematopoiesis.
- IL-2 interleukin 2
- CD44 an adhesive molecule that participates in a wide variety of cellular functions such as lymphocyte activation, recirculation homing, and hematopoiesis.
- DN1, DN2, and DN4 cells / subpopulation were greater in animals treated with either ntECs transduced with E40RF1 alone or ntECs transduced with both BMP4 and E40RF1.
- the percentage of DN3 cells showed a corresponding decrease.
- the largest relative difference was in the earliest and most rare subpopulations (DN1 and DN2) for which the increase in animals receiving ntECs transduced with both E40RFland BMP4 was statistically significant.
- CD3/CD4 and CD4/CD8 cells CD3/CD4 and CD4/CD8 cells.
- Thymic epithelial cells are characterized by expression of EpCAM and absence of CD45.
- Out results showed that, as for thymic T-cell populations, animals receiving co infusion of ntECs exhibited greater numbers of EpCAMT cells than animals receiving bone marrow alone (Fig. 14).
- the number in ntEC -treated animals equaled (E40RF1 alone) or exceeded (E4+BMP4) that of uninjured animals (Fig. 14). This suggests an overshoot phenomenon though this is largely due to a small number of animals with very high numbers of EpC AM-positive cells (Fig. 14).
- Data on recovery of various subsets of thymic stromal cells is provided below.
- HUVECs and BMP4+ HUVECs could not be grown in sufficient number to use in this in vivo study (see Fig. 1).
- BMP4+ and E40RF1+ ntECs were generated essentially as described in Example 1.
- C57B16 mice were myeloablated with 1,000 cG (a lethal dose) of total body irradiation (TBI) and dosed with either 200,000 or 500,000 whole bone marrow (WBM) cells from syngeneic mice.
- TBI total body irradiation
- WBM whole bone marrow
- HUVECs and BMP4+ HUVECs could not be grown in sufficient number to use in this in vivo study (see Fig. 1).
- a phase 1, open-label, non-randomized, multi -center, multi dose escalation prospective study of BMP4+ E40RF1+ ntECs is performed in adult human subjects with hematologic malignancies undergoing myeloablative conditioning (MAC) and matched related or unrelated donor (MRD or MUD) allogeneic hematopoietic cell transplantation (HCT).
- MAC myeloablative conditioning
- MUD matched related or unrelated donor
- HCT allogeneic hematopoietic cell transplantation
- ntECS from different tissue sources are used (HUVECs and ECs from adipose tissue, skin, lung, heart, kidney and/or bone marrow).
- BMP4+ E40RF1+ ntECs are produced as described in Example 1.
- Enrolled subjects undergo planned HCT as per institutional standards with one of the following MAC regimens - as chosen by the treating oncologist:
- etoposide 120 mg/kg and TBI >1000 cGY
- busulfan (16 mg/kg oral or 12.8 mg/kg IV)
- cyclophosphamide 120 mg/kg (Bu/Cy)
- busulfan (16 mg/kg PO or 12.8 mg/kg IV) and fludarabine (120-180 mg/m2) (Bu/Flu).
- BMP4+ E40RF1+ ntECs are administered intravenously 2 hours after completion of allogeneic (MRD or MUD) HCT infusion on Day 0 upon observation that no acute reaction related to infusion of stem cells has occurred. If acute infusion related reaction occurs during HCT infusion, then the reaction is treated and the subject will not proceed with the trial.
