WO2020172324A1 - Nurr1 receptor modulators - Google Patents

Nurr1 receptor modulators Download PDF

Info

Publication number
WO2020172324A1
WO2020172324A1 PCT/US2020/018890 US2020018890W WO2020172324A1 WO 2020172324 A1 WO2020172324 A1 WO 2020172324A1 US 2020018890 W US2020018890 W US 2020018890W WO 2020172324 A1 WO2020172324 A1 WO 2020172324A1
Authority
WO
WIPO (PCT)
Prior art keywords
substituted
unsubstituted
membered
nhc
och
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2020/018890
Other languages
English (en)
French (fr)
Other versions
WO2020172324A8 (en
Inventor
Pamela M. ENGLAND
Matthew P. Jacobson
Richard Beresis
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Shangphama Innovation Inc
University of California Berkeley
University of California San Diego UCSD
Original Assignee
Shangphama Innovation Inc
University of California Berkeley
University of California San Diego UCSD
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CN202080028466.6A priority Critical patent/CN113692276B/zh
Priority to US17/431,111 priority patent/US20230063230A1/en
Priority to EP20759164.5A priority patent/EP3927330A4/en
Priority to JP2021571643A priority patent/JP7746165B2/ja
Priority to CN202510253725.XA priority patent/CN120097859A/zh
Priority to AU2020226633A priority patent/AU2020226633C1/en
Priority to CA3130269A priority patent/CA3130269A1/en
Application filed by Shangphama Innovation Inc, University of California Berkeley, University of California San Diego UCSD filed Critical Shangphama Innovation Inc
Publication of WO2020172324A1 publication Critical patent/WO2020172324A1/en
Anticipated expiration legal-status Critical
Publication of WO2020172324A8 publication Critical patent/WO2020172324A8/en
Priority to JP2025061013A priority patent/JP2025118609A/ja
Priority to AU2025213600A priority patent/AU2025213600A1/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/16Amides, e.g. hydroxamic acids
    • A61K31/165Amides, e.g. hydroxamic acids having aromatic rings, e.g. colchicine, atenolol, progabide
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/16Amides, e.g. hydroxamic acids
    • A61K31/18Sulfonamides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/21Esters, e.g. nitroglycerine, selenocyanates
    • A61K31/27Esters, e.g. nitroglycerine, selenocyanates of carbamic or thiocarbamic acids, meprobamate, carbachol, neostigmine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/40Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil
    • A61K31/403Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil condensed with carbocyclic rings, e.g. carbazole
    • A61K31/404Indoles, e.g. pindolol
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/41Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with two or more ring hetero atoms, at least one of which being nitrogen, e.g. tetrazole
    • A61K31/4151,2-Diazoles
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/535Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with at least one nitrogen and one oxygen as the ring hetero atoms, e.g. 1,2-oxazines
    • A61K31/53751,4-Oxazines, e.g. morpholine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/14Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
    • A61P25/16Anti-Parkinson drugs
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/18Antipsychotics, i.e. neuroleptics; Drugs for mania or schizophrenia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/30Drugs for disorders of the nervous system for treating abuse or dependence
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07CACYCLIC OR CARBOCYCLIC COMPOUNDS
    • C07C231/00Preparation of carboxylic acid amides
    • C07C231/02Preparation of carboxylic acid amides from carboxylic acids or from esters, anhydrides, or halides thereof by reaction with ammonia or amines
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07CACYCLIC OR CARBOCYCLIC COMPOUNDS
    • C07C231/00Preparation of carboxylic acid amides
    • C07C231/12Preparation of carboxylic acid amides by reactions not involving the formation of carboxamide groups
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07CACYCLIC OR CARBOCYCLIC COMPOUNDS
    • C07C233/00Carboxylic acid amides
    • C07C233/01Carboxylic acid amides having carbon atoms of carboxamide groups bound to hydrogen atoms or to acyclic carbon atoms
    • C07C233/02Carboxylic acid amides having carbon atoms of carboxamide groups bound to hydrogen atoms or to acyclic carbon atoms having nitrogen atoms of carboxamide groups bound to hydrogen atoms or to carbon atoms of unsubstituted hydrocarbon radicals
    • C07C233/11Carboxylic acid amides having carbon atoms of carboxamide groups bound to hydrogen atoms or to acyclic carbon atoms having nitrogen atoms of carboxamide groups bound to hydrogen atoms or to carbon atoms of unsubstituted hydrocarbon radicals with carbon atoms of carboxamide groups bound to carbon atoms of an unsaturated carbon skeleton containing six-membered aromatic rings
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07CACYCLIC OR CARBOCYCLIC COMPOUNDS
    • C07C233/00Carboxylic acid amides
    • C07C233/01Carboxylic acid amides having carbon atoms of carboxamide groups bound to hydrogen atoms or to acyclic carbon atoms
    • C07C233/16Carboxylic acid amides having carbon atoms of carboxamide groups bound to hydrogen atoms or to acyclic carbon atoms having the nitrogen atom of at least one of the carboxamide groups bound to a carbon atom of a hydrocarbon radical substituted by singly-bound oxygen atoms
    • C07C233/17Carboxylic acid amides having carbon atoms of carboxamide groups bound to hydrogen atoms or to acyclic carbon atoms having the nitrogen atom of at least one of the carboxamide groups bound to a carbon atom of a hydrocarbon radical substituted by singly-bound oxygen atoms with the substituted hydrocarbon radical bound to the nitrogen atom of the carboxamide group by an acyclic carbon atom
    • C07C233/22Carboxylic acid amides having carbon atoms of carboxamide groups bound to hydrogen atoms or to acyclic carbon atoms having the nitrogen atom of at least one of the carboxamide groups bound to a carbon atom of a hydrocarbon radical substituted by singly-bound oxygen atoms with the substituted hydrocarbon radical bound to the nitrogen atom of the carboxamide group by an acyclic carbon atom having the carbon atom of the carboxamide group bound to an acyclic carbon atom of a carbon skeleton containing six-membered aromatic rings
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07CACYCLIC OR CARBOCYCLIC COMPOUNDS
    • C07C235/00Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by oxygen atoms
    • C07C235/02Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by oxygen atoms having carbon atoms of carboxamide groups bound to acyclic carbon atoms and singly-bound oxygen atoms bound to the same carbon skeleton
    • C07C235/04Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by oxygen atoms having carbon atoms of carboxamide groups bound to acyclic carbon atoms and singly-bound oxygen atoms bound to the same carbon skeleton the carbon skeleton being acyclic and saturated
    • C07C235/18Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by oxygen atoms having carbon atoms of carboxamide groups bound to acyclic carbon atoms and singly-bound oxygen atoms bound to the same carbon skeleton the carbon skeleton being acyclic and saturated having at least one of the singly-bound oxygen atoms further bound to a carbon atom of a six-membered aromatic ring, e.g. phenoxyacetamides
    • C07C235/20Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by oxygen atoms having carbon atoms of carboxamide groups bound to acyclic carbon atoms and singly-bound oxygen atoms bound to the same carbon skeleton the carbon skeleton being acyclic and saturated having at least one of the singly-bound oxygen atoms further bound to a carbon atom of a six-membered aromatic ring, e.g. phenoxyacetamides having the nitrogen atoms of the carboxamide groups bound to hydrogen atoms or to acyclic carbon atoms
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07CACYCLIC OR CARBOCYCLIC COMPOUNDS
    • C07C235/00Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by oxygen atoms
    • C07C235/88Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by oxygen atoms having the nitrogen atom of at least one of the carboxamide groups further acylated
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07CACYCLIC OR CARBOCYCLIC COMPOUNDS
    • C07C243/00Compounds containing chains of nitrogen atoms singly-bound to each other, e.g. hydrazines, triazanes
    • C07C243/24Hydrazines having nitrogen atoms of hydrazine groups acylated by carboxylic acids
    • C07C243/26Hydrazines having nitrogen atoms of hydrazine groups acylated by carboxylic acids with acylating carboxyl groups bound to hydrogen atoms or to acyclic carbon atoms
    • C07C243/28Hydrazines having nitrogen atoms of hydrazine groups acylated by carboxylic acids with acylating carboxyl groups bound to hydrogen atoms or to acyclic carbon atoms to hydrogen atoms or to carbon atoms of a saturated carbon skeleton
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07CACYCLIC OR CARBOCYCLIC COMPOUNDS
    • C07C243/00Compounds containing chains of nitrogen atoms singly-bound to each other, e.g. hydrazines, triazanes
    • C07C243/24Hydrazines having nitrogen atoms of hydrazine groups acylated by carboxylic acids
    • C07C243/26Hydrazines having nitrogen atoms of hydrazine groups acylated by carboxylic acids with acylating carboxyl groups bound to hydrogen atoms or to acyclic carbon atoms
    • C07C243/30Hydrazines having nitrogen atoms of hydrazine groups acylated by carboxylic acids with acylating carboxyl groups bound to hydrogen atoms or to acyclic carbon atoms to carbon atoms of an unsaturated carbon skeleton
    • C07C243/32Hydrazines having nitrogen atoms of hydrazine groups acylated by carboxylic acids with acylating carboxyl groups bound to hydrogen atoms or to acyclic carbon atoms to carbon atoms of an unsaturated carbon skeleton the carbon skeleton containing rings
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07CACYCLIC OR CARBOCYCLIC COMPOUNDS
    • C07C247/00Compounds containing azido groups
    • C07C247/02Compounds containing azido groups with azido groups bound to acyclic carbon atoms of a carbon skeleton
    • C07C247/04Compounds containing azido groups with azido groups bound to acyclic carbon atoms of a carbon skeleton being saturated
    • C07C247/06Compounds containing azido groups with azido groups bound to acyclic carbon atoms of a carbon skeleton being saturated and containing rings
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07CACYCLIC OR CARBOCYCLIC COMPOUNDS
    • C07C261/00Derivatives of cyanic acid
    • C07C261/04Cyanamides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07CACYCLIC OR CARBOCYCLIC COMPOUNDS
    • C07C271/00Derivatives of carbamic acids, i.e. compounds containing any of the groups, the nitrogen atom not being part of nitro or nitroso groups
    • C07C271/06Esters of carbamic acids
    • C07C271/08Esters of carbamic acids having oxygen atoms of carbamate groups bound to acyclic carbon atoms
    • C07C271/10Esters of carbamic acids having oxygen atoms of carbamate groups bound to acyclic carbon atoms with the nitrogen atoms of the carbamate groups bound to hydrogen atoms or to acyclic carbon atoms
    • C07C271/20Esters of carbamic acids having oxygen atoms of carbamate groups bound to acyclic carbon atoms with the nitrogen atoms of the carbamate groups bound to hydrogen atoms or to acyclic carbon atoms to carbon atoms of hydrocarbon radicals substituted by nitrogen atoms not being part of nitro or nitroso groups
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07CACYCLIC OR CARBOCYCLIC COMPOUNDS
    • C07C303/00Preparation of esters or amides of sulfuric acids; Preparation of sulfonic acids or of their esters, halides, anhydrides or amides
    • C07C303/02Preparation of esters or amides of sulfuric acids; Preparation of sulfonic acids or of their esters, halides, anhydrides or amides of sulfonic acids or halides thereof
    • C07C303/22Preparation of esters or amides of sulfuric acids; Preparation of sulfonic acids or of their esters, halides, anhydrides or amides of sulfonic acids or halides thereof from sulfonic acids, by reactions not involving the formation of sulfo or halosulfonyl groups; from sulfonic halides by reactions not involving the formation of halosulfonyl groups
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07CACYCLIC OR CARBOCYCLIC COMPOUNDS
    • C07C303/00Preparation of esters or amides of sulfuric acids; Preparation of sulfonic acids or of their esters, halides, anhydrides or amides
    • C07C303/26Preparation of esters or amides of sulfuric acids; Preparation of sulfonic acids or of their esters, halides, anhydrides or amides of esters of sulfonic acids
    • C07C303/28Preparation of esters or amides of sulfuric acids; Preparation of sulfonic acids or of their esters, halides, anhydrides or amides of esters of sulfonic acids by reaction of hydroxy compounds with sulfonic acids or derivatives thereof
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07CACYCLIC OR CARBOCYCLIC COMPOUNDS
    • C07C303/00Preparation of esters or amides of sulfuric acids; Preparation of sulfonic acids or of their esters, halides, anhydrides or amides
    • C07C303/36Preparation of esters or amides of sulfuric acids; Preparation of sulfonic acids or of their esters, halides, anhydrides or amides of amides of sulfonic acids
    • C07C303/38Preparation of esters or amides of sulfuric acids; Preparation of sulfonic acids or of their esters, halides, anhydrides or amides of amides of sulfonic acids by reaction of ammonia or amines with sulfonic acids, or with esters, anhydrides, or halides thereof
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07CACYCLIC OR CARBOCYCLIC COMPOUNDS
    • C07C309/00Sulfonic acids; Halides, esters, or anhydrides thereof
    • C07C309/01Sulfonic acids
    • C07C309/02Sulfonic acids having sulfo groups bound to acyclic carbon atoms
    • C07C309/03Sulfonic acids having sulfo groups bound to acyclic carbon atoms of an acyclic saturated carbon skeleton
    • C07C309/13Sulfonic acids having sulfo groups bound to acyclic carbon atoms of an acyclic saturated carbon skeleton containing nitrogen atoms, not being part of nitro or nitroso groups, bound to the carbon skeleton
    • C07C309/14Sulfonic acids having sulfo groups bound to acyclic carbon atoms of an acyclic saturated carbon skeleton containing nitrogen atoms, not being part of nitro or nitroso groups, bound to the carbon skeleton containing amino groups bound to the carbon skeleton
    • C07C309/15Sulfonic acids having sulfo groups bound to acyclic carbon atoms of an acyclic saturated carbon skeleton containing nitrogen atoms, not being part of nitro or nitroso groups, bound to the carbon skeleton containing amino groups bound to the carbon skeleton the nitrogen atom of at least one of the amino groups being part of any of the groups, X being a hetero atom, Y being any atom
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07CACYCLIC OR CARBOCYCLIC COMPOUNDS
    • C07C309/00Sulfonic acids; Halides, esters, or anhydrides thereof
    • C07C309/63Esters of sulfonic acids
    • C07C309/64Esters of sulfonic acids having sulfur atoms of esterified sulfo groups bound to acyclic carbon atoms
    • C07C309/70Esters of sulfonic acids having sulfur atoms of esterified sulfo groups bound to acyclic carbon atoms of a carbon skeleton substituted by carboxyl groups
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07CACYCLIC OR CARBOCYCLIC COMPOUNDS
    • C07C311/00Amides of sulfonic acids, i.e. compounds having singly-bound oxygen atoms of sulfo groups replaced by nitrogen atoms, not being part of nitro or nitroso groups
    • C07C311/01Sulfonamides having sulfur atoms of sulfonamide groups bound to acyclic carbon atoms
    • C07C311/02Sulfonamides having sulfur atoms of sulfonamide groups bound to acyclic carbon atoms of an acyclic saturated carbon skeleton
    • C07C311/03Sulfonamides having sulfur atoms of sulfonamide groups bound to acyclic carbon atoms of an acyclic saturated carbon skeleton having the nitrogen atoms of the sulfonamide groups bound to hydrogen atoms or to acyclic carbon atoms
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07CACYCLIC OR CARBOCYCLIC COMPOUNDS
    • C07C311/00Amides of sulfonic acids, i.e. compounds having singly-bound oxygen atoms of sulfo groups replaced by nitrogen atoms, not being part of nitro or nitroso groups
    • C07C311/01Sulfonamides having sulfur atoms of sulfonamide groups bound to acyclic carbon atoms
    • C07C311/02Sulfonamides having sulfur atoms of sulfonamide groups bound to acyclic carbon atoms of an acyclic saturated carbon skeleton
    • C07C311/03Sulfonamides having sulfur atoms of sulfonamide groups bound to acyclic carbon atoms of an acyclic saturated carbon skeleton having the nitrogen atoms of the sulfonamide groups bound to hydrogen atoms or to acyclic carbon atoms
    • C07C311/05Sulfonamides having sulfur atoms of sulfonamide groups bound to acyclic carbon atoms of an acyclic saturated carbon skeleton having the nitrogen atoms of the sulfonamide groups bound to hydrogen atoms or to acyclic carbon atoms to acyclic carbon atoms of hydrocarbon radicals substituted by nitrogen atoms, not being part of nitro or nitroso groups
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07CACYCLIC OR CARBOCYCLIC COMPOUNDS
    • C07C311/00Amides of sulfonic acids, i.e. compounds having singly-bound oxygen atoms of sulfo groups replaced by nitrogen atoms, not being part of nitro or nitroso groups
    • C07C311/01Sulfonamides having sulfur atoms of sulfonamide groups bound to acyclic carbon atoms
    • C07C311/02Sulfonamides having sulfur atoms of sulfonamide groups bound to acyclic carbon atoms of an acyclic saturated carbon skeleton
    • C07C311/03Sulfonamides having sulfur atoms of sulfonamide groups bound to acyclic carbon atoms of an acyclic saturated carbon skeleton having the nitrogen atoms of the sulfonamide groups bound to hydrogen atoms or to acyclic carbon atoms
    • C07C311/06Sulfonamides having sulfur atoms of sulfonamide groups bound to acyclic carbon atoms of an acyclic saturated carbon skeleton having the nitrogen atoms of the sulfonamide groups bound to hydrogen atoms or to acyclic carbon atoms to acyclic carbon atoms of hydrocarbon radicals substituted by carboxyl groups
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07CACYCLIC OR CARBOCYCLIC COMPOUNDS
    • C07C311/00Amides of sulfonic acids, i.e. compounds having singly-bound oxygen atoms of sulfo groups replaced by nitrogen atoms, not being part of nitro or nitroso groups
    • C07C311/22Sulfonamides, the carbon skeleton of the acid part being further substituted by singly-bound oxygen atoms
    • C07C311/23Sulfonamides, the carbon skeleton of the acid part being further substituted by singly-bound oxygen atoms having the sulfur atoms of the sulfonamide groups bound to acyclic carbon atoms
    • C07C311/24Sulfonamides, the carbon skeleton of the acid part being further substituted by singly-bound oxygen atoms having the sulfur atoms of the sulfonamide groups bound to acyclic carbon atoms of an acyclic saturated carbon skeleton
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07CACYCLIC OR CARBOCYCLIC COMPOUNDS
    • C07C311/00Amides of sulfonic acids, i.e. compounds having singly-bound oxygen atoms of sulfo groups replaced by nitrogen atoms, not being part of nitro or nitroso groups
    • C07C311/48Amides of sulfonic acids, i.e. compounds having singly-bound oxygen atoms of sulfo groups replaced by nitrogen atoms, not being part of nitro or nitroso groups having nitrogen atoms of sulfonamide groups further bound to another hetero atom
    • C07C311/49Amides of sulfonic acids, i.e. compounds having singly-bound oxygen atoms of sulfo groups replaced by nitrogen atoms, not being part of nitro or nitroso groups having nitrogen atoms of sulfonamide groups further bound to another hetero atom to nitrogen atoms
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07CACYCLIC OR CARBOCYCLIC COMPOUNDS
    • C07C321/00Thiols, sulfides, hydropolysulfides or polysulfides
    • C07C321/12Sulfides, hydropolysulfides, or polysulfides having thio groups bound to acyclic carbon atoms
    • C07C321/20Sulfides, hydropolysulfides, or polysulfides having thio groups bound to acyclic carbon atoms of an unsaturated carbon skeleton containing rings
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07CACYCLIC OR CARBOCYCLIC COMPOUNDS
    • C07C323/00Thiols, sulfides, hydropolysulfides or polysulfides substituted by halogen, oxygen or nitrogen atoms, or by sulfur atoms not being part of thio groups
    • C07C323/23Thiols, sulfides, hydropolysulfides or polysulfides substituted by halogen, oxygen or nitrogen atoms, or by sulfur atoms not being part of thio groups containing thio groups and nitrogen atoms, not being part of nitro or nitroso groups, bound to the same carbon skeleton
    • C07C323/24Thiols, sulfides, hydropolysulfides or polysulfides substituted by halogen, oxygen or nitrogen atoms, or by sulfur atoms not being part of thio groups containing thio groups and nitrogen atoms, not being part of nitro or nitroso groups, bound to the same carbon skeleton having the sulfur atoms of the thio groups bound to acyclic carbon atoms of the carbon skeleton
    • C07C323/25Thiols, sulfides, hydropolysulfides or polysulfides substituted by halogen, oxygen or nitrogen atoms, or by sulfur atoms not being part of thio groups containing thio groups and nitrogen atoms, not being part of nitro or nitroso groups, bound to the same carbon skeleton having the sulfur atoms of the thio groups bound to acyclic carbon atoms of the carbon skeleton the carbon skeleton being acyclic and saturated
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07CACYCLIC OR CARBOCYCLIC COMPOUNDS
    • C07C323/00Thiols, sulfides, hydropolysulfides or polysulfides substituted by halogen, oxygen or nitrogen atoms, or by sulfur atoms not being part of thio groups
    • C07C323/23Thiols, sulfides, hydropolysulfides or polysulfides substituted by halogen, oxygen or nitrogen atoms, or by sulfur atoms not being part of thio groups containing thio groups and nitrogen atoms, not being part of nitro or nitroso groups, bound to the same carbon skeleton
    • C07C323/39Thiols, sulfides, hydropolysulfides or polysulfides substituted by halogen, oxygen or nitrogen atoms, or by sulfur atoms not being part of thio groups containing thio groups and nitrogen atoms, not being part of nitro or nitroso groups, bound to the same carbon skeleton at least one of the nitrogen atoms being part of any of the groups, X being a hetero atom, Y being any atom
    • C07C323/40Y being a hydrogen or a carbon atom
    • C07C323/41Y being a hydrogen or an acyclic carbon atom
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07CACYCLIC OR CARBOCYCLIC COMPOUNDS
    • C07C67/00Preparation of carboxylic acid esters
    • C07C67/03Preparation of carboxylic acid esters by reacting an ester group with a hydroxy group
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D209/00Heterocyclic compounds containing five-membered rings, condensed with other rings, with one nitrogen atom as the only ring hetero atom
    • C07D209/02Heterocyclic compounds containing five-membered rings, condensed with other rings, with one nitrogen atom as the only ring hetero atom condensed with one carbocyclic ring
    • C07D209/04Indoles; Hydrogenated indoles
    • C07D209/30Indoles; Hydrogenated indoles with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, directly attached to carbon atoms of the hetero ring
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D217/00Heterocyclic compounds containing isoquinoline or hydrogenated isoquinoline ring systems
    • C07D217/02Heterocyclic compounds containing isoquinoline or hydrogenated isoquinoline ring systems with only hydrogen atoms or radicals containing only carbon and hydrogen atoms, directly attached to carbon atoms of the nitrogen-containing ring; Alkylene-bis-isoquinolines
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D231/00Heterocyclic compounds containing 1,2-diazole or hydrogenated 1,2-diazole rings
    • C07D231/02Heterocyclic compounds containing 1,2-diazole or hydrogenated 1,2-diazole rings not condensed with other rings
    • C07D231/10Heterocyclic compounds containing 1,2-diazole or hydrogenated 1,2-diazole rings not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members
    • C07D231/12Heterocyclic compounds containing 1,2-diazole or hydrogenated 1,2-diazole rings not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members with only hydrogen atoms, hydrocarbon or substituted hydrocarbon radicals, directly attached to ring carbon atoms
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D249/00Heterocyclic compounds containing five-membered rings having three nitrogen atoms as the only ring hetero atoms
    • C07D249/02Heterocyclic compounds containing five-membered rings having three nitrogen atoms as the only ring hetero atoms not condensed with other rings
    • C07D249/041,2,3-Triazoles; Hydrogenated 1,2,3-triazoles
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D249/00Heterocyclic compounds containing five-membered rings having three nitrogen atoms as the only ring hetero atoms
    • C07D249/02Heterocyclic compounds containing five-membered rings having three nitrogen atoms as the only ring hetero atoms not condensed with other rings
    • C07D249/041,2,3-Triazoles; Hydrogenated 1,2,3-triazoles
    • C07D249/061,2,3-Triazoles; Hydrogenated 1,2,3-triazoles with aryl radicals directly attached to ring atoms
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D257/00Heterocyclic compounds containing rings having four nitrogen atoms as the only ring hetero atoms
    • C07D257/02Heterocyclic compounds containing rings having four nitrogen atoms as the only ring hetero atoms not condensed with other rings
    • C07D257/04Five-membered rings
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D265/00Heterocyclic compounds containing six-membered rings having one nitrogen atom and one oxygen atom as the only ring hetero atoms
    • C07D265/281,4-Oxazines; Hydrogenated 1,4-oxazines
    • C07D265/301,4-Oxazines; Hydrogenated 1,4-oxazines not condensed with other rings
    • C07D265/321,4-Oxazines; Hydrogenated 1,4-oxazines not condensed with other rings with oxygen atoms directly attached to ring carbon atoms
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D295/00Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms
    • C07D295/04Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms with substituted hydrocarbon radicals attached to ring nitrogen atoms
    • C07D295/12Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms with substituted hydrocarbon radicals attached to ring nitrogen atoms substituted by singly or doubly bound nitrogen atoms
    • C07D295/125Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms with substituted hydrocarbon radicals attached to ring nitrogen atoms substituted by singly or doubly bound nitrogen atoms with the ring nitrogen atoms and the substituent nitrogen atoms attached to the same carbon chain, which is not interrupted by carbocyclic rings
    • C07D295/13Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms with substituted hydrocarbon radicals attached to ring nitrogen atoms substituted by singly or doubly bound nitrogen atoms with the ring nitrogen atoms and the substituent nitrogen atoms attached to the same carbon chain, which is not interrupted by carbocyclic rings to an acyclic saturated chain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D401/00Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom
    • C07D401/02Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings
    • C07D401/04Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings directly linked by a ring-member-to-ring-member bond
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D401/00Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom
    • C07D401/02Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings
    • C07D401/12Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings linked by a chain containing hetero atoms as chain links
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D403/00Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00
    • C07D403/02Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00 containing two hetero rings
    • C07D403/04Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00 containing two hetero rings directly linked by a ring-member-to-ring-member bond
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D403/00Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00
    • C07D403/02Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00 containing two hetero rings
    • C07D403/12Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00 containing two hetero rings linked by a chain containing hetero atoms as chain links
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D405/00Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom
    • C07D405/02Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom containing two hetero rings
    • C07D405/04Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom containing two hetero rings directly linked by a ring-member-to-ring-member bond
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D409/00Heterocyclic compounds containing two or more hetero rings, at least one ring having sulfur atoms as the only ring hetero atoms
    • C07D409/02Heterocyclic compounds containing two or more hetero rings, at least one ring having sulfur atoms as the only ring hetero atoms containing two hetero rings
    • C07D409/04Heterocyclic compounds containing two or more hetero rings, at least one ring having sulfur atoms as the only ring hetero atoms containing two hetero rings directly linked by a ring-member-to-ring-member bond
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D413/00Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms
    • C07D413/02Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings
    • C07D413/06Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings linked by a carbon chain containing only aliphatic carbon atoms
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D413/00Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms
    • C07D413/02Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings
    • C07D413/12Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings linked by a chain containing hetero atoms as chain links
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07FACYCLIC, CARBOCYCLIC OR HETEROCYCLIC COMPOUNDS CONTAINING ELEMENTS OTHER THAN CARBON, HYDROGEN, HALOGEN, OXYGEN, NITROGEN, SULFUR, SELENIUM OR TELLURIUM
    • C07F5/00Compounds containing elements of Groups 3 or 13 of the Periodic Table
    • C07F5/02Boron compounds
    • C07F5/027Organoboranes and organoborohydrides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07FACYCLIC, CARBOCYCLIC OR HETEROCYCLIC COMPOUNDS CONTAINING ELEMENTS OTHER THAN CARBON, HYDROGEN, HALOGEN, OXYGEN, NITROGEN, SULFUR, SELENIUM OR TELLURIUM
    • C07F7/00Compounds containing elements of Groups 4 or 14 of the Periodic Table
    • C07F7/02Silicon compounds
    • C07F7/08Compounds having one or more C—Si linkages
    • C07F7/0803Compounds with Si-C or Si-Si linkages
    • C07F7/081Compounds with Si-C or Si-Si linkages comprising at least one atom selected from the elements N, O, halogen, S, Se or Te
    • C07F7/0812Compounds with Si-C or Si-Si linkages comprising at least one atom selected from the elements N, O, halogen, S, Se or Te comprising a heterocyclic ring
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07FACYCLIC, CARBOCYCLIC OR HETEROCYCLIC COMPOUNDS CONTAINING ELEMENTS OTHER THAN CARBON, HYDROGEN, HALOGEN, OXYGEN, NITROGEN, SULFUR, SELENIUM OR TELLURIUM
    • C07F7/00Compounds containing elements of Groups 4 or 14 of the Periodic Table
    • C07F7/02Silicon compounds
    • C07F7/08Compounds having one or more C—Si linkages
    • C07F7/18Compounds having one or more C—Si linkages as well as one or more C—O—Si linkages
    • C07F7/1804Compounds having Si-O-C linkages
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07FACYCLIC, CARBOCYCLIC OR HETEROCYCLIC COMPOUNDS CONTAINING ELEMENTS OTHER THAN CARBON, HYDROGEN, HALOGEN, OXYGEN, NITROGEN, SULFUR, SELENIUM OR TELLURIUM
    • C07F9/00Compounds containing elements of Groups 5 or 15 of the Periodic Table
    • C07F9/02Phosphorus compounds
    • C07F9/06Phosphorus compounds without P—C bonds
    • C07F9/16Esters of thiophosphoric acids or thiophosphorous acids
    • C07F9/165Esters of thiophosphoric acids
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07FACYCLIC, CARBOCYCLIC OR HETEROCYCLIC COMPOUNDS CONTAINING ELEMENTS OTHER THAN CARBON, HYDROGEN, HALOGEN, OXYGEN, NITROGEN, SULFUR, SELENIUM OR TELLURIUM
    • C07F9/00Compounds containing elements of Groups 5 or 15 of the Periodic Table
    • C07F9/02Phosphorus compounds
    • C07F9/06Phosphorus compounds without P—C bonds
    • C07F9/16Esters of thiophosphoric acids or thiophosphorous acids
    • C07F9/165Esters of thiophosphoric acids
    • C07F9/1653Esters of thiophosphoric acids with arylalkanols

