WO2020218866A1 - 만성 골수성 백혈병의 진단용 바이오마커 - Google Patents

만성 골수성 백혈병의 진단용 바이오마커 Download PDF

Info

Publication number
WO2020218866A1
WO2020218866A1 PCT/KR2020/005418 KR2020005418W WO2020218866A1 WO 2020218866 A1 WO2020218866 A1 WO 2020218866A1 KR 2020005418 W KR2020005418 W KR 2020005418W WO 2020218866 A1 WO2020218866 A1 WO 2020218866A1
Authority
WO
WIPO (PCT)
Prior art keywords
pacsin2
protein
sh3bp1
cobll1
domain
Prior art date
Application number
PCT/KR2020/005418
Other languages
English (en)
French (fr)
Inventor
김홍태
정희진
박기범
김동욱
Original Assignee
주식회사 대웅제약
울산과학기술원
가톨릭대학교 산학협력단
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 주식회사 대웅제약, 울산과학기술원, 가톨릭대학교 산학협력단 filed Critical 주식회사 대웅제약
Publication of WO2020218866A1 publication Critical patent/WO2020218866A1/ko

Links

Images

Classifications

    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6893—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • G01N33/57407—Specifically defined cancers
    • G01N33/57426—Specifically defined cancers leukemia
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • G01N33/57484—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumor, cancer, neoplasia, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides, metabolites
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6803—General methods of protein analysis not limited to specific proteins or families of proteins
    • G01N33/6845—Methods of identifying protein-protein interactions in protein mixtures
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00—Detection or diagnosis of diseases
    • G01N2800/52—Predicting or monitoring the response to treatment, e.g. for selection of therapy based on assay results in personalised medicine; Prognosis
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00—Detection or diagnosis of diseases
    • G01N2800/56—Staging of a disease; Further complications associated with the disease

