WO2020099663A1 - Compositions for treating oxidative stress-associated skin diseases and skin ageing and diagnosis of oxidative stress-associated skin diseases - Google Patents
Compositions for treating oxidative stress-associated skin diseases and skin ageing and diagnosis of oxidative stress-associated skin diseases Download PDFInfo
- Publication number
- WO2020099663A1 WO2020099663A1 PCT/EP2019/081546 EP2019081546W WO2020099663A1 WO 2020099663 A1 WO2020099663 A1 WO 2020099663A1 EP 2019081546 W EP2019081546 W EP 2019081546W WO 2020099663 A1 WO2020099663 A1 WO 2020099663A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- roxp
- acnes
- composition
- subject
- skin
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/66—Microorganisms or materials therefrom
- A61K35/74—Bacteria
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/164—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/43—Enzymes; Proenzymes; Derivatives thereof
- A61K38/44—Oxidoreductases (1)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/02—Inorganic compounds
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/08—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing oxygen, e.g. ethers, acetals, ketones, quinones, aldehydes, peroxides
- A61K47/14—Esters of carboxylic acids, e.g. fatty acid monoglycerides, medium-chain triglycerides, parabens or PEG fatty acid esters
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/30—Macromolecular organic or inorganic compounds, e.g. inorganic polyphosphates
- A61K47/32—Macromolecular compounds obtained by reactions only involving carbon-to-carbon unsaturated bonds, e.g. carbomers, poly(meth)acrylates, or polyvinyl pyrrolidone
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K8/00—Cosmetics or similar toiletry preparations
- A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
- A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
- A61K8/64—Proteins; Peptides; Derivatives or degradation products thereof
- A61K8/66—Enzymes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K8/00—Cosmetics or similar toiletry preparations
- A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
- A61K8/96—Cosmetics or similar toiletry preparations characterised by the composition containing materials, or derivatives thereof of undetermined constitution
- A61K8/99—Cosmetics or similar toiletry preparations characterised by the composition containing materials, or derivatives thereof of undetermined constitution from microorganisms other than algae or fungi, e.g. protozoa or bacteria
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0014—Skin, i.e. galenical aspects of topical compositions
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/18—Antioxidants, e.g. antiradicals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q19/00—Preparations for care of the skin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q19/00—Preparations for care of the skin
- A61Q19/08—Anti-ageing preparations
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q5/00—Preparations for care of the hair
- A61Q5/006—Antidandruff preparations
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/02—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving viable microorganisms
- C12Q1/04—Determining presence or kind of microorganism; Use of selective media for testing antibiotics or bacteriocides; Compositions containing a chemical indicator therefor
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/26—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving oxidoreductase
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/5005—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
- G01N33/5008—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
- G01N33/5044—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics involving specific cell types
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6893—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/20—Dermatological disorders
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/70—Mechanisms involved in disease identification
- G01N2800/7004—Stress
- G01N2800/7009—Oxidative stress
Definitions
- aspects of the invention are broadly in the medical and cosmetic fields and more specifically concern methods, uses and compositions for the prophylactic or therapeutic treatment of oxidative stress-associated skin diseases or for prevention or reduction of skin ageing.
- the invention further concerns methods for diagnosing oxidative stress-associated skin diseases, or for identifying subjects likely to benefit from administration of anti-oxidant compositions disclosed by the invention, and related personalised medicine and companion diagnostic approaches.
- ROS reactive oxygen species
- Oxidative damage caused by free radicals such as ROS is also a main cause of physical ageing in general, and of the skin in particular. While skin is equipped with an elaborate antioxidant system that protects it from oxidative damage, the natural antioxidant pool can be compromised with age, or overwhelmed by oxidative stress, e.g., due to excess UV exposure. Free radicals can attack collagen and elastin causing the structure to break down. With age, the accumulated free radical effects begin to slow down the cell function, therefore reducing the body’s self repair capabilities. Free radical attacks eventually lead to wrinkles, sagging skin, and“age spots.” There exists an ongoing need to provide additional or improved avenues to prevent or reduce oxidative stress and its harmful effects on the skin in both therapeutic and cosmetic contexts.
- the present inventors previously characterised the protein RoxP (radical oxygenase of Propionibacterium acnes ) abundantly expressed by C. ctcnes isolates, and showed that RoxP exhibits antioxidant activity in certain in vitro conditions, and can support C. acnes growth in aerobic settings in vitro and the colonization of human skin explants ex vivo (Allhom et al. 2016 Sci Rep 6:36412).