Definitions

  • idiopathic PD Although the molecular basis for idiopathic PD remains incompletely understood, it has been proposed to include oxidative stress, mitochondrial dysfunction, and dysregulation of dopamine homeostasis. Currently, there are no available treatments that stop or even slow the progression of PD.
  • Ring A is aryl or heteroaryl.
  • L 1 is L 101 -L 102 -L 103 .
  • L 101 is a bond, -S(0) 2 -, -N(R 101 )-, -0-, -S-, -C(O)-, -C(0)N(R 101 )-, -N(R 101 )C(O)-,
  • cycloalkylene substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted aryl ene, substituted or unsubstituted heteroaryl ene, L 104 -L 105 , L 104 -NH-L 105 , or L 104 -CH2-L 105 .
  • L 102 is a bond, -S(0) 2 -, -N(R 102 )-, -0-, -S-, -C(O)-, -C(0)N(R 102 )-, -N(R 102 )C(O)-,
  • cycloalkylene substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroaryl ene.
  • L 103 is a bond, -S(0) 2 -, -N(R 103 )-, -0-, -S-, -C(O)-, -C(0)N(R 103 )-, -N(R 103 )C(O)-,
  • cycloalkylene substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroaryl ene.
  • L 104 is a bond, -0-, -NH-, -S-, -S(0) 2 -, -C(O)-, -NHC(O)-, -C(0)NH-, -OC(O)-,
  • L 105 is a bond, -0-, -NH-, -S-, -S(0) 2 -, -C(O)-, -NHC(O)-, -C(0)NH-, -OC(O)-,
  • heterocycloalkyl ene
  • R 101 , R 102 , and R 103 are independently hydrogen, oxo, halogen, -CCb, -CBn, -CF3,
  • R 1 is hydrogen, halogen, -CXb, -CHXb, -CH 2 X ⁇ -OCX , -OCHzX 1 , -OCHX , -CN, -SOniR 1D , -SOviNR 1A R 1B , -NHC(0)NR 1A R 1b , -N(0) mi , -NR 1A R 1B , -C(0)R lc ,
  • E is an electrophilic moiety.
  • R 2 is independently halogen, -CX 2 3 , -CHX 2 2 , -CH 2 X 2 , -OCX 2 3 , -OCH 2 X 2 ,
  • R 1A , R 1b , R 1C , R 1d , R 2A , R 2B , R 2C , and R 2D are independently hydrogen, halogen, -CCb, -CBr 3 , -CF3, -CI3, -CHiCl, -CH 2 Br, -CH 2 F, -CH 2 I, -CHCb, -CHBr 2 , -CHF 2 , -CHI 2 , -CN, -OH, -Mi l , -COOH, -CONK ! , -N0 2 , -SH, -SO3H, -S0 4 H, -S0 2 NH 2 , -NHNH 2 , -NHNH 2 ,
  • nl and n2 are independently an integer from 0 to 4.
  • ml, m2, vl, and v2 are independently 1 or 2.
  • X 1 and X 2 are independently -F, -Cl, -Br, or -I.
  • z2 is an integer from 0 to 5.
  • composition including a compound described herein and a pharmaceutically acceptable excipient.
  • the method including administering to the subject in need thereof a therapeutically effective amount of a compound described herein.
  • a method of modulating the level of activity of Nurrl in a subject in need thereof including administering to the subject in need thereof a therapeutically effective amount of a compound described herein.
  • a method of increasing the level of activity of Nurrl in a cell including contacting the cell with a compound described herein.
  • a method of increasing the level of dopamine in a cell including contacting the cell with a compound described herein.
  • FIGS. 1A-1C Crystal structures of Nurrl -screening hit complexes reveal two different ligand binding sites and receptor conformations.
  • FIG. 1 A Structures of screening hits 19.49 and 10.25.
  • FIG. IB Structure of 19.49 screening hit covalently bound to Cys566.
  • FIG. 1C Structure of 10.25 screening hit covalently bound to Cys566.
  • FIGS. 2A-2B Compounds 85 (FIG. 2A) and 87 (FIG. 2B) both bind to the Nurrl ligand binding domain with high nanomolar affinity. Binding measured by microscale thermophoresis.
  • FIGS. 3A-3B Compounds 85 (FIG. 3A) and 87 (FIG. 3B) stimulate the
  • FIGS. 4A-4D Reaction schemes for select compounds.
  • substituent groups are specified by their conventional chemical formulae, written from left to right, they equally encompass the chemically identical substituents that would result from writing the structure from right to left, e.g., -CH2O- is equivalent to -OCH2-.
  • alkyl by itself or as part of another substituent, means, unless otherwise stated, a straight (i.e., unbranched) or branched carbon chain (or carbon), or combination thereof, which may be fully saturated, mono- or polyunsaturated and can include mono-, di-, and multivalent radicals.
  • the alkyl may include a designated number of carbons (e.g., C1-C10 means one to ten carbons).
  • Alkyl is an uncyclized chain.
  • saturated hydrocarbon radicals include, but are not limited to, groups such as methyl, ethyl, n-propyl, isopropyl, n- butyl, t-butyl, isobutyl, sec-butyl, methyl, homologs and isomers of, for example, n-pentyl, n- hexyl, n-heptyl, n-octyl, and the like.
  • An unsaturated alkyl group is one having one or more double bonds or triple bonds.
  • unsaturated alkyl groups include, but are not limited to, vinyl, 2-propenyl, crotyl, 2-isopentenyl, 2-(butadienyl), 2,4-pentadienyl, 3-(l,4- pentadienyl), ethynyl, 1- and 3-propynyl, 3-butynyl, and the higher homologs and isomers.
  • An alkoxy is an alkyl attached to the remainder of the molecule via an oxygen linker (-0-).
  • An alkyl moiety may be an alkenyl moiety.
  • An alkyl moiety may be an alkynyl moiety.
  • An alkyl moiety may be fully saturated.
  • An alkenyl may include more than one double bond and/or one or more triple bonds in addition to the one or more double bonds.
  • An alkynyl may include more than one triple bond and/or one or more double bonds in addition to the one or more triple bonds.
  • alkylene by itself or as part of another substituent, means, unless otherwise stated, a divalent radical derived from an alkyl, as exemplified, but not limited by, -CH2CH2CH2CH2-.
  • an alkyl (or alkylene) group will have from 1 to 24 carbon atoms, with those groups having 10 or fewer carbon atoms being preferred herein.
  • A“lower alkyl” or“lower alkylene” is a shorter chain alkyl or alkylene group, generally having eight or fewer carbon atoms.
  • alkenylene by itself or as part of another substituent, means, unless otherwise stated, a divalent radical derived from an alkene.
  • heteroalkyl by itself or in combination with another term, means, unless otherwise stated, a stable straight or branched chain, or combinations thereof, including at least one carbon atom and at least one heteroatom (e.g., O, N, P, Si, and S), and wherein the nitrogen and sulfur atoms may optionally be oxidized, and the nitrogen heteroatom may optionally be quatemized.
  • the heteroatom(s) e.g., N, S, Si, or P
  • Heteroalkyl is an uncyclized chain. Examples include, but are not limited to: -CH2-CH2-O-CH3, -CH2-CH2-NH-CH3,
  • a heteroalkyl moiety may include one heteroatom (e.g., O, N, S, Si, or P).
  • a heteroalkyl moiety may include two optionally different heteroatoms (e.g., O, N, S, Si, or P).
  • a heteroalkyl moiety may include three optionally different heteroatoms (e.g., O, N, S, Si, or P).
  • a heteroalkyl moiety may include four optionally different heteroatoms (e.g., O, N, S, Si, or P).
  • a heteroalkyl moiety may include five optionally different heteroatoms (e.g., O, N, S, Si, or P).
  • a heteroalkyl moiety may include up to 8 optionally different heteroatoms (e.g., O, N, S, Si, or P).
  • the term “heteroalkenyl,” by itself or in combination with another term, means, unless otherwise stated, a heteroalkyl including at least one double bond.
  • a heteroalkenyl may optionally include more than one double bond and/or one or more triple bonds in additional to the one or more double bonds.
  • the term“heteroalkynyl,” by itself or in combination with another term, means, unless otherwise stated, a heteroalkyl including at least one triple bond.
  • heteroalkynyl may optionally include more than one triple bond and/or one or more double bonds in additional to the one or more triple bonds.
  • heteroalkylene by itself or as part of another substituent, means, unless otherwise stated, a divalent radical derived from heteroalkyl, as exemplified, but not limited by, -CH2-CH2-S-CH2-CH2- and -CH2-S-CH2-CH2-NH-CH2-.
  • heteroalkylene groups heteroatoms can also occupy either or both of the chain termini (e.g., alkyleneoxy, alkylenedioxy, alkyleneamino, alkylenediamino, and the like). Still further, for alkylene and heteroalkylene linking groups, no orientation of the linking group is implied by the direction in which the formula of the linking group is written. For example, the formula -C(0)2R'- represents both -C(0)2R'- and -R'C(0)2-.
  • heteroalkyl groups include those groups that are attached to the remainder of the molecule through a heteroatom, such as -C(0)R', -C(0)NR', -NR'R", -OR', -SR, and/or -SO2R.
  • heteroalkyl is recited, followed by recitations of specific heteroalkyl groups, such as - NR'R" or the like, it will be understood that the terms heteroalkyl and -NR'R" are not redundant or mutually exclusive. Rather, the specific heteroalkyl groups are recited to add clarity. Thus, the term“heteroalkyl” should not be interpreted herein as excluding specific heteroalkyl groups, such as -NR'R” or the like.
  • Cycloalkyl and heterocycloalkyl are not aromatic. Additionally, for heterocycloalkyl, a heteroatom can occupy the position at which the heterocycle is attached to the remainder of the molecule.
  • Examples of cycloalkyl include, but are not limited to, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, 1-cyclohexenyl, 3-cyclohexenyl, cycloheptyl, and the like.
  • heterocycloalkyl examples include, but are not limited to, 1- (1,2,5,6-tetrahydropyridyl), 1-piperidinyl, 2-piperidinyl, 3-piperidinyl, 4-morpholinyl, 3- morpholinyl, tetrahydrofuran-2-yl, tetrahydrofuran-3-yl, tetrahydrothien-2-yl,
  • halo(Ci-C4)alkyl includes, but is not limited to, fluoromethyl, difluoromethyl, trifluoromethyl, 2,2,2-trifluoroethyl, 4-chlorobutyl, 3-bromopropyl, and the like.
  • acyl means, unless otherwise stated, -C(0)R where R is a substituted or unsubstituted alkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
  • aryl means, unless otherwise stated, a polyunsaturated, aromatic, hydrocarbon substituent, which can be a single ring or multiple rings (preferably from 1 to 3 rings) that are fused together (i.e., a fused ring aryl) or linked covalently.
  • a fused ring aryl refers to multiple rings fused together wherein at least one of the fused rings is an aryl ring.
  • heteroaryl refers to aryl groups (or rings) that contain at least one heteroatom such as N, O, or S, wherein the nitrogen and sulfur atoms are optionally oxidized, and the nitrogen atom(s) are optionally quaternized.
  • heteroaryl includes fused ring heteroaryl groups (i.e., multiple rings fused together wherein at least one of the fused rings is a heteroaromatic ring).
  • a 5,6-fused ring heteroarylene refers to two rings fused together, wherein one ring has 5 members and the other ring has 6 members, and wherein at least one ring is a heteroaryl ring.
  • a 6,6-fused ring heteroarylene refers to two rings fused together, wherein one ring has 6 members and the other ring has 6 members, and wherein at least one ring is a heteroaryl ring.
  • a 6,5-fused ring heteroarylene refers to two rings fused together, wherein one ring has 6 members and the other ring has 5 members, and wherein at least one ring is a heteroaryl ring.
  • a heteroaryl group can be attached to the remainder of the molecule through a carbon or heteroatom.
  • Non-limiting examples of aryl and heteroaryl groups include phenyl, naphthyl, pyrrolyl, pyrazolyl, pyridazinyl, triazinyl, pyrimidinyl, imidazolyl, pyrazinyl, purinyl, oxazolyl, isoxazolyl, thiazolyl, furyl, thienyl, pyridyl, pyrimidyl, benzothiazolyl, benzoxazoyl benzimidazolyl, benzofuran,
  • Substituents for each of the above noted aryl and heteroaryl ring systems are selected from the group of acceptable substituents described below.
  • An“arylene” and a“heteroarylene,” alone or as part of another substituent, mean a divalent radical derived from an aryl and heteroaryl, respectively.
  • a heteroaryl group substituent may be -O- bonded to a ring heteroatom nitrogen.
  • Spirocyclic rings are two or more rings wherein adjacent rings are attached through a single atom.
  • the individual rings within spirocyclic rings may be identical or different.
  • Individual rings in spirocyclic rings may be substituted or unsubstituted and may have different substituents from other individual rings within a set of spirocyclic rings.
  • Possible substituents for individual rings within spirocyclic rings are the possible substituents for the same ring when not part of spirocyclic rings (e.g., substituents for cycloalkyl or
  • Spirocylic rings may be substituted or unsubstituted cycloalkyl, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heterocycloalkylene and individual rings within a spirocyclic ring group may be any of the immediately previous list, including having all rings of one type (e.g., all rings being substituted heterocycloalkylene wherein each ring may be the same or different substituted heterocycloalkylene).
  • heterocyclic spirocyclic rings means a spirocyclic rings wherein at least one ring is a heterocyclic ring and wherein each ring may be a different ring.
  • substituted spirocyclic rings means that at least one ring is substituted and each substituent may optionally be different.
  • oxo means an oxygen that is double bonded to a carbon atom.
  • alkylarylene as an arylene moiety covalently bonded to an alkylene moiety (also referred to herein as an alkylene linker).
  • alkylarylene group has the formula:
  • An alkylarylene moiety may be substituted (e.g., with a substituent group) on the alkylene moiety or the arylene linker (e.g., at carbons 2, 3, 4, or 6) with halogen, oxo, -N 3 , -CF3, -CCI3, -CBr , -CI3, -CN, -CHO, -OH, -NH 2 , -COOH, -CONH2, -NO2, -SH, -SO2CH3, -SO 3 H, -OSO 3 H, -SO 2 NH 2 , -NHNH 2 , -ONH 2 , -NHC(0)NHNH 2 , substituted or
  • alkylarylene is unsubstituted.
  • heterocycloalkyl includes both substituted and unsubstituted forms of the indicated radical. Preferred substituents for each type of radical are provided below.
  • R, R', R", R'", and R" each preferably independently refer to hydrogen, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl (e.g., aryl substituted with 1-3 halogens), substituted or unsubstituted heteroaryl, substituted or unsubstituted alkyl, alkoxy, or thioalkoxy groups, or arylalkyl groups.
  • aryl e.g., aryl substituted with 1-3 halogens
  • substituted or unsubstituted heteroaryl substituted or unsubstituted alkyl, alkoxy, or thioalkoxy groups, or arylalkyl groups.
  • each of the R groups is independently selected as are each R', R", R", and R"" group when more than one of these groups is present.
  • R' and R" are attached to the same nitrogen atom, they can be combined with the nitrogen atom to form a 4-, 5-, 6-, or 7- membered ring.
  • -NR'R includes, but is not limited to, 1-pyrrolidinyl and 4- morpholinyl.
  • alkyl is meant to include groups including carbon atoms bound to groups other than hydrogen groups, such as haloalkyl (e.g., -CF3 and -CH2CF3) and acyl (e g., -C(0)CH 3 , -C(0)CF 3 , -C(0)CH 2 0CH , and the like).
  • haloalkyl e.g., -CF3 and -CH2CF3
  • acyl e g., -C(0)CH 3 , -C(0)CF 3 , -C(0)CH 2 0CH , and the like.
  • R', R", R'", and R" are preferably independently selected from hydrogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl.
  • R groups are independently selected as are each R', R", R", and R"" groups when more than one of these groups is present.
  • Substituents for rings may be depicted as substituents on the ring rather than on a specific atom of a ring (commonly referred to as a floating substituent).
  • the substituent may be attached to any of the ring atoms (obeying the rules of chemical valency) and in the case of fused rings or spirocyclic rings, a substituent depicted as associated with one member of the fused rings or spirocyclic rings (a floating substituent on a single ring), may be a substituent on any of the fused rings or spirocyclic rings (a floating substituent on multiple rings).
  • the multiple substituents may be on the same atom, same ring, different atoms, different fused rings, different spirocyclic rings, and each substituent may optionally be different.
  • a point of attachment of a ring to the remainder of a molecule is not limited to a single atom (a floating substituent)
  • the attachment point may be any atom of the ring and in the case of a fused ring or spirocyclic ring, any atom of any of the fused rings or spirocyclic rings while obeying the rules of chemical valency.
  • a ring, fused rings, or spirocyclic rings contain one or more ring heteroatoms and the ring, fused rings, or spirocyclic rings are shown with one more floating substituents (including, but not limited to, points of attachment to the remainder of the molecule), the floating substituents may be bonded to the heteroatoms.
  • the ring heteroatoms are shown bound to one or more hydrogens (e.g., a ring nitrogen with two bonds to ring atoms and a third bond to a hydrogen) in the structure or formula with the floating substituent, when the heteroatom is bonded to the floating substituent, the substituent will be understood to replace the hydrogen, while obeying the rules of chemical valency.
  • Two or more substituents may optionally be joined to form aryl, heteroaryl, cycloalkyl, or heterocycloalkyl groups.
  • Such so-called ring-forming substituents are typically, though not necessarily, found attached to a cyclic base structure.
  • the ring-forming substituents are attached to adjacent members of the base structure.
  • two ring-forming substituents attached to adjacent members of a cyclic base structure create a fused ring structure.
  • the ring-forming substituents are attached to a single member of the base structure.
  • two ring forming substituents attached to a single member of a cyclic base structure create a spirocyclic structure.
  • the ring-forming substituents are attached to non-adjacent members of the base structure.
  • Two of the substituents on adjacent atoms of the aryl or heteroaryl ring may optionally form a ring of the formula -T-C(0)-(CRR') q -U-, wherein T and U are
  • q is an integer of from 0 to 3.
  • two of the substituents on adjacent atoms of the aryl or heteroaryl ring may optionally be replaced with a substituent of the formula -A-(CH2) r -B-, wherein A and B are independently -CRR'-, -0-, -NR.-, -S-, -S(O) -, -S(0) 2 -, -S(0) 2 NR'-, or a single bond, and r is an integer of from 1 to 4.
  • One of the single bonds of the new ring so formed may optionally be replaced with a double bond.
  • two of the substituents on adjacent atoms of the aryl or heteroaryl ring may optionally be replaced with a substituent of the formula -(CRR') s -X'- (C"R"R"') d -, where s and d are independently integers of from 0 to 3, and X' is -0-, -NR'-, -S-, -S(O)-, -S(0) 2 -, or -S(0) 2 NR-.
  • R, R, R", and R" are preferably independently selected from hydrogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl.
  • the terms“heteroatom” or“ring heteroatom” are meant to include oxygen (O), nitrogen (N), sulfur (S), phosphorus (P), selenium (Se), and silicon (Si).
  • the terms“heteroatom” or“ring heteroatom” are meant to include oxygen (O), nitrogen (N), sulfur (S), phosphorus (P), and silicon (Si).
  • A“substituent group,” as used herein, means a group selected from the following moieties:
  • unsubstituted alkyl e.g., Ci-Cx alkyl, C1-C6 alkyl, or C1-C4 alkyl
  • unsubstituted heteroalkyl e.g., 2 to 8 membered heteroalkyl, 2 to 6 membered heteroalkyl, or 2 to 4 membered heteroalkyl
  • unsubstituted cycloalkyl e.g., C 3 -Cx cycloalkyl, C 3 -C 6 cycloalkyl, or C5-C6 cycloalkyl
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered heterocycloalkyl, 3 to 6 membered heterocycloalkyl, or 5 to 6 membered heterocycloalkyl
  • unsubstituted aryl e.g., C6-C10 aryl, C10 aryl, or phenyl
  • alkyl e.g., Ci-Cs alkyl, C1-C6 alkyl, or C1-C4 alkyl
  • heteroalkyl e.g., 2 to 8 membered heteroalkyl, 2 to 6 membered heteroalkyl, or 2 to 4 membered
  • heteroalkyl cycloalkyl (e.g., C 3 -Cs cycloalkyl, C 3 -C 6 cycloalkyl, or C5-C6 cycloalkyl), heterocycloalkyl (e.g., 3 to 8 membered heterocycloalkyl, 3 to 6 membered heterocycloalkyl, or 5 to 6 membered heterocycloalkyl), aryl (e.g., C6-C10 aryl, C10 aryl, or phenyl), heteroaryl (e.g., 5 to 10 membered heteroaryl, 5 to 9 membered heteroaryl, or 5 to 6 membered heteroaryl), substituted with at least one substituent selected from:
  • alkyl e.g., Ci-Cs alkyl, C1-C6 alkyl, or C1-C4 alkyl
  • heteroalkyl e.g., 2 to 8 membered heteroalkyl, 2 to 6 membered heteroalkyl, or 2 to 4 membered heteroalkyl
  • cycloalkyl e.g., C3-C8 cycloalkyl, C3-C6 cycloalkyl, or C5-C6 cycloalkyl
  • heterocycloalkyl e.g., 3 to 8 membered heterocycloalkyl, 3 to 6 membered heterocycloalkyl, or 5 to 6 membered heterocycloalkyl
  • aryl e.g., C 6 - C10 aryl, C10 aryl, or phenyl
  • heteroaryl e.g., 5 to 10 membered heteroaryl, 5 to 9 membered heteroaryl, or 5 to 6 membered hetero
  • A“size-limited substituent” or“ size-limited substituent group,” as used herein, means a group selected from all of the substituents described above for a“substituent group,” wherein each substituted or unsubstituted alkyl is a substituted or unsubstituted C1-C20 alkyl, each substituted or unsubstituted heteroalkyl is a substituted or unsubstituted 2 to 20 membered heteroalkyl, each substituted or unsubstituted cycloalkyl is a substituted or unsubstituted C3-C8 cycloalkyl, each substituted or unsubstituted heterocycloalkyl is a substituted or unsubstituted 3 to 8 membered heterocycloalkyl, each substituted or unsubstituted aryl is a substituted or unsubstituted C6-C10 aryl, and each substituted or unsubstituted heteroaryl is a group selected
  • A“lower substituent” or“ lower substituent group,” as used herein, means a group selected from all of the substituents described above for a“substituent group,” wherein each substituted or unsubstituted alkyl is a substituted or unsubstituted Ci-Cs alkyl, each substituted or unsubstituted heteroalkyl is a substituted or unsubstituted 2 to 8 membered heteroalkyl, each substituted or unsubstituted cycloalkyl is a substituted or unsubstituted C3- C7 cycloalkyl, each substituted or unsubstituted heterocycloalkyl is a substituted or unsubstituted 3 to 7 membered heterocycloalkyl, each substituted or unsubstituted aryl is a substituted or unsubstituted C6-C10 aryl, and each substituted or unsubstituted heteroaryl is a substituted or
  • each substituted group described in the compounds herein is substituted with at least one substituent group. More specifically, in some embodiments, each substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted
  • heterocycloalkyl substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene described in the compounds herein are substituted with at least one substituent group. In other embodiments, at least one or all of these groups are substituted with at least one size-limited substituent group. In other embodiments, at least one or all of these groups are substituted with at least one lower substituent group.
  • each substituted or unsubstituted alkyl may be a substituted or unsubstituted C1-C20 alkyl
  • each substituted or unsubstituted heteroalkyl is a substituted or unsubstituted 2 to 20 membered heteroalkyl
  • each substituted or unsubstituted cycloalkyl is a substituted or unsubstituted C3-C8 cycloalkyl
  • each substituted or unsubstituted heterocycloalkyl is a substituted or unsubstituted 3 to 8 membered
  • each substituted or unsubstituted aryl is a substituted or unsubstituted C 6 - C10 aryl
  • each substituted or unsubstituted heteroaryl is a substituted or unsubstituted 5 to 10 membered heteroaryl.
  • each substituted or unsubstituted alkylene is a substituted or unsubstituted C1-C20 alkylene
  • each substituted or unsubstituted heteroalkylene is a substituted or unsubstituted 2 to 20 membered
  • heteroalkylene each substituted or unsubstituted cycloalkylene is a substituted or
  • each substituted or unsubstituted heterocycloalkylene is a substituted or unsubstituted 3 to 8 membered heterocycloalkylene
  • each substituted or unsubstituted arylene is a substituted or unsubstituted C6-C10 arylene
  • each substituted or unsubstituted heteroarylene is a substituted or unsubstituted 5 to 10 membered
  • each substituted or unsubstituted alkyl is a substituted or unsubstituted Ci-Cs alkyl
  • each substituted or unsubstituted heteroalkyl is a substituted or unsubstituted 2 to 8 membered heteroalkyl
  • each substituted or unsubstituted cycloalkyl is a substituted or unsubstituted C3-C7 cycloalkyl
  • each substituted or unsubstituted alkyl is a substituted or unsubstituted Ci-Cs alkyl
  • each substituted or unsubstituted heteroalkyl is a substituted or unsubstituted 2 to 8 membered heteroalkyl
  • each substituted or unsubstituted cycloalkyl is a substituted or unsubstituted C3-C7 cycloalkyl
  • heterocycloalkyl is a substituted or unsubstituted 3 to 7 membered heterocycloalkyl
  • each substituted or unsubstituted aryl is a substituted or unsubstituted C6-C 10 aryl
  • each substituted or unsubstituted heteroaryl is a substituted or unsubstituted 5 to 9 membered heteroaryl.
  • each substituted or unsubstituted alkylene is a substituted or unsubstituted Ci-Cs alkylene
  • each substituted or unsubstituted heteroalkylene is a substituted or unsubstituted 2 to 8 membered heteroalkylene
  • unsubstituted cycloalkylene is a substituted or unsubstituted C3-C7 cycloalkylene
  • each substituted or unsubstituted heterocycloalkylene is a substituted or unsubstituted 3 to 7 membered heterocycloalkylene
  • each substituted or unsubstituted arylene is a substituted or unsubstituted C6-C10 arylene
  • each substituted or unsubstituted heteroaryl ene is a substituted or unsubstituted 5 to 9 membered heteroarylene.
  • the compound is a chemical species set forth in the Examples section, figures, or tables below.
  • a substituted or unsubstituted moiety e.g., substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, and/or substituted or unsubstituted heteroarylene) is unsubstituted (e.g., is an unsubstituted alkyl, unsubstituted heteroalkyl, unsubstituted cycloalkyl, unsubstituted
  • a substituted or unsubstituted moiety e.g., substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted
  • cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, and/or substituted or unsubstituted heteroarylene is substituted (e.g., is a substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroaryl ene, respectively).
  • a substituted moiety e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroaryl ene
  • is substituted with at least one substituent group wherein if the substituted moiety is substituted with a plurality of substituent groups, each substituent group may optionally be different. In embodiments, if the substituted moiety is substituted with a plurality of substituent groups, each substituent group is different.
  • a substituted moiety e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroaryl ene
  • is substituted with at least one size-limited substituent group wherein if the substituted moiety is substituted with a plurality of size-limited substituent groups, each size-limited substituent group may optionally be different.
  • each size-limited substituent group is different.
  • a substituted moiety e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroaryl ene
  • is substituted with at least one lower substituent group wherein if the substituted moiety is substituted with a plurality of lower substituent groups, each lower substituent group may optionally be different. In embodiments, if the substituted moiety is substituted with a plurality of lower substituent groups, each lower substituent group is different.
  • a substituted moiety e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroaryl ene
  • the substituted moiety is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • Certain compounds of the present disclosure possess asymmetric carbon atoms (optical or chiral centers) or double bonds; the enantiomers, racemates, diastereomers, tautomers, geometric isomers, stereoisometric forms that may be defined, in terms of absolute stereochemistry, as (R)-or (S)- or, as (D)- or (L)- for amino acids, and individual isomers are encompassed within the scope of the present disclosure.
  • the compounds of the present disclosure do not include those that are known in art to be too unstable to synthesize and/or isolate.
  • the present disclosure is meant to include compounds in racemic and optically pure forms.
  • Optically active (R)- and (S)-, or (D)- and (L)-isomers may be prepared using chiral synthons or chiral reagents, or resolved using conventional techniques.
  • the compounds described herein contain olefmic bonds or other centers of geometric asymmetry, and unless specified otherwise, it is intended that the compounds include both E and Z geometric isomers.
  • the term“isomers” refers to compounds having the same number and kind of atoms, and hence the same molecular weight, but differing in respect to the structural arrangement or configuration of the atoms.
  • tautomer refers to one of two or more structural isomers which exist in equilibrium and which are readily converted from one isomeric form to another.
  • structures depicted herein are also meant to include compounds which differ only in the presence of one or more isotopically enriched atoms.
  • compounds having the present structures except for the replacement of a hydrogen by a deuterium or tritium, or the replacement of a carbon by 13 C- or 14 C-enriched carbon are within the scope of this disclosure.
  • the compounds of the present disclosure may also contain unnatural proportions of atomic isotopes at one or more of the atoms that constitute such compounds.
  • the compounds may be radiolabeled with radioactive isotopes, such as for example tritium (3 ⁇ 4), iodine-125 ( 125 I), or carbon-14 ( 14 C). All isotopic variations of the compounds of the present disclosure, whether radioactive or not, are encompassed within the scope of the present disclosure.
  • each amino acid position that contains more than one possible amino acid. It is specifically contemplated that each member of the Markush group should be considered separately, thereby comprising another embodiment, and the Markush group is not to be read as a single unit.
  • bioconjugate and“bioconjugate linker” refer to the resulting association between atoms or molecules of bioconjugate reactive groups or bioconjugate reactive moieties.
  • the association can be direct or indirect.
  • a conjugate between a first bioconjugate reactive group e.g., -NFL, -COOH, -N- hydroxysuccinimide, or -maleimide
  • a second bioconjugate reactive group e.g., sulfhydryl, sulfur-containing amino acid, amine, amine sidechain containing amino acid, or carboxylate
  • covalent bond or linker e.g., a first linker of second linker
  • indirect e.g., by non-covalent bond (e.g., electrostatic interactions (e.g., ionic bond, hydrogen bond, halogen bond), van der Waals interactions (e.g., dipole-
  • bioconjugates or bioconjugate linkers are formed using bioconjugate chemistry (i.e., the association of two bioconjugate reactive groups) including, but are not limited to nucleophilic substitutions (e.g., reactions of amines and alcohols with acyl halides, active esters), electrophilic substitutions (e.g., enamine reactions) and additions to carbon-carbon and carbon-heteroatom multiple bonds (e.g., Michael reaction, Diels-Alder addition).
  • bioconjugate chemistry i.e., the association of two bioconjugate reactive groups
  • nucleophilic substitutions e.g., reactions of amines and alcohols with acyl halides, active esters
  • electrophilic substitutions e.g., enamine reactions
  • additions to carbon-carbon and carbon-heteroatom multiple bonds e.g., Michael reaction, Diels-Alder addition.
  • the first bioconjugate reactive group e.g., maleimide moiety
  • the second bioconjugate reactive group e.g., a sulfhydryl
  • the first bioconjugate reactive group (e.g., haloacetyl moiety) is covalently attached to the second bioconjugate reactive group (e.g., a sulfhydryl).
  • the first bioconjugate reactive group (e.g., pyridyl moiety) is covalently attached to the second bioconjugate reactive group (e.g., a sulfhydryl).
  • the first bioconjugate reactive group e.g., -N- hydroxysuccinimide moiety