Definitions

  • the present invention relates to proteins Cobll1, PACSIN2, and SH3BP1, which are biomarkers for diagnosis of chronic myeloid leukemia (CML). More specifically, the present invention relates to a method for diagnosing the progression stage of CML through each of the biomarkers or their interaction, and for diagnosing whether a CML patient exhibits resistance to a tyrosine kinase inhibitor, which is an existing CML treatment.
  • CML chronic myeloid leukemia
  • Leukemia refers to a disease in which leukocytes proliferate into tumors. Types of leukemia can be divided into myeloid leukemia and lymphocytic leukemia according to the white blood cells from which leukemia originates, and are divided into acute leukemia and chronic leukemia according to the progression rate. The clinical manifestations of leukemia vary depending on the type of disease and the nature of the cells involved. Lymphoblastic leukemia is caused by lymphatic blood cells, myeloid leukemia by bone marrow blood cells, and chronic myelogenous leukemia is caused by malignant clones of mutated hematopoietic stem cells (HSC).
  • HSC mutated hematopoietic stem cells
  • chronic myelogenous leukemia is a malignant blood disease in which various blood cells, which are abnormally increased by massive proliferation of hematopoietic stem cells in the bone marrow, invade peripheral blood or other organs, and is a malignant blood cancer that occurs mainly in adults.
  • Chronic myelogenous leukemia progresses through three clinical stages: a chronic phase (CP), an accelerated phase (AP), and a blast crisis (BC).
  • CP chronic phase
  • AP accelerated phase
  • BC blast crisis
  • the most common method for diagnosing chronic myelogenous leukemia is to detect the Philadelphia chromosome through a chromosome examination.
  • a translocation between chromosome 9 and chromosome 22 is found, and the translocation is a part of the abl (abelson oncogene) gene present at the q34 position of chromosome 9, chromosome 22 q11.2. It is formed by translocating to the bcr (break point cluster region) gene present at the position, and this rearrangement is called BCR-ABL1 rearrangement.
  • the translocation leading to the BCR-ABL1 fusion gene is a major cause of the initiation of CML
  • the BCR-ABL1 fusion gene encodes the BCR-ABL1 fusion protein, a constitutively active tyrosine kinase.
  • Imatinib is the first tyrosine kinase inhibitor (TKI) targeting BCR-ABL1 and has been shown to be very effective in treating CML.
  • TKI tyrosine kinase inhibitor
  • imatinib has a problem in that it cannot completely remove CML clones due to the resistance and insensitivity of primitive CML cells to imatinib treatment.
  • nilotinib has been used as a TKI for CML treatment.
  • BCR-ABL1 kinase dependent or independent While the majority of patients develop resistance through BCR-ABL1 kinase-dependent mechanisms such as point mutation or amplification, the presence of BCR-ABL1 independent resistance suggests that there are other mechanisms of TKI resistance.
  • Cobll1 (Cordon-bleu protein-like 1) protein is known as a negative regulator of apoptosis and is associated with low insulin resistance.
  • CML patients with high Cobll1 expression have poor clinical results.
  • the expression of Cobll1 protein was significantly increased in the acute phase of CML, and it was confirmed that the Cobll1 protein was associated with the progression of CML to the acute phase, and it was also studied to have resistance to TKI upon expression of Cobll1 (patent Document 1).
  • Cobll1 is known to induce TKI resistance and blastic transformation through activation of the NF- ⁇ B signaling pathway in CML (Non-Patent Document 1).
  • PACSIN2 Protein kinase C and casein kinase substrate in neurons protein 2
  • PACSIN2 is a commonly expressed cytoplasmic adapter protein. It has an N-terminal F-BAR domain and a C-terminal SH3 domain, and is highly conserved in vertebrates.
  • PACSIN2 is known to act in cell migration, caveolae formation, and receptor internalization. PACSIN2 is involved in endocytosis by interacting with several proteins including dynamin-2, N-WASP and synaptojanin through the SH3 domain.
  • SH3BP1 SH3 Domain Binding Protein 1
  • SH3BP1 SH3 Domain Binding Protein 1
  • the SH3BP1 protein was found to be important in cell motility by binding to the exocyst complex that tethers secretory vesicles to the plasma membrane. The protein can promote metastasis in human liver cancer cells and tissues.
  • Patent Document 0001 Korean Patent Registration No. 10-1820572
  • Non-Patent Document 0001 Han, S., et al. Cobll1 is linked to drug resistance and blastic transformation in chronic myeloid leukemia. Leukemia 31, 1532 (2017).
  • An object of the present invention is to provide a biomarker protein related to chronic myelogenous leukemia.
  • an object of the present invention is to provide a method for effectively diagnosing whether chronic myelogenous leukemia progresses to the acute phase by measuring the expression level of the biomarker protein.
  • the present invention provides a method for effectively diagnosing whether a patient with chronic myelogenous leukemia exhibits resistance to a tyrosine kinase inhibitor, an existing treatment for chronic myelogenous leukemia, by measuring the expression level of the biomarker protein or their interaction. The purpose.
  • Cobll1, PACSIN2, and SH3BP1 proteins as biomarkers, it is possible to more effectively diagnose whether chronic myelogenous leukemia progresses to the acute phase, treatment resistance to existing tyrosine kinase inhibitors, etc., as well as the existing BCR- Since it can be used to diagnose patients who have not been predicted and diagnosed by measuring the ABL1 gene expression level, it is expected to be used for various progression, drug resistance, and prognosis prediction and diagnosis of chronic myelogenous leukemia.
  • FIGS. 1 to 26 are diagrams showing the experimental process of Example 1 or results thereof, showing that PACSIN2 is a novel binding protein of Cobll1.
  • FIG. 1 is a schematic diagram of a mass spectrometry method and a yeast protein hybrid method for quantitative analysis.
  • FIG. 5 shows the labeled protein expression vector was co-transformed with yeast AH109 cells, and growing colonies were evaluated in high stringent medium. Blue colonies on the selection medium indicate a positive interaction.
  • 6 and 7 show the interaction between overexpressed or endogenous Cobll1 and PACSIN2 in K562 cells.
  • WT wild-type Cobll1 or PACSIN2 and its internal deletion mutations. Residue numbers are indicated above the diagram.
  • Cobll1-2A and -3A represent point mutations in which two and three proline-rich motifs of Cobll1 are mutated, respectively.
  • FIGs 17-19 show the interaction between GST-PACSIN2 SH3 and the overexpressed Cobll1-WT or Cobll1-3A mutation (3A).
  • Figure 20 shows the interaction between overexpressed Cobll1-WT or Cobll1-3A and PACSIN2.
  • Figure 21 shows the HSQC spectrum of the 1H-15N PACSIN2 SH3 domain. Assigned resonance is indicated.
  • 26 is a schematic diagram of the structure of the binding domains of Cobll1 and PACSIN2.
  • 27 to 39 are diagrams showing the experimental process or results thereof of Example 2, showing that PACSIN2 regulates nilotinib resistance in K562 cells.
  • FIGS. 27 and 28 show that knock-down of PACSIN2 attenuates apoptosis induced by nilotinib in K562 cells.
  • Figure 27 shows the results of FACS analysis in K562 cells using siRNA of PACSIN2.
  • 28 is a bar graph showing the percentage of apoptotic cells.
  • 29 and 30 show that PACSIN2 overexpression sensitized K562 cells to nilotinib-induced apoptosis. 29 shows the results of FACS analysis of K562 cells expressing the labeled gene. 30 is a bar graph showing the percentage of apoptotic cells.
  • 31 to 33 show that the expression of siRNA-resistant Myc-PACSIN2 in K562 cells recovers nilotinib-induced apoptosis.
  • 31 is a diagram of the Cobll1 siRNA-resistant Myc-PACSIN2 plasmid.
  • 32 shows the results of FACS analysis of K562 cells expressing the labeled gene.
  • 33 is a bar graph showing the percentage of apoptotic cells.
  • 34 and 35 show that the deletion mutation in the N-terminal region of Cobll1 is important in restoring the effect of PACSIN2 on nilotinib sensitivity.
  • 34 shows the results of FACS analysis of K562 cells expressing the labeled gene.
  • 35 is a bar graph showing the percentage of apoptotic cells.
  • 36 and 37 show that SH3 of PACSIN2 is a major domain of nilotinib sensitivity.
  • 36 shows the results of FACS analysis of K562 cells expressing the labeled gene.
  • 37 is a bar graph showing the percentage of apoptotic cells.
  • 38 and 39 show that mutations in the proline-rich region of Cobll1 do not recover the effect of PACSIN2 on nilotinib sensitivity. 38 shows the results of FACS analysis of K562 cells expressing the labeled gene. 39 is a bar graph showing the percentage of apoptotic cells.
  • FIGs 40 to 65 are diagrams showing the experimental process of Examples 3 and 4 or the results thereof, SH3BP1 is a new binding protein of PACSIN2, PACSIN2 protein through its own SH3 domain SH3BP1 and Cobll1 and show that it binds with competition.
  • 40 is a schematic diagram of tandem affinity purification for mass spectrometry.
  • Figure 44 shows the interaction between GST-PACSIN2 SH3 and overexpressed SH3BP1.
  • Figures 45 and 46 show diagrams of predicted proline-rich regions and SH3BP1.
  • SH3BP1-DPD2 represents a deletion mutation in which all five proline-rich motifs of SH3BP1 are deleted.
  • Figure 50 shows the interaction of overexpressed SH3BP1-WT or SH3BP1-DPD2 mutations with PACSIN2.
  • Figures 51 and 52 show HSQC spectra of the PACSIN2 SH3 domain in the presence of SH3BP1-CT ( Figure 51) and Cobll1-NT ( Figure 52). The part with many factors was enlarged. Residues that are heavily affected are indicated separately, and broadened residues are indicated by an asterisk.
  • Figure 54 shows that SH3BP1 overexpression attenuates nilotinib-induced apoptosis in K562 cells.
  • Figure 55 shows that knock-down of SH3BP1 made K562 cells sensitive to nilotinib-induced apoptosis.
  • Figure 56 shows GST pull-down analysis using GST-Rac1 and cell lysates transfected with or without Cobll1 expression plasmid.
  • Figure 60 shows the HSQC spectrum of the PACSIN2 SH3 domain in the presence of SH3BP1-CT (blue), Cobll1-NT (red) and two proteins (green).
  • 61 and 62 show the competitive binding of Cobll1 and SH3BP1 to PACSIN2.
  • Figure 63 shows the change in the chemical shift of the PACSIN2 SH3 domain in the competitive binding of Cobll1 and SH3BP1 to PACSIN2.
  • 66 to 73 are diagrams showing the experimental results in Example 5, the PACSIN2-SH3BP1-Rac1a pathway is necessary for normal hematopoiesis in zebrafish, and the Cobll1/PACSIN2/SH3BP1 signaling system indicates that the bone marrow formation is regulated.
  • 66 shows antisense morpholinos (MOs) that inhibit the expression of sh3bp1 and rac1a .
  • FIG. 67 shows mpx WISH images of 28 hpf (28 hours post fertilization; hours post fertilization) embryos and controls injected with sh3bp1 -MO (top panel) and rac1a -MO (bottom panel).
  • FIG. 69 shows WISH images of 28 hpf embryos injected with pacsin2 -MO (top panel) and pacsin2 mRNA (bottom panel).
  • FIG. 71 shows WISH images of 28 hpf embryos to which pacsin2 mRNA (top panel) was not injected and pacsin2 mRNA (bottom panel) was injected.
  • FIG. 72 shows mpx WISH images of 28 hpf cobll1b-MO-injected embryos and cobll1b-MO + pacsin2-MO-injected embryos and non-injected controls.
  • Example 6 are diagrams showing experimental results of Example 6, showing the clinical correlation of the expression of Cobll1/PACSIN2/SH3BP1.
  • 84 to 86 are results of analyzing the expression patterns of three proteins of Cobll1, PACSIN2, and SH3BP1 in patients.
  • 92 shows a schematic diagram of drug resistance and progression of CML according to the expression of Cobll1 / PACSIN2 / SH3BP1.
  • the present invention relates to the protein of Cobll1 (Cordon-bleu protein-like 1), PACSIN2 (Protein kinase C and casein kinase substrate in neurons protein 2), and SH3BP1 (SH3 Domain Binding Protein 1) from biological samples isolated from chronic myelogenous leukemia patients. Measuring the expression level; And comparing the measured protein expression level with the expression level of each protein in the chronic phase of chronic myelogenous leukemia.
  • Cobll1 Coredon-bleu protein-like 1
  • PACSIN2 Protein kinase C and casein kinase substrate in neurons protein 2
  • SH3BP1 SH3 Domain Binding Protein 1
  • the protein is Cobll1+/PACSIN2+/SH3BP1+, Cobll1+/PACSIN2-/SH3BP1+, Cobll1-/PACSIN2-/SH3BP1+, and Cobll1-/PACSIN2-/SH3BP1+, and one or more protein expression patterns selected from the group consisting of.
  • it can be diagnosed as acute phase progression of chronic myelogenous leukemia.
  • the (+) indicates that the protein expression was increased compared to the protein expression level in the chronic phase, and (-) indicates that the protein expression did not change compared to the protein expression level in the chronic period.
  • the present invention also provides a method for diagnosing treatment resistance to a tyrosine kinase inhibitor in a patient, comprising measuring the expression level of PACSIN2 or SH3BP1 protein from a biological sample isolated from an individual.
  • biological sample means any sample capable of confirming the level of expression of gastric proteins in the body. Specifically, it may be blood, plasma, serum, bone marrow, tissue, cells, saliva, sputum, hair, urine, and the like, and may be, for example, blood, bone marrow cells, and the like.
  • the biological sample may be isolated from an individual, and specifically, may be isolated from an individual suspected of developing chronic myelogenous leukemia or the same. However, it is not limited thereto.
  • the "individual” refers to a subject for which the stage of chronic myelogenous leukemia is diagnosed or whether resistance to a tyrosine kinase inhibitor is developed. Specifically, it may be a patient with chronic myelogenous leukemia.
  • the individual may be a mammal, and may be included without limitation, such as humans, cows, horses, pigs, dogs, sheep, goats, or cats.
  • the sensitivity to the tyrosine kinase inhibitor is reduced by reducing the treatment resistance to the tyrosine kinase inhibitor. It is diagnosed as having.
  • the expression of the PACSIN2 protein when the expression of the PACSIN2 protein is unchanged compared to the normal control, or the expression of the SH3BP1 protein is increased compared to the normal control, it is diagnosed as having a therapeutic resistance to a tyrosine kinase inhibitor.
  • the tyrosine kinase inhibitor is a substance that inhibits the activity of tyrosine kinase, and may be used as a target therapeutic agent.
  • it may be imatinib, nilotinib, dasatinib, bosutinib, or ponatinib, and specifically nilotinib.
  • it is not limited thereto.
  • the present invention provides a method for diagnosing treatment resistance to a tyrosine kinase inhibitor in a patient, comprising measuring the interaction of two or more of Cobll1, PACSIN2, and SH3BP1 proteins from a biological sample isolated from a patient with chronic myelogenous leukemia.
  • the binding between the Cobll1 protein and the PACSIN2 protein may be due to the binding of the N-terminal proline-rich region of the Cobll1 protein and the SH3 domain of PACSIN2.
  • the SH3 domain of PACSIN2 may have an amino acid sequence of 430 to 486 of SEQ ID NO: 1.
  • the N-terminal proline-rich region of the Cobll1 protein may have an amino acid sequence of 1 to 410 of SEQ ID NO: 2.
  • it has one or more amino acid sequences selected from the group consisting of the amino acid sequences 18 to 25 of SEQ ID NO: 2, the amino acid sequences 292 to 299 of SEQ ID NO: 2, and the amino acid sequences 361 to 368 of SEQ ID NO: 2, More specifically, it may have an amino acid sequence of 175 to 370 of SEQ ID NO: 2. However, it is not limited thereto.
  • the binding between the SH3BP1 protein and the PACSIN2 protein may be due to the binding of the C-terminal proline-rich region of the SH3BP1 protein to the SH3 domain of PACSIN2.
  • the proline-rich region of the C-terminus of the SH3BP1 protein may have an amino acid sequence of 541 to 701 of SEQ ID NO: 3.
  • the diagnostic method comprises the SH3 domain of PACSIN2; The proline-rich region at the N-terminus of the Cobll1 protein; And it may be to measure the interaction of two or more of the proline-rich region of the C-terminal of the SH3BP1 protein of the SH3BP1 protein.
  • the method of measuring the protein expression level is radioimmunoassay, radioimmunoprecipitation, immunoprecipitation, ELISA (enzyme-linked immunosorbentassay), sandwich assay, real-time PCR. ), reverse transcription-polymerase chain reaction (RT-PCR), or western blotting, but is not limited thereto.
  • the method of measuring the interaction of proteins in the present invention is a yeast protein hybrid method (yeast two hybrid), immunoprecipitation method (immunoprecipitation), co-immunoprecipitation method (co-immunoprecipitation), reverse co-immunoprecipitation method (reverse co- immunoprecipitation), GST pull-down assay, affinity chromoatography, phage display, or immunohistochemistry, but is not limited thereto.
  • the “diagnosis method” may be used in the same meaning as “a method of providing information necessary for diagnosis”. However, it is not limited thereto.
  • the present invention also provides a composition for diagnosis of acute progression of chronic myelogenous leukemia, comprising an agent for measuring the expression levels of Cobll1, PACSIN2, and SH3BP1 proteins in a sample.
  • the formulation may be a formulation capable of specifically binding to a desired protein and easily measuring its level.
  • it may be an antibody, aptamer, or ligand that specifically binds to the protein, but is not limited thereto.
  • the present invention also provides a composition for diagnosing treatment resistance to a tyrosine kinase inhibitor, comprising an agent for measuring the expression level of PACSIN2 or SH3BP1 protein in a sample.
  • the present invention provides a composition for diagnosing treatment resistance to a tyrosine kinase inhibitor, comprising an agent measuring the interaction of two or more of Cobll1, PACSIN2, and SH3BP1 proteins in a sample.
  • composition may further include an arbitrary configuration for measuring the expression level of the protein.
  • composition may be provided in the form of a kit, but is not limited thereto.
  • Cobll1, PACSIN2, and SH3BP1 proteins diagnosis of acute progression of chronic myelogenous leukemia, and diagnosis of treatment resistance to a tyrosine kinase inhibitor are as described above.
  • Cobll1 affects nilotinib sensitivity and regulates hematopoiesis.
  • tandem affinity purification of K562 cell extract was performed using Cobll1 antibody, and yeast protein hybrid method of human bone marrow cDNA library using Cobll1 as a bait (yeast two-hybrid system). ) was performed (Fig. 1).
  • yeast protein hybrid method of human bone marrow cDNA library using Cobll1 as a bait (yeast two-hybrid system). ) was performed (Fig. 1).
  • yeast protein hybrid method of human bone marrow cDNA library using Cobll1 as a bait (yeast two-hybrid system). ) was performed (Fig. 1).
  • yeast protein hybrid method of human bone marrow cDNA library using Cobll1 as a bait
  • Cobll1 and PACSIN2 were confirmed by using yeast protein hybridization method and immunoprecipitation method for overexpressing or endogenous protein in K562 cells (FIGS. 5 to 7).
  • Cobll1 and PACSIN2 deletion mutations were expressed in K562 cells, and the interaction was explored by co-immunoprecipitation (FIGS. 8 and 10). It was found that deletion of amino acids 14-366 of Cobll1 containing the Ubiquitin-like (UBL) domain eliminated the interaction with PACSIN2 (FIG. 9). Reverse co-immunoprecipitation assay showed that amino acids 430-486 (sequence below) of PACSIN2 containing the SH3 domain are important for the interaction with Cobll1 (FIG. 11).
  • Cobll1 Since the SH3 domain is known to interact with the proline-rich motif, the proline-rich motif of Cobll1 was analyzed using SH3 software and MoDPepInt (Modular Domain Peptide Interaction) Server. It was found that Cobll1 has three proline-rich motifs in the N-terminal region, which can form potential PACSIN2 binding sites ( Figures 14 and 15).
  • Peptides corresponding to three proline-rich motifs including residues 18-25, 292-299 and 361-368 of Coblll were synthesized, and each peptide was added to the 15 N-labeled PACSIN2 SH3 domain in various molar ratios. . As shown in Figs. 22 to 24, after addition of the Cobll1 proline-rich peptide to the PACSIN2 SH3 domain, some residues exhibited chemical shift perturbation.
  • Example 2 Control of nilotinib resistance according to the interaction between Cobll1 and PACSIN2
  • nilotinib resistance was restored by overexpression of full-length Cobll1 and PACSIN2, but inhibited when only PACSIN2 was overexpressed in K562 cells.
  • nilotinib resistance was not restored by overexpression of the Cobll1 P3A mutation defective in the interaction with PACSIN2 (FIGS. 38 and 39 ).
  • PACSIN2 binding protein was searched through tandem affinity purification using PACSIN2 as a bait in K562 cells (FIG. 40). Through this, several PACSIN2 binding proteins including PACSIN2 itself, Cobll1, SH3BP1, ARHGAP17, TCOF1, DNM2, and WIPF2 were identified (FIG. 41). Since SH3BP1 contains a proline-rich region capable of binding to the SH3 domain, it was assumed that SH3BP1 could be a new PACSIN2 binding protein.
  • SH3BP1 was co-immunoprecipitate by full-length PACSIN2, not the D4 mutation of the SH3 domain, suggesting that it requires the SH3 domain of PACSIN2 for interaction (Fig. 42).
  • Immunoprecipitation of endogenous PACSIN2 similarly showed an interaction with endogenous SH3BP1 in K562 cells (FIG. 43 ).
  • the purified GST-PACSIN2 SH3 protein in vitro showed a strong interaction with SH3BP1 (Fig. 44).
  • the proline-rich motif of SH3BP1 was analyzed using SH3 software (MoDPepInt server), ELM (Eukaryotic Linear Motif) resource, and BLAST 25,26.
  • SH3 software MoDPepInt server
  • ELM Eukaryotic Linear Motif
  • BLAST 2526 BLAST 2526.
  • MoDPepInt step size 10
  • ELM resource, and BLAST analysis each of 1, 4 (3 class 1 and 1 class II SH3 binding domains) and 1 PACSIN2 SH3 binding motif were generated in SH3BP1. From this, it was predicted that SH3BP1 contained five potential proline-rich motifs capable of interacting with the PACSIN2 SH3 domain (FIGS. 45 and 46 ).
  • each or a combination of deletion and/or point mutations was introduced into each proline-rich motif (FIG. 47 ), and GST pull-down analysis was performed.
  • the SH3BP1 DPD2 mutation in which all five proline-rich motifs are mutated, interacts weakly with the PACSIN2 SH3 domain, while all other SH3BP1 mutations are complete (PRM, PD2 and PD4) or most binding ( PD1 and PD3) were retained ( Figures 48 and 49).
  • SH3BP1-CT the C-terminal region of SH3BP1 (residues 541-701; hereinafter referred to as "SH3BP1-CT") containing all proline-rich motifs was purified.
  • SH3BP1-CT unlabeled SH3BP1-CT was added to the 15 N-labeled PACSIN2 SH3 domain in various molar ratios, a large spectral change was shown (FIG. 51).
  • Cobll1-NT N-terminal portion of Cobll1 (residues 175-370; hereinafter referred to as "Cobll1-NT") containing the second and third proline-rich motifs was purified. Since the size of Cobll1 including all three proline-rich peptides (> 40 kDa) was too large for NMR analysis, the first proline-rich motif was excluded for NMR titration. The first proline-rich motif of Cobll1 is thought to be less important than the other two proline-rich motifs in binding to PACSIN2. Cobll1-1A mutant having a mutation in the first proline-rich motif bound PACSIN2 with similar affinity to wild-type Cobll1 (FIGS. 17 to 19 ).
  • the first proline-rich motif had a very weak interaction with PACSIN2 compared to the other two motifs (FIGS. 22 to 24 ).
  • Most of the residues of the PACSIN2 SH3 domain were greatly affected by Cobll1-NT binding (FIG. 52), and the modified pattern was similar to that of SH3BP1-CT binding.
  • Signals for the residues of the PACSIN2 SH3 domain were shifted and broadened by SH3BP1-CT and Cobll1-NT binding, and the overall chemical shift changes induced by binding of the two proteins were similar in direction and distance (FIGS. 51 to 53). .
  • SH3BP1 acts in nilotinib resistance
  • SH3BP1 was overexpressed or knock-down by siRNA to evaluate its effect on apoptosis.
  • Overexpression of SH3BP1 reduced nilotinib-induced apoptosis in K562 cells by about 3 times (FIG. 54).
  • deficiency of SH3BP1 increased nilotinib-induced apoptosis by about 2 times (FIG. 55).
  • SH3BP1 activates Rac1, and inhibition of Rac1 is known to reduce the proliferation of TKI-resistant CML blast-phase red blood cells. Since SH3BP1 and Cobll1 both interact with PACSIN2, it was hypothesized that Cobll1 activates the Rac1 pathway by releasing SH3BP1 from PACSIN2. Experimental results, consistent with this hypothesis, Cobll1 overexpression activated Rac1 (Fig. 56). In K562 cells, overexpression of wild-type Rac1 together with PACSIN2 restored nilotinib resistance, which was eliminated by overexpression of PACSIN2 alone (FIG. 57). Nilotinib resistance by Rac1 overexpression was worsened by overexpression of the active form of Rac1 (Rac1 V12) (Fig. 57).
  • Example 4 PACSIN2 protein competitively binds to SH3BP1 and Cobll1 through its SH3 domain
  • Cobll1-NT-f the N-terminal region of Cobll1 (residue 1-410; hereinafter referred to as “Cobll1-NT-f”) and SH3BP1-CT containing three proline-rich motifs were used.
  • the dissociation constant (Kd) between the PACSIN2 SH3 domain and Cobll-NT-f was 25.8 nM
  • the dissociation constant (Kd) between the PACSIN2 SH3 domain and SH3BP1-CT was 2.2 ⁇ M. That is, it was confirmed that the binding affinity between the PACSIN2 SH3 domain and Cobll1-NT-f was 85 times higher than the binding affinity between the PACSIN2 SH3 domain and SH3BP1-CT (FIGS. 58 and 59 ).
  • the number of bone marrow cells was decreased in both sh3bp1 and rac1a morphants compared to the control group (FIG. 68 ).
  • increased expression of pacsin2 through mRNA injection reduced the number of mpx- positive primitive bone marrow cells.
  • embryonic bone marrow formation was not changed in pacsin2 morphants (FIGS. 69 to 71 ).
  • Cobll1 is high in BC cells, and that Cobll1 activates the Rac1 pathway by modulating the mutual binding between PACSIN2 and SH3BP1 in CML cells.
  • Cobll1 in CML patient samples , PACSIN2, SH3BP1 expression level and Rac1 activity of the three proteins were confirmed.
  • PACSIN2 a novel binding protein of Cobll1 increases the nilotinib sensitivity of K562 cells.
  • the SH3 domain of PACSIN2 binds to the proline-rich region located at the N-terminus of the Cobll1 protein, both of which play a crucial role in the antagonism of TKI resistance.
  • PACSIN2 also binds in the same SH3 domain as SH3BP1.
  • the SH3BP1 protein reduces the sensitivity of CML to nilotinib, similar to Cobll1 function, through interaction with PACSIN2, which competes with the Cobll1 protein.
  • Cobll1/PACSIN2/SH3BP1 plays an important role in the regulation of bone marrow formation in zebrafish embryogenesis. Furthermore, it was confirmed through the cells of 33 BC-tranformed CML patients that the expression of Cobll1, PACSIN2 and SH3BP1 was significantly related to the blast cell ratio. Expression of these three proteins was not observed in CP cells, but four different expression patterns were observed in BC patients: Cobll1+/PACSIN2+/SH3BP1+, Cobll1+/PACSIN2-/SH3BP1+, Cobll1-/PACSIN2-/SH3BP1+, and Cobll1- /PACSIN2-/SH3BP1-. This suggests that the interaction between Cobll1, PACSIN2 and SH3BP1 is important for conversion to BC, TKI resistance, and normal hematopoietic cell formation.
  • Rhin1 activation induces TKI resistance at the cellular level, promotes HSC migration and self-renewal, and is involved in the onset and maintenance of leukemia.
  • the SH3BP1 protein is known to activate Rac1 to regulate cancer cell behavior.
  • SH3BP1 activates the Rac1 signaling pathway, while PACSIN2 inhibits Rac1 activity through interaction with SH3BP1.
  • Cobll1 preferentially binds to overexpressed PACSIN2 and interferes with the interaction between SH3BP1 and PACSIN2.
  • the freed SH3BP1 activates the Rac1 signaling pathway, inducing TKI resistance and embryonic hematopoietic cell formation.
  • PACSIN2 and SH3BP1 are novel regulators of CML TKI resistance and BC modification.
  • PACSIN2 is a novel tumor suppressor that induces apoptosis by nilotinib by inhibiting the function of the SH3BP1/Rac1 pathway, which can be restored by ectopic expression of Cobll1.
  • the Cobll1/SH3BP1/PACSIN2 axis, which regulates Rac1 activity, is not only a novel biomarker for CML, but can also be a therapeutic target to inhibit disease progression. Accordingly, the present invention can provide new insights for developing diagnostic and treatment strategies for CML.
  • a total of 66 CML samples (26 CP, 1 AP, 39 BC) were obtained from the bone marrow (BM) and peripheral blood (PB) of 41 CML patients. Ten of them had serial samples from CP and BC. Mononuclear cells (MCs) were separated by Ficoll-Paque (GE Healthcare, Waukesha, WI, USA) density gradient centrifugation method. Samples were stored in liquid nitrogen with 10% dimethyl sulfoxide (DMSO, Sigma-Aldrich, St. Louis, MO, USA) in fetal bovine serum (Sigma-Aldrich) and thawed for analysis. All human samples were obtained from Korea Leukemia Bank, and the protocol was approved by the Institutional Review Board. Patient consent was obtained in accordance with the Helsinki Declaration.
  • DMSO dimethyl sulfoxide
  • Sigma-Aldrich fetal bovine serum
  • the K562 cell line was maintained in an RPMI medium supplemented with 10% fetal bovine serum (Gibco, Franklin Lakes, NJ) and 1% penicillin/streptomycin (Gibco) in an atmosphere of 37° C. and 5% CO 2 .
  • the human embryonic kidney 293T (HEK293T) cell line was maintained in DMEM supplemented with 10% fetal bovine serum and 1% penicillin/streptomycin at 37° C., 5% CO 2 atmosphere.
  • the full-length cDNA clone of Cobll1 (Clone ID: 30345650) was purchased from Thermo Scientific (Waltham, MA, USA).
  • the full-length cDNA clone for PACSIN2 (clone ID: hMU008023) was purchased from Korean Human Gene Bank.
  • Myc-PACSIN2, SFB-PACSIN2, Myc-SH3BP1 and SFB-SH3BP1 internal deletion mutations were generated by polymerase chain reaction (PCR).
  • a full-length cDNA clone for Rac1 (clone ID: hMU007586) was purchased from Korean Human Gene Bank. Forms of wild-type and active-type HA-Rac1 were generated by PCR. GST-SH3 was generated by PCR.
  • Nilotinib (Sigma-Aldrich) was reconstituted with 10 mM stock in DMSO and stored at -20°C.
  • siRNA double strands of Cobll1 and PACSIN2 were purchased from IDT (Integrated DNA Technologies Inc., Coralville, IA, USA). The relevant sequence is as follows.
  • siRNAs and plasmids were transfected into cells using electrophoresis. Specifically, K562 cells (6x10 6 or 2x10 6 cells) were electroporated using the Neon Transfection System (MPK10096, Invitrogen, Carlsbad, CA, USA). A total of 20 ⁇ g of plasmid DNA or 200 nM siRNA was added to the cells and electroporated according to the user's protocol (1450 V for 15 ms in 2 pulses), and the transfected cells were treated in prewarmed RPMI medium supplemented with 10% FBS for 48 hours. Cultured.
  • NETN buffer 150 mM NaCl, 0.5 mM EDTA, 50 mM Tris, pH 7.5, 0.5% NP-40
  • NETN buffer 150 mM NaCl, 0.5 mM EDTA, 50 mM Tris, pH 7.5, 0.5% NP-40 was added to the transfected cells.
  • nilotinib was added to the transfected cells and incubated for 48 hours.
  • Apoptosis was analyzed by FACS (fluorescence-activated cell sorting) (BD Bioscience).
  • anti-Cobll1 1:200 as previously known
  • anti-PACSIN2 Sigma-Aldrich, SAB1300127
  • anti-FLAG Sigma-Aldrich, F3165)
  • anti-Myc (Roche, 11814150001) (Roche, Basel, Switzerland), 1: 2000; anti-HA (Roche, 12013819001), 1: 2000; anti- ⁇ -actin (Sigma-Aldrich, A5316), 1:5000; anti-GFP (Clontech 632380) (Clontech, Mountain View, CA, USA), 1:2,000; anti-SH3BP1 (Proteintech, 20541-1-AP), 1:1000.
  • Horseradish peroxidase-conjugated secondary antibody specific for rabbit (Sigma-Aldrich, A0545) or mouse (Sigma-Aldrich, A9917) IgG was diluted 1:2000 and used.
  • Wild-type Zebrafish of AB* strain were reared and maintained in an automatic circulation system (Genomic-Design) at 28.5° C. according to the guidelines of the UNIST Institutional Animal Care and Use Committee (IACUC). (IACUC approval number: UNISTIACUC-15-15). Fertilized and injected embryos were maintained in E3 fish water (0.57 g NaCl, 25.3 mg KCl, 96.6 mg CaCl 2 ⁇ 2H 2 O, 163.3 mg MgSO 4 ⁇ 7H 2 O, in 2 liters of distilled water) until fixation.
  • pacsin2 The cDNA of pacsin2 was synthesized using wild-type zebrafish embryonic RNA and inserted into the PCS2 + vector. Full-length pacsin2 was synthesized through in vitro transcription (mMESSAGE mMACHINE Kit, Ambion).
  • Pacsin2 mRNA was injected into single-cell stage wild-type embryos. Microinjection was performed using a Femtojet 4i microinjector (Eppendorf).
  • the base sequence including the N-terminal region (1-410 and 175-370) of Cobll1 was cloned into the pGEX-6P-2 vector.
  • the SH3 domain of PACSIN2 (430-486) and the C-terminal region of SH3BP1 (541-701) were cloned into pGEX-4T-1 and pET-21a vectors, respectively.
  • the recombinant vector was transformed into E. coli BL21-CodonPlus (DE3) cells, and the transformed cells were cultured in LB medium, and 0.5 mM IPTG was added to express mass.
  • the collected E. coli cells were dissolved in lysis buffer (20 mM Tris-HCl, 500 mM NaCl.
  • GST fusion proteins (Cobll1 and PACSIN2 SH3 domains) are elution buffer (20 mM Tris-HCl, 200 mM NaCl, 5% Glycerol, 10 mM DTT, 0.2 mM TCEP, 1 mM EDTA, 10 mM glutathione) using a GST column. pH 7.0) was separated and purified.
  • GST-tag was removed using PreScission protease (Thermo Fisher Scientific) or Thrombin, and then increased salt (up to 1 M NaCl) and purified by ion exchange chromatography. After that, it was purified using a Hiload 16/600 Superdex 75/200 prep grade column (GE Healthcare) in a final buffer (50 mM sodium phosphate, 100 mM NaCl, 1 mM TCEP, pH 6.3). In the case of the poly-histidine tag-fused protein (SH3BP1), the concentration of imidazole was increased (up to 1 M imidazole) and separated and purified using a Ni column. After that, it was purified using a Hiload 16/600 Superdex 75 prep grade column (GE Healthcare).
  • Cobll1 and SH3BP1 were performed under conditions of 0.0390625, 0.078125, 0.15625, 0.3125, 0.625, 1.25, 2.5, 5, 10 ⁇ M and 0.625, 1.25, 2.5, 5, 10, 20, and 40 ⁇ M, respectively.
  • the sensor surface was regenerated using 100 mM NaOH. Binding curves were analyzed using Scrubber2 software (BioNavis).
  • the PACSIN2 SH3 domain labeled with 15 N or 15 N, 13 C was expressed using M9 minimal medium using 15 N-enriched ammonium chloride or 13 C-enriched glucose, and purified by the same method as the unlabeled PACSIN2 SH3 domain. .
  • Using a Bruker AVANCE II 600 MHz spectrometer 1 H- 15 N HSQC and HNCACB of the PACSIN2 SH3 domain were measured under 298K conditions, and backbone assignment was performed by analyzing these.
  • 1 H- 15 N HSQC NMR titration experiment was performed using a Bruker AVANCE II 800 MHz spectrometer under 298K conditions.
  • the synthesized Cobll1-derived proline-rich peptide (AKAPLPPAETK, the first proline-rich peptide; RRAPLPPMPAS, the second proline-rich peptide; RKAPSPPSKIP, the third proline-rich peptide) was purchased from ANYGEN and the final buffer (50 mM sodium phosphate, 100 mM NaCl, 1 mM TCEP, pH 6.3) was dissolved at 9 mM.
  • the ratio of PACSIN2 SH3 domain: first or third proline-rich peptide is as follows: 1:0.5, 1:2, 1:8 for the first proline-rich peptide; 1:0.5, and 1:2 for the third proline-rich peptide.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Immunology (AREA)
  • Molecular Biology (AREA)
  • Hematology (AREA)
  • Urology & Nephrology (AREA)
  • Biomedical Technology (AREA)
  • Chemical & Material Sciences (AREA)
  • Physics & Mathematics (AREA)
  • Cell Biology (AREA)
  • Medicinal Chemistry (AREA)
  • Pathology (AREA)
  • Food Science & Technology (AREA)
  • Biotechnology (AREA)
  • Microbiology (AREA)
  • Analytical Chemistry (AREA)
  • Biochemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • General Physics & Mathematics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Hospice & Palliative Care (AREA)
  • Oncology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Bioinformatics & Computational Biology (AREA)
  • Biophysics (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Investigating Or Analysing Biological Materials (AREA)