- RoxP radical oxygenase of Propionibacterium acnes
- the present invention is at least in part based on the unexpected discovery that RoxP protects human skin from oxidative damage in therapeutically and cosmetically relevant model systems, and that reduced skin quantity of RoxP correlates with oxidative stress-associated skin diseases in humans.
- an aspect provides a cosmetic use of a composition comprising a live Cutibacterium acnes strain secreting RoxP (radical oxygenase of Propionibacterium acnes ) for preventing or reducing skin ageing in a subject.
- RoxP radical oxygenase of Propionibacterium acnes
- a related aspect provides a cosmetic method for preventing or reducing skin ageing in a subject, the method comprising administering to the skin of the subject a cosmetically effective amount of a composition comprising a live C. acnes strain secreting RoxP.
- compositions comprising a live C. acnes strain secreting RoxP for use in a method of preventing or treating an oxidative stress-associated skin disease.
- a related aspect provides a method for preventing or treating an oxidative stress-associated skin disease in a subject in need thereof, the method comprising administering to the skin of the subject a prophylactically or therapeutically effective amount of a composition comprising a live C. acnes strain secreting RoxP.
- Another related aspect provides use of a composition comprising a live C. acnes strain secreting RoxP for the manufacture of a medicament for use in a method of preventing or treating an oxidative stress-associated skin disease.
- a further related aspect provides use of a composition comprising a live C. acnes strain secreting RoxP for preventing or treating an oxidative stress-associated skin disease.
- a further aspect provides a cosmetic use of a composition comprising RoxP or a biologically active variant or fragment thereof for preventing or reducing skin ageing in a subject.
- a related aspect provides a cosmetic method for preventing or reducing skin ageing in a subject, the method comprising administering to the skin of the subject a cosmetically effective amount of a composition comprising RoxP or a biologically active variant or fragment thereof.
- compositions comprising RoxP or a biologically active variant or fragment thereof for use in a method of preventing or treating an oxidative stress-associated skin disease.
- a related aspect provides a method for preventing or treating an oxidative stress-associated skin disease in a subject in need thereof, the method comprising administering to the skin of the subject a prophylactically or therapeutically effective amount of a composition comprising RoxP or a biologically active variant or fragment thereof.
- Another related aspect provides use of a composition comprising RoxP or a biologically active variant or fragment thereof for the manufacture of a medicament for use in a method of preventing or treating an oxidative stress- associated skin disease.
- a further related aspect provides use of a composition comprising RoxP or a biologically active variant or fragment thereof for preventing or treating an oxidative stress- associated skin disease.
- a further aspect provides a method for diagnosing oxidative stress-associated skin disease in a subject or for determining whether a subject would benefit from administration of RoxP or a live C. acnes strain secreting RoxP, the method comprising determining the quantity of RoxP or the quantity of C. acnes in a skin sample from the subject.
- a related aspect provides a method comprising determining the quantity of RoxP or the quantity of C. acnes in a skin sample from a subject suspected of having or being at risk of having an oxidative stress-associated skin disease, or suspected to benefit from administration of RoxP or a live C. acnes strain secreting RoxP.
- Such diagnostic methods can also be employed to select subjects as having or being at risk of having an oxidative stress-associated skin disease, or as ones that would benefit from administration of a live C. acnes strain secreting RoxP or from administration of RoxP.
- the so- selected subjects can undergo the prophylactic or therapeutic interventions disclosed herein comprising the administration of a live C. acnes strain secreting RoxP or administration of RoxP or a biologically active variant or fragment thereof.
- the so-selected subjects can also undergo other prophylactic or therapeutic interventions useful for treating the respective oxidative stress-associated skin disease.
- Figure 1 roxP expression in different C. a cues phylotypes.
- qPCR quantifications of roxP mRNA were run in biological and technological duplicates, normalized against gapdh transcripts and evaluated using double delta Cq analysis. Grouped with their respective phylotypes, statistical significance was subsequently determined through a student’s t-test. *** p ⁇ 0.001, **** p ⁇ 0.0001.
- Figure 2 Fifteen different strains of C. acnes were cultured in TSB under anaerobic (solid line) or aerobic (dashed line) conditions for 5-7 days. Certain strains (A) showed no significant difference between oxic and anoxic growth, (B) were favouring aerobic growth mainly in the late exponential phase, or (C) had an increased lag time in aerobic conditions. Lines coloured in black represent strains expressing the most common RoxP homologue, and grey lines represent strains expressing the less common protein variant. The Y-axis describes OD 6 oo and the X-axis represents time (days).