  • is covalently attached to the second bioconjugate reactive group (e.g., an amine).
  • the first bioconjugate reactive group (e.g., maleimide moiety) is covalently attached to the second bioconjugate reactive group (e.g., a sulfhydryl).
  • the first bioconjugate reactive group (e.g., -sulfo-N-hydroxysuccinimide moiety) is covalently attached to the second bioconjugate reactive group (e.g., an amine).
  • bioconjugate reactive moieties used for bioconjugate chemistries herein include, for example:
  • haloalkyl groups wherein the halide can be later displaced with a nucleophilic group such as, for example, an amine, a carboxylate anion, thiol anion, carbanion, or an alkoxide ion, thereby resulting in the covalent attachment of a new group at the site of the halogen atom;
  • a nucleophilic group such as, for example, an amine, a carboxylate anion, thiol anion, carbanion, or an alkoxide ion
  • dienophile groups which are capable of participating in Diels-Alder reactions such as, for example, maleimido or maleimide groups
  • aldehyde or ketone groups such that subsequent derivatization is possible via formation of carbonyl derivatives such as, for example, imines, hydrazones, semicarbazones or oximes, or via such mechanisms as Grignard addition or alkyllithium addition;
  • amine or sulfhydryl groups (e.g., present in cysteine), which can be, for example, acylated, alkylated or oxidized;
  • alkenes which can undergo, for example, cycloadditions, acylation, Michael addition, etc;
  • biotin conjugate can react with avidin or strepavidin to form a avidin-biotin complex or streptavidin-biotin complex.
  • bioconjugate reactive groups can be chosen such that they do not participate in, or interfere with, the chemical stability of the conjugate described herein.
  • a reactive functional group can be protected from participating in the crosslinking reaction by the presence of a protecting group.
  • the bioconjugate comprises a molecular entity derived from the reaction of an unsaturated bond, such as a maleimide, and a sulfhydryl group.
  • an analog is used in accordance with its plain ordinary meaning within Chemistry and Biology and refers to a chemical compound that is structurally similar to another compound (i.e., a so-called“reference” compound) but differs in composition, e.g., in the replacement of one atom by an atom of a different element, or in the presence of a particular functional group, or the replacement of one functional group by another functional group, or the absolute stereochemistry of one or more chiral centers of the reference compound. Accordingly, an analog is a compound that is similar or comparable in function and appearance but not in structure or origin to a reference compound.
  • the terms“a” or“an,” as used in herein means one or more.
  • the phrase “substituted with a[n],” as used herein means the specified group may be substituted with one or more of any or all of the named substituents.
  • a group such as an alkyl or heteroaryl group, is“substituted with an unsubstituted C1-C20 alkyl, or unsubstituted 2 to 20 membered heteroalkyl,” the group may contain one or more unsubstituted C1-C20 alkyls, and/or one or more unsubstituted 2 to 20 membered heteroalkyls.
  • R-substituted where a moiety is substituted with an R substituent, the group may be referred to as“R-substituted.” Where a moiety is R- substituted, the moiety is substituted with at least one R substituent and each R substituent is optionally different. Where a particular R group is present in the description of a chemical genus (such as Formula (I)), a Roman alphabetic symbol may be used to distinguish each appearance of that particular R group. For example, where multiple R 13 substituents are present, each R 13 substituent may be distinguished as R 13A , R 13B , R 13C , R 13D , etc., wherein each of R 13A , R 13B , R 13C , R 13D , etc. is defined within the scope of the definition of R 13 and optionally differently.
  • salts are meant to include salts of the active compounds that are prepared with relatively nontoxic acids or bases, depending on the particular substituents found on the compounds described herein.
  • base addition salts can be obtained by contacting the neutral form of such compounds with a sufficient amount of the desired base, either neat or in a suitable inert solvent.
  • pharmaceutically acceptable base addition salts include sodium, potassium, calcium, ammonium, organic amino, or magnesium salt, or a similar salt.
  • acid addition salts can be obtained by contacting the neutral form of such compounds with a sufficient amount of the desired acid, either neat or in a suitable inert solvent.
  • pharmaceutically acceptable acid addition salts include those derived from inorganic acids like hydrochloric, hydrobromic, nitric, carbonic,
  • salts of amino acids such as arginate and the like, and salts of organic acids like glucuronic or galactunoric acids and the like (see, for example, Berge et al. ,“Pharmaceutical Salts”, Journal of Pharmaceutical Science , 1977, 66, 1-19).
  • Certain specific compounds of the present disclosure contain both basic and acidic functionalities that allow the compounds to be converted into either base or acid addition salts.
  • the compounds of the present disclosure may exist as salts, such as with pharmaceutically acceptable acids.
  • the present disclosure includes such salts.
  • Non-limiting examples of such salts include hydrochlorides, hydrobromides, phosphates, sulfates, methanesulfonates, nitrates, maleates, acetates, citrates, fumarates, proprionates, tartrates (e.g., (+)-tartrates, (-)-tartrates, or mixtures thereof including racemic mixtures), succinates, benzoates, and salts with amino acids such as glutamic acid, and quaternary ammonium salts (e.g., methyl iodide, ethyl iodide, and the like). These salts may be prepared by methods known to those skilled in the art.
  • the neutral forms of the compounds are preferably regenerated by contacting the salt with a base or acid and isolating the parent compound in the conventional manner.
  • the parent form of the compound may differ from the various salt forms in certain physical properties, such as solubility in polar solvents.
  • the present disclosure provides compounds, which are in a prodrug form.
  • Prodrugs of the compounds described herein are those compounds that readily undergo chemical changes under physiological conditions to provide the compounds of the present disclosure.
  • Prodrugs of the compounds described herein may be converted in vivo after administration.
  • prodrugs can be converted to the compounds of the present disclosure by chemical or biochemical methods in an ex vivo environment, such as, for example, when contacted with a suitable enzyme or chemical reagent.
  • Certain compounds of the present disclosure can exist in unsolvated forms as well as solvated forms, including hydrated forms. In general, the solvated forms are equivalent to unsolvated forms and are encompassed within the scope of the present disclosure. Certain compounds of the present disclosure may exist in multiple crystalline or amorphous forms.
  • a polypeptide, or a cell is“recombinant” when it is artificial or engineered, or derived from or contains an artificial or engineered protein or nucleic acid (e.g., non-natural or not wild type).
  • an artificial or engineered protein or nucleic acid e.g., non-natural or not wild type.
  • a polynucleotide that is inserted into a vector or any other heterologous location e.g., in a genome of a recombinant organism, such that it is not associated with nucleotide sequences that normally flank the polynucleotide as it is found in nature is a recombinant polynucleotide.
  • a protein expressed in vitro or in vivo from a recombinant polynucleotide is an example of a recombinant polypeptide.
  • a polynucleotide sequence that does not appear in nature for example a variant of a naturally occurring gene, is recombinant.
  • Co-administer is meant that a composition described herein is administered at the same time, just prior to, or just after the administration of one or more additional therapies.
  • the compounds of the invention can be administered alone or can be co-administered to the patient.
  • Co-administration is meant to include simultaneous or sequential administration of the compounds individually or in combination (more than one compound).
  • the preparations can also be combined, when desired, with other active substances (e.g., to reduce metabolic degradation).
  • A“cell” as used herein, refers to a cell carrying out metabolic or other function sufficient to preserve or replicate its genomic DNA.
  • a cell can be identified by well-known methods in the art including, for example, presence of an intact membrane, staining by a particular dye, ability to produce progeny or, in the case of a gamete, ability to combine with a second gamete to produce a viable offspring.
  • Cells may include prokaryotic and eukaroytic cells.
  • Prokaryotic cells include but are not limited to bacteria.
  • Eukaryotic cells include but are not limited to yeast cells and cells derived from plants and animals, for example mammalian, insect (e.g., spodoptera) and human cells. Cells may be useful when they are naturally nonadherent or have been treated not to adhere to surfaces, for example by trypsinization.
  • treating refers to any indicia of success in the treatment or amelioration of an injury, disease, pathology or condition, including any objective or subjective parameter such as abatement; remission; diminishing of symptoms or making the injury, pathology or condition more tolerable to the patient; slowing in the rate of
  • treating cancer includes slowing the rate of growth or spread of cancer cells, reducing metastasis, or reducing the growth of metastatic tumors.
  • the term“treating” and conjugations thereof include prevention of an injury, pathology, condition, or disease.
  • treating is preventing.
  • treating does not include preventing.
  • the treating or treatment is no prophylactic treatment.
  • An“effective amount” is an amount sufficient for a compound to accomplish a stated purpose relative to the absence of the compound (e.g., achieve the effect for which it is administered, treat a disease, reduce enzyme activity, increase enzyme activity, reduce signaling pathway, reduce one or more symptoms of a disease or condition.
  • An example of an“effective amount” is an amount sufficient to contribute to the treatment, prevention, or reduction of a symptom or symptoms of a disease, which could also be referred to as a “therapeutically effective amount” when referred to in this context.
  • A“reduction” of a symptom or symptoms means decreasing of the severity or frequency of the symptom(s), or elimination of the symptom(s).
  • prophylactically effective amount of a drug is an amount of a drug that, when administered to a subject, will have the intended prophylactic effect, e.g., preventing or delaying the onset (or reoccurrence) of an injury, disease, pathology or condition, or reducing the likelihood of the onset (or reoccurrence) of an injury, disease, pathology, or condition, or their symptoms.
  • the full prophylactic effect does not necessarily occur by administration of one dose, and may occur only after administration of a series of doses. Thus, a prophylactically effective amount may be administered in one or more administrations.
  • An“activity decreasing amount,” as used herein, refers to an amount of antagonist required to decrease the activity of an enzyme relative to the absence of the antagonist.
  • A“function disrupting amount,” as used herein, refers to the amount of antagonist required to disrupt the function of an enzyme or protein relative to the absence of the antagonist.
  • An“activity increasing amount,” as used herein, refers to an amount of agonist required to increase the activity of an enzyme relative to the absence of the agonist.
  • A“function increasing amount,” as used herein, refers to the amount of agonist required to increase the function of an enzyme or protein relative to the absence of the agonist. The exact amounts will depend on the purpose of the treatment, and will be ascertainable by one skilled in the art using known techniques (see, e.g., Lieberman, Pharmaceutical Dosage Forms (vols.
  • Control or“control experiment” is used in accordance with its plain ordinary meaning and refers to an experiment in which the subjects or reagents of the experiment are treated as in a parallel experiment except for omission of a procedure, reagent, or variable of the experiment.
  • the control is used as a standard of comparison in evaluating experimental effects.
  • a control is the measurement of the activity (e.g., signaling pathway) of a protein in the absence of a compound as described herein (including embodiments, examples, figures, or Tables).
  • Contacting is used in accordance with its plain ordinary meaning and refers to the process of allowing at least two distinct species (e.g., chemical compounds including biomolecules, or cells) to become sufficiently proximal to react, interact or physically touch. It should be appreciated; however, the resulting reaction product can be produced directly from a reaction between the added reagents or from an intermediate from one or more of the added reagents which can be produced in the reaction mixture.
  • species e.g., chemical compounds including biomolecules, or cells
  • the term“contacting” may include allowing two species to react, interact, or physically touch, wherein the two species may be a compound as described herein and a cellular component (e.g., protein, ion, lipid, nucleic acid, nucleotide, amino acid, protein, particle, organelle, cellular compartment, microorganism, virus, lipid droplet, vesicle, small molecule, protein complex, protein aggregate, or macromolecule).
  • a cellular component e.g., protein, ion, lipid, nucleic acid, nucleotide, amino acid, protein, particle, organelle, cellular compartment, microorganism, virus, lipid droplet, vesicle, small molecule, protein complex, protein aggregate, or macromolecule.
  • contacting includes allowing a compound described herein to interact with a cellular component (e.g., protein, ion, lipid, nucleic acid, nucleotide, amino acid, protein, particle, virus, lipid droplet, organelle, cellular compartment, microorganism, vesicle, small molecule, protein complex, protein aggregate, or macromolecule) that is involved in a signaling pathway.
  • a cellular component e.g., protein, ion, lipid, nucleic acid, nucleotide, amino acid, protein, particle, virus, lipid droplet, organelle, cellular compartment, microorganism, vesicle, small molecule, protein complex, protein aggregate, or macromolecule
  • the term“activation,”“activate,”“activating” and the like in reference to a protein refers to conversion of a protein into a biologically active derivative from an initial inactive or deactivated state.
  • the terms“agonist,”“activator,”“upregulator,” etc. refer to a substance capable of detectably increasing the expression or activity of a given gene or protein.
  • the agonist can increase expression or activity by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, or 99% in comparison to a control in the absence of the agonist.
  • expression or activity is 1.5-fold, 2-fold, 3-fold, 4-fold, 5-fold, 10-fold or higher than the expression or activity in the absence of the agonist.
  • the term“inhibition,”“inhibit,”“inhibiting” and the like in reference to a cellular component-inhibitor interaction means negatively affecting (e.g., decreasing) the activity or function of the cellular component (e.g., decreasing the signaling pathway stimulated by a cellular component (e.g., protein, ion, lipid, virus, lipid droplet, nucleic acid, nucleotide, amino acid, protein, particle, organelle, cellular compartment, microorganism, vesicle, small molecule, protein complex, protein aggregate, or
  • a cellular component e.g., protein, ion, lipid, virus, lipid droplet, nucleic acid, nucleotide, amino acid, protein, particle, organelle, cellular compartment, microorganism, vesicle, small molecule, protein complex, protein aggregate, or
  • inhibition means negatively affecting (e.g., decreasing) the concentration or levels of the cellular component relative to the concentration or level of the cellular component in the absence of the inhibitor.
  • inhibition refers to reduction of a disease or symptoms of disease.
  • inhibition refers to a reduction in the activity of a signal transduction pathway or signaling pathway (e.g., reduction of a pathway involving the cellular component).
  • inhibition includes, at least in part, partially or totally blocking stimulation, decreasing, preventing, or delaying activation, or inactivating, desensitizing, or down-regulating the signaling pathway or enzymatic activity or the amount of a cellular component.
  • the antagonist can decrease expression or activity by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, or 99% in comparison to a control in the absence of the antagonist.
  • expression or activity is 1.5-fold, 2-fold, 3-fold, 4-fold, 5-fold, 10-fold or lower than the expression or activity in the absence of the antagonist.
  • modulator refers to a composition that increases or decreases the level of a target molecule or the function of a target molecule or the physical state of the target of the molecule (e.g., a target may be a cellular component (e.g., protein, ion, lipid, virus, lipid droplet, nucleic acid, nucleotide, amino acid, protein, particle, organelle, cellular
  • a target may be a cellular component (e.g., protein, ion, lipid, virus, lipid droplet, nucleic acid, nucleotide, amino acid, protein, particle, organelle, cellular
  • the term“expression” includes any step involved in the production of the polypeptide including, but not limited to, transcription, post-transcriptional modification, translation, post-translational modification, and secretion. Expression can be detected using conventional techniques for detecting protein (e.g., ELISA, Western blotting, flow cytometry, immunofluorescence, immunohistochemistry, etc.).
  • modulate is used in accordance with its plain ordinary meaning and refers to the act of changing or varying one or more properties. “Modulation” refers to the process of changing or varying one or more properties. For example, as applied to the effects of a modulator on a target protein, to modulate means to change by increasing or decreasing a property or function of the target molecule or the amount of the target molecule.
  • “Patient” or“subject in need thereof’ refers to a living organism suffering from or prone to a disease or condition that can be treated by administration of a pharmaceutical composition as provided herein.
  • Non-limiting examples include humans, other mammals, bovines, rats, mice, dogs, monkeys, goat, sheep, cows, deer, and other non-mammalian animals.
  • a patient is human.
  • Disease or“condition” refer to a state of being or health status of a patient or subject capable of being treated with the compounds or methods provided herein.
  • the disease is a disease related to (e.g., caused by) a cellular component (e.g., protein, ion, lipid, nucleic acid, nucleotide, amino acid, protein, particle, organelle, cellular compartment, microorganism, vesicle, small molecule, protein complex, protein aggregate, or macromolecule).
  • a cellular component e.g., protein, ion, lipid, nucleic acid, nucleotide, amino acid, protein, particle, organelle, cellular compartment, microorganism, vesicle, small molecule, protein complex, protein aggregate, or macromolecule.
  • the disease is a neurodegenerative disease.
  • the disease is a cancer.
  • neurodegenerative disease refers to a disease or condition in which the function of a subject’s nervous system becomes impaired.
  • Examples of neurodegenerative diseases that may be treated with a compound, pharmaceutical composition, or method described herein include Alexander’s disease, Alper’s disease, Alzheimer’s disease, Amyotrophic lateral sclerosis, Ataxia telangiectasia, Batten disease (also known as Spielmeyer-Vogt-Sjogren-Batten disease), Bovine spongiform
  • encephalopathy BSE
  • Canavan disease Cockayne syndrome
  • Corticobasal degeneration Creutzfeldt-Jakob disease
  • frontotemporal dementia Gerstmann-Straussler-Scheinker syndrome
  • Huntington’s disease HIV-associated dementia
  • Kennedy’s disease Krabbe’s disease
  • kuru Lewy body dementia
  • Machado- Joseph disease Spinocerebellar ataxia type 3
  • Multiple sclerosis Multiple System Atrophy
  • Narcolepsy Neuroborreliosis, Parkinson's disease, Pelizaeus-Merzbacher Disease, Pick’s disease
  • Primary lateral sclerosis Prion diseases
  • Refsum’s disease Sandhoff s disease
  • Schilder’s disease Subacute combined degeneration of spinal cord secondary to Pernicious Anaemia, Schizophrenia, Spinocerebellar ataxia (multiple types with varying characteristics), Spinal muscular atrophy, Steele- Richardson-Olszewski disease, or Tabes dors
  • the term“inflammatory disease” refers to a disease or condition characterized by aberrant inflammation (e.g., an increased level of inflammation compared to a control such as a healthy person not suffering from a disease).
  • inflammatory diseases include autoimmune diseases, arthritis, rheumatoid arthritis, psoriatic arthritis, juvenile idiopathic arthritis, multiple sclerosis, systemic lupus erythematosus (SLE), myasthenia gravis, juvenile onset diabetes, diabetes mellitus type 1, Guillain-Barre syndrome, Hashimoto’s encephalitis, Hashimoto’s thyroiditis, ankylosing spondylitis, psoriasis, Sjogren’s syndrome, vasculitis, glomerulonephritis, auto-immune thyroiditis, Behcet’s disease, Crohn’s disease, ulcerative colitis, bullous pemphigoid, sarcoidosis, ichthyosis
  • cancer refers to all types of cancer, neoplasm or malignant tumors found in mammals (e.g., humans), including leukemia, lymphoma, carcinomas and sarcomas.
  • Exemplary cancers that may be treated with a compound or method provided herein include cancer of the thyroid, endocrine system, brain, breast, cervix, colon, head and neck, liver, kidney, lung, non-small cell lung, melanoma, mesothelioma, ovary, sarcoma, stomach, uterus, medulloblastoma, colorectal cancer, or pancreatic cancer. Additional examples include, Hodgkin’s Disease, Non-Hodgkin’s Lymphoma, multiple myeloma, neuroblastoma, glioma, glioblastoma multiforme, ovarian cancer,
  • rhabdomyosarcoma primary thrombocytosis, primary macroglobulinemia, primary brain tumors, cancer, malignant pancreatic insulanoma, malignant carcinoid, urinary bladder cancer, premalignant skin lesions, testicular cancer, lymphomas, thyroid cancer, esophageal cancer, genitourinary tract cancer, malignant hypercalcemia, endometrial cancer, adrenal cortical cancer, neoplasms of the endocrine or exocrine pancreas, medullary thyroid cancer, medullary thyroid carcinoma, melanoma, colorectal cancer, papillary thyroid cancer, hepatocellular carcinoma, or prostate cancer.
  • leukemia refers broadly to progressive, malignant diseases of the blood- forming organs and is generally characterized by a distorted proliferation and development of leukocytes and their precursors in the blood and bone marrow. Leukemia is generally clinically classified on the basis of (1) the duration and character of the disease-acute or chronic; (2) the type of cell involved; myeloid (myelogenous), lymphoid (lymphogenous), or monocytic; and (3) the increase or non-increase in the number abnormal cells in the blood- leukemic or aleukemic (subleukemic).
  • Exemplary leukemias that may be treated with a compound or method provided herein include, for example, acute nonlymphocytic leukemia, chronic lymphocytic leukemia, acute granulocytic leukemia, chronic granulocytic leukemia, acute promyelocytic leukemia, adult T-cell leukemia, aleukemic leukemia, a leukocythemic leukemia, basophylic leukemia, blast cell leukemia, bovine leukemia, chronic myelocytic leukemia, leukemia cutis, embryonal leukemia, eosinophilic leukemia, Gross’ leukemia, hairy-cell leukemia, hemoblastic leukemia, hemocytoblastic leukemia, histiocytic leukemia, stem cell leukemia, acute monocytic leukemia, leukopenic leukemia, lymphatic leukemia, lymphoblastic leukemia, lymphocytic leukemia, lymphogenous leukemia,
  • lymphoma refers to a group of cancers affecting hematopoietic and lymphoid tissues. It begins in lymphocytes, the blood cells that are found primarily in lymph nodes, spleen, thymus, and bone marrow. Two main types of lymphoma are non-Hodgkin lymphoma and Hodgkin’s disease. Hodgkin’s disease represents approximately 15% of all diagnosed lymphomas. This is a cancer associated with Reed- Stemberg malignant B lymphocytes. Non-Hodgkin’s lymphomas (NHL) can be classified based on the rate at which cancer grows and the type of cells involved.
  • B-cell lymphomas that may be treated with a compound or method provided herein include, but are not limited to, small lymphocytic lymphoma, Mantle cell lymphoma, follicular lymphoma, marginal zone lymphoma, extranodal (MALT) lymphoma, nodal (monocytoid B-cell) lymphoma, splenic lymphoma, diffuse large cell B-lymphoma, Burkitt’s lymphoma, lymphoblastic lymphoma,
  • T- cell lymphomas that may be treated with a compound or method provided herein include, but are not limited to, cutaneous T-cell lymphoma, peripheral T-cell lymphoma, anaplastic large cell lymphoma, mycosis fungoides, and precursor T-lymphoblastic lymphoma.
  • sarcoma generally refers to a tumor which is made up of a substance like the embryonic connective tissue and is generally composed of closely packed cells embedded in a fibrillar or homogeneous substance.
  • Sarcomas that may be treated with a compound or method provided herein include a chondrosarcoma, fibrosarcoma,
  • lymphosarcoma melanosarcoma, myxosarcoma, osteosarcoma, Abemethy's sarcoma, adipose sarcoma, liposarcoma, alveolar soft part sarcoma, ameloblastic sarcoma, botryoid sarcoma, chloroma sarcoma, chorio carcinoma, embryonal sarcoma, Wilms’ tumor sarcoma, endometrial sarcoma, stromal sarcoma, Ewing’s sarcoma, fascial sarcoma, fibroblastic sarcoma, giant cell sarcoma, granulocytic sarcoma, Hodgkin's sarcoma, idiopathic multiple pigmented hemorrhagic sarcoma, immunoblastic sarcoma of B cells, lymphoma,
  • immunoblastic sarcoma of T-cells Jensen’s sarcoma, Kaposi’s sarcoma, Kupffer cell sarcoma, angiosarcoma, leukosarcoma, malignant mesenchymoma sarcoma, parosteal sarcoma, reticulocytic sarcoma, Rous sarcoma, serocystic sarcoma, synovial sarcoma, or telangiectaltic sarcoma.
  • melanoma is taken to mean a tumor arising from the melanocytic system of the skin and other organs.
  • Melanomas that may be treated with a compound or method provided herein include, for example, acral-lentiginous melanoma, amelanotic melanoma, benign juvenile melanoma, Cloudman’s melanoma, S91 melanoma, Harding-Passey melanoma, juvenile melanoma, lentigo maligna melanoma, malignant melanoma, nodular melanoma, subungal melanoma, or superficial spreading melanoma.
  • carcinoma refers to a malignant new growth made up of epithelial cells tending to infiltrate the surrounding tissues and give rise to metastases.
  • exemplary carcinomas that may be treated with a compound or method provided herein include, for example, medullary thyroid carcinoma, familial medullary thyroid carcinoma, acinar carcinoma, acinous carcinoma, adenocystic carcinoma, adenoid cystic carcinoma, carcinoma adenomatosum, carcinoma of adrenal cortex, alveolar carcinoma, alveolar cell carcinoma, basal cell carcinoma, carcinoma basocellulare, basaloid carcinoma, basosquamous cell carcinoma, bronchioalveolar carcinoma, bronchiolar carcinoma, bronchogenic carcinoma, cerebriform carcinoma, cholangiocellular carcinoma, chorionic carcinoma, colloid carcinoma, comedo carcinoma, corpus carcinoma, cribriform carcinoma, carcinoma en cuirasse, carcinoma cutaneum, cylindrical carcinoma, cylindrical cell carcinoma, duct carcinoma, carcinoma durum, embryonal carcinoma, encephaloid
  • “Pharmaceutically acceptable excipient” and“pharmaceutically acceptable carrier” refer to a substance that aids the administration of an active agent to and absorption by a subject and can be included in the compositions of the present invention without causing a significant adverse toxicological effect on the patient.
  • “pharmaceutically acceptable excipient” and“pharmaceutically acceptable carrier” refer to a substance that aids the administration of an active agent to and absorption by a subject and can be included in the compositions of the present invention without causing a significant adverse toxicological effect on the patient.
  • pharmaceutically acceptable excipients include water, NaCl, normal saline solutions, lactated Ringer’s, normal sucrose, normal glucose, binders, fillers, disintegrants, lubricants, coatings, sweeteners, flavors, salt solutions (such as Ringer’s solution), alcohols, oils, gelatins, carbohydrates such as lactose, amylose or starch, fatty acid esters, hydroxymethycellulose, polyvinyl pyrrolidine, and colors, and the like.
  • Such preparations can be sterilized and, if desired, mixed with auxiliary agents such as lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure, buffers, coloring, and/or aromatic substances and the like that do not deleteriously react with the compounds of the invention.
  • auxiliary agents such as lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure, buffers, coloring, and/or aromatic substances and the like that do not deleteriously react with the compounds of the invention.
  • auxiliary agents such as lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure, buffers, coloring, and/or aromatic substances and the like that do not deleteriously react with the compounds of the invention.
  • auxiliary agents such as lubricants, preservatives, stabilizers, wetting agents
  • the term“preparation” is intended to include the formulation of the active compound with encapsulating material as a carrier providing a capsule in which the active component with or without other carriers, is surrounded by a carrier, which is thus in association with it.
  • a carrier which is thus in association with it.
  • cachets and lozenges are included. Tablets, powders, capsules, pills, cachets, and lozenges can be used as solid dosage forms suitable for oral administration.
  • the term“about” means a range of values including the specified value, which a person of ordinary skill in the art would consider reasonably similar to the specified value. In embodiments, about means within a standard deviation using
  • about means a range extending to +/- 10% of the specified value. In embodiments, about includes the specified value.
  • administering means oral administration, administration as a suppository, topical contact, intravenous, intraperitoneal, intramuscular, intralesional, intrathecal, intranasal or subcutaneous administration, or the implantation of a slow-release device, e.g., a mini-osmotic pump, to a subject.
  • Administration is by any route, including parenteral and transmucosal (e.g., buccal, sublingual, palatal, gingival, nasal, vaginal, rectal, or transdermal).
  • Parenteral administration includes, e.g., intravenous, intramuscular, intra arteriole, intradermal, subcutaneous, intraperitoneal, intraventricular, and intracranial.
  • Other modes of delivery include, but are not limited to, the use of liposomal formulations, intravenous infusion, transdermal patches, etc.
  • co-administer it is meant that a composition described herein is administered at the same time, just prior to, or just after the administration of one or more additional therapies, for example cancer therapies such as chemotherapy, hormonal therapy, radiotherapy, or immunotherapy.
  • the compounds of the invention can be administered alone or can be co-administered to the patient.
  • administration is meant to include simultaneous or sequential administration of the compounds individually or in combination (more than one compound).