Abstract

본 발명은 만성 골수성 백혈병(chronic myeloid leukemia; CML)의 진단용 바이오마커인 Cobll1, PACSIN2, SH3BP1 단백질에 관한 것이다. 보다 구체적으로, 본 발명은 상기 바이오마커 각각 또는 이들의 상호작용을 통해 CML의 진행 단계를 진단하고, CML 환자가 기존 CML 치료제인 타이로신 키나아제 억제제에 내성을 나타내는지 여부를 진단하는 방법에 관한 것이다.

Description

만성 골수성 백혈병의 진단용 바이오마커
본 발명은 만성 골수성 백혈병(chronic myeloid leukemia; CML)의 진단용 바이오마커인 Cobll1, PACSIN2, SH3BP1 단백질에 관한 것이다. 보다 구체적으로, 본 발명은 상기 바이오마커 각각 또는 이들의 상호작용을 통해 CML의 진행 단계를 진단하고, CML 환자가 기존 CML 치료제인 타이로신 키나아제 억제제에 내성을 나타내는지 여부를 진단하는 방법에 관한 것이다.
백혈병(leukemia)은 백혈구가 종양성으로 증식하는 질환을 총칭한다. 백혈병의 종류는 백혈병이 기원하는 백혈구에 따라 골수성 백혈병과 림프성 백혈병으로 나눌 수 있고, 진행속도에 따라 급성 백혈병과 만성 백혈병으로 나뉜다. 백혈병의 임상학적 양상은 질환의 유형과 침범한 세포의 성질에 따라 다양하다. 림프성 백혈병은 림프계 혈액세포가, 골수성 백혈병은 골수계 혈액세포가, 그리고 만성 골수성 백혈병은 변이가 생긴 조혈모세포(hematopoietic stem cell; HSC)의 악성 클론들에 의해서 발생한다.
특히, 만성 골수성 백혈병은 조혈모세포가 골수 내에서 대량 증식하여 비정상적으로 증가한 각종 혈구 세포가 말초 혈액이나 기타 장기를 침습하는 악성 혈액 질환으로 성인에서 주로 발병하는 악성 혈액암이다. 만성 골수성 백혈병은 만성기(chronic phase; CP), 가속기(accelerated phase; AP) 및 급성기(blast crisis; BC)의 세 가지 임상 단계를 통해 진행된다. 만성 골수성 백혈병의 진단을 위한 가장 일반적인 방법은 염색체 검사를 통해서 필라델피아 염색체를 발견하는 것이다. 실제 만성 골수성 백혈병 환자의 95% 정도에서 9번 염색체와 22번 염색체 사이의 전좌가 발견되며, 상기 전좌는 9번 염색체의 q34 위치에 존재하는 abl(abelson oncogene) 유전자 일부가 22번 염색체 q11.2 위치에 존재하는 bcr(break point cluster region) 유전자로 전위되어 형성되는데, 이러한 재배열을 BCR-ABL1 재배열(BCR-ABL1 rearrangement)이라고 한다.
일반적으로, BCR-ABL1 융합 유전자를 초래하는 전위는 CML의 개시의 주요 원인이며, BCR-ABL1 융합 유전자는 항상적으로 활성화된(constitutively active) 티로신 키나아제인 BCR-ABL1 융합 단백질을 암호화한다. 이매티닙(imatinib)은 BCR-ABL1을 표적으로 하는 최초의 티로신 키나아제 억제제(tyrosine kinase inhibitor; TKI)로서, CML 치료에 매우 효과적임이 밝혀졌다. 그러나 이매티닙은 이매티닙 치료에 대한 primitive CML 세포의 내성(resistance) 및 비감수성(insensitivity)으로 인해, CML 클론을 완전히 제거할 수 없다는 문제가 있다. 그 외에도, 닐로티닙(nilotinib)이 TKI으로서 CML 치료에 사용되고 있다. ATP 및 allosteric 부위 억제제를 포함한 차세대 BCR-ABL TKI의 개발에도 불구하고 일부 환자는 급성기로의 진행 단계에서 여전히 TKI에 대한 내성을 나타낸다. 이러한 내성은 BCR-ABL1 키나아제 의존성이거나 또는 비의존성인 것으로 밝혀졌다. 대다수의 환자는 점 돌연변이(point mutation)나 증폭(amplification)과 같은 BCR-ABL1 키나아제 의존성 메커니즘을 통해 내성을 나타내는 반면, BCR-ABL1 비의존성 내성의 존재는 TKI 내성의 다른 메커니즘이 있음을 시사한다.
Cobll1(Cordon-bleu protein-like 1) 단백질은 세포사멸의 음성 조절인자(negative regulator)로 알려져 있으며 낮은 인슐린 내성과 관련되어 있다. 또한, Cobll1의 발현이 높은 CML 환자의 경우 임상 결과가 좋지 않다고 알려져 있다. 특히 Cobll1 단백질의 발현은 CML의 급성기에서 확연히 증가하여, Cobll1 단백질이 CML의 급성기로의 진행과 연관되어 있음이 확인된 바 있으며, 또한 Cobll1의 발현시 TKI에 내성을 갖는 것으로 연구된 바 있다(특허문헌 1). 나아가 Cobll1은 CML에서 NF-κB 신호 전달 경로의 활성화를 통해 TKI 내성과 모세포 전환(blastic transformation)을 유도하는 것으로 알려져 있다(비특허문헌 1).
PACSIN2(Protein kinase C and casein kinase substrate in neurons protein 2)는 흔하게 발현되는 세포질 아답터 단백질(cytoplasmic adapter protein)이다. 이는 N-말단 F-BAR 도메인 및 C-말단 SH3 도메인을 보유하며, 척추동물에서 고도로 보존되어 있다. PACSIN2는 세포 이동, caveolae 형성, 및 수용체 내재화(receptor internalization) 작용을 하는 것으로 알려져 있다. PACSIN2는 SH3 도메인을 통해 dynamin-2, N-WASP 및 synaptojanin을 비롯한 여러 단백질과 상호작용하여 내포작용에 관여한다.
SH3BP1(SH3 Domain Binding Protein 1) 단백질은 Rac 신호를 조절하고 cytoskeletal dynamics, 세포 운동성 및 상피 접합체 형성 등에 관여한다. SH3BP1 단백질은 원형질막에 분비성 소포를 연결하는(tether) exocyst 복합체와 결합하여 세포 운동성에서 중요한 것으로 확인되었다. 상기 단백질은 사람의 간암 세포와 조직에서 전이를 촉진할 수 있다.
그러나 현재까지 CML에서의 PACSIN2 및 SH3BP1 단백질의 기능, 특히, Cobll1, PACSIN2, SH3BP1 단백질 사이의 상호작용에 대해서는 전혀 알려진 바 없다.
(특허문헌 0001) 한국등록특허 제10-1820572호
(비특허문헌 0001) Han, S., et al. Cobll1 is linked to drug resistance and blastic transformation in chronic myeloid leukemia. Leukemia 31, 1532 (2017).
종래에는 BCR-ABL의 재배열을 확인하여 만성 골수성 백혈병을 진단하고 예후를 예측하고자 하는 많은 연구들이 활발히 진행되었다. 그러나 BCR-ABL1 유전자에서 돌연변이가 발생하지 않은 백혈병들이 빈번히 발생하고 있으며, 특히 만성 골수성 백혈병에서 급성기로 전환되는 기작 및 이를 위한 진단 방법들에 대한 연구는 거의 없는 실정이다.
본 발명에서는 만성 골수성 백혈병과 관련된 바이오마커 단백질을 제공하는 것을 목적으로 한다.
또한, 본 발명은 상기 바이오마커 단백질의 발현 수준을 측정하여 만성 골수성 백혈병의 급성기로의 진행 여부를 효과적으로 진단하는 방법을 제공하는 것을 목적으로 한다.
또한, 본 발명은 상기 바이오마커 단백질의 발현 수준 또는 이들의 상호작용을 측정하여, 만성 골수성 백혈병 환자가 기존 만성 골수성 백혈병 치료제인 타이로신 키나아제 억제제에 내성을 나타내는지 여부를 효과적으로 진단하는 방법을 제공하는 것을 목적으로 한다.
본 발명에서는 Cobll1, PACSIN2, SH3BP1 단백질을 바이오마커로 이용함으로써, 만성 골수성 백혈병의 급성기로의 진행 여부, 기존의 타이로신 키나아제 억제제에 대한 치료 내성 등을 보다 효과적으로 진단할 수 있을 뿐 아니라, 기존의 BCR-ABL1 유전자 발현량 측정에 의하여 예측 및 진단되지 못했던 환자들을 진단하는데 사용될 수 있기 때문에, 만성 골수성 백혈병의 다양한 진행, 약제 저항성, 예후 예측 및 진단 등에 사용될 수 있을 것으로 기대된다.
도 1 내지 26은 실시예 1의 실험 과정 또는 그의 결과를 보여주는 도면으로서, PACSIN2가 Cobll1의 새로운 결합 단백질임을 보여준다.
도 1은 정량 분석을 위한 질량 분광 분석법 및 효모 단백질 잡종법의 모식도이다.
도 2 내지 4는 Cobll1 단백질의 질량 분광 분석법 또는 효모 단백질 잡종법으로 확인된 단백질을 나타낸다.
도 5는 표지된 단백질 발현 벡터를 효모 AH109 세포로 공동 형질전환시키고, 성장하는 콜로니를 high stringent 배지에서 평가하였다. 선택 배지상의 청색 콜로니는 양성 상호작용을 나타낸다.
도 6 및 7은 K562 세포에서 과발현 또는 내인성 Cobll1과 PACSIN2 사이의 상호작용을 나타낸다.
도 8 및 10은 야생형 (WT) Cobll1 또는 PACSIN2 및 그 내부 결실 돌연변이의 모식도이다. 잔기 번호를 다이어그램 위에 표시하였다.
도 9 및 11은 Cobll1과 PACSIN2의 상호작용하는 도메인을 동정한 결과를 보여준다.
도 12 및 13은 Cobll1과 PACSIN2의 상호작용하는 도메인을 GST-pull down 분석을 통해 추가로 확인한 결과를 보여준다.
도 14는 Cobll1의 예상되는 프롤린-풍부 영역을 나타낸다.
도 15는 Cobll1의 프롤린-풍부 영역의 다이어그램을 나타낸다.
도 16은 Cobll1의 프롤린-풍부 영역의 돌연변이의 요약이다. 주요 프롤린 잔기는 알라닌으로 돌연변이되었다. Cobll1-2A 및 -3A는 Cobll1의 2개 및 3개의 프롤린-풍부 모티프가 각각 돌연변이된 점 돌연변이를 나타낸다.
도 17 내지 19는 GST-PACSIN2 SH3와 과발현 Cobll1-WT 또는 Cobll1-3A 돌연변이(3A) 사이의 상호작용을 나타낸다.
도 20은 과발현 Cobll1-WT 또는 Cobll1-3A와 PACSIN2 사이의 상호작용을 나타낸다.
도 21은 1H-15N PACSIN2 SH3 도메인의 HSQC 스펙트럼을 보여준다. Assigned resonance가 표기되었다.
도 22 내지 24는 Cobll1에서 유래된 제2 프롤린-풍부 펩타이드의 존재하에 PACSIN2 SH3 도메인의 스펙트럼 변화를 나타낸다. 펩타이드 결합에 의해 크게 영향받는 잔기가 표시되어 있다.
도 25는 3 개의 Cobll1 프롤린-풍부 펩타이드 (PACSIN2 SH3:프롤린-풍부 펩타이드 = 1:4)와의 결합시, PACSIN2 SH3 도메인의 화학적 변화(CSP, ΔδHN.N)의 값을 보여준다. 높은 CSP 값을 나타내는 잔기를 표시하였고, 사라진 잔기(N480)은 빨간색 별표로 강조 표시하였다.
도 26은 Cobll1과 PACSIN2의 결합 도메인의 구조를 개략화한 것이다.
도 27 내지 39는 실시예 2의 실험 과정 또는 그의 결과를 보여주는 도면으로서, PACSIN2가 K562 세포에서 닐로티닙 내성을 조절함을 보여준다.
도 27 및 28은 PACSIN2의 knock-down은 K562 세포에서 닐로티닙에 의해 유발된 세포사멸을 약화시킴을 나타낸다. 도 27은 PACSIN2의 siRNA를 사용하여 K562 세포에서의 FACS 분석 결과를 나타낸다. 도 28은 세포사멸된 세포의 백분율을 나타내는 막대 그래프이다.
도 29 및 30은 PACSIN2 과발현이 K562 세포를 닐로티닙 유도 세포사멸에 대해 민감화(sensitize)하였음을 보여준다. 도 29는 표지된 유전자가 발현된 K562 세포에 대한 FACS 분석 결과를 나타낸다. 도 30은 세포사멸된 세포의 백분율을 나타내는 막대 그래프이다.
도 31 내지 33은 K562 세포에서 siRNA-내성 Myc-PACSIN2의 발현이 닐로티닙 유도된 세포사멸을 회복(rescue)시킴을 나타낸다. 도 31은 Cobll1 siRNA-내성 Myc-PACSIN2 플라스미드의 다이어그램이다. 도 32는 표지된 유전자가 발현된 K562 세포에 대한 FACS 분석 결과를 나타낸다. 도 33은 세포사멸된 세포의 백분율을 나타내는 막대 그래프이다.
도 34 및 35는 Cobll1의 N-말단 영역의 결손 돌연변이가 닐로티닙 감수성에 대한 PACSIN2의 효과를 회복(rescue)함에 있어서 중요함을 나타낸다. 도 34은 표지된 유전자가 발현된 K562 세포에 대한 FACS 분석 결과를 나타낸다. 도 35는 세포사멸된 세포의 백분율을 나타내는 막대 그래프이다.
도 36 및 37은 PACSIN2의 SH3은 닐로티닙 감수성의 주요 도메인임을 나타낸다. 도 36은 표지된 유전자가 발현된 K562 세포에 대한 FACS 분석 결과를 나타낸다. 도 37은 세포사멸된 세포의 백분율을 나타내는 막대 그래프이다.
도 38 및 39는 Cobll1의 프롤린-풍부 부위의 돌연변이는 닐로티닙 감수성에 대한 PACSIN2의 효과를 회복(rescue)하지 못함을 나타낸다. 도 38은 표지된 유전자가 발현된 K562 세포에 대한 FACS 분석 결과를 나타낸다. 도 39는 세포사멸된 세포의 백분율을 나타내는 막대 그래프이다.
위 모든 그래프는 3회의 독립적인 실험의 평균을 나타내며, 오차 막대는 SEM을 나타낸다. Cobll1 및 PACSIN2의 발현은 웨스턴 블롯에 의해 확인되었다.
도 40 내지 65는 실시예 3 및 4의 실험 과정 또는 그의 결과를 보여주는 도면으로서, SH3BP1가 PACSIN2의 새로운 결합 단백질이며, PACSIN2 단백질은 자신의 SH3 도메인을 통하여 SH3BP1 및 Cobll1와 경쟁으로 결합함을 나타낸다.
도 40은 질량 분석을 위한 tandem affinity purification의 모식도이다.
도 41은 질량 분광 분석법으로 확인된 단백질을 보여준다.
도 42는 PACSIN2가 SH3 도메인을 통해 SH3BP1에 결합함을 보여준다.
도 43은 내인성 SH3BP1과 PACSIN2 사이의 상호작용을 나타낸다.
도 44는 GST-PACSIN2 SH3과 과발현된 SH3BP1 사이의 상호작용을 나타낸다.
도 45 및 46은 예측된 프롤린-풍부 영역과 SH3BP1의 다이어그램을 나타낸다.
도 47은 SH3BP1의 프롤린-풍부 영역의 돌연변이를 요약한 것이다. 주요 프롤린 잔기가 알라닌으로 돌연변이되거나 선택된 영역이 결실되었다. SH3BP1-DPD2는 SH3BP1의 5개의 프롤린-풍부 모티프가 모두 결실된 결실 돌연변이를 나타낸다.
도 48 및 49는 SH3BP1 돌연변이에 따른 PACSIN2의 상호작용을 나타낸다.
도 50은 과발현된 SH3BP1-WT 또는 SH3BP1-DPD2 돌연변이와 PACSIN2와의 상호작용을 나타낸다.
도 51 및 52는 SH3BP1-CT (도 51) 및 Cobll1-NT (도 52)의 존재하에 PACSIN2 SH3 도메인의 HSQC 스펙트럼을 나타낸다. 인자가 많은 부분은 확대하였다. 영향을 많이 받는 잔기는 별도 표기하였고, 확장된(broadened) 잔기는 별표로 표시하였다.
도 53은 SH3BP1-CT 및 Cobll1-NT와의 결합시 PACSIN2 SH3 도메인의 CSP 값을 나타낸다. SH3BP1-CT 및 Cobll1-NT 존재하에서 사라지는 잔기는 각각 파란색 별표와 빨간색 별표로 표시하였다.
도 54는 SH3BP1 과발현이 K562 세포에서 닐로티닙 유도된 세포사멸을 약화시킴을 나타낸다.
도 55는 SH3BP1의 knock-down이 K562 세포를 닐로티닙 유도된 세포사멸에 민감하게 하였음을 나타낸다.
도 56은 Cobll1 발현 플라스미드로 형질감염되거나 또는 되지 않은 세포 용해물 및 GST-Rac1을 사용한 GST pull-down 분석을 보여준다.
도 57은 Rac1의 과발현은 K562 세포에서 닐로티닙 유도된 세포사멸을 약화시킴을 보여준다.
도 58은 PACSIN2 SH3 도메인과 Cobll1-NT-f 사이의 해리 상수를 보여준다.
도 59는 PACSIN2 SH3 도메인과 SH3BP1-CT 사이의 해리 상수를 보여준다.
도 60은 SH3BP1-CT (청색), Cobll1-NT (적색) 및 두 단백질(녹색)의 존재하의 PACSIN2 SH3 도메인의 HSQC 스펙트럼을 나타낸다.
도 61 및 62는 PACSIN2에 대한 Cobll1과 SH3BP1의 경쟁적 결합을 보여준다.
도 63은 PACSIN2에 대한 Cobll1과 SH3BP1의 경쟁적 결합에서의 PACSIN2 SH3 도메인의 화학적 이동의 변화를 나타낸다.
도 64 및 65는 Cobll1의 전장 및 N-말단 영역은 PACSIN2와 SH3BP1 사이의 생체 내 결합을 억제함을 나타낸다.
위 모든 그래프는 3회의 독립적인 실험의 평균으로서 세포사멸된 세포의 백분율을 나타내며, 오차 막대는 SEM을 나타낸다. 단백질의 발현은 웨스턴 블롯에 의해 확인되었다.
도 66 내지 73은 실시예 5에서의 실험 결과를 보여주는 도면으로서, PACSIN2-SH3BP1-Rac1a 경로는 제브라 피쉬의 정상적인 조혈에 필요하며, Cobll1/PACSIN2/SH3BP1 신호전달 체계는 골수 형성을 조절함을 나타낸다.
도 66은 sh3bp1과 rac1a 발현을 억제하는 antisense morpholinos (MOs)를 나타낸다.
도 67은 sh3bp1-MO (상단 패널)과 rac1a-MO (하단 패널)가 주입된 28 hpf(수정 후 28 시간; hours post fertilization) 배아 및 대조군의 mpx WISH 이미지를 나타낸다.
도 68은 미주입된 대조군과 비교하여, sh3bp1 morphants (미주입 대조군, n = 25; sh3bp1-MO, n = 25; ** P value <0.01, 대조군과 유의한 차이가 있음, Student 's t-test) 및 rac1a morphants (미주입 대조군, n = 12; rac1a-MO, n = 12; ** P value <0.01, 대조군과 유의한 차이가 있음, Student's t-test)의 mpx-양성 세포의 정량화된 그래프를 보여준다.
도 69는 pacsin2-MO (상단 패널) 및 pacsin2 mRNA (하단 패널)가 주입된 28 hpf 배아의 WISH 이미지를 나타낸다. 도 71은 pacsin2 mRNA (상단 패널)가 주입되지 않은 것과 pacsin2 mRNA (하단 패널)가 주입된 28 hpf 배아의 WISH 이미지를 나타낸다.
도 70은 pacsin2 morphants 주입 배아 (미주입 대조군, n = 20; pacsin2-MO, n = 20; n.s. P value> 0.05, 대조군과 유의한 차이가 없음, Student 's t-test) 및 pacsin2 mRNA 주입 배아 (미주입 대조군, n = 12; pacsin2-mRNA 주입군, n = 12; ** P 값 <0.01, 대조군과 유의한 차이가 있음, Student 's t-test)의 mpx-양성 세포의 정량화된 그래프를 보여준다.