- FIG. 4 RoxP antioxidant activity under adverse conditions. The ability of RoxP to reduce ABTS radical cations, denoted by a decrease in absorbance at 734 nm, was tested in multiple settings. Different concentrations of recombinant RoxP (rRoxP) (0.2-3.2 mM) in sodium phosphate buffer (20 mM, pH 7.4) (A), rRoxP (2.7 mM) incubated with salt solutions (B), pre heated rRoxP (2.7 mM) incubated for 20 min in temperatures ranging from RT to 98°C and allowed to cool down to ambient temperature prior to activity measurements (C), or rRoxP (2 mM) stored at room temperature for up to 2 weeks (D) were added to a solution of pre-formed ABTS + radicals and the absorbance recorded after 30 sec.
- rRoxP recombinant RoxP
- Figure 5 Human monocyte (A) or keratinocyte (B) cell lines were exposed to oxidative stress through addition of paraquat, while adding RoxP momentarily afterwards. Cells were incubated for 24 h (keratinocytes) or 48 h (monocytes) before cell viability was analysed through MTT assays. Representative microscopy visualizations of monocytes after paraquat (C) or paraquat + RoxP (D) are demonstrated. Statistics were calculated using a student’s t-test.
- Figure 7 Box plot of the relative abundances of the five most abundant genera and four most abundant species in the four groups (A). Whiskers shows the 5-95% percentile and median values are shown as vertical lines. Differentially abundant taxa based of LefSe analysis are marked with an *.
- B Determination of relative abundancies of C. acnes phylotypes in AK and BCC. C. acnes type II abundances increase in AK-affected skin sites compared to controls (increase from 15% to 39%), whereas type IA strains decline (from 70% to 45%).
- Figure 8 Alignment of the roxP upstream region of eight C. acnes strains.
- the strains represent the eight dominant roxP upstream sequences, covering the entire C. acnes population (see Figure 9).
- the upstream sequences contain the putative roxP promoter, underlined. This promoter was found using the tool BPROM (Solovyev and Salamov 2011, Automatic Annotation of Microbial Genomes and Metagenomic Sequences. In Metagenomics and its Applications in Agriculture, Biomedicine and Environmental Studies (Ed. R.W. Li), Nova Science Publishers, p. 61-78) (the confidence values (LDF (Linear discriminant function) scores are given in brackets after the strain name).
- BPROM Solovyev and Salamov 2011, Automatic Annotation of Microbial Genomes and Metagenomic Sequences. In Metagenomics and its Applications in Agriculture, Biomedicine and Environmental Studies (Ed. R.W. Li), Nova Science Publishers, p. 61-78)
- LDF Linear discriminant function
- acnes consensus promoter sequence (-10 region: T.A.n.n.n.T and -35 region: G/A.n.T/G.T/G.n.G), identified by Lin et al. (2013 BMC Genomics 14:620) was compared: all mismatched bases are bold italics.
- Type IA strains with the SLST type A and C carry a roxP upstream sequence with a perfect match to the consensus promoter.
- Type II strains represented by strains 09-9 and ATCC 11828 carry mismatches in the -35 region.
- Figure 9 Analysis of the roxP upstream region containing the putative promoter.
- 155 sequenced C. acnes genomes were screened for the roxP upstream region (200 nt). All C. acnes genomes carried this region. Eight dominant sequences were found; representative strains carrying each an individual roxP upstream sequence are shown. The respective upstream regions were phylogenetically compared.
- Most sequenced genomes carried the version represented by strain PA 12.1.L1 : 81 genomes; the other strains represented: PA 15.1.R1, 24 genomes; 09-109, 8 genomes; KPA171202, 11 genomes; PMH5, 4 genomes; 523, 3 genomes; 09-9, 2 genomes; ATCC 11828, 20 genomes.
- the respective type names IA, IB, II, III as well as the SLST types A, C, G, H, K, L of the strains are given in the figure. Type II strains can be found in different clusters.
- Figure 10 Phylogenetic tree of RoxP sequences from C. acnes. Amino acid sequences of RoxP from the investigated C. acnes strains were aligned using a ClustalW algorithm, which separated RoxP into three main types. The first type contained RoxP from strains PMH-7 and PMH-5 (both belonging to phylotype III), the second type contained RoxP from strains PA_12_1_R1, PA_21_1_L1, PA_12_1_L1, PA_15_1_R1, KPA171202, 09-23, and
- PA 30 2 L1 (all but one belonging to phylotype I; strain 09-23 belongs to phylotype II), the third type contained RoxP from strains AD24, 10-43, 09-09, 09-323, and 11-79 (all belonging to phylotype II).
- FIG. 11 Affinity purification of RoxP from bacterial supernatant to high purity using RoxP- based molecular imprint cryogel matrix.