  • compositions of the present invention can be delivered by transdermally, by a topical route, formulated as applicator sticks, solutions, suspensions, emulsions, gels, creams, ointments, pastes, jellies, paints, powders, and aerosols.
  • co-administration includes administering one active agent within 0.5, 1, 2, 4, 6, 8, 10, 12, 16, 20, or 24 hours of a second active agent.
  • administration includes administering two active agents simultaneously, approximately simultaneously (e.g., within about 1, 5, 10, 15, 20, or 30 minutes of each other), or sequentially in any order.
  • co-administration can be accomplished by co-formulation, i.e., preparing a single pharmaceutical composition including both active agents.
  • the active agents can be formulated separately.
  • the active and/or adjunctive agents may be linked or conjugated to one another.
  • the compounds described herein can be co-administered with conventional neurodegenerative disease treatments including, but not limited to, Parkinson’s disease treatments such as levodopa, carbidopa, selegiline, amantadine, donepezil, galanthamine, rivastigmine, tacrine, dopamine agonists (e.g., bromocriptine, pergolide, pramipexole, ropinirole), anticholinergic drugs (e.g., trihexyphenidyl, benztropine, biperiden,
  • Parkinson’s disease treatments such as levodopa, carbidopa, selegiline, amantadine, donepezil, galanthamine, rivastigmine, tacrine, dopamine agonists (e.g., bromocriptine, pergolide, pramipexole, ropinirole), anticholinergic drugs (e.g., trihexyphenidyl,
  • procyclidine procyclidine
  • catechol-O-methyl-transferase inhibitors e.g., tolcapone, entacapone
  • the compounds described herein can also be co-administered with conventional anti-inflammatory disease treatments including, but not limited to, analgesics (e.g., acetaminophen, duloxetine), nonsteroidal anti-inflammatory drugs (e.g., aspirin, ibuprofen, naproxen, diclofenac), corticosteroids (e.g., prednisone, betamethasone, cortisone, dexamethasone, hydrocortisone, methylprednisolone, prednisolone), and opoids (e.g., codeine, fentanyl, hydrocodone, hydromorphone, morphine, meperidine, oxycodone).
  • analgesics e.g., acetaminophen, duloxetine
  • nonsteroidal anti-inflammatory drugs e.g., aspirin, ibuprofen, naproxen, diclofenac
  • corticosteroids
  • Anti-cancer agent is used in accordance with its plain ordinary meaning and refers to a composition (e.g., compound, drug, antagonist, inhibitor, modulator) having
  • an anti-cancer agent is a chemotherapeutic.
  • an anti cancer agent is an agent identified herein having utility in methods of treating cancer.
  • an anti-cancer agent is an agent approved by the FDA or similar regulatory agency of a country other than the USA, for treating cancer.
  • an anti-cancer agent is an agent with antineoplastic properties that has not (e.g., yet) been approved by the FDA or similar regulatory agency of a country other than the USA, for treating cancer.
  • anti-cancer agents include, but are not limited to, MEK (e.g., MEK1, MEK2, or MEK1 and MEK2) inhibitors (e.g., XL518, CI-1040, PD035901, selumetinib/ AZD6244, GSK1120212/ trametinib, GDC-0973, ARRY-162, ARRY-300, AZD8330, PD0325901, U0126, PD98059, TAK-733, PD318088, AS703026, BAY 869766), alkylating agents (e.g., cyclophosphamide, ifosfamide, chlorambucil, busulfan, melphalan, mechlorethamine, uramustine, thiotepa, nitrosoureas, nitrogen mustards (e.g.,
  • amifostine aminolevulinic acid
  • amrubicin amsacrine
  • anagrelide anastrozole
  • antineoplaston antisense oligonucleotides; aphidicolin glycinate; apoptosis gene modulators; apoptosis regulators; apurinic acid; ara-CDP-DL-PTBA; arginine deaminase; asulacrine; atamestane; atrimustine; axinastatin 1; axinastatin 2; axinastatin 3; azasetron; azatoxin;
  • azatyrosine baccatin III derivatives; balanol; batimastat; BCR/ABL antagonists;
  • benzochlorins benzoylstaurosporine; beta lactam derivatives; beta-alethine; betaclamycin B; betulinic acid; bFGF inhibitor; bicalutamide; bisantrene; bisaziridinylspermine; bisnafide; bistratene A; bizelesin; breflate; bropirimine; budotitane; buthionine sulfoximine;
  • calcipotriol calphostin C; camptothecin derivatives; canarypox IL-2; capecitabine;
  • carboxamide-amino-triazole carboxyamidotriazole; CaRest M3; CARN 700; cartilage derived inhibitor; carzelesin; casein kinase inhibitors (ICOS); castanospermine; cecropin B; cetrorelix; chlorins; chloroquinoxaline sulfonamide; cicaprost; cis-porphyrin; cladribine; clomifene analogues; clotrimazole; collismycin A; collismycin B; combretastatin A4;
  • combretastatin analogue conagenin; crambescidin 816; crisnatol; cryptophycin 8;
  • cryptophycin A derivatives curacin A; cyclopentanthraquinones; cycloplatam; cypemycin; cytarabine ocfosfate; cytolytic factor; cytostatin; dacliximab; decitabine; dehydrodidemnin B; deslorelin; dexamethasone; dexifosfamide; dexrazoxane; dexverapamil; diaziquone;
  • didemnin B didemnin B; didox; diethylnorspermine; dihydro-5-azacytidine; 9-dioxamycin; diphenyl spiromustine; docosanol; dolasetron; doxifluridine; droloxifene; dronabinol; duocarmycin SA; ebselen; ecomustine; edelfosine; edrecolomab; eflornithine; elemene; emitefur;
  • epirubicin epristeride
  • estramustine analogue epristeride
  • estrogen agonists epristeride
  • estrogen antagonists epristeride
  • estramustine analogue epristeride
  • estrogen agonists epristeride
  • estrogen antagonists epristeride
  • etanidazole etoposide phosphate; exemestane; fadrozole; trasrabine; fenretinide; filgrastim; finasteride; flavopiridol; flezelastine; fluasterone; fludarabine; fluorodaunorunicin
  • hydrochloride forfenimex; formestane; fostriecin; fotemustine; gadolinium texaphyrin;
  • gallium nitrate galocitabine; ganirelix; gelatinase inhibitors; gemcitabine; glutathione inhibitors; hepsulfam; heregulin; hexamethylene bisacetamide; hypericin; ibandronic acid; idarubicin; idoxifene; idramantone; ilmofosine; ilomastat; imidazoacridones; imiquimod; immunostimulant peptides; insulin-like growth factor- 1 receptor inhibitor; interferon agonists; interferons; interleukins; iobenguane; iododoxorubicin; ipomeanol, 4-; iroplact; irsogladine; isobengazole; isohomohalicondrin B; itasetron; jasplakinolide; kahalalide F; lamellarin-N triacetate; lanreotide; lein
  • leuprolide+estrogen+progesterone leuprorelin; levamisole; liarozole; linear polyamine analogue; lipophilic disaccharide peptide; lipophilic platinum compounds; lissoclinamide 7; lobaplatin; lombricine; lometrexol; lonidamine; losoxantrone; lovastatin; loxoribine;
  • lurtotecan lutetium texaphyrin; lysofylline; lytic peptides; maitansine; mannostatin A; marimastat; masoprocol; maspin; matrilysin inhibitors; matrix metalloproteinase inhibitors; menogaril; merbarone; meterelin; methioninase; metoclopramide; MTF inhibitor;
  • mifepristone miltefosine; mirimostim; mismatched double stranded RNA; mitoguazone; mitolactol; mitomycin analogues; mitonafide; mitotoxin fibroblast growth factor-saporin; mitoxantrone; mofarotene; molgramostim; monoclonal antibody, human chorionic gonadotrophin; monophosphoryl lipid A+myobacterium cell wall sk; mopidamol; multiple drug resistance gene inhibitor; multiple tumor suppressor 1 -based therapy; mustard anticancer agent; mycaperoxide B; mycobacterial cell wall extract; myriaporone; N-acetyldinaline; N- substituted benzamides; nafarelin; nagrestip; naloxone+pentazocine; napavin; naphterpin; nartograstim; nedaplatin; nemorubicin; neridronic acid;
  • octreotide okicenone; oligonucleotides; onapristone; ondansetron; ondansetron; oracin; oral cytokine inducer; ormaplatin; osaterone; oxaliplatin; oxaunomycin; palauamine;
  • palmitoylrhizoxin pamidronic acid; panaxytriol; panomifene; parabactin; pazelliptine;
  • pegaspargase peldesine; pentosan polysulfate sodium; pentostatin; pentrozole; perflubron; perfosfamide; perillyl alcohol; phenazinomycin; phenylacetate; phosphatase inhibitors;
  • plasminogen activator inhibitor platinum complex; platinum compounds; platinum-triamine complex; porfimer sodium; porfiromycin; prednisone; propyl bis-acridone; prostaglandin J2; proteasome inhibitors; protein A-based immune modulator; protein kinase C inhibitor;
  • protein kinase C inhibitors microalgal; protein tyrosine phosphatase inhibitors; purine nucleoside phosphorylase inhibitors; purpurins; pyrazoloacridine; pyridoxylated hemoglobin polyoxyethylerie conjugate; raf antagonists; raltitrexed; ramosetron; ras farnesyl protein transferase inhibitors; ras inhibitors; ras-GAP inhibitor; retelliptine demethylated; rhenium Re 186 etidronate; rhizoxin; ribozymes; RII retinamide; rogletimide; rohitukine; romurtide; roquinimex; rubiginone B 1 ; ruboxyl; safmgol; saintopin; SarCNU; sarcophytol A;
  • oligonucleotides oligonucleotides; signal transduction inhibitors; signal transduction modulators; single chain antigen-binding protein; sizofuran; sobuzoxane; sodium borocaptate; sodium phenylacetate; solverol; somatomedin binding protein; sonermin; sparfosic acid; spicamycin D;
  • spiromustine spiromustine; splenopentin; spongistatin 1; squalamine; stem cell inhibitor; stem-cell division inhibitors; stipiamide; stromelysin inhibitors; sulfmosine; superactive vasoactive intestinal peptide antagonist; suradista; suramin; swainsonine; synthetic glycosaminoglycans; tallimustine; tamoxifen methiodide; tauromustine; tazarotene; tecogalan sodium; tegafur; tellurapyrylium; telomerase inhibitors; temoporfm; temozolomide; teniposide;
  • thrombopoietin mimetic thymalfasin; thymopoietin receptor agonist; thymotrinan; thyroid stimulating hormone; tin ethyl etiopurpurin; tirapazamine; titanocene bichloride; topsentin; toremifene; totipotent stem cell factor; translation inhibitors; tretinoin; triacetyluridine; triciribine; trimetrexate; triptorelin; tropisetron; turosteride; tyrosine kinase inhibitors;
  • tyrphostins UBC inhibitors; ubenimex; urogenital sinus-derived growth inhibitory factor; urokinase receptor antagonists; vapreotide; variolin B; vector system, erythrocyte gene therapy; velaresol; veramine; verdins; verteporfm; vinorelbine; vinxaltine; vitaxin; vorozole; zanoterone; zeniplatin; zilascorb; zinostatin stimalamer, Adriamycin, Dactinomycin, Bleomycin, Vinblastine, Cisplatin, acivicin; aclarubicin; acodazole hydrochloride; acronine; adozelesin; aldesleukin; altretamine; ambomycin; ametantrone acetate; aminoglutethimide; amsacrine; anastrozole; anthramycin; asparaginase; asperlin; azacitidine;
  • azotomycin batimastat; benzodepa; bicalutamide; bisantrene hydrochloride; bisnafide dimesylate; bizelesin; bleomycin sulfate; brequinar sodium; bropirimine; busulfan;
  • cactinomycin calusterone; caracemide; carbetimer; carboplatin; carmustine; carubicin hydrochloride; carzelesin; cedefmgol; chlorambucil; cirolemycin; cladribine; crisnatol mesylate; cyclophosphamide; cytarabine; dacarbazine; daunorubicin hydrochloride;
  • decitabine dexormaplatin; dezaguanine; dezaguanine mesylate; diaziquone; doxorubicin; doxorubicin hydrochloride; droloxifene; droloxifene citrate; dromostanolone propionate; duazomycin; edatrexate; eflomithine hydrochloride; elsamitrucin; enloplatin; enpromate; epipropidine; epirubicin hydrochloride; erbulozole; esorubicin hydrochloride; estramustine; estramustine phosphate sodium; etanidazole; etoposide; etoposide phosphate; etoprine; fadrozole hydrochloride; camrabine; fenretinide; floxuridine; fludarabine phosphate;
  • melphalan menogaril; mercaptopurine; methotrexate; methotrexate sodium; metoprine; meturedepa; mitindomide; mitocarcin; mitocromin; mitogillin; mitomalcin; mitomycin; mitosper; mitotane; mitoxantrone hydrochloride; mycophenolic acid; nocodazoie;
  • Taxotere.TM compounds comprising the taxane skeleton, Erbulozole (i.e., R- 55104), Dolastatin 10 (i.e., DLS-10 and NSC-376128), Mivobulin isethionate (i.e., as CI- 980), Vincristine, NSC-639829, Discodermolide (i.e., as NVP-XX-A-296), ABT-751 (Abbott, i.e., E-7010), Altorhyrtins (e.g., Altorhyrtin A and Altorhyrtin C), Spongistatins (e.g., Spongistatin 1, Spongistatin 2, Spongistatin 3, Spongistatin 4, Spongistatin 5,
  • Altorhyrtins e.g., Altorhyrtin A and Altorhyrtin C
  • Spongistatins e.g., Spongist
  • Epothilones e.g., Epothilone A, Epothilone B, Epothilone C (i.e., desoxyepothilone A or dEpoA), Epothilone D (i.e., KOS-862, dEpoB, and desoxyepothilone B), Epothilone E, Epothilone F, Epothilone B N-oxide, Epothilone A N- oxide, 16-aza-epothilone B, 21-aminoepothilone B (i.e., BMS-310705), 21- hydroxyepothilone D (i.e., Desoxyepothilone F and dEpoF), 26-fluoroepothilones (e.g., Epothilone A, Epothilone B, Epothilone C (i.e., desoxyepothilone A or dEpoA), Epothilone D
  • WS- 9885B GS-164 (Takeda), GS-198 (Takeda), KAR-2 (Hungarian Academy of Sciences), BSF-223651 (BASF, i.e., ILX-651 and LU-223651), SAH-49960 (Lilly/Novartis), SDZ- 268970 (Lilly/Novartis), AM-97 (Armad/Kyowa Hakko), AM- 132 (Armad), AM-138 (Armad/Kyowa Hakko), IDN-5005 (Indena), Cryptophycin 52 (i.e., LY-355703), AC-7739 (Ajinomoto, i.e., AVE-8063A and CS-39.HC1), AC-7700 (Ajinomoto, i.e., AVE-8062, AVE- 8062A, CS-39-L-Ser.HCl, and RPR-258062A), Vitilevuamide, Tubulys
  • steroids e.g., dexamethasone
  • finasteride aromatase inhibitors
  • GnRH gonadotropin-releasing hormone agonists
  • adrenocorticosteroids e.g., prednisone
  • progestins e.g., hydroxyprogesterone caproate, megestrol acetate, medroxyprogesterone acetate
  • estrogens e.g., diethlystilbestrol, ethinyl estradiol
  • antiestrogen e.g., tamoxifen
  • androgens e.g., testosterone propionate, fluoxymesterone
  • antiandrogen e.g., flutamide
  • immunostimulants e.g., testosterone propionate, fluoxymesterone
  • antiandrogen e.g., flutamide
  • compound utilized in the pharmaceutical compositions of the present invention may be administered at the initial dosage of about 0.001 mg/kg to about 1000 mg/kg daily.
  • the dosages may be varied depending upon the requirements of the patient, the severity of the condition being treated, and the compound or drug being employed. For example, dosages can be empirically determined considering the type and stage of cancer diagnosed in a particular patient.
  • the dose administered to a patient should be sufficient to affect a beneficial therapeutic response in the patient over time.
  • the size of the dose will also be determined by the existence, nature, and extent of any adverse side effects that accompany the administration of a compound in a particular patient. Determination of the proper dosage for a particular situation is within the skill of the practitioner. Generally, treatment is initiated with smaller dosages which are less than the optimum dose of the compound. Thereafter, the dosage is increased by small increments until the optimum effect under circumstances is reached. For convenience, the total daily dosage may be divided and administered in portions during the day, if desired.
  • the compounds described herein can be used in combination with one another, with other active agents known to be useful in treating cancer or with adjunctive agents that may not be effective alone, but may contribute to the efficacy of the active agent.
  • the term“associated” or“associated with” in the context of a substance or substance activity or function associated with a disease means that the disease (e.g., neurodegenerative disease, cancer) is caused by (in whole or in part), or a symptom of the disease is caused by (in whole or in part) the substance or substance activity or function or the disease or a symptom of the disease may be treated by modulating (e.g., inhibiting or activating) the substance (e.g., cellular component).
  • a neurodegenerative disease associated with a protein aggregate may be a neurodegenerative disease that results (entirely or partially) from aberrant protein aggregation or a neurodegenerative disease wherein a particular symptom of the disease is caused (entirely or partially) by aberrant protein aggregation.
  • a neurodegenerative disease associated with aberrant protein aggregation or a protein aggregate associated neurodegenerative disease may be treated with a protein aggregate modulator.
  • aberrant refers to different from normal. When used to describe enzymatic activity, aberrant refers to activity that is greater or less than a normal control or the average of normal non-diseased control samples. Aberrant activity may refer to an amount of activity that results in a disease, wherein returning the aberrant activity to a normal or non-disease-associated amount (e.g., by administering a compound or using a method as described herein), results in reduction of the disease or one or more disease symptoms.
  • electrophilic refers to a chemical group that is capable of accepting electron density.
  • An“electrophilic substituent,”“electrophilic chemical moiety,” or“electrophilic moiety” refers to an electron-poor chemical group, substituent, or moiety (monovalent chemical group), which may react with an electron-donating group, such as a nucleophile, by accepting an electron pair or electron density to form a bond.
  • the electrophilic substituent of the compound is capable of reacting with a cysteine residue.
  • the electrophilic substituent is capable of forming a covalent bond with a cysteine residue and may be referred to as a“covalent cysteine modifier moiety” or“covalent cysteine modifier substituent.”
  • the covalent bond formed between the electrophilic substituent and the sulfhydryl group of the cysteine may be a reversible or irreversible bond.
  • the electrophilic substituent of the compound is capable of reacting with a lysine residue.
  • the electrophilic substituent of the compound is capable of reacting with a serine residue.
  • the electrophilic substituent of the compound is capable of reacting with a methionine residue.
  • Nucleophilic refers to a chemical group that is capable of donating electron density.
  • nucleic acid or protein when applied to a nucleic acid or protein, denotes that the nucleic acid or protein is essentially free of other cellular components with which it is associated in the natural state. It can be, for example, in a homogeneous state and may be in either a dry or aqueous solution. Purity and homogeneity are typically determined using analytical chemistry techniques such as polyacrylamide gel electrophoresis or high performance liquid chromatography. A protein that is the predominant species present in a preparation is substantially purified.
  • amino acid refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids.
  • Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, g- carboxyglutamate, and O-phosphoserine.
  • Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e., an a carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid.
  • Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions in a manner similar to a naturally occurring amino acid.
  • the terms“non-naturally occurring amino acid” and“unnatural amino acid” refer to amino acid analogs, synthetic amino acids, and amino acid mimetics which are not found in nature.
  • amino acids may be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, may be referred to by their commonly accepted single-letter codes.
  • the terms“polypeptide,”“peptide,” and“protein” are used interchangeably herein to refer to a polymer of amino acid residues, wherein the polymer may in embodiments be conjugated to a moiety that does not consist of amino acids. The terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymers.
  • amino acid or nucleotide base“position” is denoted by a number that
  • each amino acid (or nucleotide base) in the reference sequence sequentially identifies each amino acid (or nucleotide base) in the reference sequence based on its position relative to the N-terminus (or 5'-end). Due to deletions, insertions, truncations, fusions, and the like that must be taken into account when determining an optimal alignment, in general the amino acid residue number in a test sequence determined by simply counting from the N-terminus will not necessarily be the same as the number of its corresponding position in the reference sequence. For example, in a case where a variant has a deletion relative to an aligned reference sequence, there will be no amino acid in the variant that corresponds to a position in the reference sequence at the site of deletion.
  • protein complex is used in accordance with its plain ordinary meaning and refers to a protein which is associated with an additional substance (e.g., another protein, protein subunit, or a compound). Protein complexes typically have defined quaternary structure. The association between the protein and the additional substance may be a covalent bond. In embodiments, the association between the protein and the additional substance (e.g., compound) is via non-covalent interactions. In embodiments, a protein complex refers to a group of two or more polypeptide chains. Proteins in a protein complex are linked by non-covalent protein-protein interactions. A non-limiting example of a protein complex is the proteasome.
  • protein aggregate is used in accordance with its plain ordinary meaning and refers to an aberrant collection or accumulation of proteins (e.g., misfolded proteins). Protein aggregates are often associated with diseases (e.g., amyloidosis). Typically, when a protein misfolds as a result of a change in the amino acid sequence or a change in the native environment which disrupts normal non-covalent interactions, and the misfolded protein is not corrected or degraded, the unfolded/misfolded protein may aggregate. There are three main types of protein aggregates that may form: amorphous aggregates, oligomers, and amyloid fibrils. In embodiments, protein aggregates are termed aggresomes.
  • the term“Nurrl” or“NR4A2” refers to the protein that in humans is encoded by the NR4A2 gene. Nurrl is a nuclear receptor and plays a key role in the maintenance of the dopaminergic system of the brain.
  • the term“Nurrl” may refer to the nucleotide sequence or protein sequence of human NR4A2 (e.g., Entrez 4929, Uniprot P43354, RefSeq
  • Nurrl has the following amino acid sequence:
  • the term“Pituitary homeobox 3” or“Pitx3” refers to the gene that encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins and act as transcription factors. Pitx3 is involved in the maintenance of
  • Pitx3 may refer to the nucleotide sequence or protein sequence of human Pitx3 (e.g., Entrez 5309, Uniprot 075364, RefSeq NM_005029.3, or RefSeq NP 005020.1). In embodiments, Pitx3 has the following amino acid sequence:
  • TH may refer to the nucleotide sequence or protein sequence of human TH (e.g., Entrez 7054, Uniprot P07101, RefSeq NM_199292.2, or RefSeq NP_954986.2). In embodiments, TH has the following amino acid sequence:
  • VMAT2 refers to the integral membrane protein that transports neurotransmitters such as dopamine, norepinephrine, serotonin, and histamine, from cellular cytosol into synaptic vesicles.
  • the term“VMAT2” may refer to the nucleotide sequence or protein sequence of human VMAT2 (e.g., Entrez 6571, Uniprot Q05940, RefSeq NM_003054.4, or RefSeq NP_003045.2). In embodiments, VMAT2 has the following amino acid sequence:
  • VY AIAD V AF CMGY AIGP S AGGAIAKAIGFPWFMTIIGIIDIFFAPFCFFFRSPP AKEEKM AILMDHNCPIKTKMYTQN IQSYPIGEDEESESD (SEQ ID NO:4).
  • Ring A is aryl or heteroaryl.
  • L 1 is L 101 -L 102 -L 103 .
  • L 101 is a bond, -S(0) 2 -, -N(R 101 )-, -0-, -S-, -C(O)-, -C(0)N(R 101 )-, -N(R 101 )C(O)-,
  • cycloalkylene substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted aryl ene, substituted or unsubstituted heteroaryl ene, L 104 -L 105 , L 104 -NH-L 105 , or L 104 -CH2-L 105 .
  • L 102 is a bond, -S(0) 2 -, -N(R 102 )-, -0-, -S-, -C(O)-, -C(0)N(R 102 )-, -N(R 102 )C(O)-,
  • cycloalkylene substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroaryl ene.
  • L 103 is a bond, -S(0) 2 -, -N(R 103 )-, -0-, -S-, -C(O)-, -C(0)N(R 103 )-, -N(R 103 )C(O)-,
  • cycloalkylene substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroaryl ene.
  • L 104 is a bond, -0-, -NH-, -S-, -S(0) 2 -, -C(O)-, -NHC(O)-, -C(0)NH-, -OC(O)-,
  • L 105 is a bond, -0-, -NH-, -S-, -S(0) 2 -, -C(O)-, -NHC(O)-, -C(0)NH-, -OC(O)-,
  • R 101 , R 102 , and R 103 are independently hydrogen, oxo, halogen, -CCh, -CBn, -CF3,
  • R 1 is hydrogen, halogen, -CX 3 3 , -CHX 1 ! , -CH 2 X ⁇ -OCX , -OCHzX 1 , -OCHX , -CN, -SOniR 1D , -SOviNR 1A R 1B , -NHC(0)NR 1A R 1b , -N(0) mi , -NR 1A R 1B , -C(0)R lc ,
  • E is an electrophilic moiety.
  • R 2 is independently halogen, -CX 2 3 , -CHX 2 2 , -CH 2 X 2 , -OCX 2 3 , -OCH 2 X 2 ,
  • R 1A , R 1b , R 1C , R 1d , R 2A , R 2B , R 2C , and R 2D are independently hydrogen, halogen, -CCh, -CBr 3 , -CF3, -CI3, -CHiCl, -CH 2 Br, -CH 2 F, -CH 2 I, -CHCE, -CHBr 2 , -CHF 2 , -CHI 2 , -CN, -OH, -Mi l , -COOH, -CONK ! , -N0 2 , -SH, -SO3H, -S0 4 H, -S0 2 NH 2 , -NHNH 2 , -NHNH 2 ,
  • nl and n2 are independently an integer from 0 to 4.
  • ml, m2, vl, and v2 are independently 1 or 2.
  • X 1 and X 2 are independently -F, -Cl, -Br, or -I.
  • z2 is an integer from 0 to 5.
  • L 101 is a bond, -S(0) 2 -, -N(R 101 )-, -0-, -S-, -C(O)-, -C(0)N(R 101 )-, -N(R 101 )C(O)-, -N(R 101 )C(O)NH-, -NHC(0)N(R 101 )-, -C(0)0-, -OC(O)-, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or
  • L 101 is a bond, -S(0) 2 -, -N(R 101 )-, -0-, -S-, -C(O)-, -C(0)N(R 101 )-, -N(R 101 )C(O)-, -N(R 101 )C(O)NH-, -NHC(0)N(R 101 )-, -C(0)0-, -OC(O)-, substituted or unsubstituted alkylene (e.g., Ci-Cx, C1-C6, or C1-C4), substituted or unsubstituted
  • heteroalkylene e.g., 2 to 10 membered, 2 to 6 membered, or 2 to 4 membered
  • substituted or unsubstituted cycloalkylene e.g., C3-C8, C3-C6, or C5-C6
  • substituted or unsubstituted heterocycloalkylene e.g., 3 to 8 membered, 3 to 6 membered, or 5 to 6 membered
  • substituted or unsubstituted arylene e.g., C6-C10 or phenyl ene
  • substituted or unsubstituted heteroarylene e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered
  • L 104 -L 105 L 104 -NH-L 105
  • L 104 -CH 2 -L 105 L 104 -CH 2 -L 105 .
  • L 101 is a bond, -S(0) 2 -, -NH-, -0-, -S-, -C(O)-, -C(0)NH-,
  • unsubstituted alkylene e.g., Ci-Cx, C1-C6, or C1-C4
  • R 101 -substituted or unsubstituted heteroalkylene e.g., 2 to 10 membered, 2 to 6 membered, or 2 to 4 membered
  • R 101 - substituted or unsubstituted cycloalkylene e.g., C3-C8, C3-C6, or C5-C6
  • R 101 -substituted or unsubstituted heterocycloalkylene e.g., 3 to 8 membered, 3 to 6 membered, or 5 to 6 membered
  • R 101 -substituted or unsubstituted arylene e.g., C6-C10 or phenyl ene
  • R 101 - substituted or unsubstituted heteroarylene e.g., 5 to 10 membered, 5 to 9 membered, or 5
  • L 102 is a bond, -S(0) 2 -, -N(R 102 )-, -0-, -S-, -C(O)-, -C(0)N(R 102 )-, -N(R 102 )C(O)-, -N(R 102 )C(O)NH-, -NHC(0)N(R 102 )-, -C(0)0-, -OC(0)-, substituted or unsubstituted alkylene (e.g., Ci-Cx, C1-C 6 , or C1-C4), substituted or unsubstituted
  • alkylene e.g., Ci-Cx, C1-C 6 , or C1-C4
  • heteroalkylene e.g., 2 to 10 membered, 2 to 6 membered, or 2 to 4 membered
  • substituted or unsubstituted cycloalkylene e.g., C3-C8, C3-C 6 , or C5-C 6
  • substituted or unsubstituted heterocycloalkyl ene e.g., 3 to 8 membered, 3 to 6 membered, or 5 to 6 membered
  • substituted or unsubstituted arylene e.g., C 6 -C 10 or phenyl ene
  • unsubstituted heteroarylene e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • L 102 is a bond, -S(0) 2 -, -NH-, -0-, -S-, -C(O)-, -C(0)NH-, -NHC(O)-, -NHC(0)NH-, -NHC(0)NH-, -C(0)0-, -OC(0)-, R 102 -substituted or
  • unsubstituted alkylene e.g., Ci-Cs, C1-C 6 , or C1-C4
  • R 102 -substituted or unsubstituted heteroalkylene e.g., 2 to 10 membered, 2 to 6 membered, or 2 to 4 membered
  • R 102 - substituted or unsubstituted cycloalkylene e.g., C3-C8, C3-C 6 , or C5-C 6
  • R 102 -substituted or unsubstituted heterocycloalkyl ene e.g., 3 to 8 membered, 3 to 6 membered, or 5 to 6 membered
  • R 102 -substituted or unsubstituted arylene e.g., C 6 -C 10 or phenyl ene
  • R 102 - substituted or unsubstituted heteroarylene e.g., 5 to 10
  • L 103 is a bond, -S(0) 2 -, -N(R 103 )-, -0-, -S-, -C(O)-, -C(0)N(R 103 )-, -N(R 103 )C(O)-, -N(R 103 )C(O)NH-, -NHC(0)N(R 103 )-, -C(0)0-, -OC(0)-, substituted or unsubstituted alkylene (e.g., Ci-Cs, C1-C 6 , or C1-C4), substituted or unsubstituted
  • alkylene e.g., Ci-Cs, C1-C 6 , or C1-C4
  • heteroalkylene e.g., 2 to 10 membered, 2 to 6 membered, or 2 to 4 membered
  • substituted or unsubstituted cycloalkylene e.g., C3-C8, C3-C 6 , or C5-C 6
  • substituted or unsubstituted heterocycloalkyl ene e.g., 3 to 8 membered, 3 to 6 membered, or 5 to 6 membered
  • substituted or unsubstituted arylene e.g., C 6 -C 10 or phenyl ene
  • unsubstituted heteroarylene e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • L 103 is a bond, -S(0) 2 -, -NH-, -0-, -S-, -C(O)-, -C(0)NH-, -NHC(O)-, -NHC(0)NH-, -NHC(0)NH-, -C(0)0-, -OC(0)-, R 103 -substituted or
  • unsubstituted alkylene e.g., Ci-Cs, C1-C 6 , or C1-C4
  • R 103 -substituted or unsubstituted heteroalkylene e.g., 2 to 10 membered, 2 to 6 membered, or 2 to 4 membered
  • R 103 - substituted or unsubstituted cycloalkylene e.g., C3-C8, C3-C 6 , or C5-C 6
  • R 103 -substituted or unsubstituted heterocycloalkyl ene e.g., 3 to 8 membered, 3 to 6 membered, or 5 to 6 membered
  • R 103 -substituted or unsubstituted arylene e.g., C6-C10 or phenyl ene
  • R 103 - substituted or unsubstituted heteroarylene e.g., 5 to 10 member
  • R 1A , R 1B , R 1C , and R 1D are independently hydrogen, halogen,
  • -ONH 2 -NHC(0)NHNH 2 , -NHC(0)NH 2 , -NHSOiH, -NHC(0)H, -NHC(0)OH, -NHOH, -OCCI3, -OCBrs, -OCF3, -OCI3, -OCHiCl, -OCH 2 Br, -OCH 2 F, -OCH 2 I, -OCHCb, -OCHBr 2 , -OCHF 2 , -OCHI 2 , substituted or unsubstituted alkyl (e.g., Ci-Cx, C1-C6, or C1-C4), substituted or unsubstituted heteroalkyl (e.g., 2 to 10 membered, 2 to 6 membered, or 2 to 4 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, or C5-C6), substituted or unsubstituted heterocycl
  • substituted or unsubstituted aryl e.g., C6-C10 or phenyl
  • substituted or unsubstituted heteroaryl e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered
  • R 1A and R 1B substituents bonded to the same nitrogen atom may be joined to form a substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, or 5 to 6 membered) or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
  • R 1A , R 1B , R 1C , and R 1D are independently hydrogen, halogen,
  • R 2A , R 2B , R 2C , and R 2D are independently hydrogen, halogen,
  • substituted or unsubstituted aryl e.g., C 6 -C 10 or phenyl
  • substituted or unsubstituted heteroaryl e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered
  • R 2A and R 2B substituents bonded to the same nitrogen atom may be joined to form a substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, or 5 to 6 membered) or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
  • R 2A , R 2B , R 2C , and R 2D are independently hydrogen, halogen,
  • the compound has the formula Ring A, R 1 , R 2 , L 103 , L 104 , L 105 , and z2 are as described herein.
  • W is N or CH.
  • L 103 is a bond, substituted or unsubstituted alkylene, or substituted or unsubstituted heteroalkylene.
  • L 104 is a bond, -S(0) 2 -, -C(O)-, -NHC(O)-, -OC(O)-, substituted or unsubstituted alkylene, or substituted or unsubstituted heteroalkylene.
  • L 105 is a bond, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, or substituted or unsub stituted heterocy cl oalkyl ene .
  • Ring A is aryl (e.g., C6-C10 or phenyl) or heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
  • Ring A is a C6-C10 aryl.
  • Ring A is a phenyl.
  • Ring A is a 5 to 10 membered heteroaryl.
  • Ring A is a 5 to 9 membered heteroaryl.
  • Ring A is a 5 to 6 membered heteroaryl.
  • Ring A is a phenyl or 5 to 10 membered heteroaryl.
  • Ring A is a phenyl. In embodiments, Ring A is a naphthyl. In embodiments, Ring A is a quinolinyl. In embodiments, Ring A is an isoquinolinyl. In embodiments, Ring
  • Ring A is a phenyl or 5 to 10 membered heteroaryl.
  • Ring A is a phenyl. In embodiments, Ring A is a naphthyl. In embodiments, Ring A is a quinolinyl. In embodiments, Ring A is an isoquinolinyl. In embodiments, Ring A is a benzoxazolyl. In embodiments, Ring A is denotes the