도 72는 28 hpf cobll1b-MO 주입된 배아 및 cobll1b-MO + pacsin2-MO가 함께 주입된 배아와, 미주입된 대조군의 mpx WISH 이미지를 나타낸다.
도 73은 대조군과 비교하여, cobll1b morphants 및 cobIIlb + pacsin2 morphants으로부터의 mpx-양성 세포의 정량화된 그래프를 보여준다(미주입 대조군, n = 15; cobll1b-MO, n = 15; cob1l1b-MO + pacsin2-MO, n = 15; *** P value <0.001, 대조군 및 cobll1b-morphants와 유의한 차이가 있음, Student 's t-test).
도 74 내지 92는 실시예 6의 실험 결과를 보여주는 도면으로서, Cobll1/PACSIN2/SH3BP1 발현의 임상적 상관 관계를 나타낸다.
도 74 내지 83은 CP에서 BC로 진행되는 10명의 CML 환자 샘플에서 Cobll1, PACSIN2, SH3BP1의 세 단백질들의 발현을 확인한 결과를 보여준다.
도 84 내지 86은 환자에서 Cobll1, PACSIN2, SH3BP1의 세 단백질들의 발현 양상을 분석한 결과이다.
도 87은 Cobll1/PACSIN2/SH3BP1 세 단백질의 발현이 Rac1 활성화를 조절하는지 여부를 실험한 결과를 나타낸다.
도 88 내지 91은 Kaplan-Meier 생존 곡선을 사용하여 24명의 환자에서 Cobll1 / PACSIN2 / SH3BP1 발현에 따른 12 개월 전체 생존 확률을 나타낸다.
도 92는 Cobll1 / PACSIN2 / SH3BP1 발현에 따른 CML의 약물 내성 및 진행에 대한 모식도를 나타낸다.
본 발명은 만성 골수성 백혈병 환자로부터 분리한 생물학적 시료로부터 Cobll1 (Cordon-bleu protein-like 1), PACSIN2 (Protein kinase C and casein kinase substrate in neurons protein 2), 및 SH3BP1 (SH3 Domain Binding Protein 1) 단백질의 발현 수준을 측정하는 단계; 및 상기 측정된 단백질 발현 수준을 만성 골수성 백혈병의 만성기에서의 각 단백질의 발현 수준과 비교하는 단계를 포함하는, 만성 골수성 백혈병의 급성기 진행의 진단 방법을 제공한다.
일 실시태양에서, 상기 단백질은 Cobll1+/PACSIN2+/SH3BP1+, Cobll1+/PACSIN2-/SH3BP1+, Cobll1-/PACSIN2-/SH3BP1+, 및 Cobll1-/PACSIN2-/SH3BP1-로부터 이루어지는 군에서 선택되는 하나 이상의 단백질 발현 양상을 나타내낼 수 있고, 이 경우 만성 골수성 백혈병의 급성기 진행으로 진단할 수 있다. 상기 (+)는 단백질의 발현이 만성기의 단백질 발현 수준과 비교하여 증가한 것을 나타내고, (-)는 단백질의 발현이 만성기의 단백질 발현 수준과 비교하여 변화가 없음을 나타낸다.
본 발명은 또한 개체로부터 분리한 생물학적 시료로부터 PACSIN2 또는 SH3BP1 단백질의 발현 수준을 측정하는 단계를 포함하는, 상기 환자의 티로신 키나아제 억제제에 대한 치료 내성의 진단 방법을 제공한다.
본원에서 "생물학적 시료(biological sample)" 란, 체내의 위 단백질의 발현 정도를 확인할 수 있는 모든 시료를 의미한다. 구체적으로 혈액, 혈장, 혈청, 골수, 조직, 세포, 타액, 객담, 머리카락, 소변 등일 수 있으며, 예를 들어 혈액, 골수세포 등 일 수 있다.
상기 생물학적 시료는 개체로부터 분리된(isolated) 것일 수 있고, 구체적으로 만성 골수성 백혈병 혹은 이의 발병이 의심되는 개체로부터 분리된 것일 수 있다. 그러나 이에 제한되지 않는다.
상기 "개체"는 만성 골수성 백혈병의 병기를 진단하거나, 티로신 키나아제 억제제의 내성 발생 여부를 진단하고자 하는 대상을 의미한다. 구체적으로는 만성 골수성 백혈병 환자일 수 있다.
이때, 상기 개체는 포유동물 일 수 있고, 예를 들어 인간, 소, 말, 돼지, 개, 양, 염소, 또는 고양이 등 제한없이 포함될 수 있다.
만성 골수성 백혈병 환자의 급성기로의 진행은 티로신 키나아제 억제제에 대한 치료 내성 발생과 밀접한 관련성을 갖는바, 본 발명에서 "티로신 키나아제 억제제에 대한 치료 내성을 진단"하는 것은 "만성 골수성 백혈병의 급성기 진행의 진단"일 수 있다.
일 실시태양에서, PACSIN2 단백질의 발현이 정상 대조군과 비교하여 증가하였거나, 또는 SH3BP1 단백질의 발현이 정상 대조군과 비교하여 변화가 없는 경우, 티로신 키나아제 억제제에 대한 치료 내성을 감소시켜 티로신 키나아제 억제제에 감수성을 갖는 것으로 진단한다.
또다른 실시태양에서, PACSIN2 단백질의 발현이 정상 대조군과 비교하여 변화가 없거나, 또는 SH3BP1 단백질의 발현이 정상 대조군과 비교하여 증가한 경우, 티로신 키나아제 억제제에 대한 치료 내성을 갖는 것으로 진단한다.
또다른 실시태양에서, SH3BP1 단백질의 발현 수준이 증가한 경우; 또는 SH3BP1 단백질 및 PACSIN2 발현 수준이 변화하지 않은 경우, 티로신 키나아제 억제제에 대한 내성을 갖는 것으로 진단한다.
본 발명에서 티로신 키나아제(tyrosine kinase) 억제제는 티로신 키나아제의 활성을 억제하는 물질로, 표적치료제로 사용되는 것일 수 있다. 예를 들어, 이매티닙(imatinib), 닐로티닙(nilotinib), 다사티닙(dasatinib), 보수티닙(bosutinib), 또는 포나티닙(ponatinib)일 수 있고, 구체적으로는 닐로티닙일 수 있다. 그러나 이에 제한되지 않는다.
본 발명은 만성 골수성 백혈병 환자로부터 분리한 생물학적 시료로부터 Cobll1, PACSIN2, 및 SH3BP1 단백질 중 둘 이상의 상호작용을 측정하는 단계를 포함하는, 상기 환자의 티로신 키나아제 억제제에 대한 치료 내성의 진단 방법을 제공한다.
일 실시태양에서, Cobll1 단백질과 PACSIN2 단백질이 상호작용하여 서로 결합하는 경우, 티로신 키나아제 억제제에 대한 치료 내성을 갖는 것으로 진단한다. 이 때 Cobll1 단백질과 PACSIN2 단백질의 상호작용에 의한 결합은, Cobll1 단백질의 N-말단의 프롤린 풍부 영역과 PACSIN2의 SH3 도메인의 결합에 의한 것일 수 있다. 상기 PACSIN2의 SH3 도메인은 서열번호 1의 430에서 486의 아미노산 서열을 가질 수 있다. 상기 Cobll1 단백질의 N-말단의 프롤린 풍부 영역은 서열번호 2의 1 내지 410의 아미노산 서열을 가질 수 있다. 구체적으로는, 서열번호 2의 18에서 25의 아미노산 서열, 서열번호 2의 292에서 299의 아미노산 서열, 및 서열번호 2의 361에서 368의 아미노산 서열로 이루어지는 군으로부터 선택되는 하나 이상의 아미노산 서열을 갖고, 보다 구체적으로는, 서열번호 2의 175에서 370의 아미노산 서열을 가질 수 있다. 그러나 이에 제한되지 않는다.
또다른 실시태양에서, SH3BP1 단백질과 PACSIN2 단백질의 상호작용에 의한 결합은, SH3BP1 단백질의 C-말단의 프롤린 풍부 영역과 PACSIN2의 SH3 도메인의 결합에 의한 것일 수 있다. 이 때 SH3BP1 단백질의 C-말단의 프롤린 풍부 영역은 서열번호 3의 541에서 701의 아미노산 서열을 가질 수 있다.
Figure PCTKR2020005418-appb-I000001
한편 본 발명에서 '특정 서열번호로 기재된 아미노산 서열을 가지는', '특정 서열번호로 기재된 아미노산 서열을 포함하는' 단백질 혹은 도메인으로 기재되어 있다 하더라도, 해당 서열번호의 아미노산 서열로 구성된 단백질 혹은 도메인과 동일 혹은 상응하는 활성을 가지는 경우라면, 일부 서열이 결실, 변형, 치환 또는 부가된 아미노산 서열을 갖는 경우도 본 발명에서 사용될 수 있음은 자명하다. Cobll1, PACSIN2, 및 SH3BP1의 세 단백질이 모두 존재하는 경우, PACSIN2 단백질은 그의 SH3 도메인을 통해 SH3BP1 또는 Cobll1과 경쟁적으로 결합한다. PACSIN2 SH3 도메인은 Cobll1과 우선적으로 상호작용하여 SH3BP1을 방출시킨다. 방출된 SH3BP1은 Rac1 신호 전달 경로를 활성화시켜 티로신 키나아제 억제제에 대한 내성을 유도한다.
또다른 실시태양에서, 상기 진단 방법은 PACSIN2의 SH3 도메인; Cobll1 단백질의 N-말단의 프롤린 풍부 영역; 및 SH3BP1 단백질의 SH3BP1 단백질의 C-말단의 프롤린 풍부 영역 중 2 이상의 상호작용을 측정하는 것일 수 있다.
각 도메인 및 프롤린 풍부 영역, 이들의 상호작용에 대해서는 전술한 바와 같다.
본 발명에서 단백질 발현 수준을 측정하는 방법은 방사능면역분석, 방사능면역침강법, 면역침강법, ELISA(enzyme-linked immunosorbentassay), 샌드위치 분석법(sandwich assay), 실시간-중합효소연쇄반응(real-time PCR), 역전사-중합효소연쇄반응(RT-PCR), 또는 웨스턴 블롯팅(western blotting)일 수 있으나, 이로 제한되지 않는다.
또한 본 발명에서 단백질의 상호작용을 측정하는 방법은 효모 단백질 잡종법(yeast two hybrid), 면역침강법(immunoprecipitation), 동시-면역침강법(co-immunoprecipitation), 역 동시-면역침강법(reverse co-immunoprecipitation), GST 풀 다운(GST pull-down) 분석법, 친화성 크로마토그래피(affinity chromoatography), 파아지 디스플레이(phage display), 또는 면역조직화학(immunohistochemistry)일 수 있으나, 이로 제한되지 않는다.
상기 "진단하는 방법"은 "진단에 필요한 정보를 제공하는 방법"과 동일한 의미로 사용될 수 있다. 그러나 이에 제한되지 않는다.
본 발명은 또한 시료 중 Cobll1, PACSIN2, 및 SH3BP1 단백질의 발현 수준을 측정하는 제제를 포함하는, 만성 골수성 백혈병의 급성기 진행의 진단용 조성물을 제공한다. 이 때 상기 제제는 목적하는 단백질과 특이적으로 결합할 수 있고, 그의 수준을 용이하게 측정할 수 있는 제제일 수 있다. 예를 들어, 상기 단백질에 특이적으로 결합하는 항체, 앱타머, 또는 리간드일 수 있으나, 이로 제한되지 않는다.
본 발명은 또한 시료 중 PACSIN2 또는 SH3BP1 단백질의 발현 수준을 측정하는 제제를 포함하는, 티로신 키나아제 억제제에 대한 치료 내성 진단용 조성물을 제공한다.
또다른 실시태양에서, 본 발명은 시료 중 Cobll1, PACSIN2, 및 SH3BP1 단백질 중 둘 이상의 상호작용을 측정하는 제제를 포함하는, 티로신 키나아제 억제제에 대한 치료 내성 진단용 조성물을 제공한다.
상기 조성물은 단백질의 발현 수준을 측정하기 위한 임의의 구성을 더 포함할 수 있다.
상기 조성물은 키트 형태로 제공되는 것일 수 있으나 이에 제한되지 않는다.
상기 Cobll1, PACSIN2, 및 SH3BP1 단백질, 만성 골수성 백혈병의 급성기 진행의 진단, 티로신 키나아제 억제제에 대한 치료 내성의 진단에 대해서는 전술한 바와 같다.
이하 실시예를 통하여 본 발명을 더욱 상세하게 설명하고자 하나, 하기의 실시예는 단지 설명의 목적을 위한 것이며 본원 발명의 범위를 한정하고자 하는 것은 아니다.
실시예 1: 새로운 Cobll1 결합 단백질로서의 PACSIN2의 동정
Cobll1이 닐로티닙 감수성에 영향을 미치고 조혈을 조절함이 알려져 있다. Cobll1이 닐로티닙 감수성과 조혈에 미치는 영향을 연구하기 위해 Cobll1 항체를 사용하여 K562 세포 추출물의 tandem affinity purification을 수행하고, Cobll1을 bait으로하여 인간 골수 cDNA 라이브러리의 효모 단백질 잡종법(yeast two-hybrid system)을 수행하였다(도 1). 질량 분광 분석 결과, 몇 가지 결합 단백질 후보가 확인되었고, 4.5 x 106개의 형질전환체에 대해 효모 단백질 잡종법을 수행하여 14개의 양성 클론을 회수하였다. proteomic 분석시 24 %의 펩타이드가 PACSIN2로부터 유래하였고(도 2), 효모 단백질 잡종법을 통해 14개 중 11개의 클론이 PACSIN2로부터 유래하였기에(도 3 및 4), PACSIN2가 가장 유망한 Cobll1-상호작용 단백질로서 확인되었다.
추가로 K562 세포에서 과발현 또는 내인성 단백질을 효모 단백질 잡종법 및 면역침강법(immunoprecipitation)을 사용하여 Cobll1과 PACSIN2 사이의 상호작용을 확인하였다(도 5 내지 7).
Cobll1과 PACSIN2에서 필수 상호작용 도메인을 확인하기 위해, K562 세포에서 Cobll1과 PACSIN2 결실 돌연변이를 발현시키고, 동시-면역침강법(co- immunoprecipitation)에 의해 상호작용을 탐색하였다(도 8 및 10). Ubiquitin-like (UBL) 도메인을 포함하는 Cobll1의 아미노산 14-366의 결실은 PACSIN2와의 상호작용을 제거한다는 것을 발견하였다(도 9). 역 동시-면역침강법(reverse co-immunoprecipitation assay)은 SH3 도메인을 포함하는 PACSIN2의 아미노산 430-486 (아래 서열)이 Cobll1과의 상호작용에 중요하다는 것을 보여주었다(도 11).
RVRALYDYEGQEHDELSFKAGDELTKMEDEDEQGWCKGRLDNGQVGLYPANYVEAIQ
PACSIN2의 SH3 도메인과 Cobll1 사이의 상호작용은 정제된 GST-PACSIN2 SH3 단백질을 전장 Cobll1과의 GST-pull down 분석을 통해 추가로 확인하였다(도 12 및 13).
SH3 도메인은 프롤린-풍부 모티프와 상호작용하는 것으로 알려져 있으므로, SH3 software, MoDPepInt (Modular Domain Peptide Interaction) Server를 이용하여 Cobll1의 프롤린-풍부 모티프를 분석하였다. Cobll1이 N-말단 영역에 3개의 프롤린-풍부 모티프를 갖는 것을 발견하였는데, 이들은 잠재적 PACSIN2 결합 부위를 형성할 수 있다(도 14 및 15).
1개, 2개 또는 3개 모티프의 프롤린 잔기를 알라닌으로 돌연변이시켜 몇 가지 돌연변이를 제조하였다(도 16). 모든 프롤린 잔기가 돌연변이된 경우(Cobll1-3A 돌연변이), PACSIN2와의 상호작용이 거의 완전히 상실되었고, 2개의 모티프가 돌연변이된 경우(Cobll1-2A 돌연변이), 결합에 있어 작은 감소가 나타났으며, 오직 1개의 프롤린 모티프가 돌연변이된 경우(Cobll-1A 돌연변이), 야생형 단백질의 결합과 비교하여 결합에 영향을 미치지 않았다(도 17 내지 19). 이는 프롤린-풍부 모티프 각각이 PACSIN2와의 상호작용에 기여함을 나타낸다.
Cobll1 야생형 또는 3A 돌연변이와 PACSIN2의 동시-면역침강법에 의해 PACSIN2와 결합하는 Cobll1 프롤린-풍부 모티프의 역할을 추가로 확인하였다(도 20). 원자 수준에서 PACSIN2 SH3 도메인과 Cobll1 프롤린-풍부 모티프 사이의 상호작용을 확인하기 위해 핵자기공명 (NMR) 분광법을 수행하였다. 하나의 프롤린 및 관찰되지 않은 잔기 (H442)를 제외하고는, PACSIN2 SH3 도메인의 백본 아미드(1H 및 15N) 공명은 1H-15N heteronuclear single quantum correlation (HSQC) 스펙트럼에 모두 할당되었다(도 21). Cobll1의 잔기 18-25, 292-299 및 361-368을 포함하는 3개의 프롤린-풍부 모티프에 상응하는 펩타이드를 합성하고, 각각의 펩타이드를 다양한 몰 비율의 15N-표지된 PACSIN2 SH3 도메인에 첨가하였다. 도 22 내지 24에 나타낸 바와 같이, PACSIN2 SH3 도메인에 Cobll1 프롤린-풍부 펩타이드를 첨가한 후에, 몇몇 잔기들은 화학적 시프트의 변화(chemical shift perturbation)를 나타내었다.
PACSIN2 SH3 도메인의 Y437, Q440, E441, D460, G463, A479, N480, V482 및 A484는 3개의 프롤린-풍부 펩타이드의 첨가에 의해 변경되었으나, 제1 펩타이드(잔기 18-25)의 효과는 제2 및 제3 펩타이드의 효과보다는 약하였다. 각각의 펩타이드에 결합시 PACSIN2 SH3 도메인에 대한 평균 화학적 시프트 변화(CSPs, Δδ)를 도 25에 도시하였다. 이러한 결과는 Cobll1 프롤린-풍부 모티프 각각의 결합 강도가 다르더라도, PACSIN2 SH3 도메인에 대한 3 개의 Cobll1 프롤린-풍부 모티프의 전체적인 결합 모드는 유사하다는 것을 나타낸다(도 25).
종합하면, 이 결과는 Cobll1이 프롤린-풍부 모티프를 통해 PACSIN2의 SH3 도메인에 강하게 결합한다는 것을 보여준다(도 26).
실시예 2: Cobll1과 PACSIN2 사이의 상호작용에 따른 닐로티닙 내성 조절
PACSIN2와 Cobll1이 결합하는 것이 확인됨에 따라, 본 실시예에서는 닐로티닙 내성에 대한 PACSIN2의 효과를 실험하였다.
흥미롭게도 K562 세포에서 PACSIN2의 결핍은 닐로티닙 유도된 세포사멸을 감소시켰는데(도 27 및 28), 이는 PACSIN2가 종양 억제 인자로서 닐로티닙 내성을 부정적으로 조절(negatively regulate)함을 시사한다. 대조적으로, PACSIN2의 과발현은 닐로티닙 유도된 세포사멸을 약 2배 증가시켰으며, Cobll1 과발현은 닐로티닙 유도된 세포사멸을 감소시켰다(도 29 및 30). siRNA-내성 야생형 PACSIN2의 발현은 닐로티닙 감수성을 회복시켰으므로, PACSIN2 siRNA에 의한 세포사멸의 억제는 오프-타겟(off-target) 효과 때문이 아니었다(도 31 내지 33). 이러한 데이터는 PACSIN2와 Cobll1이 닐로티닙 내성에 대해 반대로 작용함을 시사한다.
다음으로 Cobll1과 PACSIN2 사이의 상호작용이 어떻게 닐로티닙 내성에 영향을 미치는지 검토하였다. K562 세포에서 상호작용 결함이 있는 Cobll1 D1과 전장 PACSIN2의 과발현이 닐로티닙에 의해 유발된 세포사멸을 증가시킨다는 것을 발견하였다(도 34 및 35). 또한 상호작용이 결여된(interaction-defective) PACSIN2 D4 돌연변이는 닐로티닙 유도된 세포사멸을 억제하는 반면, Cobll1에 대한 상호작용 영역을 여전히 가지고 있는 PACSIN2 D1, D2, D3 돌연변이는 닐로티닙 유도된 세포사멸을 덜 효과적으로 억제하였다(도 36 및 37).
또한 닐로티닙 내성은 전장 Cobll1과 PACSIN2의 과발현에 의해 회복(restore)되었으나, K562 세포에서 PACSIN2만 과발현된 경우에는 저해되었다. 대조적으로, 닐로티닙 내성은 PACSIN2와의 상호작용에 결함이있는 Cobll1 P3A 돌연변이의 과발현에 의해서는 회복(restore)되지 않았다(도 38 및 39).