- MUD allogeneic
- BMP4+ E40RF1+ ntECs are administered in a dose escalation manner, comprising four cohorts (each of at least 6 patients) as shown in Table 7, below.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Biomedical Technology (AREA)
- Chemical & Material Sciences (AREA)
- Biotechnology (AREA)
- Zoology (AREA)
- Genetics & Genomics (AREA)
- Cell Biology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Organic Chemistry (AREA)
- Wood Science & Technology (AREA)
- General Health & Medical Sciences (AREA)
- Vascular Medicine (AREA)
- General Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Medicinal Chemistry (AREA)
- Microbiology (AREA)
- Developmental Biology & Embryology (AREA)
- Virology (AREA)
- Immunology (AREA)
- Epidemiology (AREA)
- Physics & Mathematics (AREA)
- Biophysics (AREA)
- Molecular Biology (AREA)
- Plant Pathology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US17/614,521 US20220226391A1 (en) | 2019-05-28 | 2020-05-28 | Compositions and methods for thymic regeneration and t-cell reconstitution |
| CA3141989A CA3141989A1 (en) | 2019-05-28 | 2020-05-28 | Compositions and methods for thymic regeneration and t-cell reconstitution |
| SG11202113119QA SG11202113119QA (en) | 2019-05-28 | 2020-05-28 | Compositions and methods for thymic regeneration and t-cell reconstitution |
| AU2020283586A AU2020283586A1 (en) | 2019-05-28 | 2020-05-28 | Compositions and methods for thymic regeneration and T-cell reconstitution |
| KR1020217042865A KR20220015451A (ko) | 2019-05-28 | 2020-05-28 | 흉선 재생과 t 세포의 재구성을 위한 조성물 및 방법 |
| CN202080053410.6A CN114340642A (zh) | 2019-05-28 | 2020-05-28 | 用于胸腺再生和t细胞重建的组合物和方法 |
| EP20813769.5A EP3976065A4 (en) | 2019-05-28 | 2020-05-28 | COMPOSITIONS AND METHODS FOR THYMIC REGENERATION AND T LYMPHOCYTE REPLENISHMENT |
| JP2021570514A JP7637418B2 (ja) | 2019-05-28 | 2020-05-28 | 胸腺再生およびt細胞再構成のための組成物および方法 |
| IL288439A IL288439A (en) | 2019-05-28 | 2021-11-25 | Compounds and methods for regeneration of the thymus gland and restoration of t cells |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201962853452P | 2019-05-28 | 2019-05-28 | |
| US62/853,452 | 2019-05-28 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2020243310A1 true WO2020243310A1 (en) | 2020-12-03 |
Family
ID=73553922
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2020/034932 Ceased WO2020243310A1 (en) | 2019-05-28 | 2020-05-28 | Compositions and methods for thymic regeneration and t-cell reconstitution |
Country Status (10)
| Country | Link |
|---|---|
| US (1) | US20220226391A1 (https=) |
| EP (1) | EP3976065A4 (https=) |
| JP (1) | JP7637418B2 (https=) |
| KR (1) | KR20220015451A (https=) |
| CN (1) | CN114340642A (https=) |
| AU (1) | AU2020283586A1 (https=) |
| CA (1) | CA3141989A1 (https=) |
| IL (1) | IL288439A (https=) |
| SG (1) | SG11202113119QA (https=) |
| WO (1) | WO2020243310A1 (https=) |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| RU2753441C2 (ru) | 2016-09-13 | 2021-08-16 | Ангиокрин Биосайенс, Инк. | Гематоэнцефалический барьер, содержащий сконструированные эндотелиальные клетки |
| WO2024155791A1 (en) * | 2023-01-18 | 2024-07-25 | Angiocrine Bioscience, Inc. | Use of umbilical vein endothelial cells for the treatment of lung injury |
| WO2025245461A1 (en) * | 2024-05-23 | 2025-11-27 | Thymofox Inc. | Methods of activating foxn1 |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20170292111A1 (en) * | 2014-10-29 | 2017-10-12 | Memorial Sloan-Kettering Cancer Center | Use of bmp4 for thymic regeneration |
| US20180258386A1 (en) * | 2007-01-19 | 2018-09-13 | Cornell Research Foundation, Inc. | Methods and compositions for promoting survival and proliferation of endothelial cells and stimulating angiogensis |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| RU2743761C2 (ru) | 2014-12-19 | 2021-02-25 | Анджиокрин Биосайенс, Инк. | Биосовместимые имплантаты, содержащие сконструированные эндотелиальные клетки |