  • Ring A is a phenyl or 5 to 10 membered heteroaryl.
  • Ring A is a phenyl. In embodiments, Ring A is a naphthyl. In embodiments, Ring A is a quinolinyl. In embodiments, Ring A is a 3-quinolinyl. In embodiments, Ring A is an isoquinolinyl. In embodiments, Ring A is a benzoxazolyl. In embodiments, Ring A is a 6-benzoxazolyl.
  • the compound has the formula
  • R 2X , R 2Y , and R 2Z are independently hydrogen, or may independently assume any value of R 2 , including in embodiments.
  • R 2X , R 2Y , and R 2Z are independently hydrogen, halogen, -CX 2 3 , -CHX 2 2, -CH 2 X 2 , -OCX 2 3, -OCH2X 2 , -0CHX 2 2, -CN, -SO Rule2R 2D , -SO V2 NR 2A R 2B ,
  • unsubstituted alkyl e.g., Ci-Cx, C 1 -C 6 , or C 1 -C 4
  • substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, or 2 to 4 membered
  • substituted or unsubstituted cycloalkyl e.g., C 3 -C 8 , C 3 -C 6 , or Cs-Cr,
  • substituted or unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, or 5 to 6 membered
  • substituted or unsubstituted aryl e.g., C 6 -C 10 or phenyl
  • substituted or unsubstituted heteroaryl e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered
  • R 2X and R 2Y substituents may be joined
  • R 2Y and R 2Z substituents may be joined to form a substituted or unsubstituted cycloalkyl (e.g., C3- Cs, C3-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6-C10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
  • a substituted or unsubstituted cycloalkyl e.g., C3- Cs, C3-C6, or C5-C6
  • substituted or unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, or 5 to 6 membere
  • R 2X , R 2Y , and R 2Z are independently hydrogen, halogen, -CX 2 3 , -CHX 2 2, -CH2X 2 , -OCX 2 3, -OCH2X 2 , -OCHX 2 2, -CN, -SO Rule2R 2D , -SO V2 NR 2A R 2B ,
  • R 20 -substituted or unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, or 5 to 6 membered
  • R 20 - substituted or unsubstituted aryl e.g., C6-C10 or phenyl
  • R 20 -substituted or unsubstituted heteroaryl e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered
  • R 2X and R 2Y substituents may be joined to form an R 20 -substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, or C5-C6), R 20 -substituted or unsubstituted heterocycloalkyl (e.g.,
  • R 20 -substituted or unsubstituted aryl e.g., C6-C10 or phenyl
  • R 20 -substituted or unsubstituted heteroaryl e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • R 2X is independently halogen or unsubstituted heteroalkyl
  • R 2Y is independently hydrogen or halogen
  • R 2Z is independently hydrogen, halogen, -CN, -NR 2A C(0)R 2C , unsubstitued heteroalkyl, or substituted or unsubstituted heterocycloalkyl.
  • R 2X is independently halogen or unsubstituted heteroalkyl.
  • R 2Y is independently hydrogen or halogen.
  • R 2Z is
  • R 2X is independently halogen. In embodiments, R 2X is independently unsubstituted heteroalkyl.
  • R 2Y is independently hydrogen. In embodiments, R 2Y is independently halogen.
  • R 2Z is independently hydrogen. In embodiments, R 2Z is independently halogen. In embodiments, R 2Z is independently -CN. In embodiments, R 2Z is independently
  • R 2Z is independently unsubstitued heteroalkyl. In embodiments, R 2Z is independently substituted or unsubstituted heterocycloalkyl.
  • R 2X is independently halogen
  • R 2Y is independently halogen
  • R 2Z is independently hydrogen
  • R 2X is independently halogen.
  • R 2Y is independently halogen.
  • R 2Z is independently hydrogen.
  • R 2X is independently halogen or unsubstituted 2 to 4 membered heteroalkyl
  • R 2Y is independently hydrogen
  • R 2Z is independently halogen, -CN
  • R 2A is independently hydrogen
  • R 2C is independently unsubstituted C1-C2 alkyl.
  • R 2X is independently halogen or unsubstituted 2 to 4 membered heteroalkyl.
  • R 2Y is independently hydrogen.
  • R 2Z is independently halogen, -CN, -NR 2A C(0)R 2C , unsubstituted 2 to 4 membered heteroalkyl, or substituted or unsubstituted 5 to 6 membered heterocycloalkyl.
  • R 2A is independently hydrogen.
  • R 2C is independently unsubstituted C1-C2 alkyl.
  • R 2X is independently halogen.
  • R 2X is independently unsubstituted 2 to 4 membered heteroalkyl.
  • R 2Z is independently halogen.
  • R 2Z is independently -CN.
  • R 2Z is independently
  • R 2Z is independently unsubstituted 2 to 4 membered heteroalkyl. In embodiments, R 2Z is independently substituted or unsubstituted 5 to 6 membered heterocycloalkyl.
  • R 2X is independently halogen or -OCH3;
  • R 2Y is independently hydrogen;
  • R 2Z is independently halogen, -CN, -NHC(0)CH 3 , -OCH3, or substituted or unsubstituted 5 to 6 membered heterocycloalkyl;
  • R 2A is independently hydrogen;
  • R 2C is independently unsubstituted C1-C2 alkyl.
  • R 2X is independently halogen or -OCH3.
  • R 2Y is independently hydrogen.
  • R 2Z is independently halogen, -CN, -NHC(0)CH 3 , -OCH3, or substituted or unsubstituted 5 to 6 membered heterocycloalkyl.
  • R 2A is independently hydrogen.
  • R 2C is independently unsubstituted C1-C2 alkyl.
  • R 2X is independently halogen.
  • R 2X is independently -OCH3.
  • R 2Z is independently halogen.
  • R 2Z is independently halogen. In embodiments, R 2Z is
  • R 2Z is independently -CN. In embodiments, R 2Z is independently -NHC(0)CH 3 . In embodiments, R 2Z is independently -OCH3. In embodiments, R 2Z is independently substituted or
  • R 2X is independently halogen or -OCH3; R 2Y is independently hydrogen; R 2Z is independently halogen, -CN, -NHC(0)CH 3 , -OCH3, or substituted or unsubstituted 5 to 6 membered heterocycloalkyl. In embodiments, R 2Z is independently substituted or unsubstituted 5 to 6 membered heterocycloalkyl. In embodiments, R 2Z is independently substituted 5 to 6 membered heterocycloalkyl. In embodiments, R 2Z is
  • L 103 is a bond, substituted or unsubstituted alkylene (e.g., Ci-Cs, Ci-C 6 , or C1-C4), or substituted or unsubstituted heteroalkyl ene (e.g., 2 to 8 membered, 2 to 6 membered, or 2 to 4 membered).
  • L 103 is a bond.
  • L 103 is substituted or unsubstituted Ci-Cs alkylene.
  • L 103 is substituted or unsubstituted C1-C6 alkylene.
  • L 103 is substituted or unsubstituted C1-C4 alkylene.
  • L 103 is substituted or unsubstituted 2 to 8 membered
  • L 103 is substituted or unsubstituted 2 to 6 membered heteroalkylene. In embodiments, L 103 is substituted or unsubstituted 2 to 4 membered heteroalkylene.
  • L 103 is an unsubstituted alkylene. In embodiments, L 103 is an unsubstituted C1-C4 alkylene. In embodiments, L 103 is an unsubstituted ethylene.
  • L 103 is a bond, R 103 -substituted or unsubstituted alkylene (e.g., Ci- Cs, C1-C6, or C1-C4), or R 103 -substituted or unsubstituted heteroalkylene (e.g., 2 to 8 membered, 2 to 6 membered, or 2 to 4 membered).
  • R 103 -substituted or unsubstituted alkylene e.g., Ci- Cs, C1-C6, or C1-C4
  • R 103 -substituted or unsubstituted heteroalkylene e.g., 2 to 8 membered, 2 to 6 membered, or 2 to 4 membered.
  • R 101 , R 102 , and R 103 are independently hydrogen, oxo, halogen, -CCh, -CBr 3 , -CF , -CI 3 , -CH 2 C1, -CH 2 Br, -CH 2 F, -CH 2 I, -CHC1 2 , -CHBr 2 , -CHF 2 , -CHI 2 , -CN, -OH, -NH 2 , -COOH, -CONH 2 , -N0 2 , -SH, -S0 3 H, -S0 4 H, -SO 2 NH 2 , -NHNH 2 , -NHNH 2 ,
  • R 101 , R 102 , and R 103 are independently oxo, halogen, -CC1 3 , -CBr 3 , -CF 3 , -CI 3 , -CH 2 C1, -CH 2 Br, -CH 2 F, -CH 2 I, -CHCh, -CHBr 2 , -CHF 2 , -CHI 2 , -CN, -OH, -NH 2 , -COOH, -C0NH 2 , -N0 2 , -SH, -S0 3 H, -S0 4 H, -S0 2 NH 2 , -NHNH 2 , -ONH 2 ,
  • R 101 is independently hydrogen, oxo, halogen, -CC1 3 , -CBr 3 , -CF 3 , -CI 3 , -CH 2 C1, -CH 2 Br, -CH 2 F, -CH 2 I, -CHC1 2 , -CHBr 2 , -CHF 2 , -CHI 2 , -CN, -OH, -NH 2 , -COOH, -C0NH 2 , -N0 2 , -SH, -S0 3 H, -S0 4 H, -S0 2 NH 2 , -NHNH 2 , -ONH 2 ,
  • R 101 is independently oxo, halogen, -CCI3, -CBn, -CF3,
  • -CI 3 -CH 2 CI, -CH 2 Br, -CH 2 F, -CH 2 I, -CHC1 2 , -CHBr 2 , -CHF 2 , -CHI 2 , -CN, -OH, -NH 2 , -COOH, -COMB, -N0 2 , -SH, -SO 3 H, -S0 4 H, -S0 2 MI 2 , -MIMI 2 , -OMI 2 ,
  • heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • R lu -substituted or unsubstituted aryl e.g., C 6 -C 10 or phenyl
  • R lu -substituted or unsubstituted heteroaryl e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • R 111 is independently oxo, halogen, -CCI 3 , -CBn, -CF 3 , -CI 3 , -CH 2 C1, -CH 2 Br,
  • R 101 is independently hydrogen, halogen, -CCI3, -CBn, -CF3, -CI3, -CHiCl, -CH 2 Br, -CH 2 F, -CH 2 I, -CHCB, -CHBr 2 , -CHF 2 , -CHI 2 , -CN, -OH, -NH 2 , -COOH, -COMB, -N0 2 , -SH, -SO3H, -SO4H, -SOiMB, -NHNH 2 , -0NH 2 , -NHC(0)NHNH 2 , -NHC(0)NH 2 , -NHSO Z H, -NHC(0)H, -NHC(0)0H, -NHOH, -OCCI3, -OCBr , -OCF3, -OCI3, -OCH2CI, -OCH2B1-, -OCH2F, -OCH2I,
  • R 102 is independently hydrogen, oxo, halogen, -CCI 3 , -CBn, -CF 3 , -CI3, -CH2CI, -CH 2 Br, -CH 2 F, -CH2I, -CHCI2, -CHBr 2 , -CHF 2 , -CHI 2 , -CN, -OH, -NH 2 , -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2,
  • R 112 -substituted or unsubstituted alkyl e.g., Ci-Cs, C1-C 6 , C1-C4, or C1-C2
  • R 112 - substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • R 112 -substituted or unsubstituted cycloalkyl e.g., Ci-Cs, C1-C 6 , C1-C4, or C1-C2
  • heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • R 112 -substituted or unsubstituted aryl e.g., C 6 -C 10 or phenyl
  • R 112 -substituted or unsubstituted heteroaryl e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • R 102 is independently oxo, halogen, -CCI 3 , -CBn, -CF 3 ,
  • R 112 -substituted or unsubstituted alkyl e.g., Ci-Cs, C1-C6, C1-C4, or C1-C2
  • R 112 - substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • R 112 -substituted or unsubstituted cycloalkyl e.
  • heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • R 112 -substituted or unsubstituted aryl e.g., C 6 -C 10 or phenyl
  • R 112 -substituted or unsubstituted heteroaryl e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • R 112 is independently oxo, halogen, -CCh, -CBn, -CF 3 , -CI 3 , -CH 2 CI, -CHiBr,
  • R 102 is independently hydrogen, halogen, -CCI 3 , -CBn, -CF 3 , -CI 3 , -CH2CI, -CH 2 Br, -CH 2 F, -CH 2 I, -CHCI2, -CHBr 2 , -CHF 2 , -CHI 2 , -CN, -OH, -NH 2 , -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC(0)NHNH 2 , -NHC(0)NH 2 , -NHSO 2 H, -NHC(0)H, -NHC(0)OH, -NHOH, -OCCI 3 , -OCBr , -OCF 3 , -OCI3, -OCH2CI, -OCHiBr, -OCH2F, -OCH2I, -OCH2I, -
  • R 103 is independently hydrogen, oxo, halogen, -CCI 3 , -CBn, -CF 3 , -CI3, -CH2CI, -CH 2 Br, -CH 2 F, -CH 2 I, -CHCI2, -CHBr 2 , -CHF 2 , -CHI 2 , -CN, -OH, -NH 2 , -CO OH, -CONH 2 , -NO 2 , -SH, -SO 3 H, -SO 4 H, -SO 2 NH 2 , -NHNH 2 , -ONH 2 , -NHC(0)NHNH 2 , -NHC(0)NH 2 , -NHSO 2 H, -NHC(0)H, -NHC(0)OH, -NHC(NH)H, -NHC(NH)NH 2 ,
  • R 113 -substituted or unsubstituted alkyl e.g., Ci-Cs, C1-C6, or Ci- C4
  • R 113 -substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, or 2 to 4 membered
  • R 113 -substituted or unsubstituted cycloalkyl e.g., C 3 -C 8 , C 3 -C 6 , or C 5 -C 6
  • R 113 -substituted or unsubstituted heterocycloalkyl e.g., 3 to 8
  • R 103 is independently oxo, halogen, -CCh, -CBn, -CF3, -CI3, -CH2CI, -CH 2 Br, -CH 2 F, -CH 2 I, -CHC1 2 , -CHBr 2 , -CHF 2 , -CHI 2 , -CN, -OH, -NH 2 , -COOH, -CONHi, -N0 2 , -SH, -SO3H, -SO4H, -S0 2 NH 2 , -NHNHi, -ONH 2 , -NHC(0)NHNH 2 , -NHC(0)NH 2 , -NHSOiH, -NHC(0)H, -NHC(0)OH, -NHC(NH)H, -NHC(NH)NH 2 ,
  • R 113 -substituted or unsubstituted alkyl e.g., Ci-Cs, C1-C6, or Ci- C4
  • R 113 -substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, or 2 to 4 membered
  • R 113 -substituted or unsubstituted cycloalkyl e.g., C3-C8, C3-C6, or C5-C6
  • R 113 -substituted or unsubstituted heterocycloalkyl e.g., 3 to 8 membered
  • R 113 is independently oxo, halogen, -CCI 3 , -CBn, -CF 3 , -CI 3 , -CH 2 C1, -CH 2 Br,
  • R 103 is independently hydrogen, halogen, -CCI 3 , -CBn, -CF 3 , -CI 3 , -CHiCl, -CH 2 Br, -CH 2 F, -CH 2 I, -CHCb, -CHBr 2 , -CHF 2 , -CHb, -CN, -OH, -NH 2 , -COOH, -CONHi, -N0 2 , -SH, -SO 3 H, -SO 4 H, -S0 2 NH 2 , -NHNH I , -0NH 2 , -NHC(0)NHNH 2 , -NHC(0)NH 2 , -NHSO I H, -NHC(0)H, -NHC(0)0H, -NHOH, -OCCI 3 , -OCBr , -OCF 3 , -OCI 3 , -OCHiCl, -OCHiBr,
  • L 104 is a bond, -S(0) 2 -, -C(O)-, -NHC(O)-, -C(0)NH-, -OC(O)-, -C(0)0-, substituted or unsubstituted alkyl ene, or substituted or unsubstituted heteroalkylene.
  • L 104 is a bond, -0-, -NH-, -S-, -S(0) 2 -, -C(O)-, -NHC(O)-,
  • L 104 is a bond. In embodiments, L 104 is -0-. In embodiments, L 104 is -NH-. In embodiments, L 104 is -S-. In embodiments, L 104 is -S(0) 2 -. In embodiments, L 104 is -C(O)-.
  • L 104 is -NHC(O)-. In embodiments, L 104 is -C(0)NH-. In embodiments, L 104 is -OC(O)-. In embodiments, L 104 is -C(0)0-. In embodiments, L 104 is substituted or unsubstituted Ci-Cx alkylene. In embodiments, L 104 is substituted or unsubstituted C1-C6 alkylene. In embodiments, L 104 is substituted or unsubstituted C1-C4 alkylene. In embodiments, L 104 is substituted or unsubstituted 2 to 8 membered heteroalkylene.
  • L 104 is substituted or unsubstituted 2 to 6 membered heteroalkylene. In embodiments, L 104 is substituted or unsubstituted 2 to 4 membered heteroalkylene. In embodiments, L 104 is unsubstituted Ci-Cs alkylene. In embodiments, L 104 is unsubstituted 2 to 8 membered heteroalkylene.
  • L 104 is a bond, -S(0) 2 -, -C(O)-, -NHC(O)-, -OC(O)-, substituted or unsubstituted alkylene (e.g., Ci-Cs, C1-C6, or C1-C4), or substituted or unsubstituted heteroalkylene (e.g., 2 to 8 membered, 2 to 6 membered, or 2 to 4 membered).
  • alkylene e.g., Ci-Cs, C1-C6, or C1-C4
  • heteroalkylene e.g., 2 to 8 membered, 2 to 6 membered, or 2 to 4 membered.
  • L 104 is a bond. In embodiments, L 104 is -S(0) 2 -. In embodiments, L 104 is -C(O)-. In embodiments, L 104 is -NHC(O)-. In embodiments, L 104 is -OC(O)-. In embodiments, L 104 is substituted or unsubstituted Ci-Cs alkylene. In embodiments, L 104 is substituted or unsubstituted C1-C6 alkylene. In embodiments, L 104 is substituted or unsubstituted C1-C4 alkylene. In embodiments, L 104 is substituted or unsubstituted 2 to 8 membered heteroalkylene.
  • L 104 is substituted or unsubstituted 2 to 6 membered heteroalkylene. In embodiments, L 104 is substituted or unsubstituted 2 to 4 membered heteroalkylene. In embodiments, L 104 is unsubstituted Ci-Cs alkylene. In embodiments, L 104 is unsubstituted 2 to 8 membered heteroalkylene.
  • L 104 is a bond, -0-, -NH-, -S-, -S(0) 2 -, -C(O)-, -NHC(O)-,
  • R 104 -substituted or unsubstituted alkylene e.g., Ci-Cs, C1-C6, or C1-C4
  • R 104 -substituted or unsubstituted heteroalkylene e.g., 2 to 8 membered, 2 to 6 membered, or 2 to 4 membered.
  • L 104 is a bond, -S(0) 2 -, -C(O)-, -NHC(O)-, -0C(0)-, R 104 - substituted or unsubstituted alkylene (e.g., C i-Cx, C1-C6, or C1-C4), or R 104 -substituted or unsubstituted heteroalkylene (e.g., 2 to 8 membered, 2 to 6 membered, or 2 to 4 membered).
  • alkylene e.g., C i-Cx, C1-C6, or C1-C4
  • R 104 -substituted or unsubstituted heteroalkylene e.g., 2 to 8 membered, 2 to 6 membered, or 2 to 4 membered.
  • R 104 is independently oxo, halogen, -CCI3, -CBr3, -CF3, -CI3, -CH2CI, -CHiBr,
  • substituted or unsubstituted aryl e.g., C6-C10 or phenyl
  • substituted or unsubstituted heteroaryl e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • R 104 is independently oxo, halogen, -CCI 3 , -CBn, -CF 3 , -CI 3 , -CH 2 CI, -CH 2 Br, -CH 2 F, -CH 2 I, -CHCI 2 , -CHBr 2 , -CHF 2 , -CHI 2 , -CN, -OH, -NH 2 , -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC(0)NHNH 2 , -NHC(0)NH 2 , -NHSO 2 H, -NHC(0)H, -NHC(0)OH, -NHC(NH)H, -NHC(NH)NH 2 ,
  • R 114 -substituted or unsubstituted alkyl e.g., Ci-Cs, C1-C6, or Ci- C4
  • R 114 -substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, or 2 to 4 membered
  • R 114 -substituted or unsubstituted cycloalkyl e.g., C 3 -C 8 , C 3 -C 6 , or C 5 -C 6
  • R 114 -substituted or unsubstituted heterocycloalkyl e.g., 3 to 8 member
  • R 114 is independently oxo, halogen, -CCI 3 , -CBn, -CF 3 , -CI 3 , -CH 2 CI, -CHiBr,
  • L 105 is a bond, -0-, -NH-, -S-, -S(0) 2 -, -C(O)-, -NHC(O)-, -C(0)NH-, -OC(O)-, -C(0)0-, substituted or unsubstituted alkylene (e.g., Ci-Cs, C 1 -C 6 , or C 1 -C 4 ), substituted or unsubstituted heteroalkyl ene (e.g., 2 to 8 membered, 2 to 6 membered, or 2 to 4 membered), substituted or unsubstituted cycloalkylene (e.g., C 3 -C 8 , C 3 -C 6 , or C 5 - C 6 ), or substituted or unsubstituted heterocycloalkylene (e.g., 3 to 8 membered, 3 to 6 membered, or 5 to 6 membered).
  • L 105 is a bond, -0-, -NH-, -S-, -S(0) 2 -, -C(O)-, -NHC(O)-, -C(0)NH-, -OC(O)-, -C(0)0-, substituted or unsubstituted alkylene (e.g., Ci-Cs, C1-C 6 , or C 1 -C 4 ), substituted or unsubstituted heteroalkyl ene (e.g., 2 to 8 membered, 2 to 6 membered, or 2 to 4 membered), substituted or unsubstituted cycloalkylene (e.g., C 3 -C 8 , C 3 -C 6 , or C 5 - C 6 ), or substituted or unsubstituted heterocycloalkylene (e.g., 3 to 8 membered, 3 to 6 membered, or 5 to 6 membered).
  • L 105 is a bond. In embodiments, L 105 is -0-. In embodiments, L 105 is -NH-. In embodiments, L 105 is -S-. In embodiments, L 105 is -S(0) 2 -. In embodiments, L 105 is -C(O)-. In embodiments, L 105 is -NHC(O)-. In embodiments, L 105 is -C(0)NH-. In embodiments, L 105 is -OC(O)-. In embodiments, L 105 is -C(0)0-. In embodiments, L 105 is substituted or unsubstituted Ci-Cx alkylene.
  • L 105 is substituted or unsubstituted C 1 -C 6 alkylene. In embodiments, L 105 is substituted or unsubstituted C 1 -C 4 alkylene. In embodiments, L 105 is substituted or unsubstituted 2 to 8 membered hetereoalkylene. In embodiments, L 105 is substituted or unsubstituted 2 to 6 membered heteroalkylene. In embodiments, L 105 is substituted or unsubstituted 2 to 4 membered heteroalkylene. In embodiments, L 105 is substituted or unsubstituted C 3 -C 8 cycloalkylene.
  • L 105 is substituted or unsubstituted C 3 - C 6 cycloalkylene. In embodiments, L 105 is substituted or unsubstituted C5-C6 cycloalkylene. In embodiments, L 105 is substituted or unsubstituted 3 to 8 membered heterocycloalkylene.
  • L 105 is substituted or unsubstituted 3 to 6 membered heterocycloalkylene.
  • L 105 is substituted or unsubstituted 5 to 6 membered heterocycloalkylene.
  • L 105 is unsubstituted Ci-Cs alkylene. In embodiments, L 105 is unsubstituted 2 to 8 membered hetereoalkylene. In embodiments, L 105 is unsubstituted C3-C8 cycloalkylene. In embodiments, L 105 is unsubstituted 3 to 8 membered heterocycloalkylene.
  • L 105 is a bond, substituted or unsubstituted alkylene (e.g., Ci-Cs, C 1 -C 6 , or C 1 -C 4 ), substituted or unsubstituted heteroalkylene (e.g., 2 to 8 membered, 2 to 6 membered, or 2 to 4 membered), substituted or unsubstituted cycloalkylene (e.g., C 3 -C 8 , C 3 - C 6 , or C 5 -C 6 ), or substituted or unsubstituted heterocycloalkylene (e.g., 3 to 8 membered, 3 to 6 membered, or 5 to 6 membered).
  • substituted or unsubstituted alkylene e.g., Ci-Cs, C 1 -C 6 , or C 1 -C 4
  • substituted or unsubstituted heteroalkylene e.g., 2 to 8 membered, 2 to 6 membered,
  • L 105 is a bond. In embodiments, L 105 is substituted or unsubstituted Ci-Cs alkylene. In embodiments, L 105 is substituted or unsubstituted C 1 -C 6 alkylene. In embodiments, L 105 is substituted or unsubstituted C 1 -C 4 alkylene. In embodiments, L 105 is substituted or unsubstituted 2 to 8 membered
  • L 105 is substituted or unsubstituted 2 to 6 membered heteroalkylene. In embodiments, L 105 is substituted or unsubstituted 2 to 4 membered heteroalkylene. In embodiments, L 105 is substituted or unsubstituted C 3 -C 8 cycloalkylene. In embodiments, L 105 is substituted or unsubstituted C 3 -C 6 cycloalkylene. In embodiments, L 105 is substituted or unsubstituted C 5 -C 6 cycloalkylene. In embodiments, L 105 is substituted or unsubstituted 3 to 8 membered heterocycloalkylene.
  • L 105 is substituted or unsubstituted 3 to 6 membered heterocycloalkylene. In embodiments, L 105 is substituted or unsubstituted 5 to 6 membered heterocycloalkylene. In embodiments, L 105 is unsubstituted Ci-Ce alkylene. In embodiments, L 105 is unsubstituted 2 to 8 membered hetereoalkylene. In embodiments, L 105 is unsubstituted C 3 -C 8 cycloalkylene. In embodiments, L 105 is unsubstituted 3 to 8 membered heterocycloalkylene.
  • L 105 is an unsubstituted alkylene. In embodiments, L 105 is an unsubstituted C 1 -C 4 alkylene. In embodiments, L 105 is In embodiments, L 105 is
  • L 105 is a bond, -0-, -NH-, -S-, -S(0) 2 -, -C(O)-, -NHC(O)-,
  • R 105 -substituted or unsubstituted alkylene e.g., Ci-Cs, C 1 -C 6 , or C 1 -C 4
  • R 105 -substituted or unsubstituted heteroalkylene e.g., 2 to 8 membered, 2 to 6 membered, or 2 to 4 membered
  • R 105 -substituted or unsubstituted cycloalkylene e.g., C 3 -C 8 , C 3 -C 6 , or C 5 -C 6
  • R 105 -substituted or unsubstituted heterocycloalkylene e.g., 3 to 8 membered, 3 to 6 membered, or 5 to 6 membered.
  • L 105 is a bond, R 105 -substituted or unsubstituted alkylene (e.g., Ci- Cs, C 1 -C 6 , or C 1 -C 4 ), R 105 -substituted or unsubstituted heteroalkylene (e.g., 2 to 8 membered, 2 to 6 membered, or 2 to 4 membered), R 105 -substituted or unsubstituted cycloalkylene (e.g., C3-C8, C3-C6, or C5-C6), or R 105 -substituted or unsubstituted heterocycloalkylene (e.g., 3 to 8 membered, 3 to 6 membered, or 5 to 6 membered).
  • R 105 -substituted or unsubstituted alkylene e.g., Ci- Cs, C 1 -C 6 , or C 1 -C 4
  • R 105 is independently oxo, halogen, -CCI 3 , -CBn, -CF 3 , -CI 3 , -CH 2 CI, -CHiBr,
  • substituted or unsubstituted aryl e.g., C 6 -C 10 or phenyl
  • substituted or unsubstituted heteroaryl e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • R 105 is independently oxo, halogen, -CCI3, -CBn, -CF3, -CI3, -CH2CI, -CH 2 Br, -CH 2 F, -CH 2 I, -CHCI2, -CHBr 2 , -CHF 2 , -CHI 2 , -CN, -OH, -NH 2 , -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC(0)NHNH 2 , -NHC(0)NH 2 , -NHSO2H, -NHC(0)H, -NHC(0)OH, -NHC(NH)H, -NHC(NH)NH 2 ,
  • R 115 -substituted or unsubstituted alkyl e.g., Ci-Cs, C1-C6, or Ci- C4
  • R 115 -substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, or 2 to 4 membered
  • R 115 -substituted or unsubstituted cycloalkyl e.g., C 3 -C 8 , C 3 -C 6 , or C 5 -C 6
  • R 115 -substituted or unsubstituted heterocycloalkyl e.g., 3 to 8 member
  • R 115 is independently oxo, halogen, -CCI 3 , -CBn, -CF 3 , -CI 3 , -CH 2 CI, -CHiBr,
  • W is N. In embodiments, W is CH.
  • substituted or unsubstituted alkyl e.g., Ci-Cx, C1-C6, or C1-C4
  • substituted or unsubstituted heteroalkyl e.g., 2 to 10 membered, 2 to 6 membered, or 2 to 4 membered
  • substituted or unsubstituted cycloalkyl e.g., C3-C8, C3-C6, or C5-C6
  • substituted or unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, or 5 to 6 membered
  • substituted or unsubstituted aryl e.g., C6-C10 or phenyl
  • R 1 is hydrogen, halogen, -CX , -CHX , -CH2X 1 , -OCX , -OCH2X 1 , -OCHX , -CN, -SOniR 1D , -SOviNR 1A R 1B , -NHC(0)NR 1A R 1B , -N(0) mi , -NR 1A R 1B , -C(0)R lc , -SC(0)R lc , -C(0)0R lc , -C(0)NR 1A R 1B , -OR 1D , -SR 1D , -SeR 1D , -NR 1A S0 2 R 1D , -NR 1A C(0)R 1C , -NR 1A C(0)0R 1c , -NR 1A OR 1c , -N 3J -SiR 1A R 1B R lc , -SP(0)(
  • R 1 is independently -C(0)R lc .
  • R 1 is independently -SC(0)R lc .
  • R 1C is independently hydrogen, halogen, -CCI3, -CBn, -CF3, -CI3, -CH 2 C1, -CH 2 Br, -CH 2 F, -CH 2 I, -CHC1 2 , -CHBr 2 , -CHF 2 , -CHI 2 , -CN, -OH, -NH 2 , -COOH, -COMB, -N0 2 , -SH, -SO3H, -SO4H, -S0 2 MI 2 , -MIMI 2 , -0MI 2 , -MIC(0)MIMI 2 , -MIC(0)MI 2 , -MIS0 2 H, -MIC(0)H, -MIC(0)OH, -MIOH, -OCCI3, -OCBr , -OCF3, -OCI3, -OCH 2 Cl, -OCH 2 Br, -OCH 2 F, -OCH 2 I, -OCO
  • R 1C is independently hydrogen, halogen, -CCI3, -CBn, -CF3, -CI3, -CH 2 C1, -CH 2 Br, -CH 2 F, -CH 2 I, -CHCb, -CHBr 2 , -CHF 2 , -CHI 2 , -CN, -OH, -NH 2 , -COOH, -C0NH 2 , -N0 2 , -SH, -SO3H, -SO4H, -S0 2 NH 2 , -NHNH 2 , -0NH 2 , -NHC(0)NHNH 2 , -NHC(0)NH 2 , -NHS0 2 H, -NHC(0)H, -NHC(0)0H, -MIOH, -OCCI3, -OCBr , -OCF3, -OCI3, -OCH 2 Cl, -OCH 2 Br, -OCH 2 F, -
  • R 1C is independently substituted or unsubstituted C 1 -C 4 alkyl. In embodiments, R 1C is independently unsubstituted C 1 -C 4 alkyl. In embodiments, R 1C is independently unsubstituted methyl. In embodiments, R 1C is independently unsubstituted ethyl. In embodiments, R 1C is independently unsubstituted propyl. In embodiments, R 1C is independently unsubstituted n-propyl. In embodiments, R 1C is independently unsubstituted isopropyl. In embodiments, R 1C is independently unsubstituted butyl. In embodiments, R 1C is independently unsubstituted n-butyl. In embodiments, R 1C is independently unsubstituted tert-butyl.
  • R 1C is independently substituted or unsubstituted aryl. In embodiments, R 1C is independently R 10 -substituted or unsubstituted aryl. In embodiments, R 1C is independently R 10 -substituted or unsubstituted phenyl. In embodiments, R 1C is independently unsubstituted phenyl.
  • R 1 is independently -C(0)R lc , and R 1C is as described herein, including in embodiments. In embodiments, R 1 is independently -C(0)OH. In
  • R 1 is independently -C(0)NH 2 .
  • R 1 is -SSR 1D .
  • R 1D is independently hydrogen, halogen, -CCb, -CBn, -CF 3 , -CI 3 , -CH 2 CI, -CH 2 Br, -CH 2 F, -CH 2 I, -CHCI 2 , -CHBr 2 , -CHF 2 , -CHI 2 , -CN, -OH, -NH 2 , -COOH, -COMB, -NO2, -SH, -SO3H, -SO4H, -S0 2 Ml2, -MIMI2, -OMI 2 , -MIC(0)MIMl2, -MIC(0)Ml 2 , -MIS0 2 H, -MIC(0)H, -MIC(0)OH, -MIOH, -OCCI 3 , -OCBr , -OCF 3 , -OCI3, -OCH2CI, -OCH 2 Br, -OCH2F, -OCH2I,
  • R 1D is independently hydrogen, halogen, -CCI 3 , -CBn, -CF 3 , -CI 3 , -CH2CI, -CH 2 Br, -CH 2 F, -CH2I, -CHCI2, -CHBr 2 , -CHF 2 , -CHI 2 , -CN, -OH, -NH 2 , -COOH, -COMB, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC(0)NHNH2, -NHC(0)NH 2 , -NHSO 2 H, -NHC(0)H, -NHC(0)OH, -NHOH, -OCCI 3 , -OCBr , -OCF 3 , -OCI3, -OCH2CI, -OCH 2 Br, -OCH2F, -OCH2I, -OCHC
  • R 1D is independently substituted or unsubstituted alkyl. In embodiments, R 1D is independently R 10 -substituted or unsubstituted alkyl. In embodiments, R 1D is independently R 10 -substituted or unsubstituted C 1 -C 16 alkyl. In embodiments, R 1D independently unsubstituted C 1 -C 16 alkyl.
  • R 1 is -SR 1D , -NR 1A R 1B , -OR 1D , E, unsubstituted alkyl, substituted or unsubstituted phenyl, or substituted or unsubstituted 5 to 6 membered heteroaryl;
  • R 1A is independently hydrogen or unsubstituted C1-C4 alkyl;
  • R 1B is independently hydrogen or unsubstituted C1-C4 alkyl;
  • R 1D is independently hydrogen, halogen, -CCI3, -CBr3, -CF3, -CI3, -CH2CI, -CH 2 Br, -CH 2 F, -CH 2 I, -CHC1 2 , -CHBr 2 , -CHF 2 , -CHI 2 , -CN, -OH, -NH 3 ⁇ 4 -COOH, -COME, -NO 3 ⁇ 4 -SH, -SO3H, -S0 4 H
  • -MIC(0)MIMI 2 -MIC(0)MI 2 , -MIC(0)MI 2 , -MIS0 2 H, -NHC(0)H, -MIC(0)OH, -MIOH, -OCCI3, -OCBr , -OCF3, -OCI3, -OCH 2 Cl, -OCH 2 Br, -OCH 2 F, -OCH 2 I, -OCHCh, -OCHBr 2 , -OCHF 2 , -OCHI 2 , -N3, -P0 3 H 2 , or substituted or unsubstituted alkyl (e.g., Ci-Cx, C1-C6, or C1-C4).
  • substituted or unsubstituted alkyl e.g., Ci-Cx, C1-C6, or C1-C4
  • R 1 is -SR 1D , -1S[R 1A R 1B , -OR 1D , E, unsubstituted alkyl, substituted or unsubstituted phenyl, or substituted or unsubstituted 5 to 6 membered heteroaryl.
  • R 1A is independently hydrogen or unsubstituted C 1 -C 4 alkyl.
  • R 1B is independently hydrogen or unsubstituted C 1 -C 4 alkyl.
  • R 1D is independently hydrogen, halogen, -CCI 3 , -CBr 3 , -CF 3 , -CI 3 , -CH 2 C1, -CH 2 Br, -CH 2 F, -CH 2 I, -CHCE, -CHBr 2 , -CHF 2 , -CHI 2 , -CN, -OH, -NH 2 , -COOH, -CONH 2 , -N0 2 , -SH, -SO 3 H, -SO 4 H, -S0 2 NH 2 , -NHNH 2 , -0NH 2 , -NHC(0)NHNH 2 , -NHC(0)NH 2 , -NHSO 2 H,
  • R 1 is -SR 1D , -NR 1A R 1B , -OR 1D , E, unsubstituted C 1 -C 4 alkyl, R 10 - substituted or unsubstituted phenyl, or R 10 -substituted or unsubstituted 5 to 6 membered heteroaryl;
  • R 1A is independently hydrogen or unsubstituted C 1 -C 4 alkyl;
  • R 1B is independently hydrogen or unsubstituted C 1 -C 4 alkyl;
  • R 1D is independently hydrogen, halogen, -CCI 3 , -CBr 3 , -CF 3 , -CI 3 , -CH 2 C1, -CH 2 Br, -CH 2 F, -CH 2 I, -CHCb, -CHBr 2 , -CHF 2 , -CHI 2 , -CN,
  • R 1 is -SR 1D , -NR 1A R 1B , -OR 1D , E, unsubstituted C 1 -C 4 alkyl, R 10 - substituted or unsubstituted phenyl, or R 10 -substituted or unsubstituted 5 to 6 membered heteroaryl.
  • R 1A is independently hydrogen or unsubstituted C 1 -C 4 alkyl.
  • R 1B is independently hydrogen or unsubstituted C 1 -C 4 alkyl.
  • R 1D is independently hydrogen, halogen, -CCI3, -CBr3, -CF3, -CI3, -CH2CI, -QHhBr, -CH2F, -CH2I, -CHCI2, -CHBr 2 , -CHF 2 , -CHI2, -CN, -OH, -NH 2 , -COOH, -CONH2, -NO2, -SH, -SO 3 H, -SO 4 H, -SO 2 NH 2 , -NHNH 2 , -ONH 2 , -NHC(0)NHNH 2 , -NHC(0)NH 2 , -NHSO 2 H, -NHC(0)H, -NHC(0)OH, -NHOH, -OCCI 3 , -OCBr , -OCF 3 , -OCI 3 , -OCH 2 CI, -OCH 2 Br, -OCH2F, -OCH2I, -
  • R 10 is independently oxo, halogen, -CCI 3 , -CBn, -CF 3 , -CI 3 , -CH 2 CI, -CH 2 Br,
  • substituted or unsubstituted alkyl e.g., Ci-Cx, C 1 -C 6 , or C 1 -C 4
  • substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, or 2 to 4 membered
  • substituted or unsubstituted cycloalkyl e.g., C 3 -C 8 , C 3 -C 6 , or C 5 -C 6
  • substituted or unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, or 5 to 6 membered
  • substituted or unsubstituted aryl e.g., C 6 -C 10 or phenyl
  • substituted or unsubstituted alkyl e.g., Ci-Cx, C 1 -C 6 , or C 1 -C 4
  • R 1 is -SR 1D or R 10 -substituted phenyl; R 1D is independently hydrogen, halogen, -CCI3, -CBr , -CF 3 , -CI3, -CH2CI, -CH 2 Br, -CH 2 F, -CH 2 I, -CHCI2,
  • R 1 is -SR 1D or R 10 -substituted phenyl.
  • R 1D is independently hydrogen, halogen, -CCI 3 , -CBr 3 , -CF 3 , -CI 3 , -CH 2 CI, -CHiBr, -CH 2 F, -CH 2 I, -CHCI2, -CHBr 2 , -CHF 2 , -CHI2, -CN, -OH, -NH 2 , -COOH, -CONH2, -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC(0)NHNH 2 , -NHC(0)NH 2 , -NHSO2H,
  • R 10 -substituted or unsubstituted C 1 -C 4 alkyl.
  • R 10 is independently oxo, halogen, -CCI 3 ,
  • -CBr 3 -CF3, -CI3, -CH2CI, -CH 2 Br, -CH 2 F, -CH 2 I, -CHCh, -CHBr 2 , -CHF 2 , -CHI 2 , -OCCI3, -OCBr , -OCF3, -OCI3, -OCH2CI, -OCH 2 Br, -OCH 2 F, -OCH 2 I, -OCHCI2, -OCHBr 2 , -OCHF2, -OCHI 2 , -CN, -OH, -NH 2 , -COOH, -CONH 2 , -NO 2 , -SH, -SO 3 H, -S0 4 H, -SO 2 NH 2 ,
  • R 1 is -SH, -SC(0)CH 3 , or -SSCH3. In embodiments, R 1 is -SH.
  • R 1 is -SC(0)CH 3. In embodiments, R 1 is -SSCH3.
  • R 1 is independently halogen, -NO2, -SH, -SeH, -SO3H,
  • R 10 is as described herein, including in
  • R 1 is independently -F. In embodiments, R 1 is
  • R 1 independently -Cl. In embodiments, R 1 is independently -Br. In embodiments, R 1 is independently -I. In embodiments, R 1 is independently -NO2. In embodiments, R 1 is independently -SH. In embodiments, R 1 is independently -SeH. In embodiments, R 1 is independently -SO3H. In embodiments, R 1 is independently -SC(0)CH3. In embodiments, R 1 is independently -SSCH3. In embodiments, R 1 is independently -SP(0)(OH) 2. In embodiments, R 1 is independently an R 10 -substituted or unsubstituted heteroalkyl. In embodiments, R 1 is independently an R 10 -substituted or unsubstituted 2 to 20 membered heteroalkyl.
  • R 1 is independently an R 10 -substituted 2 to 20 membered heteroalkyl. In embodiments, R 1 is independently an unsubstituted 2 to 20 membered heteroalkyl. In embodiments, R 1 is independently -S-(Ci-C 2 o alkyl). In embodiments, R 1 is independently -SCH 3 . In embodiments, R 1 is independently -S(0) 2 CH 3 . In embodiments,
  • R 1 is independently , wherein m is independently an integer from 0 to 4. In embodiments, R 1 is independently . In embodiments, R 1 is independently -Si(CH3)3. In embodiments, R 1 is independently
  • R 1 is independently -Si(CH2CH2CH3)3. In embodiments, R 1 is independently -Si(CH(CH3)2)3. In embodiments, R 1 is independently
  • R 1 is independently -Si(C(CH3)3)3.
  • R 1 is independently an R 10 -substituted or unsubstituted heteroaryl. In embodiments, R 1 is independently an R 10 -substituted or unsubstituted 5 to 10 membered heteroaryl. In embodiments, R 1 is independently an unsubstituted 5 to 10 membered heteroaryl. In embodiments, R 1 is independently an unsubstituted thiophenyl. In embodiments, R 1 is independently an unsubstituted furanyl. In embodiments, R 1 is independently an unsubstituted pyrrolyl. In embodiments, R 1 is independently an unsubstituted imidazolyl. In embodiments, R 1 is independently an unsubstituted tetrazolyl.