이로부터 Cobll1/PACSIN2 상호작용은 닐로티닙 내성에 중요한 역할을 함을 확인할 수 있었다.
실시예 3: 새로운 PACSIN2 결합 단백질로서의 SH3BP1의 동정
닐로티닙 내성을 부여함에 있어 PACSIN2의 기능을 이해하기 위해, K562 세포에서 PACSIN2를 bait으로 사용하여 tandem affinity purification을 통해 PACSIN2 결합 단백질을 검색하였다(도 40). 이를 통해 PACSIN2 자체, Cobll1, SH3BP1, ARHGAP17, TCOF1, DNM2 및 WIPF2를 포함한 몇 가지 PACSIN2 결합 단백질을 동정하였다(도 41). SH3BP1은 SH3 도메인에 결합할 수있는 프롤린-풍부 영역을 포함하기 때문에, SH3BP1이 새로운 PACSIN2 결합 단백질 일 수 있다고 가정하였다. SH3BP1은 SH3 도메인의 D4 돌연변이가 아닌, 전장 PACSIN2에 의해 동시-면역침강(co-immunoprecipitate)되었는데, 이는 상호작용을 위해 PACSIN2의 SH3 도메인을 필요로 함을 시사한다(도 42). 내인성 PACSIN2의 면역침강 역시 유사하게 K562 세포에서 내인성 SH3BP1과의 상호작용을 나타냈다(도 43). 또한, 시험관 내 정제된 GST-PACSIN2 SH3 단백질은 SH3BP1과 강한 상호작용을 보였다(도 44).
SH3 도메인은 프롤린-풍부 모티프와 상호작용한다고 알려져 있으므로 SH3 software (MoDPepInt server), ELM (Eukaryotic Linear Motif) resource 및 BLAST 25,26을 사용하여 SH3BP1의 프롤린-풍부 모티프를 분석하였다. MoDPepInt (step size 10), ELM resource, 및 BLAST 분석 결과, SH3BP1에 각각 1개, 4개 (3개의 class 1 및 1개의 class II SH3 결합 도메인) 및 1개의 PACSIN2 SH3 결합 모티프가 생성되었다. 이로부터 SH3BP1이 PACSIN2 SH3 도메인과 상호작용할 수 있는 5개의 잠재적인 프롤린-풍부 모티프를 포함한다고 예측하였다(도 45 및 46). PACSIN2와 상호작용하는 SH3BP1의 프롤린-풍부 모티프를 확인하기 위해, 결실 및/또는 점 돌연변이 각각 또는 조합을 각 프롤린-풍부 모티프에 도입시키고(도 47), GST pull-down analysis를 수행하였다. 5개의 프롤린-풍부 모티프가 모두 돌연변이된 SH3BP1 DPD2 돌연변이는 PACSIN2 SH3 도메인과 약하게 상호작용하는 반면, 다른 모든 SH3BP1 돌연변이는 야생형 SH3BP1의 결합과 비교하여 완전하거나(PRM, PD2 및 PD4) 또는 대부분의 결합(PD1 및 PD3)을 보유하였다(도 48 및 49).
이는 SH3BP1의 1개 또는 2개의 프롤린-풍부 모티프가 PACSIN2와의 상호작용에 충분함을 보여준다. GST pull-down 결과와 동일하게, PACSIN2는 야생형 SH3BP1과는 동시-면역침강하였으나, DPD2 돌연변이와는 그렇지 않았다. 이로부터 SH3BP1의 프롤린-풍부 모티프가 PACSIN2와의 상호작용에 중요하다는 것을 확인하였다(도 50).
NMR 분광법을 사용하여 SH3BP1과 PACSIN2 사이의 상호작용을 조사하기 위해, 모든 프롤린-풍부 모티프를 함유한 SH3BP1의 C-말단 부위(잔기 541-701; 이하, "SH3BP1-CT"라고 지칭함)를 정제하였다. 비 표지된(unlabeled) SH3BP1-CT를 다양한 몰 비율의 15N-표지된 PACSIN2 SH3 도메인에 첨가시 큰 스펙트럼 변화를 나타내었다(도 51). SH3BP1-CT의 존재 하에 PACSIN2 SH3 도메인(L434, D443, A479, Y481 및 E483)의 5개의 resonance가 완전히 사라졌는데, 이는 이들 잔기가 SH3BP1 상호작용에 강력하게 관여함을 나타낸다(도 51 및 53).
추가로 제2 및 제3 프롤린-풍부 모티프를 함유한 Cobll1의 N-말단 부위(잔기 175-370; 이하 "Cobll1-NT"라고 지칭함)를 정제하였다. 3개의 프롤린-풍부 펩타이드를 모두 포함하는 Cobll1의 크기는(> 40kDa) NMR 분석에 너무 크기 때문에, NMR 적정을 위해 제1 프롤린-풍부 모티프는 제외하였다. Cobll1의 제1 프롤린-풍부 모티프는 PACSIN2에 결합하는데 있어 다른 두 프롤린-풍부 모티프보다 덜 중요하다고 생각된다. 제1 프롤린-풍부 모티프에 돌연변이가 있는 Cobll1-1A 돌연변이는 야생형 Cobll1과 유사한 친화성(affinity)로 PACSIN2를 결합하였다(도 17 내지 19). 또한 제1 프롤린-풍부 모티프는 다른 두 모티프에 비해 PACSIN2와의 상호작용이 매우 약하였다(도 22 내지 24). PACSIN2 SH3 도메인의 대부분의 잔기는 Cobll1-NT 결합에 의해 크게 영향을 받았으며(도 52), 변형된 패턴은 SH3BP1-CT 결합시와 유사하였다. PACSIN2 SH3 도메인의 잔기에 대한 신호는 SH3BP1-CT 및 Cobll1-NT 결합에 의해 이동되고 넓어졌으며, 두 단백질의 결합에 의해 유도된 전체 화학적 이동 변화는 방향 및 거리에 있어 유사하였다(도 51 내지 53). 그러나, Cobll1-NT 결합은 SH3BP1-CT 결합에 비해 더 큰 CSP 값을 야기하였고, PACSIN2 SH3 도메인의 4개 이상의 잔기(D459, D460, Y477, 및 N480)와 SH3BP1-CT 결합으로 관찰된 나머지 5개 잔기(L434, D443, A479, Y481, E483)가 완전히 사라졌다(도 53). 이 결과는 SH3BP1 및 Cobll1은 모두 그들의 프롤린-풍부 모티프를 통해 PACSIN2의 SH3 도메인의 동일한 부위에 결합함을 나타낸다.
SH3BP1이 닐로티닙 내성에서 어떻게 작용하는지를 조사하기 위해, SH3BP1을 과발현 또는 siRNA에 의해 knock-down시켜 세포사멸에 대한 영향을 평가하였다. SH3BP1의 과발현은 K562 세포에서 닐로티닙 유도된 세포사멸을 약 3배 감소시켰다 (도 54). 대조적으로, SH3BP1의 결핍은 닐로티닙 유도된 세포사멸을 약 2 배 증가시켰다(도 55).
SH3BP1은 Rac1을 활성화시키고, Rac1의 억제는 TKI에 내성인 CML blast-phase 적혈구 간세포의 증식을 감소시키는 것으로 알려져있다. SH3BP1 및 Cobll1은 모두 PACSIN2와 상호작용하기 때문에, Cobll1이 PACSIN2로부터 SH3BP1을 방출함으로써 Rac1 경로를 활성화시킨다는 가설을 세웠다. 실험 결과, 이 가설과 일치하여, Cobll1 과발현은 Rac1을 활성화시켰다(도 56). K562 세포에서 PACSIN2와 함께 야생형 Rac1의 과발현은 닐로티닙 내성을 회복시켰는데, 이는 PACSIN2 단독의 과발현으로 제거되었다(도 57). Rac1 과발현에 의한 닐로티닙 내성은 Rac1 (Rac1 V12)의 활성 형태의 과발현에 의해 악화되었다(도 57).
실시예 4: PACSIN2 단백질은 자신의 SH3 도메인을 통하여 SH3BP1 및 Cobll1와 경쟁으로 결합함
PACSIN2 SH3 도메인은 SH3BP1 및 Cobll1 둘 다의 프롤린-풍부 모티프와 결합하기 때문에, 표면플라즈몬공명(surface plasmon resonance; SPR)과 핵자기공명(NMR) 연구를 통하여 세 단백질의 결합 친화력을 비교하였다.
SPR 분석을 위해, 3개의 프롤린-풍부 모티프를 포함하는 Cobll1의 N-말단 영역(잔기 1-410; 이하 "Cobll1-NT-f"라고 지칭함) 및 SH3BP1-CT를 사용하였다. SPR 실험 결과 PACSIN2 SH3 도메인과 Cobll-NT-f 사이의 해리 상수 (Kd)는 25.8 nM이고, PACSIN2 SH3 도메인과 SH3BP1-CT 사이의 해리 상수 (Kd)는 2.2 μM임을 확인되었다. 즉, PACSIN2 SH3 도메인과 Cobll1-NT-f와의 결합 친화력이 PACSIN2 SH3 도메인과 SH3BP1-CT 사이의 결합 친화력보다 85배 높음을 확인하였다(도 58 및 59).
이러한 친화력 차이는 NMR 연구를 통하여 다시 한번 확인하였다. Cobll1-NT와 SH3BP1-CT의 같은 몰비하에서(즉, PACSIN2 SH3 : Cobll1-NT : SH3BP1-CT = 1 : 1 : 1) 15N으로 표지된 PACSIN2 SH3 도메인의 1H-15N HSQC 스펙트럼을 측정하고, 이 스펙트럼을 Cobll1-NT 또는 SH3BP1-CT 각각과 결합한 PACSIN2 SH3 도메인의 스펙트럼과 비교하였다(도 60). Cobll1-NT와 SH3BP1-CT는 PACSIN2 SH3 도메인에 대해 유사한 결합 패턴을 보여주었기 때문에, Cobll1-NT 또는 SH3BP1-CT의 존재 하에서 PACSIN2 SH3 도메인의 많은 피크들이 겹쳐서 나타났다. 그러나, 중첩되지 않은 잔기들을 분석한 결과, Cobll1-NT 및 SH3BP1-CT가 모두 존재하는 상태에서의 PACSIN2 SH3 도메인 스펙트럼(녹색)은, SH3BP1-CT 단독으로 존재할 때의 PACSIN2 SH3 도메인 스펙트럼(파란색)보다 Cobll1-NT 단독으로 존재할 때의 PACSIN2 SH3 도메인 스펙트럼(적색)에 가까운 것을 확인하였다. 이는 PACSIN2 SH3 도메인이 SH3BP1-CT보다 Cobll1-NT와 결합하는 것을 선호한다는 것을 시사한다(도 60).
추가로 replacement titration를 통하여 PACSIN2에 대한 Cobll1과 SH3BP1의 경쟁적 결합을 조사하였다. SH3BP1-CT를 15N으로 표지된 PACSIN2 SH3 도메인 (PACSIN2 SH3 : SH3BP1-CT = 1 : 1)에 첨가 한 후, 다양한 몰비에서 Cob1l1-NT의 적정을 수행하였다. 또한 반대의 실험도 수행하였다(도 61 및 62).
포화점(청색)에서 SH3BP1-CT에 결합된 PACSIN2 SH3 도메인의 Y435, K455, Q462 및 Q463 잔기의 화학적 이동은 Cobll-NT 농도 증가에 의해 점진적으로 이동됨을 확인하였다(도 63 상부 패널). 반대로, Cobll1-NT-PACSIN2 SH3 복합체에 SH3BP1-CT를 첨가한 경우에는 화학적 이동의 변화가 없는 잔기(K455 및 Q462) 또는 더 작은 화학적 이동의 변화를 보이는 잔기(Y435 및 G463)가 관찰되었다(도 63 하부 패널).
이러한 replacement titrations은 Cobll1-NT가 SH3BP1-CT에 비해 PACSIN2 SH3 도메인에 강하게 결합한다는 것을 보여주는 결과들과 일치하며, Cobll1-NT가 PACSIN2에서 SH3BP1을 대체할 수 있음을 보여준다.
또한 Cobll1의 전체 또는 N-말단 영역의 발현이 PACSIN2와 SH3BP1 사이의 결합을 억제한다는 것을 확인하였다(도 64 및 65).
이로부터, PACSIN2가 SH3 도메인을 통해 SH3BP1 또는 Cobll1가 경쟁적으로 결합하며, 평형 상태에서 PACSIN2 SH3 도메인이 Cobll1의 프롤린-풍부 모티프와 우선적으로 상호작용한다는 것을 보여준다.
실시예 5: Cobll1/PACSIN2/SH3BP1 신호전달 체계는 골수 형성을 조절함
Zebrafish cobll1b 유전자가 정상적인 조혈세포 형성에 필수적임이 공지된 바 있다. 본 실시예에서는 Cobll1/PACSIN2/SH3BP1/Rac1의 신호전달 경로가 조혈세포 형성에 관여한다는 가설을 세운 뒤, Zebrafish 배아를 이용하여 골수 형성에 대한 sh3bp1, rac1a 및 pacsin2의 기능을 확인하였다.
sh3bp1과 rac1a 발현을 억제하는 antisense morpholinos (MOs)를 사용하여(도 66) 골수에서 특이적으로 발현되는 mpx1의 패턴을 in situ hybridization (WISH)에 의해 확인하였다(도 67).
골수 세포의 수는 sh3bp1과 rac1a morphants 모두에서 대조군에 비해 감소하였다(도 68). 마찬가지로 mRNA 주입을 통한 pacsin2의 발현 증가는 mpx 양성 원시 골수 세포의 수를 감소시켰다. 반면에 배아 골수 형성은 pacsin2 morphants에서 변화되지 않음을 확인하였다(도 69 내지 71).
이러한 결과들은 SH3BP1/Rac1a 신호전달 체계가 Zebrafish 배 발생 과정에서 골수 형성을 증가시키는 반면, PACSIN2는 골수 형성을 감소시킴을 나타낸다.
pacsin2의 gain-of-function 데이터는 배아의 조혈세포 형성에 대한 PACSIN2의 부정적인 효과를 암시하는 반면, pacsin2의 loss-of-function 연구는 영향을 없음을 보여준다. 실시예 4를 통해 PACSIN2에 대한 Cobll1의 결합 친화도가 SH3BP1의 결합 친화도보다 매우 높다는 것을 증명하였기 때문에, 내인성 Cobll1b가 Zebrafish 골수 형성 동안 PACSIN2에 계속적으로 결합하여 SH3BP1/Rac1a 경로를 억제하는 Cobll1b의 기능을 차단한다는 가설을 세웠다. 이 가설을 검증하기 위해, cobll1b와 pacsin2의 발현을 줄이기 위하여 cobll1b 및 pacsin2 MOs를 공동 주입하였다. 앞서 설명한 바와 같이, cobll1b MO를 주사하면 28 hpf에서 mpx 양성 세포의 수가 현저히 감소함을 확인하였다. 반대로, 동시에 pacsin2와 cobll1b의 발현을 감소시키면 골수 형성이 회복되는데, 이는 cobll1b 발현의 상실로 자유로워진 PACSIN2가 SH3BP1/Rac1a 경로를 억제하여 정상적인 조혈의 진행을 유도한다는 것을 의미한다(도 72 및 73). 이러한 결과들은 Cobll1b/PACSIN2/SH3BP1/Rac1a 경로의 조절 네트워크가 척추동물의 정상적인 배아 조혈세포 형성을 조절할 때 CML에서 닐로티닙 내성을 조절하는 동일한 메커니즘을 사용하여 한다는 것을 의미한다.
실시예 6: Cobll1/PACSIN2/SH3BP1 발현의 임상적 상관 관계
상기 실시예들로부터, Cobll1의 발현이 BC 세포에서 높고, Cobll1이 CML 세포에서 PACSIN2와 SH3BP1 사이의 상호 결합을 조절함으로써 Rac1 경로를 활성화시킨다는 사실을 입증하였는바, 본 실시예에서는 CML 환자 샘플에서 Cobll1, PACSIN2, SH3BP1의 세 단백질들의 발현 정도와 Rac1 활성을 확인하였다.
10명의 환자들에서 3개의 유전자 발현 수준을 측정하여, CP에서 BC로 진행되는 시료를 수집한 뒤, 10 명의 환자들의 serial 샘플에서 Cobll1, PACSIN2, SH3BP1의 세 단백질들의 발현을 확인하였다. 흥미롭게도 세 단백질들 중 CP 샘플에서 발현된 단백질은 없었으나, BC 환자 10명 중 6명에서 Cobll1, PACSIN2 또는 SH3BP1 중 적어도 하나의 단백질이 발현됨을 확인하였다(도 74 내지 83).
추가로 환자 집단에서 세 단백질의 발현 양상을 분석하였다(도 84 내지 86).
분석 결과 CP 샘플에서 발현된 단백질은 없었으나, BC 샘플에서 세 단백질들이 Cobll1+/PACSIN2+/SH3BP1+, Cobll1+/PACSIN2-/SH3BP1+, Cobll1-/PACSIN2-/SH3BP1+ 및 Cobll1-/PACSIN2-/SH3BP1-의 4 가지 발현 양상을 보임을 확인하였다.
또한 Cobll1/PACSIN2/SH3BP1 세 단백질의 발현이 Rac1 활성화를 조절하는지를 환자 샘플에서 확인하였다. 그 결과 Cobll1 및 SH3BP1만이 발현되는 #1744 환자의 BC 세포에서 Rac1 활성이 증가되지만 #1744 환자의 CP 샘플에서는 증가되지 않음을 확인하였다. 반면에 세 단백질들 중 어느 것도 발현하지 않는 #1919 환자의 CP 및 BC 세포 모두에서는 Rac1 활성이 나타나지 않았다(도 87).
33 명의 BC 환자의 생존율과 3개 단백질들의 4 가지 발현 양상 (Cobll1+/PACSIN2+/SH3BP1+, Cobll1+/PACSIN2-/SH3BP1+, Cobll1-/PACSIN2-/SH3BP1+ 및 Cobll1-/PACSIN2-/SH3BP1-)을 비교한 결과 3개 단백질들의 발현 양상이 환자의 생존율과 blast 비율에 중요함을 확인하였다(표 1). 9 명의 줄기 세포 이식 (SCT) 환자들을 제외한 24 명의 BC 환자의 생존율을 비교한 결과 Cobll1-/PACSIN2-/SH3BP1- 발현 양상을 보이는 환자의 생존율이 제일 높다는 것을 확인하였다 (도 88 내지 91). 이 결과들은 Cobll1/PACSIN2/SH3BP1 단백질들의 발현이 각 환자마다 다르고 CML 진행 단계에서도 다름을 보여준다 (도 92).
Figure PCTKR2020005418-appb-T000001
상기 실시예들의 결과로부터, Cobll1의 새로운 결합 단백질인 PACSIN2는 K562 세포의 닐로티닙 감수성을 증가시킨다는 것을 확인하였다. PACSIN2의 SH3 도메인은 Cobll1 단백질의 N-말단에 위치한 프롤린 풍부 영역에 결합하는데, 이 두 결합은 TKI 내성에 대한 길항 작용에 결정적인 역할을 한다. PACSIN2는 또한 SH3BP1와 동일한 SH3 도메인에서 결합한다. SH3BP1 단백질은 Cobll1 단백질과 경쟁하는 PACSIN2와의 상호작용을 통해, Cobll1 기능과 유사하게, CML의 닐로티닙에 대한 감수성을 감소시킨다. 마찬가지로, Cobll1/PACSIN2/SH3BP1 세 단백질들 간의 이러한 경쟁적 상호작용은 zebrafish 배 발생 과정에서의 골수 형성 조절에 중요한 역할을 한다. 나아가 Cobll1, PACSIN2 및 SH3BP1의 발현이 blast cell 비율과 상당한 관련이 있음을 33명의 BC-tranformed CML 환자 세포를 통해 확인하였다. 이 세가지 단백질들의 발현은 CP 세포에는 관찰되지 않았지만, BC 환자에서는 4 가지의 다른 발현 양상이 관찰되었다: Cobll1+/PACSIN2+/SH3BP1+, Cobll1+/PACSIN2-/SH3BP1+, Cobll1-/PACSIN2-/SH3BP1+, 및 Cobll1-/PACSIN2-/SH3BP1-. 이는 Cobll1, PACSIN2 및 SH3BP1 사이의 상호작용이 BC로의 전환, TKI 내성, 및 정상적인 조혈세포 형성에 중요함을 시사한다.