- A Ammonium sulphate precipitated (80%) and re- buffered (100 mM sodium phosphate pH 7.0) supernatant from C. acnes type II strain AD24 were run over a RoxP -based molecular imprint cryogel matrix. The flow-through was collected and bound proteins eluted with 500 mM imidazole. PageRulerTM Prestained Protein Ladder (Thermo Scientific) was used as a molecular weight determinant.
- B Original gel.
- Figure 12 Calibration curve for determination of RoxP concentrations in skin swab samples using a capacitive biosensor.
- Figure 13 Prevalence of RoxP in patients with BCC. Individuals with either basal cell carcinoma (grey) or actinic keratosis (black) were swabbed at diseased (affected) and healthy (non-affected) regions of the skin. Absolute quantity of RoxP was determined by RoxP-MIP capacitive biosensor measurements. The analysis includes only those individuals from whom two matching data points could be successfully computed.
- Figure 14 Relative abundance of the most abundant genera (all other genera clustered in the “Other” group) in the four groups: AKC (actinic keratosis: healthy skin site), AKS (actinic keratosis: affected skin site), BCCC (basal cell carcinoma: healthy skin site), and BCCS (basal cell carcinoma: affected skin site).
- FIG. 15 Morphology evaluation of reconstituted human epidermis (RHEs) exposed to UV stress.
- RHEs human epidermis
- A Negative control 1 - unstressed RHEs without RoxP-enriched C. acnes supernatant
- B Negative control 2 - unstressed RHEs with C. acnes supernatant at 10% v/v
- C Positive control 1 - RHEs stressed with UV
- D Test 1 - RHEs stressed with UV in the presence of RoxP-enriched C. acnes supernatant at 10% v/v.
- Figure 16 DNA damage / CPDs evaluation of RHEs exposed to UV stress.
- A Negative control 1 - unstressed RHEs without RoxP-enriched C. acnes supernatant
- B Negative control 2 - unstressed RHEs with RoxP-enriched C. acnes supernatant at 10% v/v
- C Positive control
- FIG. 17 DNA damage / 8-OHdG evaluation of RHEs exposed to UV stress.
- A Negative control 1 - unstressed RHEs without RoxP-enriched C. acnes supernatant
- B Negative control
- Figure 18 System detoxification evaluation (GPx analysis) of RHEs exposed to UV or ozone stress.
- Negative control 1 - unstressed RHEs without RoxP-enriched C. acnes supernatant Negative control 2 - unstressed RHEs with RoxP-enriched C. acnes supernatant at 10% v/v
- Positive control 1 - RHEs stressed with UV Test 1 - RHEs stressed with UV in the presence of RoxP-enriched C. acnes supernatant at 10% v/v
- Positive control 2 - RHEs stressed with ozone Test 2 - RHEs stressed with ozone in the presence of RoxP-enriched C. acnes supernatant at 10% v/v.
- Figure 19 Apoptosis evaluation (active caspase-3) evaluation of RHEs exposed to UV stress.
- Negative control 1 unstressed RHEs without RoxP-enriched C. acnes supernatant
- Negative control 2 unstressed RHEs with RoxP-enriched C. acnes supernatant at 10% v/v
- C Positive control 1 - RHEs stressed with UV
- D Test 1 - RHEs stressed with UV in the presence of RoxP-enriched C. acnes supernatant at 10% v/v
- E Quantification of the results shown in (A)-(D), bar #1 Negative control 1, bar #2 Negative control 2, bar #3 Positive control 1, bar #4 Test 1.
- Figure 20 ABTS radical cation assay using RoxP-Peptide 1 (dotted curve) or RoxP-Peptide 2 (dashed curve), and water as a control (dashed and dotted curve).
- A kinetics analysis
- B assay of concentration dependence.
- FIG. 21 ORAC (oxygen radical absorbance capacity) assay using RoxP-Peptide 1 (A) or RoxP-Peptide 2 (B).
- Figure 27 Flavins and RoxP activity in ABTS reduction assays.
- Figure 28 Treatment areas 1 to 6 and irradiation areas in the study according to Example 19.
- Figure 29 Skin color a* (erythema) by Chromameter in an in vivo study of RoxP (raw data).
- Figure 30 Skin color a* (erythema) by Chromameter in an in vivo study of RoxP (differences to baseline).
- the terms“about” or“approximately” as used herein when referring to a measurable value such as a parameter, an amount, a temporal duration, and the like, are meant to encompass variations of and from the specified value, such as variations of +/-10% or less, preferably +/- 5% or less, more preferably +1-1% or less, and still more preferably +/-0.1% or less of and from the specified value, insofar such variations are appropriate to perform in the disclosed invention. It is to be understood that the value to which the modifier“about” or“approximately” refers is itself also specifically, and preferably, disclosed.