  • R 1 is independently In embodiments, R 1 is independently In embodiments, R 1 is independently
  • R 1 is R 10 -substituted phenyl, and R 10 is independently halogen.
  • R 1 is , wherein R 10 1 and R 10 2 may each independently be hydrogen or any value of R 10 as described herein, including in embodiments.
  • R 10 1 and R 10 2 are each independently halogen.
  • R 1 is
  • R 1 is independently an R 10 -substituted or unsubstituted 2 to 8 membered heteroalkyl, and R 10 is as described herein, including in embodiments.
  • R 1 is independently an R 10 -substituted 2 to 8 membered heteroalkyl, and R 10 is independently oxo.
  • R 1 is independently -NHC(O)-(R 10 -substituted or unsubstituted C1-C4 alkyl).
  • R 1 is independently -NHC(O)-(R 10 -substituted C1-C4 alkyl).
  • R 1 is independently -NHC(0)-(unsubstituted C1-C4 alkyl).
  • R 1 is independently O . In embodiments, R 1 is independently
  • R 1 is independently O . In embodiments, R 1 is
  • R 1 is independently -NHS(0) 2 -(unsubstituted
  • R 1 is independently O
  • R 1 is E.
  • R 16 is independently hydrogen, halogen, -CX 16 3 , -CHX 16 2, -CH2X 16 , -CN,
  • -OCHX 16 2, -OCH2X 16 substituted or unsubstituted alkyl (e.g., Ci-Cs, C1-C6, C1-C4, or C1-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6-C10 or phenyl), or substituted or unsubstituted heteroaryl (e.
  • R 17 is independently hydrogen, halogen, -CX 17 3 , -CHX 17 2, -CH2X 17 , -CN,
  • R 18 is independently hydrogen, halogen, -CX 18 3 , -CHX 18 2, -CH2X 18 , -CN,
  • R 19 is independently hydrogen, halogen, -CX 19 3 , -CHX 19 2, -CH2X 19 , -CN,
  • substituted or unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • substituted or unsubstituted aryl e.g., C6-C10 or phenyl
  • substituted or unsubstituted heteroaryl e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • R 16A , R 16B , R 17A , R 17B , R 18A , R 18B , R 19A , and R 19B are independently hydrogen, -CX3,
  • substituted or unsubstituted alkyl e.g., Ci-Cx, C1-C6, C1-C4, or C1-C2
  • substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • substituted or unsubstituted cycloalkyl e.g., C3-C8, C3-C6, C4-C6, or C5-C6
  • substituted or unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered
  • substituted or unsubstituted aryl e.g., C6-C10 or phenyl
  • X, X 16 , X 17 , X 18 , and X 19 are independently -F, -Cl, -Br, or -I.
  • nl6, nl7, nl8, and nl9 are independently an integer from 0 to 4.
  • ml6, ml7, ml8, ml9, vl6, vl7, vl8, and vl9 are independently 1 or 2.
  • R 16 is independently hydrogen, halogen, -CX 16 3 , -CHX 16 2, -CH2X 16 , -CN, -SOni 6 R 16A , -SOvi 6 NR 16A R 16B , -NHNR 16A R 16B , -0NR 16A R 16B ,
  • a substituted R 16 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 16 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 16 when R 16 is substituted, it is substituted with at least one substituent group.
  • R 16 when R 16 is substituted, it is substituted with at least one size-limited substituent group.
  • R 16 when R 16 is substituted, it is substituted with at least one lower substituent group.
  • R 16 is independently hydrogen, halogen, -CCI3, -CBr3, -CF3, -CI3, -CH2CI, -CH 2 Br, -CH 2 F, -CH 2 I, -CHC1 2 , -CHBr 2 , -CHF 2 , -CHI 2 , -CN, -OH, -NH 2 , -COOH, -COMB, -N0 2 , -SH, -SO3H, -SO4H, -S0 2 MI 2 , -NHNIB, -0MB, -MIC(0)MIMB, -MIC(0)MB, -NHSO2H, -MIC(0)H, -MIC(0)OH, -MIOH, -OCCI3, -OCBr , -OCF3, -OCI3, -OOBCl, -OOBBr, -OOBF, -OCH 2 I, -OCHCB, -OCHBr 2 ,
  • a substituted R 17 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 17 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 17 when R 17 is substituted, it is substituted with at least one substituent group.
  • R 17 when R 17 is substituted, it is substituted with at least one size-limited substituent group.
  • R 17 when R 17 is substituted, it is substituted with at least one lower substituent group.
  • R 17 is independently hydrogen, halogen, -CCI3, -CBr3, -CF3, -CI3, -CHiCl, -CH 2 Br, -CH 2 F, -CH 2 I, -CHC1 2 , -CHBr 2 , -CHF 2 , -CHI 2 , -CN, -OH, -NH 2 , -COOH, -COMB, -N0 2 , -SH, -SO3H, -SO4H, -S0 2 NH 2 , -NHNH 2 , -0NH 2 , -NHC(0)NHNH 2 , -NHC(0)NH 2 , -NHSO2H, -NHC(0)H, -NHC(0)0H, -NHOH, -OCCI3, -OCBr 3 , -OCF3, -OCI3, -OCH2CI, -OCH2B1-, -OCH2F,
  • R 18 is independently hydrogen, halogen, -CX 18 3 , -CHX 18 2,
  • a substituted R 18 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 18 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 18 when R 18 is substituted, it is substituted with at least one substituent group.
  • R 18 when R 18 is substituted, it is substituted with at least one size-limited substituent group.
  • R 18 when R 18 is substituted, it is substituted with at least one lower substituent group.
  • R 18 is independently hydrogen, halogen, -CCb, -CBr3, -CF3, -CI3, -CH2CI, -CH 2 Br, -CH 2 F, -CH 2 I, -CHC1 2 , -CHBr 2 , -CHF 2 , -CHI 2 , -CN, -OH, -NH 2 , -COOH, -COMB, -N0 2 , -SH, -SO3H, -SO4H, -S0 2 MI 2 , -NHMB, -0MI 2 , -MIC(0)MIMI 2 , -MIC(0)MB, -NHSO2H, -MIC(0)H, -MIC(0)OH, -MIOH, -OCCI3, -OCBr , -OCF3, -OCI3, -OOBCl, -OOBBr, -OCH 2 F, -OCH 2 I, -OCHCB, -OCHB
  • R 19 is independently hydrogen, halogen, -CX 19 3 , -CHX 19 2 , -OBX 19 , -CN, -SO ni9 R 19A , -SO vi9 NR 19A R 19B , -NHNR 19A R 19B , -0NR 19A R 19B ,
  • a substituted R 19 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 19 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 19 when R 19 is substituted, it is substituted with at least one substituent group.
  • R 19 when R 19 is substituted, it is substituted with at least one size-limited substituent group.
  • R 19 when R 19 is substituted, it is substituted with at least one lower substituent group.
  • R 19 is independently hydrogen, halogen, -CCI3, -CBr3, -CF3, -CI3, -CH2CI, -CH 2 Br, -CH 2 F, -CH 2 I, -CHC1 2 , -CHBr 2 , -CHF 2 , -CHI 2 , -CN, -OH, -NH 2 , -COOH, -COMB, -N0 2 , -SH, -SO3H, -SO4H, -S0 2 MI 2 , -NHMB, -0MB, -MIC(0)MIMB, -MIC(0)MB, -NHSO2H, -MIC(0)H, -MIC(0)OH, -MIOH, -OCCI3, -OCBr , -OCF3, -OCI3, -OOBCl, -OOBBr, -OOBF, -OCH 2 I, -OCHCB, -OCHBr 2 , -
  • R 16A is independently hydrogen, -CX 3 , -CHX 2 , -CH 2 X, -CN, -OH, -COOH, -COMB, substituted (e.g., substituted with at least one substituent group, size- limited substituent group, or lower substituent group) or unsubstituted alkyl (e.g., Ci-Cs, Ci- C 6 , C 1 -C 4 , or Ci-C 2 ), substituted (e.g., substituted with at least one substituent group, size- limited substituent group, or lower substituent group) or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted cycloalkyl
  • substituted e.
  • a substituted R 16A (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 16A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 16A when R 16A is substituted, it is substituted with at least one substituent group.
  • R 16A when R 16A is substituted, it is substituted with at least one size-limited substituent group.
  • R 16A when R 16A is substituted, it is substituted with at least one lower substituent group.
  • R 16B is independently hydrogen, -CX 3 , -CHX 2 , -CH 2 X, -CN, -OH, -COOH, -CONH 2 , substituted (e.g., substituted with at least one substituent group, size- limited substituent group, or lower substituent group) or unsubstituted alkyl (e.g., Ci-Cs, Ci- C 6 , C 1 -C 4 , or C 1 -C 2 ), substituted (e.g., substituted with at least one substituent group, size- limited substituent group, or lower substituent group) or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted cycl
  • a substituted R 16B (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 16B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 16B when R 16B is substituted, it is substituted with at least one substituent group.
  • R 16B when R 16B is substituted, it is substituted with at least one size-limited substituent group.
  • R 16B when R 16B is substituted, it is substituted with at least one lower substituent group.
  • R 16A and R 16B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heterocycloalkyl or substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroaryl.
  • a substituted moiety formed by joining R 16A and R 16B substituents bonded to the same nitrogen atom is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted moiety formed by joining R 16A and R 16B substituents bonded to the same nitrogen atom is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 17A is independently hydrogen, -CX 3 , -CHX 2 , -CH 2 X, -CN, -OH, -COOH, -CONH 2 , substituted (e.g., substituted with at least one substituent group, size- limited substituent group, or lower substituent group) or unsubstituted alkyl (e.g., Ci-Cs, Ci- C 6 , C 1 -C 4 , or C 1 -C 2 ), substituted (e.g., substituted with at least one substituent group, size- limited substituent group, or lower substituent group) or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted cycl
  • a substituted R 17A (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 17A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 17A when R 17A is substituted, it is substituted with at least one substituent group.
  • R 17A when R 17A is substituted, it is substituted with at least one size-limited substituent group.
  • R 17A when R 17A is substituted, it is substituted with at least one lower substituent group.
  • R 17B is independently hydrogen, -CX 3 , -CHX 2 , -CH 2 X, -CN, -OH, -COOH, -CONH 2 , substituted (e.g., substituted with at least one substituent group, size- limited substituent group, or lower substituent group) or unsubstituted alkyl (e.g., Ci-Cs, Ci- C 6 , C 1 -C 4 , or C 1 -C 2 ), substituted (e.g., substituted with at least one substituent group, size- limited substituent group, or lower substituent group) or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted cycl
  • a substituted R 17B (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 17B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 17B when R 17B is substituted, it is substituted with at least one substituent group.
  • R 17B when R 17B is substituted, it is substituted with at least one size-limited substituent group.
  • R 17B when R 17B is substituted, it is substituted with at least one lower substituent group.
  • R 17A and R 17B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heterocycloalkyl or substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroaryl.
  • a substituted moiety formed by joining R 17A and R 17B substituents bonded to the same nitrogen atom is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted moiety formed by joining R 17A and R 17B substituents bonded to the same nitrogen atom is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 17A and R 17B substituents bonded to the same nitrogen atom e.g., substituted heterocycloalkyl and/or substituted heteroaryl
  • the substituted moiety formed by joining R 17A and R 17B substituents bonded to the same nitrogen atom is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may
  • R 17B substituents bonded to the same nitrogen atom is substituted, it is substituted with at least one substituent group.
  • R 17A and R 17B when the moiety formed by joining R 17A and
  • R 17B substituents bonded to the same nitrogen atom is substituted, it is substituted with at least one size-limited substituent group.
  • R 17A and R 17B substituents bonded to the same nitrogen atom when the moiety formed by joining R 17A and R 17B substituents bonded to the same nitrogen atom is substituted, it is substituted with at least one lower substituent group.
  • R 18A is independently hydrogen, -CX 3 , -CHX 2 , -CH 2 X, -CN, -OH, -COOH, -CONH 2 , substituted (e.g., substituted with at least one substituent group, size- limited substituent group, or lower substituent group) or unsubstituted alkyl (e.g., Ci-Cs, Ci- C6, C 1 -C 4 , or C 1 -C 2 ), substituted (e.g., substituted with at least one substituent group, size- limited substituent group, or lower substituent group) or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted cycloalkyl (e.g.
  • a substituted R 18A (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 18A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 18A when R 18A is substituted, it is substituted with at least one substituent group.
  • R 18A when R 18A is substituted, it is substituted with at least one size-limited substituent group.
  • R 18A when R 18A is substituted, it is substituted with at least one lower substituent group.
  • R 18B is independently hydrogen, -CX 3 , -CHX 2 , -CH 2 X, -CN, -OH, -COOH, -CONH 2 , substituted (e.g., substituted with at least one substituent group, size- limited substituent group, or lower substituent group) or unsubstituted alkyl (e.g., Ci-Cs, Ci- C6, C 1 -C 4 , or C 1 -C 2 ), substituted (e.g., substituted with at least one substituent group, size- limited substituent group, or lower substituent group) or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted cycloalkyl (e.g.
  • a substituted R 18B (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 18B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 18B when R 18B is substituted, it is substituted with at least one substituent group.
  • R 18B when R 18B is substituted, it is substituted with at least one size-limited substituent group.
  • R 18B when R 18B is substituted, it is substituted with at least one lower substituent group.
  • R 18A and R 18B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heterocycloalkyl or substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroaryl.
  • a substituted moiety formed by joining R 18A and R 18B substituents bonded to the same nitrogen atom is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted moiety formed by joining R 18A and R 18B substituents bonded to the same nitrogen atom is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 19A is independently hydrogen, -CX 3 , -CHX 2 , -CH 2 X, -CN, -OH, -COOH, -CONH 2 , substituted (e.g., substituted with at least one substituent group, size- limited substituent group, or lower substituent group) or unsubstituted alkyl (e.g., Ci-Cs, Ci- C 6 , C 1 -C 4 , or C 1 -C 2 ), substituted (e.g., substituted with at least one substituent group, size- limited substituent group, or lower substituent group) or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted cycl
  • a substituted R 19A (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 19A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 19A when R 19A is substituted, it is substituted with at least one substituent group.
  • R 19A when R 19A is substituted, it is substituted with at least one size-limited substituent group.
  • R 19A when R 19A is substituted, it is substituted with at least one lower substituent group.
  • R 19B is independently hydrogen, -CX 3 , -CHX 2 , -CH 2 X, -CN, -OH, -COOH, -CONH 2 , substituted (e.g., substituted with at least one substituent group, size- limited substituent group, or lower substituent group) or unsubstituted alkyl (e.g., Ci-Cs, Ci- C6, C 1 -C 4 , or C 1 -C 2 ), substituted (e.g., substituted with at least one substituent group, size- limited substituent group, or lower substituent group) or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted cycloalkyl (e.g.
  • a substituted R 19B (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 19B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 19B when R 19B is substituted, it is substituted with at least one substituent group.
  • R 19B when R 19B is substituted, it is substituted with at least one size-limited substituent group.
  • R 19B when R 19B is substituted, it is substituted with at least one lower substituent group.
  • R 19A and R 19B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heterocycloalkyl or substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroaryl.
  • a substituted moiety formed by joining R 19A and R 19B substituents bonded to the same nitrogen atom is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted moiety formed by joining R 19A and R 19B substituents bonded to the same nitrogen atom is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different.
  • R 16A , R 16B , R 17A , R 17B , R 18A , R 18B , R 19A , and R 19B are
  • unsubstituted alkyl e.g, Ci-C 8 , Ci-Ce, C1-C4, or Ci-C 2
  • unsubstituted heteroalkyl e.g, 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered
  • unsubstituted cycloalkyl e.g, C3-C8, C3- C 6 , C4-C6, or C5-C6
  • unsubstituted heterocycloalkyl e.g, 3 to 8 membered, 3 to 6 member
  • E is .
  • E is . In embodiments, E i , .s n* -' . In embodiments, E is
  • the compound has the formula Ring A, R 1 , R 2 , L 103 , L 104 , L 105 and z2 are as described herein.
  • L 103 is a bond, substituted or unsubstituted alkylene, or substituted or unsubstituted heteroalkylene.
  • L 104 is a bond, -O-, -NH-, -S-, or substituted or unsubstituted alkylene.
  • L 105 is -S(0) 2 -, -C(0)-, -NHC(O)-, -C(0)NH-, -OC(O)-, or -C(0)0-.
  • L 105 is -S(0) 2 -, -C(O)-, -NHC(O)-, or -OC(O)-.
  • n is an integer from 0 to 4.
  • the compound has the formula are as described herein.
  • L 103 is a bond, substituted or unsubstituted C1-C6 alkylene, or substituted or unsubstituted 2 to 6 membered heteroalkylene
  • L 104 is a bond, -0-, -NH-, -S-, or substituted or unsubstituted C1-C4 alkylene
  • L 105 is -S(0)2-, -C(O)-, -NHC(O)-, or -OC(O)-
  • n is an integer from 0 to 4
  • R 2X and R 2Y are independently hydrogen, halogen, -CX 2 3 , -CHX 2 2 , -CH 2 X 2 , -OCX 2 3 , -OCH 2 X 2 , -OCHX 2 2 , -CN, -SO Rule2R 2D ,
  • substituted or unsubstituted alkyl e.g., Ci-Cx, C1-C6, or C1-C4
  • substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, or 2 to 4 membered
  • substituted or unsubstituted cycloalkyl e.g., C 3 -Cx, C 3 -C 6 , or C5-C6
  • substituted or unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, or 5 to 6 membered
  • substituted or unsubstituted aryl e.g., C6
  • R 2X and R 2Y substituents may be joined to form a substituted or unsubstituted cycloalkyl (e.g., C 3 -Cx, C 3 -C 6 , or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, or 5 to
  • substituted or unsubstituted aryl e.g., C6-C10 or phenyl
  • substituted or unsubstituted heteroaryl e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • L 103 is a bond, substituted or unsubstituted C1-C6 alkylene, or substituted or unsubstituted 2 to 6 membered heteroalkylene;
  • L 104 is a bond, -0-, -NH-, -S-, or substituted or unsubstituted C1-C4 alkylene;
  • L 105 is -S(0)2-, -C(O)-, -NHC(O)-, or -OC(O)-;
  • n is an integer from 0 to 4; and
  • R 2X and R 2Y are independently hydrogen, halogen, -CX 2 3 , -CHX 2 2 , -CH 2 X 2 , -OCX 2 3 , -OCH 2 X 2 , -OCHX 2 2 , -CN, -SO Rule2R 2D ,
  • R 20 -substi tuted or unsubstituted alkyl e.g., Ci-Cx, C 1 -C 6 , or C 1 -C 4
  • R 20 -substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, or 2 to 4 membered
  • R 20 - substituted or unsubstituted cycloalkyl e.g., C 3 -C 8 , C 3 -C 6 , or C 5 -C 6
  • R 20 -substituted or unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to
  • R 20 -substituted or unsubstituted aryl e.g., C 6 -C 10 or phenyl
  • R 20 -substituted or unsubstituted heteroaryl e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered
  • R 2X and R 2Y substituents may be joined to form an R 20 -substi tuted or unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , or C 5 -C 6 ), R 20 -substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, or 5 to 6 membered), R 20 -substituted or unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or R 20 -substi tuted
  • n is 0. In embodiments, n is 1. In embodiments, n is 2. In embodiments, n is 3. In embodiments, n is 4. In embodiments, when n is 0, L 104 and L 105 are not a bond.
  • R 2X and R 2Y are independently halogen. In embodiments, R 2X and R 2Y are independently -Cl.
  • L 103 is an unsubstituted alkyl ene. In embodiments, L 103 is an unsubstituted C 1 -C 6 alkylene. In embodiments, L 103 is an unsubstituted C 1 -C 4 alkylene. In embodiments, L 103 is a bond.
  • L 104 is a bond, -0-, -NH-, -S-, or substituted or unsubstituted alkylene (e.g., Ci-Cs, C1-C6, or C1-C4). In embodiments, L 104 is a bond. In embodiments, L 104 is -0-. In embodiments, L 104 is -NH-. In embodiments, L 104 is -S-. In embodiments,
  • L 104 is substituted or unsubstituted Ci-Cs alkylene. In embodiments, L 104 is substituted or unsubstituted C 1 -C 6 alkylene. In embodiments, L 104 is substituted or unsubstituted C 1 -C 4 alkylene. In embodiments, L 104 is unsubstituted Ci-Cs alkylene.
  • L 104 is a bond, -0-, -NH-, -S-, or R 104 -substituted or unsubstituted alkylene (e.g., Ci-Cs, C1-C6, or C1-C4).
  • R 104 is as described herein, including in
  • L 105 is -S(0) 2 -, -C(O)-, -NHC(O)-, or -OC(O)-. In embodiments, L 105 is -S(0) 2 -. In embodiments, L 105 is -C(O)-. In embodiments, L 105 is -NHC(O)-. In embodiments, L 105 is -OC(O)-. [0315] In embodiments, -L 1 -CH2-L 1 -NH-L 1 - is
  • R 1 is hydrogen, -SR 1D , -NR 1A R 1B , -OR 1D , -NR 1A S0 2 R 1D , -NR 1A C(0)R lc , E, substituted or unsubstituted C1-C6 alkyl, substituted or unsubstituted 2 to 10 membered heteroalkyl, substituted or unsubstituted C5-C6 cycloalkyl, substituted or unsubstituted 5 to 6 membered heterocycloalkyl, substituted or unsubstituted phenyl, or substituted or unsubstituted 5 to 6 membered heteroaryl; E is an electrophilic moiety; R 1A , R 1B , R 1C , and R 1D are independently hydrogen, halogen, -CCh, -CBn, -CF 3 , -CI 3 , -CH 2 CI, -CH 2 Br, -CH
  • R 1 is hydrogen, -SR 1D , -NR 1A R 1B , -OR 1D , -NR 1A S0 2 R 1D ,
  • R 10 -substituted or unsubstituted C1-C6 alkyl, R 10 -substituted or unsubstituted 2 to 10 membered heteroalkyl, R 10 -substituted or unsubstituted C5-C6 cycloalkyl, R 10 -substituted or unsubstituted 5 to 6 membered heterocycloalkyl, R 10 - substituted or unsubstituted phenyl, or R 10 -substituted or unsubstituted 5 to 6 membered heteroaryl.
  • R 1A , R 1B , R 1C , and R 1D are independently hydrogen,
  • halogen -CCh, -CBr , -CF 3 , -CI3, -CH 2 C1, -CH 2 Br, -CH 2 F, -CH 2 I, -CHCh, -CHBr 2 , -CHF 2 , -CHI 2 , -CN, -OH, -NH 2 , -COOH, -CONH 2 , -N0 2 , -SH, -SO3H, -S0 4 H, -S0 2 NH 2 , -NHNH 2 , -ONH 2 , -NHC(0)NHNH 2 , -NHC(0)NH 2 , -NHS0 2 H, -NHC(0)H, -NHC(0)OH, -NHOH, -OCCI3, -OCBr , -OCF3, -OCI3, -OCH 2 Cl, -OCH 2 Br, -OCH 2 F, -OCH 2 I, -OCHCh, -OC
  • R 10 unsubstituted 2 to 10 membered heteroalkyl, R 10 -substituted or unsubstituted C5-C6 cycloalkyl, R 10 -substituted or unsubstituted 5 to 6 membered heterocycloalkyl, R 10 - substituted or unsubstituted phenyl, or R 10 -substituted or unsubstituted 5 to 6 membered heteroaryl.
  • R 10 is independently oxo, halogen, -CCI3, -CBn, -CF3, -CI3, -CH 2 C1, -CH 2 Br, -CH 2 F, -CH 2 I, -CHCh, -CHBr 2 , -CHF 2 , -CHh, -OCCI3, -OCBr , -OCF3, -OCI3, -OCH 2 Cl, -OCH 2 Br, -OCH 2 F, -OCH 2 I, -OCHCh, -OCHBr 2 , -OCHF 2 , -OCHh, -CN, -OH, -NH 2 , -COOH, -COMh, -N0 2 , -SH, -SO3H, -S0 4 H, -S0 2 NH 2 , -NHNH 2 , -ONH 2 , -NHC(0)NHNH 2 , -NHC(0)NH 2
  • R 11 is independently oxo, halogen, -CCI 3 , -CBn, -CF 3 , -CI 3 , -CH 2 CI, -QBBr,
  • R 12 - substituted or unsubstituted alkyl e.g., Ci-Cs, C1-C6, or C1-C4
  • R 12 -substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, or 2 to 4 membered
  • R 12 - substituted or unsubstituted cycloalkyl e.g., C 3 -C 8 , C 3 -C 6 , or C 5 -C 6
  • R 12 -substituted or unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, or 5 to 6
  • R 12 -substituted or unsubstituted aryl e.g., C 6 -C 10 or phenyl
  • R 12 -substituted or unsubstituted heteroaryl e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • R 12 is independently oxo, halogen, -CCI 3 , -CBn, -CF 3 , -CI 3 , -CH 2 CI, -QBBr,
  • R 13 - substituted or unsubstituted alkyl e.g., Ci-Cs, C1-C6, or Ci-C 4
  • R 13 -substituted or unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, or 2 to 4 membered
  • R 13 - substituted or unsubstituted cycloalkyl e.g., C 3 -C 8 , C 3 -C 6 , or C 5 -C 6
  • R 13 -substituted or unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, or 5 to 6
  • R 13 -substituted or unsubstituted aryl e.g., C 6 -C 10 or phenyl
  • R 13 -substituted or unsubstituted heteroaryl e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • R 13 is independently oxo, halogen, -CCI 3 , -CBn, -CF 3 , -CB, -CH 2 CI, -QBBr,
  • unsubstituted alkyl e.g., Ci-Cs, C 1 -C 6 , or Ci-C 4
  • unsubstituted heteroalkyl e.g., 2 to 8 membered, 2 to 6 membered, or 2 to 4 membered
  • unsubstituted cycloalkyl e.g., C 3 -C 8 , C 3 - Ce, or C5-C6
  • unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, or 5 to 6 membered
  • unsubstituted aryl e.g., C6-C10 or phenyl
  • unsubstituted heteroaryl e.g.,
  • R 2 is independently halogen, -CX 2 3 , -CHX 2 2, -CH2X 2 , -OCX 2 3 , -OCH2X 2 , -OCHX 2 2, -CN, -SOfinity2R 2D , -SO V2 NR 2A R 2B , -NHC(0)NR 2A R 2B , -N(0)m2, -NR 2A R 2B , -C(0)R 2C , -C(0)OR 2C , -C(0)NR 2A R 2B , -OR 2D , -NR 2A S0 2 R 2D , -NR 2A C(0)R 2C ,
  • R 2 is independently halogen, -CCI 3 , -CBn, -CF 3 , -CI 3 , -CH 2 CI, -CH 2 Br, -CH 2 F, -CH 2 I, -CHCI 2 , -CHBr 2 , -CHF 2 , -CHI 2 , -CN, -OH, -NH 2 , -COOH, -CONH 2 , -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC(0)NHNH 2 , -NHC(0)NH 2 , -NHSO 2 H, -NHC(0)H, -NHC(0)OH, -NHOH, -OCCI 3 , -OCBr , -OCF 3 , -OCI 3 , -OCH 2 CI, -OCH 2 Br, -OCH2F, -OCH
  • R 2 is independently halogen, -CCI 3 , -CBn, -CF 3 , -CI 3 , -CH 2 CI, -CH 2 Br, -CH 2 F, -CH 2 I, -CHCI 2 , -CHBr 2 , -CHF 2 , -CHI 2 , -CN, -OH, -NH 2 , -COOH, -CONH 2 , -NO2, -SH, -SO3H, -SO4H, -SO2NH2, -NHNH2, -ONH2, -NHC(0)NHNH 2 , -NHC(0)NH 2 , -NHSO 2 H, -NHC(0)H, -NHC(0)OH, -NHOH, -OCCI 3 , -OCBr , -OCF 3 , -OCI 3 , -OCH 2 CI, -OCH 2 Br, -OCH2F, -OCH
  • R 20 -substituted or unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, or 5 to 6 membered
  • R 20 - substituted or unsubstituted aryl e.g., C 6 -C 10 or phenyl
  • R 20 -substituted or unsubstituted heteroaryl e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered
  • two R 2 substituents bonded to adjacent atoms may be joined to form an R 20 -substituted or unsubstituted cycloalkyl, R 20 -substituted or unsubstituted heterocycloalkyl, R 20 - substituted or unsubstituted ary
  • R 20 is independently oxo, halogen, -CCI 3 , -CBn, -CF 3 , -CI 3 , -CH 2 CI, -03 ⁇ 4BG,
  • unsubstituted cycloalkyl e.g., C 3 -C 8 , C 3 -C 6 , or C 5 -C 6
  • R 21 - substituted or unsubstituted heterocycloalkyl e.g., 3 to 8 membered, 3 to 6 membered, or 5 to 6 membered
  • R 21 - substituted or unsubstituted aryl e.g., C 6 -C 10 or phenyl
  • R 21 - substituted or unsubstituted heteroaryl e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • R 21 is independently oxo, halogen, -CCI 3 , -CBn, -CF 3 , -CI 3 , -CH 2 CI, -03 ⁇ 4BG,
  • R 22 is independently oxo, halogen, -CCh, -CBn, -CF 3 , -CI 3 , -CH 2 CI, -CHiBr,
  • unsubstituted aryl e.g., C6-C10 or phenyl
  • unsubstituted heteroaryl e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered.
  • the compound [0334] In embodiments, the compound [0335] In embodiments, the compound
  • the compound i [0338] In embodiments, the compound i
  • the compound [0348] In embodiments, the compound [0349] In embodiments, the compound i
  • the compound [0363] In embodiments, the compound [0364] In embodiments, the compound
  • the compound i [0371] In embodiments, the compound i [0372] In embodiments, the compound
  • the compound [0378] In embodiments, the compound [0379] In embodiments, the compound
  • the compound [0382] In embodiments, the compound [0383] In embodiments, the compound i
  • the compound [0385] In embodiments, the compound [0386] In embodiments, the compound
  • the compound is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl
  • the compound [0391] In embodiments, the compound [0392] In embodiments, the compound i
  • the compound [0398] In embodiments, the compound [0399] In embodiments, the compound i
  • the compound [0406] In embodiments, the compound [0407] In embodiments, the compound i
  • the compound i [0410] In embodiments, the compound i
  • the compound [0418] In embodiments, the compound [0419] In embodiments, the compound
  • the compound [0423] In embodiments, the compound [0424] In embodiments, the compound
  • the compound i [0427] In embodiments, the compound i [0428] In embodiments, the compound
  • the compound i [0431] In embodiments, the compound i [0432] In embodiments, the compound
  • Ring A is not embodiments
  • Ring A is not In embodiments, Ring A is not .
  • X 2 is independently -F, -Cl, -Br, or -I. In embodiments, X 2 is independently -Cl.
  • R 1 is not -SSR 1D . R 1D is as described herein.
  • E is not -SS-(unsubstituted C 1 -C 7 alkyl). In embodiments, E is not -SS-(3 to 7 membered unsubstituted heteroalkyl. In embodiments, E is not
  • the compound is not
  • the compound covalently binds Nurrl (e.g., human Nurrl). In embodiments, the compound irreversibly covalently binds Nurrl (e.g., human Nurrl). In embodiments, the compound reversibly covalently binds Nurrl (e.g., human Nurrl).
  • the compound contacts an amino acid corresponding to Cys566 of human Nurrl . In embodiments, the compound contacts an amino acid corresponding to Cys475 of human Nurrl . In embodiments, the compound contacts an amino acid
  • the compound contacts an amino acid corresponding to Arg515 of human Nurrl . In embodiments, the compound contacts an amino acid corresponding to Arg563 of human Nurrl . In embodiments, the compound contacts an amino acid
  • the compound covalently binds an amino acid corresponding to Cys566 of human Nurrl .
  • the compound irreversibly covalently binds an amino acid corresponding to Cys566 of human Nurrl.
  • the compound reversibly covalently binds an amino acid corresponding to Cys566 of human Nurrl.
  • the compound stabilizes a Nurrl monomer. In embodiments, the compound stabilizes a Nurrl homodimer. In embodiments, the compound stabilizes a head- to-tail Nurrl homodimer. In embodiments, the compound stabilizes a Nurrl heterodimer. In embodiments, the Nurrl heterodimer is a heterodimer with RXRa.
  • the compound stabilizes a Nurrl monomer relative to a control (e.g., absence of the compound). In embodiments, the compound stabilizes a Nurrl homodimer relative to a control (e.g., absence of the compound). In embodiments, the compound stabilizes a head-to-tail Nurrl homodimer relative to a control (e.g., absence of the compound). In embodiments, the compound stabilizes a Nurrl heterodimer relative to a control (e.g., absence of the compound). In embodiments, the Nurrl heterodimer is a heterodimer with RXRa.
  • the compound contacts a Nurrl monomer. In embodiments, the compound contacts a Nurrl homodimer. In embodiments, the compound contacts a head-to- tail Nurrl homodimer. In embodiments, the compound contacts a Nurrl heterodimer. In embodiments, the Nurrl heterodimer is a heterodimer with RXRa.
  • the compound binds a Nurrl monomer. In embodiments, the compound binds a Nurrl homodimer. In embodiments, the compound binds a head-to-tail Nurrl homodimer. In embodiments, the compound binds a Nurrl heterodimer. In embodiments, the Nurrl heterodimer is a heterodimer with RXRa.
  • the compound precludes the formation of Nurrl :RXR
  • the compound inhibits the formation of Nurrl :RXR heterodimers. In embodiments, compound binding to Nurrl inhibits the resulting
  • the compound stabilizes a Nurrl dimer conformation wherein the distance between the N-termini is about 74.0 A (e.g., about 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 A).
  • the distance between the N-termini is about 74.0 A (e.g., about 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 A).
  • the compound stabilizes a Nurrl dimer conformation wherein the distance between the N-termini is at least 74.0 A (e.g., at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84,
  • the compound stabilizes a Nurrl dimer conformation wherein the distance between the N-termini is less than 74.0 A (e.g., less than 73, 72, 71, 70, 69, 68, 67, 66, 65, 65, 64, 63, 62, 61, or 60 A).
  • the compound contacts a Nurrl dimer conformation wherein the distance between the N-termini is about 74.0 A (e.g., about 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 A).
  • the distance between the N-termini is about 74.0 A (e.g., about 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 A).