최근의 연구결과들은 Rac1 활성화가 세포 수준에서 TKI 내성을 유도하고 HSC의 이동 및 자가 재생을 촉진하여 백혈병 발병 및 유지에 관여함을 밝힌바 있다. 더욱이, SH3BP1 단백질은 암 세포 행동을 조절하기 위해 Rac1을 활성화시키는 것으로 알려져 있다. 본 발명에서는 SH3BP1은 Rac1 신호 전달 경로를 활성화시키는 반면, PACSIN2는 SH3BP1과의 상호작용을 통해 Rac1 활성을 억제함을 확인하였다. 나아가, 본 발명에서는 Cobll1이 과발현된 PACSIN2와 우선적으로 결합하여, SH3BP1와 PACSIN2의 상호작용을 방해함을 보여준다. 이 결과로 자유로워진 SH3BP1은 Rac1 신호 전달 경로를 활성화시켜 TKI 내성과 배아 조혈세포 형성을 유도한다. CML 환자 샘플을 비교시, Cobll1 또는 SH3BP1 발현이 없는 BC 샘플 (# 1919)에 비해, Cobll1 및 SH3BP1 단백질의 발현이 높은 BC 샘플 (# 1744)에서 Rac1 활성이 더 강함을 보여준다. 이상의 실험 결과들은 Cobll1/PACSIN2/SH3BP1 발현에 의한 Rac1 활성화는 CML 형성과 정상적인 조혈세포 형성에 중요한 매개 변수임을 보여준다.
본 발명에서는 PACSIN2와 SH3BP1이 CML의 TKI 내성 및 BC 변형의 새로운 조절인자임을 확인하였다. PACSIN2는 Cobll1의 이소성 발현(ectopic expression)에 의해 복원될 수 있는 SH3BP1/Rac1 경로의 기능을 억제함으로써 닐로티닙에 의한 세포사멸을 유도하는 새로운 종양 억제 인자이다. Rac1 활성을 조절하는 Cobll1/SH3BP1/PACSIN2 축은 CML의 새로운 바이오 마커일 뿐 아니라 질병 진행을 억제하는 치료 표적이 될 수 있다. 이에 따라 본 발명은 CML의 진단 및 치료 전략을 개발하기 위한 새로운 통찰력을 제공할 수 있다.
제조예
1. 환자 샘플 및 세포주
41 명의 CML 환자의 골수(BM)와 말초 혈액(PB)으로부터 총 66 개의 CML 샘플(26 CP, 1 AP, 39 BC)을 얻었다. 그 중 10 명은 CP와 BC에서 serial samples을 가지고 있었다. 단핵 세포(MCs)는 Ficoll-Paque (GE Healthcare, Waukesha, WI, USA) 밀도 구배 원심분리법으로 분리하였다. 샘플을 소 태아 혈청(Sigma-Aldrich)에서 10 % 디메틸 술폭사이드 (DMSO, Sigma-Aldrich, St. Louis, MO, USA)로 액체 질소에 저장하고 분석을 위해 해동하였다. 모든 인간 샘플은 한국 백혈병은행 (Korea Leukemia Bank)에서 얻었으며 프로토콜은 Institutional Review Board의 승인을 받았다. 환자의 동의는 헬싱키 선언에 따라 얻어졌다.
2. 세포 배양
K562 세포주를 10 % 소태아 혈청 (Gibco, Franklin Lakes, NJ) 및 1 % 페니실린 / 스트렙토마이신(Gibco)이 첨가된 RPMI 배지에서 37℃, 5 % CO2 분위기에서 유지시켰다. 인간 배아 신장 293T (HEK293T) 세포주를 10 % 소태아 혈청 및 1 % 페니실린 / 스트렙토마이신으로 보충된 DMEM에서 37℃, 5 % CO2 분위기에서 유지시켰다.
3. 플라스미드
Cobll1 (Clone ID : 30345650)의 전장 cDNA 클론은 Thermo Scientific (Waltham, MA, USA)에서 구입하였다. PACSIN2 (클론 ID : hMU008023)에 대한 전장 cDNA 클론은 Korean Human Gene Bank로부터 구입하였다. Myc-PACSIN2, SFB-PACSIN2, Myc-SH3BP1 및 SFB-SH3BP1 내부 결실 돌연변이는 중합효소 연쇄 반응 (PCR)에 의해 생성되었다. Rac1 (클론 ID : hMU007586)에 대한 전장 cDNA 클론은 Korean Human Gene Bank로부터 구입하였다. 야생형 및 활성형 HA-Rac1의 형태는 PCR에 의해 생성되었다. GST-SH3은 PCR에 의해 생성되었다.
4. 화학물질
닐로티닙(Sigma-Aldrich)을 DMSO에서 10 mM stock으로 재구성하고 -20℃ 에서 보관하였다.
5. siRNA 및 형질감염
Cobll1과 PACSIN2의 모든 siRNA 이중 가닥은 IDT (Integrated DNA Technologies Inc., Coralville, IA, USA)에서 구입하였다. 관련 서열은 다음과 같다.
Figure PCTKR2020005418-appb-I000002
모든 siRNA와 플라스미드를 전기영동을 사용하여 세포 내로 형질감염시켰다. 구체적으로, Neon Transfection System (MPK10096, Invitrogen, Carlsbad, CA, USA)을 사용하여 K562 세포 (6x106 또는 2x106 세포)를 전기 천공시켰다. 총 20 μg의 플라스미드 DNA 또는 200 nM siRNA를 세포에 첨가하고 사용자의 프로토콜에 따라 전기천공하고 (2 펄스에서 15 ms 동안 1450V), 형질 감염된 세포를 48 시간 동안 10 % FBS가 보충된 prewarmed RPMI 배지에서 배양하였다.
6. 면역침감법(immunoprecipitation) 및 웨스턴 블롯(western blot)
(1) K562 세포에 표시된 단백질을 발현 플라스미드들로 transfection함.
(2) 24 시간 후, transfection된 세포에 500 ul의 NETN buffer (150 mM NaCl, 0.5 mM EDTA, 50 mM Tris, pH 7.5, 0.5 % NP-40)를 첨가함.
(3) 얼음 위에서 20분 동안 세포를 용해시킴.
(4) 용해되지 않은 세포추출물은 4℃에서 13,000 rpm에서 15분간 원심분리하여 제거함.
(5) 상층액은 streptavidin-coated beads or protein A-agarose-conjugated 1차 항체를 첨가하여 4℃ 에서 1시간 동안 배양함.
(6) 생성된 면역복합체를 NETN buffer로 3회 세척하고 SDS-PAGE를 수행함.
(7) Western blotting을 항체를 사용하여 수행함.
7. GST pull-down
(1) GST 및 GST 융합 단백질을 대장균에서 발현시킴.
(2) GST 및 GST 융합 단백질을 대장균 세포에 5 ml의 PBS-T buffer를 첨가함.
(3) 얼음 위에서 20 분 동안 대장균 세포를 용해시킨 후 초음파분쇄기를 이용하여 대장균 세포를 완전히 용해시킴.
(4) 용해되지 않은 세포추출물은 4℃에서 13,000 rpm에서 15분간 원심분리하여 제거함.
(5) 상층액은 glutathione-Sepharose 4B beads를 첨가하여 4℃에서 1시간 동안 배양함.
(6) 생성된 bead-단백질 복합체를 PBS-T buffer로 3회 세척하고 GST pull-down을 수행함.
(7) HEK293T 세포에 표시된 단백질을 발현하는 플라스미드로 transfection함.
(8) 24시간 후, transfection된 세포에 500 ul의 NETN buffer (150 mM NaCl, 0.5 mM EDTA, 50 mM Tris, pH 7.5, 0.5 % NP-40)를 첨가함.
(9) 얼음 위에서 20분 동안 세포를 용해시킴.
(10) 용해되지 않은 세포추출물은 4℃에서 13,000 rpm에서 15분간 원심분리하여 제거함.
(11) 상층액은 GST 융합단백질 또는 GST와 함께 4℃에서 1시간 동안 배양함.
(12) 생성된 복합체를 NETN buffer로 3회 세척하고 SDS-PAGE를 수행함.
(13) Western blotting을 항체를 사용하여 수행함.
8. 세포사멸 분석
(1) K562 세포에 표시된 단백질을 발현 플라스미드들 또는 siRNA로 transfection함.
(2) 48 시간 후, 표시된 농도의 닐로티닙을 transfection된 세포에 첨가하고 48시간 동안 배양함.
(3) 세포를 제조자의 프로토콜에 따라 FITC Annexin V Apoptosis Detection Kit I (BD Bioscience, 556547, San Jose, CA, USA)를 사용하여 세포사멸에 대해 분석하였음.
(4) 세포사멸은 FACS (fluorescence-activated cell sorting) (BD Bioscience)로 분석하였음.
9. 항체 및 희석 배수
웨스턴 블롯 분석을 위한 다양한 항체의 희석은 다음과 같다 : 이전에 공지된 바와 같은 anti-Cobll1 1 : 200; anti-PACSIN2 (Sigma-Aldrich, SAB1300127), 1 : 1000; anti-FLAG (Sigma-Aldrich, F3165), 1:2000; anti-Myc (Roche, 11814150001) (Roche, Basel, Switzerland), 1 : 2000; anti-HA (Roche, 12013819001), 1 : 2000; anti-β-actin (Sigma-Aldrich, A5316), 1:5000; anti-GFP (Clontech 632380) (Clontech, Mountain View, CA, USA), 1:2,000; anti-SH3BP1 (Proteintech, 20541-1-AP), 1:1000. 토끼 (Sigma-Aldrich, A0545) 또는 마우스 (Sigma-Aldrich, A9917) IgG에 특이적인 Horseradish peroxidase-컨쥬게이트 2차 항체를 1 : 2000로 희석시켜 사용하였다.
10. Zebrafish husbandry
AB* 균주의 야생형 Zebrafish는 UNIST Institutional Animal Care and Use Committee (IACUC)의 지침에 따라 28.5 ℃에서 자동 순환 시스템 (Genomic-Design)으로 양육되고 유지되었다. (IACUC 승인 번호 : UNISTIACUC-15-15). 수정 및 주입된 배아는 고정 될때까지 E3 fish water (0.57 g NaCl, 25.3 mg KCl, 96.6 mg CaCl2·2H2O, 163.3 mg MgSO4·7H2O, 증류수 2ℓ 중)에서 유지시켰다.
11. MO 및 mRNA 주입
(1) cobll1b, pacsin2, sh3bp1 및 rac1a에 대한 모든 MO (Gene Tools, Philomath, OR, USA)를 diethyl pyrocarbonate (DEPC)가 처리된 물에 25 ng/nl 농도로 희석하였음.
(2) 10 ng의 cobll1b-MO, 1 ng의 pacsin2-MO, 2.5 ng의 sh3bp1-MO 및 2.5 ng의 rac1a-MO를 단일 세포 단계의 야생형 배아에 주입하였음.
(3) pacsin2의 cDNA는 야생형 zebrafish 배아 RNA를 사용하여 합성되어, PCS2 + 벡터에 삽입되었음. 전장 pacsin2는 in vitro transcription (mMESSAGE mMACHINE Kit, Ambion)를 통해 합성되었음.
(4) Pacsin2 mRNA는 단일 세포 단계의 야생형 배아에 주입되었음. Microinjection은 Femtojet 4i microinjector (Eppendorf)를 사용하여 수행하였음.
12. Whole-mount WISH
(1) 배아는 4℃에서 4% 파라포름알데히드를 포함한 PBS에서 하룻밤 동안 배양하여 고정시켰음.
(2) 고정된 배아는 -20℃ 에서 메탄올로 밤새 탈수시켰음.
(3) 탈수된 배아를 PBS-0.1% Tween-20 (PBT) 용액으로 재수화하고 -20℃ 에서 아세톤을 사용하여 투과성을 획득하였음.
(4) 투과성을 획득한 배아는 68℃ 에서 hybridization buffer (50% formamide, 5ХSSC, 500 μg/ml torula yeast tRNA, 50 μg/ml heparin, 0.1% Tween-20, and 9 mM citric acid (pH 6.5))에서 1 시간 동안 prehybridization 되었음.
(5) 68℃에서 hybridization buffer에서 digoxigenin (DIG)-labeled antisense RNA probe for mpx와 3 일 동안 hybridization 되었음.
(6) Hybridization buffer, 2ХSSC, 0.2Х SSC, and PBT solution으로 세척 후, 4℃에서 alkaline phosphatase-conjugated anti-DIG antibodies (1:4000) (Roche, Mannheim, Germany)와 24 시간 동안 배양시켰음.
(7) 그 후 샘플을 PBT 용액으로 6회 세척하고 NBT/BCIP 기질 (Promega, Madison, USA)을 포함한 AP buffer (100 mM Tris, pH 9.5, 50 mM MgCl2, 100 mM NaCl 및 0.1 % Tween-20)에 배양하여 WISH 신호를 확인하였음.
13. 단백질 정제
Cobll1의 N-말단 영역(1-410 및 175-370)을 포함한 염기 서열은 pGEX-6P-2 벡터에 클로닝되었다. PACSIN2의 SH3 도메인(430-486)과 SH3BP1의 C-말단 영역(541-701)은 각각 pGEX-4T-1과 pET-21a 벡터에 클로닝되었다. 재조합된 벡터는 E.coli BL21-CodonPlus (DE3) 세포에 형질전환시켰고 형질전환된 세포는 LB medium에서 배양하였고, 0.5 mM IPTG를 첨가하여 대량발현시켰다. 수거된 E. coli cell들은 lysis buffer (20 mM Tris-HCl, 500 mM NaCl. 10% glycerol, 0.2 % NP40, 0.4 mM TCEP, 1 mM EDTA, pH7.0)에 녹여 sonicatior를 이용해 파쇄시켰다. GST fusion 단백질들(Cobll1과 PACSIN2 SH3 도메인)은 GST 컬럼을 이용하여 elution buffer (20 mM Tris-HCl, 200 mM NaCl, 5% Glycerol, 10 mM DTT, 0.2 mM TCEP, 1 mM EDTA, 10 mM glutathione, pH 7.0)로 분리 정제하였다. GST-tag은 PreScission protease (Thermo Fisher Scientific) 또는 Thrombin을 이용하여 제거한 후 염을 증가시키며(1 M NaCl까지) 이온교환 크로마토그래피를 이용하여 정제하였다. 그 이후 final buffer (50 mM sodium phosphate, 100 mM NaCl, 1 mM TCEP, pH 6.3) 조건에서 Hiload 16/600 Superdex 75/200 prep grade column (GE Healthcare)을 이용하여 정제하였다. Poly-histidine tag이 융합된 단백질(SH3BP1)의 경우 imidazole의 농도를 증가시키며 (1 M imidazole까지) Ni column을 이용하여 분리 정제하였다. 그 이후 Hiload 16/600 Superdex 75 prep grade column (GE Healthcare)를 이용하여 정제하였다.
14. 표면 플라즈몬 공명(SPR)
모든 SPR 실험은 25도에서 PBS buffer (10 mM KH2PO4, 137 mM NaCl, 및 2.7 mM KCl, pH 7.4) 조건으로 수행되었다. PACSIN2 SH3 도메인은 Reichert SR 7500DC system의 amine coupling 방법으로 PEG chip에 고정되었다. PACSIN2 SH3를 고정시킬 때의 유속은 10 μl/min이며 20 μg의 PACSIN2 SH3 단백질이 sample channel에 사용되었다. Cobll1의 N-말단 영역(1-410)과 SH3BP1의 C-말단 영역(541-701)은 3분의 association time 후 10분 동안 dissociation 되었다. Cobll1과 SH3BP1의 결합은 각각 0.0390625, 0.078125, 0.15625, 0.3125, 0.625, 1.25, 2.5, 5, 10 μM과 0.625, 1.25, 2.5, 5, 10, 20, 40 μM 조건에서 수행되었다. Sensor 표면은 100 mM의 NaOH를 이용하여 regeneration 시켰다. Binding curves은 Scrubber2 소프트웨어를 (BioNavis) 사용하여 분석되었다.
15. 핵자기공명(NMR)
15N 또는 15N, 13C로 표지된 PACSIN2 SH3 도메인을 15N-enriched ammonium chloride 또는 13C-enriched glucose를 이용한 M9 최소 배지를 이용하여 발현시켰고, 표지하지 않은 PACSIN2 SH3 도메인과 같은 방법으로 정제하였다. Bruker AVANCE II 600 MHz spectrometer를 이용하여 298K 조건에서 PACSIN2 SH3 도메인의 1H-15N HSQC와 HNCACB를 측정하였고, 이를 분석하여 backbone assignment를 수행하였다. 1H-15N HSQC NMR titration 실험은 298K 조건에서 Bruker AVANCE II 800 MHz spectrometer을 이용하여 수행하였다. 합성된 Cobll1 유래 프롤린-풍부 펩타이드(AKAPLPPAETK, 제1 프롤린-풍부 펩타이드; RRAPLPPMPAS, 제2 프롤린-풍부 펩타이드; RKAPSPPSKIP, 제3 프롤린-풍부 펩타이드)들은 ANYGEN에서 구입하였고 final buffer (50 mM sodium phosphate, 100 mM NaCl, 1 mM TCEP, pH 6.3)에 9 mM로 녹여 사용하였다. 제2 프롤린-풍부 펩타이드는 100 μM의 15N-PACSIN2 SH3 도메인에 다양한 비율로 titration 실험을 진행하였다(PACSIN2 SH3 도메인: 제2 프롤린-풍부 펩타이드 =1:0, 1:0.25, 1:0.5, 1:1, 1:2, 1:3, 1:4). PACSIN2 SH3 도메인 : 제1 또는 제3 프롤린-풍부 펩타이드의 비율은 다음과 같다: 제1 프롤린-풍부 펩타이드의 경우, 1:0.5, 1:2, 1:8 ; 제3 프롤린-풍부 펩타이드의 경우, 1:0.5, 및 1:2.
Cobll1-NT(175-370) 및 SH3BP1-CT의 titration과 replacement titration 실험은 표지하지 않은 Cobll1-NT 및 SH3BP1-CT를 각각 정제한 후 1 mM에서 2.2 mM의 농도로 final buffer (50 mM sodium phosphate, 100 mM NaCl, 1 mM TCEP, pH 6.3) 상태에서 실험하였다. 두 단백질들은 50 μM의 15N-PACSIN2 SH3 도메인 단백질에 다양한 비율 (PACSIN2 SH3 도메인:Cobll1-NT 또는 SH3BP1-CT = 1:0, 1:0.25, 1:0.5, 1:1, 1:2)로 titration 실험을 수행하였다. Replacement titration 실험에서는, 표지하지 않은 Cobll1-NT를 15N-PACSIN2 SH3 도메인 단백질과 SH3BP1을 존재 하에서 다양한 비율(PACSIN2 SH3 도메인: SH3BP1-CT:Cobll1-NT = 1:1:0.1, 1:1:0.25, 1:1:0.5, 1:1:0.75, 1:1:1, 1:1:2)로 첨가하였다(Cobll1-NT와 SH3BP1의 위치를 바꾼 조건에서도 동일하게 수행). 모든 NMR 스펙트럼은 NMRpipe를 이용하여 분석되었고 NMRViewJ 소프트웨어를 사용하여 데이터화하였다.