| RU2753441C2 (ru) * | 2016-09-13 | 2021-08-16 | Ангиокрин Биосайенс, Инк. | Гематоэнцефалический барьер, содержащий сконструированные эндотелиальные клетки |
-
2020
- 2020-05-28 KR KR1020217042865A patent/KR20220015451A/ko not_active Ceased
- 2020-05-28 CN CN202080053410.6A patent/CN114340642A/zh active Pending
- 2020-05-28 SG SG11202113119QA patent/SG11202113119QA/en unknown
- 2020-05-28 WO PCT/US2020/034932 patent/WO2020243310A1/en not_active Ceased
- 2020-05-28 CA CA3141989A patent/CA3141989A1/en active Pending
- 2020-05-28 US US17/614,521 patent/US20220226391A1/en active Pending
- 2020-05-28 AU AU2020283586A patent/AU2020283586A1/en not_active Abandoned
- 2020-05-28 JP JP2021570514A patent/JP7637418B2/ja active Active
- 2020-05-28 EP EP20813769.5A patent/EP3976065A4/en not_active Withdrawn
-
2021
- 2021-11-25 IL IL288439A patent/IL288439A/en unknown
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20180258386A1 (en) * | 2007-01-19 | 2018-09-13 | Cornell Research Foundation, Inc. | Methods and compositions for promoting survival and proliferation of endothelial cells and stimulating angiogensis |
| US20170292111A1 (en) * | 2014-10-29 | 2017-10-12 | Memorial Sloan-Kettering Cancer Center | Use of bmp4 for thymic regeneration |
Non-Patent Citations (1)
| Title |
|---|
| See also references of EP3976065A4 * |
Also Published As
| Publication number | Publication date |
|---|---|
| EP3976065A1 (en) | 2022-04-06 |
| JP7637418B2 (ja) | 2025-02-28 |
| US20220226391A1 (en) | 2022-07-21 |
| IL288439A (en) | 2022-01-01 |
| KR20220015451A (ko) | 2022-02-08 |
| AU2020283586A1 (en) | 2021-12-23 |
| CA3141989A1 (en) | 2020-12-03 |
| JP2022534586A (ja) | 2022-08-02 |
| SG11202113119QA (en) | 2021-12-30 |
| CN114340642A (zh) | 2022-04-12 |
| EP3976065A4 (en) | 2023-05-03 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JP5425618B2 (ja) | 成熟樹状細胞組成物およびそれを培養するための方法 | |
| US20220204924A1 (en) | Engineered endothelial cells expressing an ets transcription factor | |
| TW201736594A (zh) | 抗原特異性tcr的新生成 | |
| US20220226391A1 (en) | Compositions and methods for thymic regeneration and t-cell reconstitution | |
| US9592259B2 (en) | APC-mediated tolerance induction for therapy of multiple sclerosis | |
| Jung et al. | Stimulatory effect of HGF‐overexpressing adipose tissue‐derived mesenchymal stem cells on thymus regeneration in a rat thymus involution model | |
| US20210317410A1 (en) | Methods of making natural killer cells and uses thereof | |
| US20070196335A1 (en) | Immune Modulation By Regulating Expression Of The "Minor" Gene In Immune Dendritic Cells | |
| US20090215875A1 (en) | Methods and kits for expanding hematopoietic stem cells | |
| EP1697503B1 (en) | Cell culture with nm23, cell culture media comprising nm23 and therapeutic use of cells cultured in the presence of nm23 | |
| AU2022240974A1 (en) | Human macrophages resistant to tumor-induced repolarization | |
| KR20120054018A (ko) | 일과성 생착 ctl을 포함하는 의약품 조성물 | |
| US20240018482A1 (en) | Cryopreserved endothelial cell compositions | |
| US20230414720A1 (en) | Use of insulin-like growth factors with gamma-chain cytokines to induce homeostatic proliferation of lymphocytes | |
| Winterhalter | CRISPR/Cas9 based HLA reduction of T cells for universal T cell therapy | |
| WO2001032841A2 (en) | Method of in vitro t cell differentiation of cd34+ progenitor cells | |
| EP4117688A1 (en) | Generation of autoimmune inhibitory t cells by fibroblast mediated education |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20813769 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3141989 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2021570514 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2020283586 Country of ref document: AU Date of ref document: 20200528 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20217042865 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2020813769 Country of ref document: EP Effective date: 20220103 |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: 2020813769 Country of ref document: EP |