  • the compound contacts a Nurrl dimer conformation wherein the distance between the N-termini is at least 74.0 A (e.g., at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84,
  • the compound contacts a Nurrl dimer conformation wherein the distance between the N-termini is less than 74.0 A (e.g., less than 73, 72, 71, 70, 69, 68, 67, 66, 65, 65, 64, 63, 62, 61, or 60 A).
  • the compound binds a Nurrl dimer conformation wherein the distance between the N-termini is about 74.0 A (e.g., about 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 A).
  • the distance between the N-termini is about 74.0 A (e.g., about 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 A).
  • the compound binds a Nurrl dimer conformation wherein the distance between the N-termini is at least 74.0 A (e.g., at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 A). In embodiments, the compound binds a Nurrl dimer conformation wherein the distance between the N-termini is less than 74.0 A (e.g., less than 73, 72, 71, 70, 69, 68, 67, 66, 65, 65, 64, 63, 62, 61, or 60 A).
  • the compound stabilizes a Nurrl dimer conformation wherein the distance between the N-termini is about 59.3 A (e.g., about 40, 41, 42, 43, 44, 45, 46, 47, 48,
  • the compound stabilizes a Nurrl dimer conformation wherein the distance between the N-termini is at least 59.3 A (e.g., at least 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, or 75 A). In embodiments, the compound stabilizes a Nurrl dimer conformation wherein the distance between the N-termini is less than 59.3 A (e.g., less than 59, 58, 57, 56, 55, 54, 53, 52, 51, 50, 49, 48, 47, 46, 45, 44, 43, 42, 41, or 40 A).
  • the compound contacts a Nurrl dimer conformation wherein the distance between the N-termini is about 59.3 A (e.g., about 40, 41, 42, 43, 44, 45, 46, 47, 48,
  • the compound contacts a Nurrl dimer conformation wherein the distance between the N-termini is at least 59.3 A (e.g., at least 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, or 75 A). In embodiments, the compound contacts a Nurrl dimer conformation wherein the distance between the N-termini is less than 59.3 A (e.g., less than 59, 58, 57, 56, 55, 54, 53, 52, 51, 50, 49, 48, 47, 46, 45, 44, 43, 42, 41, or 40 A).
  • the compound binds a Nurrl dimer conformation wherein the distance between the N-termini is about 59.3 A (e.g., about 40, 41, 42, 43, 44, 45, 46, 47, 48,
  • the compound binds a Nurrl dimer conformation wherein the distance between the N-termini is at least 59.3 A (e.g., at least 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, or 75 A). In embodiments, the compound binds a Nurrl dimer conformation wherein the distance between the N-termini is less than 59.3 A (e.g., less than 59, 58, 57, 56, 55, 54, 53, 52, 51, 50, 49, 48, 47, 46, 45, 44, 43, 42, 41, or 40 A).
  • the compound binds Nurrl and induces Nurrl binding to a NBRE, a NuRE, or a DR-5 response element. In embodiments, the compound binds Nurrl and induces Nurrl binding to a NBRE. In embodiments, the compound binds Nurrl and induces Nurrl binding to a NuRE. In embodiments, the compound binds Nurrl and induces Nurrl binding to a DR-5 response element.
  • the compound is a compound as described herein, including in embodiments.
  • the compound is a compound described herein (e.g., in the examples section, in the figures, in the tables, in the claims, or in the appendix).
  • a pharmaceutical composition including a compound described herein and a pharmaceutically acceptable excipient.
  • the pharmaceutical composition includes an effective amount of the compound. In embodiments, the pharmaceutical composition includes a therapeutically effective amount of the compound.
  • the pharmaceutical composition includes an effective amount of a second agent, wherein the second agent is an agent for treating a neurodegenerative disease.
  • the neurodegenerative disease is Parkinson’s disease.
  • the second agent is a Parkinson’s disease drug, for example, levodopa, carbidopa, selegiline, amantadine, donepezil, galanthamine, rivastigmine, tacrine, bromocriptine, pergolide, pramipexole, ropinirole, trihexyphenidyl, benztropine, biperiden, procyclidine, tolcapone, or entacapone.
  • the pharmaceutical composition includes a therapeutically effective amount of the second agent.
  • the pharmaceutical composition includes an effective amount of a second agent, wherein the second agent is an agent for treating an inflammatory disease, for example, acetaminophen, duloxetine, aspirin, ibuprofen, naproxen, diclofenac, prednisone, betamethasone, cortisone, dexamethasone, hydrocortisone, methylprednisolone,
  • an inflammatory disease for example, acetaminophen, duloxetine, aspirin, ibuprofen, naproxen, diclofenac, prednisone, betamethasone, cortisone, dexamethasone, hydrocortisone, methylprednisolone,
  • the pharmaceutical composition includes a therapeutically effective amount of the second agent.
  • the pharmaceutical composition includes an effective amount of a second agent, wherein the second agent is an anti-cancer agent.
  • a pharmaceutical composition including 5,6- dihydroxyindole (DHI) and a pharmaceutically acceptable excipient.
  • the pharmaceutical composition includes an effective amount of 5,6-dihydroxyindole (DHI).
  • the pharmaceutical composition includes a therapeutically effective amount of 5,6-dihydroxyindole (DHI).
  • the pharmaceutical composition includes an effective amount of a second agent described herein.
  • the method including administering to the subject in need thereof a therapeutically effective amount of a compound described herein.
  • DHI 5,6-dihydroxyindole
  • the disease associated with dysregulation and/or degeneration of dopaminergic neurons is Parkinson’s disease, Alzheimer’s disease, multiple sclerosis, amyotrophic lateral sclerosis, schizophrenia, or drug addiction.
  • the disease is Parkinson’s disease.
  • the disease is Alzheimer’s disease.
  • the disease is multiple sclerosis.
  • the disease is amyotrophic lateral sclerosis.
  • the disease is schizophrenia.
  • the disease is drug addiction.
  • the disease associated with dysregulation and/or degeneration of dopaminergic neurons is a cancer.
  • a method for treating a disease in a subject in need thereof including administering to the subject in need thereof a therapeutically effective amount of a compound described herein.
  • a method for treating a disease in a subject in need thereof including administering to the subject in need thereof a therapeutically effective amount of 5,6-dihydroxyindole (DHI).
  • DHI 5,6-dihydroxyindole
  • the disease is Parkinson’s disease, Alzheimer’s disease, multiple sclerosis, amyotrophic lateral sclerosis, schizophrenia, or drug addiction.
  • the disease is Parkinson’s disease.
  • the disease is Alzheimer’s disease.
  • the disease is multiple sclerosis.
  • the disease is amyotrophic lateral sclerosis.
  • the disease is schizophrenia.
  • the disease is drug addiction.
  • the disease is a cancer.
  • the cancer is breast cancer, pancreatic cancer, bladder cancer, mucoepidermoid carcinoma, gastric cancer, prostate cancer, colorectal cancer, lung cancer, adrenocortical cancer, or cervical cancer.
  • a method for reducing inflammation in a subject in need thereof including administering to the subject in need thereof a therapeutically effective amount of a compound described herein.
  • the method is for reducing inflammation in the central nervous sytem of the subject in need thereof.
  • a method for reducing oxidative stress in a subject in need thereof including administering to the subject in need thereof a therapeutically effective amount of a compound described herein.
  • the method is for reducting oxidative stress in the central nervous system of the subject in need thereof.
  • a method of modulating the level of activity of Nurrl in a subject in need thereof including administering to the subject in need thereof a therapeutically effective amount of a compound described herein.
  • the level of activity of Nurrl in the subject is increased by about 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • the level of activity of Nurrl in the subject is increased by at least 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • a method of increasing the level of activity of Nurrl in a cell including contacting the cell with a compound described herein.
  • the level of activity of Nurrl in the cell is increased by about 1.5-, 2-, 3-, 4-,
  • the level of activity of Nurrl in the cell is increased by at least 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • a method of increasing the level of activity of Pitx3 in a subject in need thereof including administering to the subject in need thereof a therapeutically effective amount of a compound described herein.
  • the level of activity of Pitx3 in the subject is increased by about 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • the level of activity of Pitx3 in the subject is increased by at least 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • a method of increasing the level of activity of Pitx3 in a cell including contacting the cell with a compound described herein.
  • the level of activity of Pitx3 in the cell is increased by about 1.5-, 2-, 3-, 4-, 5-,
  • the level of activity of Pitx3 in the cell is increased by at least 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-,
  • a method of increasing the level of activity of TH in a subject in need thereof including administering to the subject in need thereof a therapeutically effective amount of a compound described herein.
  • the level of activity of TH in the subject is increased by about 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • the level of activity of TH in the subject is increased by at least 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-,
  • a method of increasing the level of activity of TH in a cell including contacting the cell with a compound described herein.
  • the level of activity of TH in the cell is increased by about 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-,
  • the level of activity of TH in the cell is increased by at least 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-,
  • a method of increasing the level of activity of VMAT2 in a subject in need thereof including administering to the subject in need thereof a therapeutically effective amount of a compound described herein.
  • the level of activity of VMAT2 in the subject is increased by about 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-,
  • the level of activity of VMAT2 in the subject is increased by at least 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • a method of increasing the level of activity of VMAT2 in a cell including contacting the cell with a compound described herein.
  • the level of activity of VMAT2 in the cell is increased by about 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • the level of activity of VMAT2 in the cell is increased by at least 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • DDC dopa decarboxylase
  • the level of activity of DDC in the subject is increased by about 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • the level of activity of DDC in the subject is increased by at least 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • a method of increasing the level of activity of dopa decarboxylase (DDC) in a cell including contacting the cell with a compound described herein.
  • the level of activity of DDC in the cell is increased by about 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • the level of activity of DDC in the cell is increased by at least 1.5-, 2-, 3-,
  • DAT dopamine transporter
  • the level of activity of DAT in the subject is increased by about 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • the level of activity of DAT in the subject is increased by at least 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • DAT dopamine transporter
  • the level of activity of DAT in the cell is increased by about 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • the level of activity of DAT in the cell is increased by at least 1.5-, 2-, 3-,
  • a method of increasing the level of activity of BDNF in a subject in need thereof including administering to the subject in need thereof a therapeutically effective amount of a compound described herein.
  • the level of activity of BDNF in the subject is increased by about 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • the level of activity of BDNF in the subject is increased by at least 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • a method of increasing the level of activity of BDNF in a cell including contacting the cell with a compound described herein.
  • the level of activity of BDNF in the cell is increased by about 1.5-, 2-, 3-, 4-,
  • the level of activity of BDNF in the cell is increased by at least 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • a method of increasing the level of activity of NGF in a subject in need thereof including administering to the subject in need thereof a therapeutically effective amount of a compound described herein.
  • the level of activity of NGF in the subject is increased by about 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • the level of activity of NGF in the subject is increased by at least 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • a method of increasing the level of activity of NGF in a cell including contacting the cell with a compound described herein.
  • the level of activity of NGF in the cell is increased by about 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • the level of activity of NGF in the cell is increased by at least 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-,
  • a method of increasing the level of activity of GDNF receptor c-Ret in a subject in need thereof including administering to the subject in need thereof a therapeutically effective amount of a compound described herein.
  • the level of activity of GDNF receptor c-Ret in the subject is increased by about 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • the level of activity of GDNF receptor c-Ret in the subject is increased by at least 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • a method of increasing the level of activity of GDNF receptor c-Ret in a cell including contacting the cell with a compound described herein.
  • the level of activity of GDNF receptor c-Ret in the cell is increased by about 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000- fold.
  • the level of activity of GDNF receptor c-Ret in the cell is increased by at least 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • a method of increasing the level of activity of SOD1 in a subject in need thereof including administering to the subject in need thereof a therapeutically effective amount of a compound described herein.
  • the level of activity of SOD1 in the subject is increased by about 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • the level of activity of SOD1 in the subject is increased by at least 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • a method of increasing the level of activity of SOD1 in a cell including contacting the cell with a compound described herein.
  • the level of activity of SOD1 in the cell is increased by about 1.5-, 2-, 3-, 4-,
  • the level of activity of SOD1 in the cell is increased by at least 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • a method of reducing the level of activity of TNFa in a subject in need thereof including administering to the subject in need thereof a therapeutically effective amount of a compound described herein.
  • the level of activity of TNFa in the subject is reduced by about 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-,
  • the level of activity of TNFa in the subject is reduced by at least 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-,
  • a method of reducing the level of activity of TNFa in a cell including contacting the cell with a compound described herein.
  • the level of activity of TNFa in the cell is reduced by about 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • the level of activity of TNFa in the cell is reduced by at least 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • a method of reducing the level of activity of iNOS in a subject in need thereof including administering to the subject in need thereof a therapeutically effective amount of a compound described herein.
  • the level of activity of iNOS in the subject is reduced by about 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-,
  • the level of activity of iNOS in the subject is reduced by at least 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-,
  • a method of reducing the level of activity of iNOS in a cell including contacting the cell with a compound described herein.
  • the level of activity of iNOS in the cell is reduced by about 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • the level of activity of iNOS in the cell is reduced by at least 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • a method of reducing the level of activity of IL-Ib in a subject in need thereof including administering to the subject in need thereof a therapeutically effective amount of a compound described herein.
  • the level of activity of IL-Ib in the subject is reduced by about 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-,
  • the level of activity of IL-Ib in the subject is reduced by at least 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-,
  • a method of reducing the level of activity of IL-Ib in a cell including contacting the cell with a compound described herein.
  • the level of activity of IL-Ib in the cell is reduced by about 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • the level of activity of IL-Ib in the cell is reduced by at least 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • the method includes increasing the level of dopamine in a subject in need thereof, the method including administering to the subject in need thereof a therapeutically effective amount of a compound described herein.
  • the level of dopamine in the subject is increased by about 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • the level of dopamine in the subject is increased by at least 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-,
  • the method includes increasing the level of dopamine in a cell, the method including contacting the cell with a compound described herein.
  • the level of dopamine in the cell is increased by about 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • the level of dopamine in the cell is increased by at least 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-,
  • the method includes increasing synthesis of dopamine in a cell with a compound described herein as compared to a control (e.g., absence of the compound).
  • the level of synthesis of dopamine is increased by about 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • the level of synthesis of dopamine is increased by at least 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-,
  • the method includes increasing packaging of dopamine in a cell with a compound described herein as compared to a control (e.g., absence of the compound).
  • the level of packaging of dopamine is increased by about 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • the level of packaging of dopamine is increased by at least 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • the method includes increasing reuptake of dopamine in a cell with a compound described herein as compared to a control (e.g., absence of the compound).
  • the level of reuptake of dopamine is increased by about 1.5-, 2-, 3-, 4-, 5-, 6-,
  • the level of reuptake of dopamine is increased by at least 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-,
  • the method includes increasing development of dopaminergic neurons with a compound described herein as compared to a control (e.g., absence of the compound).
  • the level of development of dopaminergic neurons is increased by about 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000- fold.
  • the level of development of dopaminergic neurons is increased by at least 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • the method includes increasing maintenance of dopaminergic neurons with a compound described herein as compared to a control (e.g., absence of the compound).
  • the level of maintenance of dopaminergic neurons is increased by about 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000- fold.
  • the level of maintenance of dopaminergic neurons is increased by at least 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • the method includes increasing survival of dopaminergic neurons with a compound described herein as compared to a control (e.g., absence of the compound).
  • the level of survival of dopaminergic neurons is increased by about 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • the level of survival of dopaminergic neurons is increased by at least 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold.
  • the method includes covalently binding Nurrl (e.g., human Nurrl) with a compound described herein. In embodiments, the method includes irreversibly covalently binding Nurrl (e.g., human Nurrl) with a compound described herein. In embodiments, the method includes reversibly covalently binding Nurrl (e.g., human Nurrl) with a compound described herein.
  • Nurrl e.g., human Nurrl
  • the method includes reversibly covalently binding Nurrl (e.g., human Nurrl) with a compound described herein.
  • the method includes contacting an amino acid corresponding to Cys566 of human Nurrl with a compound described herein. In embodiments, the method includes contacting an amino acid corresponding to Cys475 of human Nurrl with a compound described herein. In embodiments, the method includes contacting an amino acid corresponding to Cys534 of human Nurrl with a compound described herein.
  • the method includes contacting an amino acid corresponding to Arg515 of human Nurrl with a compound described herein. In embodiments, the method includes contacting an amino acid corresponding to Arg563 of human Nurrl with a compound described herein. In embodiments, the method includes contacting an amino acid corresponding to Glu445 of human Nurrl with a compound described herein.
  • the method includes covalently binding an amino acid
  • the method includes irreversibly covalently binding an amino acid
  • the method includes reversibly covalently binding an amino acid
  • the method includes stabilizing a Nurrl monomer with a compound described herein. In embodiments, the method includes stabilizing a Nurrl homodimer with a compound described herein. In embodiments, the method includes stabilizing a head-to-tail Nurrl homodimer with a compound described herein.
  • the method includes stabilizing a Nurrl heterodimer with a compound described herein.
  • the Nurrl heterodimer is a heterodimer with RXRa.
  • the method includes contacting a Nurrl monomer with a compound described herein. In embodiments, the method includes contacting a Nurrl homodimer with a compound described herein. In embodiments, the method includes contacting a head-to-tail Nurrl homodimer with a compound described herein.
  • the method includes contacting a Nurrl heterodimer with a compound described herein.
  • the Nurrl heterodimer is a heterodimer with RXRa.
  • the method includes binding a Nurrl monomer with a compound described herein. In embodiments, the method includes binding a Nurrl homodimer with a compound described herein. In embodiments, the method includes binding a head-to-tail Nurrl homodimer with a compound described herein. In embodiments, the method includes binding a Nurrl heterodimer with a compound described herein. In embodiments, the Nurrl heterodimer is a heterodimer with RXRa.
  • the method includes precluding the formation of Nurrl :RXR heterodimers with a compound described herein.
  • the method includes stabilizing a Nurrl dimer conformation wherein the distance between the N-termini is about 74.0 A with a compound described herein. In embodiments, the method includes stabilizing a Nurrl dimer conformation wherein the distance between the N-termini is at least 74.0 A with a compound described herein. In embodiments, the method includes stabilizing a Nurrl dimer conformation wherein the distance between the N-termini is less than 74.0 A with a compound described herein.
  • the method includes contacting a Nurrl dimer conformation wherein the distance between the N-termini is about 74.0 A with a compound described herein. In embodiments, the method includes contacting a Nurrl dimer conformation wherein the distance between the N-termini is at least 74.0 A with a compound described herein. In embodiments, the method includes contacting a Nurrl dimer conformation wherein the distance between the N-termini is less than 74.0 A with a compound described herein.
  • the method includes binding a Nurrl dimer conformation wherein the distance between the N-termini is about 74.0 A with a compound described herein. In embodiments, the method includes binding a Nurrl dimer conformation wherein the distance between the N-termini is at least 74.0 A with a compound described herein. In embodiments, the method includes binding a Nurrl dimer conformation wherein the distance between the N-termini is less than 74.0 A with a compound described herein.
  • the method includes stabilizing a Nurrl dimer conformation wherein the distance between the N-termini is about 59.3 A with a compound described herein. In embodiments, the method includes stabilizing a Nurrl dimer conformation wherein the distance between the N-termini is at least 59.3 A with a compound described herein. In embodiments, the method includes stabilizing a Nurrl dimer conformation wherein the distance between the N-termini is less than 59.3 A with a compound described herein.
  • the method includes contacting a Nurrl dimer conformation wherein the distance between the N-termini is about 59.3 A with a compound described herein. In embodiments, the method includes contacting a Nurrl dimer conformation wherein the distance between the N-termini is at least 59.3 A with a compound described herein. In embodiments, the method includes contacting a Nurrl dimer conformation wherein the distance between the N-termini is less than 59.3 A with a compound described herein.
  • the method includes binding a Nurrl dimer conformation wherein the distance between the N-termini is about 59.3 A with a compound described herein. In embodiments, the method includes binding a Nurrl dimer conformation wherein the distance between the N-termini is at least 59.3 A with a compound described herein. In embodiments, the method includes binding a Nurrl dimer conformation wherein the distance between the N-termini is less than 59.3 A with a compound described herein.
  • the method includes binding a Nurrl and inducing Nurrl binding to a NBRE, a NuRE, or a DR-5 response element. In embodiments, the method includes binding a Nurrl and inducing Nurrl binding to a NBRE. In embodiments, the method includes binding a Nurrl and inducing Nurrl binding to a NuRE. In embodiments, the method includes binding a Nurrl and inducing Nurrl binding to a DR-5 response element.
  • Embodiment PI A compound having the formula
  • Ring A is aryl or heteroaryl
  • L 1 is L 101 -L 102 -L 103 ;
  • L 101 is a bond, -S(0) 2 -, -N(R 101 )-, -0-, -S-, -C(O)-, -C(0)N(R 101 )-, -N(R 101 )C(O)-,
  • L 102 is a bond, -S(0) 2 -, -N(R 102 )-, -0-, -S-, -C(O)-, -C(0)N(R 102 )-, -N(R 102 )C(O)-,
  • L 103 is a bond, -S(0) 2 -, -N(R 103 )-, -0-, -S-, -C(O)-, -C(0)N(R 103 )-, -N(R 103 )C(O)-,
  • R 101 , R 102 , and R 103 are independently hydrogen, halogen, -CCb, -CBn, -CF3, -CI3,
  • R 1 is hydrogen, halogen, -CX ⁇ , -CHX ⁇ , -CH2X 1 , -OCX , -OCH2X 1 , -OCHXS, -CN, -SOniR 1D , -SOviNR 1A R 1B , -NHC(0)NR 1A R 1b , -N(0)mi, -NR 1A R 1B , -C(0)R lc , -C(0)OR lc , -C(0)NR 1A R 1B , -OR 1d , -NR 1A S0 2 R 1D , -NR 1A C(0)R 1c , -NR 1A C(0)OR 1c , -NR 1A OR 1c , -N 3 , -SSR 1D ,-SiR 1A R 1B R lc , E, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or
  • heterocycloalkyl substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl
  • E is an electrophilic moiety
  • R 2 is independently halogen, -CX 2 3 , -CHX 2 2 , -CH 2 X 2 , -OCX 2 3 , -OCH 2 X 2 , -OCHX 2 2 , -CN, -SOfinity2R 2D , -SO V2 NR 2A R 2B , -NHC(0)NR 2A R 2B , -N(0)m2, -NR 2A R 2B , -C(0)R 2C , -C(0)OR 2C , -C(0)NR 2A R 2B , -OR 2D , -NR 2A S0 2 R 2D , -NR 2A C(0)R 2C , -NR 2A C(0)0R 2C , -NR 2A OR 2C , -N 3 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or
  • R 1A , R 1b , R 1C , R 1D , R 2A , R 2B , R 2C , and R 2D are independently hydrogen, halogen, -CC1 3 , -CBr 3 , -CF 3 , -CI 3 , -CH2CI, -CH 2 Br, -CH 2 F, -CH 2 I, -CHCb, -CHBr 2 , -CHF 2 , -CHI 2 , -CN,
  • X 1 and X 2 are independently -F, -Cl, -Br, or -I; and z2 is an integer from 0 to 5.
  • Embodiment P2 The compound of embodiment PI, wherein the compound has the formula
  • L 104 is a bond, -S(0) 2 -, -C(O)-, -NHC(O)-, -OC(O)-, substituted or unsubstituted alkylene, or substituted or unsubstituted heteroalkyl ene;
  • L 105 is a bond, substituted or unsubstituted alkylene, substituted or unsubstituted
  • heteroalkylene substituted or unsubstituted cycloalkylene, or substituted or unsubstituted heterocycloalkyl ene;
  • L 103 is a bond, substituted or unsubstituted alkylene, or substituted or unsubstituted heteroalkylene; and W is N or CH.
  • Embodiment P3 The compound of embodiment P2, wherein Ring A is a phenyl or 5 to 10 membered heteroaryl.
  • Embodiment P4 The compound of embodiment P2, wherein Ring A is a phenyl.
  • Embodiment P5 The compound of embodiment P2, wherein Ring A is
  • Embodiment P6 The compound of one of embodiments P2 to P4, wherein the compound has the formula
  • R 2X , R 2Y , and R 2Z are independently hydrogen, halogen, -CX 2 3 , -CHX 2 2, -CH2X 2 ,
  • Embodiment P7 The compound of embodiment P6, wherein R 2X is independently halogen or unsubstituted heteroalkyl;
  • R 2Y is independently hydrogen or halogen
  • R 2Z is independently hydrogen, halogen, -CN, -NR 2A C(0)R 2C , unsubstitued heteroalkyl, or substituted or unsubstituted heterocycloalkyl.
  • Embodiment P8 The compound of embodiment P6, wherein R 2X is independently halogen;
  • R 2Y is independently halogen; and R 2Z is independently hydrogen.
  • Embodiment P9 The compound of embodiment P6, wherein R 2X is independently halogen or unsubstituted 2 to 4 membered heteroalkyl; R 2Y is independently hydrogen; R 2Z is independently halogen, -CN, -NR 2A C(0)R 2C , unsubstituted 2 to 4 membered heteroalkyl, or substituted or unsubstituted 5 to 6 membered heterocycloalkyl;
  • R 2A is independently hydrogen
  • Embodiment PI is independently unsubstituted C1-C2 alkyl.
  • Embodiment PI 1 The compound of one of embodiments P2 to P10, wherein L 105 is an unsubstituted alkyl ene.
  • Embodiment P12 The compound of one of embodiments P2 to P10, wherein L 105 is an unsubstituted C1-C4 alkylene.
  • Embodiment P13 The compound of one of embodiments P2 to P10, wherein L 105
  • Embodiment P14 The compound of one of embodiments P2 to P13, wherein W is
  • Embodiment PI 5 The compound of one of embodiments P2 to PI 4, wherein L 103 is an unsubstituted alkylene.
  • Embodiment PI 6 The compound of one of embodiments P2 to P14, wherein L 103 is an unsubstituted C1-C4 alkylene.
  • Embodiment PI 7 The compound of one of embodiments P2 to P14, wherein L 103 is an unsubstituted ethylene.
  • Embodiment PI 8 The compound of one of embodiments P2 to P9, wherein
  • Embodiment PI 9 The compound of one of embodiments PI to PI 8, wherein R 1 is -SR 1D , -NR 1A R 1B , -OR 1d , E, unsubstituted alkyl, substituted or unsubstituted phenyl, or substituted or unsubstituted 5 to 6 membered heteroaryl;
  • R 1A is independently hydrogen or unsubstituted C 1 -C 4 alkyl
  • R 1B is independently hydrogen or unsubstituted C 1 -C 4 alkyl
  • R 1D is independently hydrogen, halogen, -CCI 3 , -CBr 3 , -CF 3 , -CI 3 , -CH 2 CI,