Claims (23)

  1. 만성 골수성 백혈병 환자로부터 분리한 생물학적 시료로부터 Cobll1 (Cordon-bleu protein-like 1), PACSIN2 (Protein kinase C and casein kinase substrate in neurons protein 2), 및 SH3BP1 (SH3 Domain Binding Protein 1) 단백질의 발현 수준을 측정하는 단계; 및
    상기 측정된 단백질 발현 수준을 만성 골수성 백혈병의 만성기에서의 각 단백질의 발현 수준과 비교하는 단계
    를 포함하는, 만성 골수성 백혈병의 급성기 진행의 진단 방법.
  2. 제1항에 있어서, 상기 단백질은 Cobll1+/PACSIN2+/SH3BP1+, Cobll1+/PACSIN2-/SH3BP1+, Cobll1-/PACSIN2-/SH3BP1+, 및 Cobll1-/PACSIN2-/SH3BP1-로부터 이루어지는 군에서 선택되는 하나 이상의 단백질 발현 양상을 나타내며, 이 때 (+)는 단백질의 발현이 만성기의 단백질 발현 수준과 비교하여 증가한 것을 나타내고, (-)는 단백질의 발현이 만성기의 단백질 발현 수준과 비교하여 단백질 발현이 변화되지 않음을 나타내는 것을 특징으로 하는, 진단 방법.
  3. 만성 골수성 백혈병 환자로부터 분리한 생물학적 시료로부터 PACSIN2 또는 SH3BP1 단백질의 발현 수준을 측정하는 단계를 포함하는, 상기 환자의 티로신 키나아제 억제제에 대한 치료 내성의 진단 방법.
  4. 제3항에 있어서, PACSIN2 단백질의 발현이 정상 대조군과 비교하여 증가하였거나, 또는 SH3BP1 단백질의 발현이 정상 대조군과 비교하여 변화되지 않은 경우, 티로신 키나아제 억제제에 대한 치료 내성을 감소시켜 티로신 키나아제 억제제에 감수성을 갖는 것으로 진단하는 것을 특징으로 하는, 진단 방법.
  5. 제3항에 있어서, PACSIN2 단백질의 발현이 정상 대조군과 비교하여 변화되지 않았거나, 또는 SH3BP1 단백질의 발현이 정상 대조군과 비교하여 증가한 경우, 티로신 키나아제 억제제에 대한 치료 내성을 갖는 것으로 진단하는 것을 특징으로 하는, 진단 방법.
  6. 만성 골수성 백혈병 환자로부터 분리한 생물학적 시료로부터 Cobll1, PACSIN2, 및 SH3BP1 단백질 중 둘 이상의 상호작용을 측정하는 단계를 포함하는, 상기 환자의 티로신 키나아제 억제제에 대한 치료 내성의 진단 방법.
  7. 제6항에 있어서, Cobll1 단백질과 PACSIN2 단백질이 상호작용하여 서로 결합하는 경우, 티로신 키나아제 억제제에 대한 치료 내성을 갖는 것으로 진단하는 것을 특징으로 하는, 진단 방법.
  8. 제7항에 있어서, Cobll1 단백질과 PACSIN2 단백질의 상호작용에 의한 결합은, Cobll1 단백질의 N-말단의 프롤린 풍부 영역과 PACSIN2의 SH3 도메인의 결합에 의한 것임을 특징으로 하는, 진단 방법.
  9. 제8항에 있어서, 상기 PACSIN2의 SH3 도메인은 서열번호 1의 430 내지 486의 아미노산 서열을 갖는 것이고, 상기 Cobll1 단백질의 N-말단의 프롤린 풍부 영역은 서열번호 2의 1 내지 410의 아미노산 서열을 갖는 것을 특징으로 하는, 진단 방법.
  10. 제9항에 있어서, 상기 Cobll1 단백질의 N-말단의 프롤린 풍부 영역은 서열번호 2의 18 내지 25의 아미노산 서열, 서열번호 2의 292 내지 299의 아미노산 서열, 및 서열번호 2의 361내지 368의 아미노산 서열로 이루어지는 군으로부터 선택되는 하나 이상의 아미노산 서열을 갖는 것을 특징으로 하는, 진단 방법.
  11. 제9항에 있어서, 상기 Cobll1 단백질의 N-말단의 프롤린 풍부 영역은 서열번호 2의 175 내지 370의 아미노산 서열을 갖는 것을 특징으로 하는, 진단 방법.
  12. 제6항에 있어서, SH3BP1 단백질과 PACSIN2 단백질의 상호작용에 의한 결합은, SH3BP1 단백질의 C-말단의 프롤린 풍부 영역과 PACSIN2의 SH3 도메인의 결합에 의한 것임을 특징으로 하는, 진단 방법.
  13. 제12항에 있어서, 상기 PACSIN2의 SH3 도메인은 서열번호 1의 430 내지 486의 아미노산 서열을 갖는 것이고, 상기 SH3BP1 단백질의 C-말단의 프롤린 풍부 영역은 서열번호 3의 541 내지 701의 아미노산 서열을 갖는 것을 특징으로 하는, 진단 방법.
  14. 제6항에 있어서, Cobll1, PACSIN2, 및 SH3BP1의 세 단백질이 모두 존재하는 경우, PACSIN2 단백질은 그의 SH3 도메인을 통해 SH3BP1 또는 Cobll1과 경쟁적으로 결합하며, 이 때 PACSIN2 SH3 도메인은 Cobll1과 우선적으로 상호작용하여 SH3BP1을 방출시킴으써 티로신 키나아제 억제제에 대한 내성을 유도하는 것을 특징으로 하는, 진단 방법.
  15. 제14항에 있어서, 상기 방출된 SH3BP1은 Rac1 신호 전달 경로를 활성화시켜 티로신 키나아제 억제제에 대한 내성을 유도하는 것을 특징으로 하는, 진단 방법.
  16. 제1항, 제3항 및 제6항 중 어느 한 항에 있어서, 상기 생물학적 시료는 혈액, 혈장, 혈청, 골수, 조직, 또는 세포로 이루어지는 군으로부터 선택되는 하나 이상인 것을 특징으로 하는, 진단 방법.
  17. 제1항 또는 제3항에 있어서, 상기 단백질 발현 수준을 측정하는 방법은 방사능면역분석, 방사능면역침강법, 면역침강법, ELISA, 샌드위치 분석법(sandwich assay), 실시간-중합효소연쇄반응(real-time PCR), 역전사-중합효소연쇄반응(RT-PCR), 및 웨스턴 블롯팅(western blotting)으로 이루어지는 군으로부터 선택되는 하나 이상인 것을 특징으로 하는, 진단 방법.
  18. 제6항에 있어서, 상기 단백질의 상호작용은 효모 단백질 잡종법(yeast two hybrid), 면역침강법(immunoprecipitation), 동시-면역침강법(co-immunoprecipitation), 역 동시-면역침강법(reverse co-immunoprecipitation), GST 풀 다운(GST pull-down) 분석법, 친화성 크로마토그래피(affinity chromoatography), 파아지 디스플레이(phage display), 및 면역조직화학(immunohistochemistry)으로 이루어지는 군으로부터 선택되는 하나 이상에 의해 측정되는 것을 특징으로 하는, 진단 방법.
  19. 제3항 또는 제6항에 있어서, 상기 티로신 키나아제 억제제는 이매티닙(imatinib), 닐로티닙(nilotinib), 다사티닙(dasatinib), 보수티닙(bosutinib), 또는 포나티닙(ponatinib)인 것을 특징으로 하는, 진단 방법.
  20. 시료 중 Cobll1, PACSIN2, 및 SH3BP1 단백질의 발현 수준을 측정하는 제제를 포함하는, 만성 골수성 백혈병의 급성기 진행의 진단용 조성물.
  21. 시료 중 PACSIN2 또는 SH3BP1 단백질의 발현 수준을 측정하는 제제를 포함하는, 티로신 키나아제 억제제에 대한 치료 내성 진단용 조성물.
  22. 시료 중 Cobll1, PACSIN2, 및 SH3BP1 단백질 중 둘 이상의 상호작용을 측정하는 제제를 포함하는, 티로신 키나아제 억제제에 대한 치료 내성 진단용 조성물.
  23. 제20항 내지 제22항 중 어느 한 항에 있어서, 상기 제제는 상기 단백질에 특이적으로 결합하는 항체, 앱타머, 또는 리간드인 것을 특징으로 하는 것인, 진단용 조성물.
PCT/KR2020/005418 2019-04-25 2020-04-24 만성 골수성 백혈병의 진단용 바이오마커 WO2020218866A1 (ko)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR10-2019-0048759 2019-04-25
KR1020190048759A KR102351603B1 (ko) 2019-04-25 2019-04-25 만성 골수성 백혈병의 진단용 바이오마커

Publications (1)

Publication Number Publication Date
WO2020218866A1 true WO2020218866A1 (ko) 2020-10-29

Family

ID=72940628

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2020/005418 WO2020218866A1 (ko) 2019-04-25 2020-04-24 만성 골수성 백혈병의 진단용 바이오마커

Country Status (2)

Country Link
KR (1) KR102351603B1 (ko)
WO (1) WO2020218866A1 (ko)

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20220092730A (ko) 2020-12-24 2022-07-04 순천향대학교 산학협력단 Amd1의 발현 또는 활성 억제제를 유효성분으로 포함하는 백혈병 예방 또는 치료용 약학적 조성물
KR20230144442A (ko) 2022-04-06 2023-10-16 연세대학교 산학협력단 급성기 만성골수성백혈병 진단용 신규 바이오마커 및 이의 용도

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20110190157A1 (en) * 2008-08-15 2011-08-04 The Regents Of The University Of California Biomarkers for Diagnosis and Treatment of Chronic Lymphocytic Leukemia
KR20120095722A (ko) * 2011-02-21 2012-08-29 김현기 타이로신 키나아제 저해제인 닐로티닙 및 이마티닙에 대한 저항성을 가지는 유전자
KR20170019635A (ko) * 2015-08-12 2017-02-22 가톨릭대학교 산학협력단 만성골수성백혈병에 관한 정보 제공 방법
KR101865198B1 (ko) * 2016-04-08 2018-06-08 충남대학교산학협력단 만성골수성백혈병에 관한 정보 제공 방법

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2019070755A1 (en) * 2017-10-02 2019-04-11 The Broad Institute, Inc. METHODS AND COMPOSITIONS FOR DETECTING AND MODULATING A GENETIC SIGNATURE OF IMMUNOTHERAPY RESISTANCE IN CANCER
WO2019091429A1 (en) * 2017-11-08 2019-05-16 Crown Bioscience Inc. (Taicang) Unique genetic fingerprints for murine tumor model and uses thereof

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20110190157A1 (en) * 2008-08-15 2011-08-04 The Regents Of The University Of California Biomarkers for Diagnosis and Treatment of Chronic Lymphocytic Leukemia
KR20120095722A (ko) * 2011-02-21 2012-08-29 김현기 타이로신 키나아제 저해제인 닐로티닙 및 이마티닙에 대한 저항성을 가지는 유전자
KR20170019635A (ko) * 2015-08-12 2017-02-22 가톨릭대학교 산학협력단 만성골수성백혈병에 관한 정보 제공 방법
KR101865198B1 (ko) * 2016-04-08 2018-06-08 충남대학교산학협력단 만성골수성백혈병에 관한 정보 제공 방법

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
HAN, S H, KIM S-H, KIM H-J, LEE Y, CHOI S-Y, PARK G, KIM D-H, LEE A, KIM J, CHOI J-M, KIM Y, MYUNG K, KIM H, KIM D-W: "Coblll is linked to drug resistance and blastic transformation in chronic myeloid leukemia", LEUKEMIA, vol. 31, no. 7, 2017, pages 1532 - 1539, XP055758404, DOI: 10.1038/leu.2017.72 *

Also Published As

Publication number Publication date
KR102351603B1 (ko) 2022-01-18
KR20200125061A (ko) 2020-11-04

Similar Documents

Publication Publication Date Title
Han et al. Ca2+-induced mitochondrial ROS regulate the early embryonic cell cycle
Wang et al. Uncleaved BAP31 in association with A4 protein at the endoplasmic reticulum is an inhibitor of Fas-initiated release of cytochromec from mitochondria
WO2020218866A1 (ko) 만성 골수성 백혈병의 진단용 바이오마커
Zhang et al. The ecdysone receptor coactivator Taiman links Yorkie to transcriptional control of germline stem cell factors in somatic tissue
Zhang et al. A chemical and genetic approach to the mode of action of fumagillin
US20110045474A1 (en) Copi molecules and uses thereof
KR101057116B1 (ko) 포유류에서의 분화 조절제 및 분화 조절 방법
Poyurovsky et al. Nucleotide binding by the Mdm2 RING domain facilitates Arf-independent Mdm2 nucleolar localization
Mass et al. Murine Creld1 controls cardiac development through activation of calcineurin/NFATc1 signaling
Fuentes et al. Molecular determinants of survival motor neuron (SMN) protein cleavage by the calcium-activated protease, calpain
WO2021107644A1 (ko) 항암 효과 증진을 위한 ERRγ 억제제를 유효성분으로 포함하는 조성물의 용도
Wilhelmi et al. The ARFRP1-dependent Golgi scaffolding protein GOPC is required for insulin secretion from pancreatic β-cells
Koo et al. The interaction of Bex and OMP reveals a dimer of OMP with a short half‐life
Sudo et al. LAPSER1 is a putative cytokinetic tumor suppressor that shows the same centrosome and midbody subcellular localization pattern as p80 katanin
Bosio et al. PPP4R2 regulates neuronal cell differentiation and survival, functionally cooperating with SMN
WO2021177518A1 (ko) 혈중 콜레스테롤 저하용, 심혈관 대사질환의 예방 또는 치료용 및 항염용 약학적 조성물
WO2010137770A1 (ko) 신규한 ｇｐｃｒ 단백질 및 이의 용도
WO2019235876A1 (ko) C-src의 발현 또는 활성 억제제를 포함하는 시누클레인병증의 예방 또는 치료용 약학 조성물
Im et al. Cdk5-mediated JIP1 phosphorylation regulates axonal outgrowth through Notch1 inhibition
WO2010016706A2 (ko) Ｉｄｂｆ의 신규 용도
Hornigold et al. Upregulation of Hic-5 in glomerulosclerosis and its regulation of mesangial cell apoptosis
WO2011090283A2 (ko) Ｓｈ３ｒｆ２ 발현 또는 활성 억제제를 함유하는 암의 예방 또는 치료용 조성물
WO2016117949A1 (ko) 포스파티딜이노시톨포스페이트 결합 물질의 세포 사멸 검출 용도
D'Incal et al. In Search of the Hidden Protein: Optimization of Detection Strategies for autism-associated Activity-Dependent Neuroprotective Protein (ADNP) mutants.
JP6616848B2 (ja) ＨＩＦ−１αのメチル化を標的とする血管新生抑制剤のスクリーニング方法

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 20795648

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 20795648

Country of ref document: EP

Kind code of ref document: A1