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Neurology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Neurosurgery (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Biomedical Technology (AREA)
  • Epidemiology (AREA)
  • Psychiatry (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Hospice & Palliative Care (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Addiction (AREA)
  • Psychology (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Emergency Medicine (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Plural Heterocyclic Compounds (AREA)
  • Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
  • Organic Low-Molecular-Weight Compounds And Preparation Thereof (AREA)
  • Peptides Or Proteins (AREA)
PCT/US2020/018890 2019-02-19 2020-02-19 Nurr1 receptor modulators Ceased WO2020172324A1 (en)

Priority Applications (9)

Application Number Priority Date Filing Date Title
US17/431,111 US20230063230A1 (en) 2019-02-19 2020-02-19 Nurr1 receptor modulators
EP20759164.5A EP3927330A4 (en) 2019-02-19 2020-02-19 NURR1 RECEPTOR MODULATORS
JP2021571643A JP7746165B2 (ja) 2019-02-19 2020-02-19 Nurr1受容体調節因子
CN202510253725.XA CN120097859A (zh) 2019-02-19 2020-02-19 Nurr1受体调节剂
AU2020226633A AU2020226633C1 (en) 2019-02-19 2020-02-19 Nurr1 receptor modulators
CN202080028466.6A CN113692276B (zh) 2019-02-19 2020-02-19 Nurr1受体调节剂
CA3130269A CA3130269A1 (en) 2019-02-19 2020-02-19 Nurr1 receptor modulators
JP2025061013A JP2025118609A (ja) 2019-02-19 2025-04-02 Nurr1受容体調節因子
AU2025213600A AU2025213600A1 (en) 2019-02-19 2025-08-06 Nurr1 receptor modulators

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201962807642P 2019-02-19 2019-02-19
US62/807,642 2019-02-19

Publications (2)

Publication Number Publication Date
WO2020172324A1 true WO2020172324A1 (en) 2020-08-27
WO2020172324A8 WO2020172324A8 (en) 2021-08-26

Family

ID=72143886

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2020/018890 Ceased WO2020172324A1 (en) 2019-02-19 2020-02-19 Nurr1 receptor modulators

Country Status (7)

Country Link
US (1) US20230063230A1 (https=)
EP (1) EP3927330A4 (https=)
JP (2) JP7746165B2 (https=)
CN (2) CN120097859A (https=)
AU (2) AU2020226633C1 (https=)
CA (1) CA3130269A1 (https=)
WO (1) WO2020172324A1 (https=)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP4015506A4 (en) * 2019-09-25 2023-08-30 Korea Institute of Radiological & Medical Sciences COMPOSITION FOR PREVENTING OR TREATING CANCER, CONTAINING A DERIVATIVE BASED ON TRIFLUOROMETHYLPHENYL PYRAZOLE AS ACTIVE PRINCIPLE
US12209087B2 (en) 2022-09-26 2025-01-28 Alterome Therapeutics, Inc. AKT1 modulators
US12441744B2 (en) 2022-12-16 2025-10-14 Astrazeneca Ab 2,6,9-trisubstituted purines

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20140142173A1 (en) * 2011-04-06 2014-05-22 Korea Research Institute Of Bioscience And Biotechnology Pharmaceutical composition for the prevention or treatment of a neurodegenerative disease, comprising a daphne genkwa extract or a compound isolated therefrom
US20160361298A1 (en) * 2015-06-11 2016-12-15 Globavir Biosciences, Inc. Methods and compositions for treating cancer

Family Cites Families (22)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JPS5714505A (en) * 1980-07-01 1982-01-25 Ube Ind Ltd Herbicide
GB8702613D0 (en) * 1987-02-05 1987-03-11 Ici Plc Compositions
DE10206723A1 (de) * 2002-02-18 2003-09-04 Ulrich Schraermeyer Therapie von Erkrankungen des Auges und des Zentralen Nervensystems
TW200505452A (en) * 2003-06-17 2005-02-16 Astrazeneca Ab Chemical compounds
AU2004285053B2 (en) * 2003-10-28 2010-10-21 Vertex Pharmaceuticals, Incorporated Benzimidazoles useful as modulators of ion channels
SE0401653D0 (sv) * 2004-06-24 2004-06-24 Astrazeneca Ab New compounds
WO2007120012A1 (en) * 2006-04-19 2007-10-25 Amorepacific Corporation Novel compounds, isomer thereof, or pharmaceutically acceptable salts thereof as vanilloid receptor antagonist; and pharmaceutical compositions containing the same
WO2009047240A1 (en) * 2007-10-09 2009-04-16 Smithkline Beecham Corporation Indole derivatives useful as ppar activators
FR2925906B1 (fr) * 2008-01-02 2010-08-20 Sanofi Aventis COMPOSES DE N-PHENYL-IMIDAZO°1,2-a!PYRIDINE-2-CARBOXAMIDES, LEUR PREPARATION ET LEUR APPLICATION EN THERAPEUTIQUE
HRP20151367T1 (hr) * 2008-05-13 2016-01-29 Yale University Kimerne male molekule za pojaäśanje odgovora protutijela na stanice raka
JP2012529518A (ja) * 2009-06-09 2012-11-22 アブラクシス バイオサイエンス リミテッド ライアビリティー カンパニー ヘッジホッグシグナル伝達のピリジル−トリアジン阻害剤
FR2955110A1 (fr) * 2010-01-08 2011-07-15 Fournier Lab Sa Nouveaux derives de type pyrrolopyridine benzoique
WO2015159175A1 (en) * 2014-04-15 2015-10-22 Pfizer Inc. Tropomyosin-related kinase inhibitors containing both a 1h-pyrazole and a pyrimidine moiety
WO2015170218A1 (en) * 2014-05-07 2015-11-12 Pfizer Inc. Tropomyosin-related kinase inhibitors
LU92852B1 (en) * 2015-10-20 2017-05-02 Athanasios Spathis NURR1:RXR activating compounds for simultaneous treatment of symptoms and pathology of Parkinsons disease
JP2018537502A (ja) * 2015-12-16 2018-12-20 サウザーン リサーチ インスチチュート ピロロピリミジン化合物、キナーゼlrrk2阻害剤としての使用、及びその調製方法
US20190151289A1 (en) * 2016-05-13 2019-05-23 Yale University Identification of Small Molecule Inhibitors of Jumonji AT-Rich Interactive Domain 1A (JARID1A) Histone Demethylase
AU2017279027A1 (en) * 2016-06-08 2018-12-20 Glaxosmithkline Intellectual Property Development Limited Chemical Compounds
CN106518793B (zh) 2016-10-25 2018-11-27 中国农业大学 一种含1,2,3-三唑环的酰胺类化合物及其制备方法与应用
CN106967047A (zh) 2017-03-29 2017-07-21 山东大学 一种取代二芳基烟酰胺类衍生物及其制备方法与应用
EP3612526A2 (en) * 2017-04-20 2020-02-26 The Regents of the University of California K-ras modulators
US11872236B2 (en) * 2018-04-05 2024-01-16 Calasia Pharmaceuticals, Inc. Pharmacological agents for treating ocular diseases

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20140142173A1 (en) * 2011-04-06 2014-05-22 Korea Research Institute Of Bioscience And Biotechnology Pharmaceutical composition for the prevention or treatment of a neurodegenerative disease, comprising a daphne genkwa extract or a compound isolated therefrom
US20160361298A1 (en) * 2015-06-11 2016-12-15 Globavir Biosciences, Inc. Methods and compositions for treating cancer

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
BLANK ET AL.: "Penetration of Benzene Through Human Skin", THE JOURNAL OF INVESTIGATIVE DERMATOLOGY, vol. 85, no. 6, December 1985 (1985-12-01), pages 522 - 526, XP055843451 *

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP4015506A4 (en) * 2019-09-25 2023-08-30 Korea Institute of Radiological & Medical Sciences COMPOSITION FOR PREVENTING OR TREATING CANCER, CONTAINING A DERIVATIVE BASED ON TRIFLUOROMETHYLPHENYL PYRAZOLE AS ACTIVE PRINCIPLE
US12209087B2 (en) 2022-09-26 2025-01-28 Alterome Therapeutics, Inc. AKT1 modulators
US12441744B2 (en) 2022-12-16 2025-10-14 Astrazeneca Ab 2,6,9-trisubstituted purines

Also Published As

Publication number Publication date
CN113692276B (zh) 2026-02-27
JP7746165B2 (ja) 2025-09-30
EP3927330A1 (en) 2021-12-29
AU2020226633C1 (en) 2026-01-29
CN120097859A (zh) 2025-06-06
AU2020226633B2 (en) 2025-07-03
US20230063230A1 (en) 2023-03-02
AU2025213600A1 (en) 2025-08-28
EP3927330A4 (en) 2022-11-30
WO2020172324A8 (en) 2021-08-26
JP2022520907A (ja) 2022-04-01
JP2025118609A (ja) 2025-08-13
AU2020226633A1 (en) 2021-09-02
CN113692276A (zh) 2021-11-23
CA3130269A1 (en) 2020-08-27

Similar Documents

Publication Publication Date Title
EP3452454B1 (en) Modulators of the integrated stress pathway
EP3452448B1 (en) Modulators of the integrated stress pathway
EP3452453B1 (en) Modulators of the integrated stress pathway
CA2904794A1 (en) Modulators of the eif2alpha pathway
AU2025213600A1 (en) Nurr1 receptor modulators
WO2019075386A1 (en) MODULATORS OF MTORC1
AU2014236370C1 (en) 5-bromo-indirubins
CA2917527C (en) Compounds and methods for treating cancer, neurological disorders, ethanol withdrawal, anxiety, depression, and neuropathic pain
WO2018144870A1 (en) Compositions and methods for inhibiting reticulon 4
WO2020146779A1 (en) mTORC1 INHIBITORS FOR ACTIVATING AUTOPHAGY
US20230255934A1 (en) Nurr1 receptor modulators and uses thereof
WO2020028525A1 (en) Sumo inhibitor compounds and uses thereof
EP3577128A1 (en) Compositions and methods for modulating ppp2r1a
CA3179305A1 (en) Notch inhibitors and uses thereof
HK40012049A (en) Modulators of the integrated stress pathway
HK40012049B (en) Modulators of the integrated stress pathway
HK40012051B (en) Modulators of the integrated stress pathway
HK40012051A (en) Modulators of the integrated stress pathway

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 20759164

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3130269

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2021571643

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2020226633

Country of ref document: AU

Date of ref document: 20200219

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2020759164

Country of ref document: EP

Effective date: 20210920

WWD Wipo information: divisional of initial pct application

Ref document number: 818868

Country of ref document: NZ