- “one or more” or“at least one”, such as one or more members or at least one member of a group of members, is clear per se, by means of further exemplification, the term encompasses inter alia a reference to any one of said members, or to any two or more of said members, such as, e.g., any >3, >4, >5, >6 or >7 etc. of said members, and up to all said members.
- “one or more” or“at least one” may refer to 1, 2, 3, 4, 5, 6, 7 or more.
- the inventors for the first time identified and validated RoxP or C. a cues bacteria secreting RoxP as useful actives for cosmetic, prophylactic or therapeutic interventions to prevent or reduce skin ageing, or to prevent or treat oxidative stress-associated skin diseases in subjects.
- the experimental section demonstrates that the compositions described herein have antioxidant properties.
- the cosmetic, prophylactic or therapeutic approaches disclosed herein may operate by protecting skin cells and/or cellular or extracellular components of the skin, such as proteins, lipids or nucleic acids, from oxidative stress, particularly by quenching or neutralising free radicals including reactive oxygen species (ROS) in the skin by the RoxP administered to the skin or delivered to the skin by C. a cues bacteria secreting RoxP.
- ROS reactive oxygen species
- an aspect of the invention provides a cosmetic use of a composition comprising a live Cutibacterium acnes strain secreting RoxP (radical oxygenase of Propionibacterium acnes ) for preventing or reducing skin ageing in a subject.
- a related aspect provides a cosmetic method for preventing or reducing skin ageing in a subject, the method comprising administering to the skin of the subject a cosmetically effective amount of a composition comprising a live C. acnes strain secreting RoxP.
- compositions comprising a live C. acnes strain secreting RoxP for use in a method of preventing or treating an oxidative stress-associated skin disease.
- Related aspects provide: a method for preventing or treating an oxidative stress-associated skin disease in a subject in need thereof, the method comprising administering to the skin of the subject a prophylactically or therapeutically effective amount of a composition comprising a live C. acnes strain secreting RoxP; use of a composition comprising a live C. acnes strain secreting RoxP for the manufacture of a medicament for use in a method of preventing or treating an oxidative stress-associated skin disease; or use of a composition comprising a live C. acnes strain secreting RoxP for preventing or treating an oxidative stress-associated skin disease.
- a further aspect provides a cosmetic use of a composition comprising RoxP or a biologically active variant or fragment thereof for preventing or reducing skin ageing in a subject.
- a related aspect provides a cosmetic method for preventing or reducing skin ageing in a subject, the method comprising administering to the skin of the subject a cosmetically effective amount of a composition comprising RoxP or a biologically active variant or fragment thereof.
- compositions comprising RoxP or a biologically active variant or fragment thereof for use in a method of preventing or treating an oxidative stress-associated skin disease.
- Related aspects provide: a method for preventing or treating an oxidative stress- associated skin disease in a subject in need thereof, the method comprising administering to the skin of the subject a prophylactically or therapeutically effective amount of a composition comprising RoxP or a biologically active variant or fragment thereof; use of a composition comprising RoxP or a biologically active variant or fragment thereof for the manufacture of a medicament for use in a method of preventing or treating an oxidative stress-associated skin disease in a subject; or use of a composition comprising RoxP or a biologically active variant or fragment thereof for preventing or treating an oxidative stress-associated skin disease in a subject.
- Cosmetic uses or methods as envisaged herein address normal, natural, or physiological processes, and can be distinguished from therapy including curative and prophylactic treatments, the purpose of which is to restore a subject from a pathological state to its original healthy condition, or to at least alleviate the symptoms of pain and suffering caused by the pathology, or to prevent pathology in the first place.
- Cosmetic uses or methods as intended herein can thus be denoted as “non-therapeutic”.
- Cosmetic uses or methods as intended herein generally employ cosmetic compositions configured for topical application to the skin.
- skin generally refers to the layer of tissue forming the natural outer covering of the body of animals, in particular vertebrates.
- Mammalian skin is composed of two primary layers: the epidermis which constitutes the outermost layer of the skin, includes stratified squamous epithelium with an underlying basal lamina, and comprises Merkel cells, keratinocytes, melanocytes and Langerhans cells; and the dermis, which constitutes the layer of skin beneath the epidermis, and comprises connective tissue, mechanoreceptors, hair follicles, sweat glands, sebaceous glands, apocrine glands, lymphatic vessels and blood vessels.
- skin includes without limitation the skin on or in the face, neck, chest, abdomen, back, arms, hands, legs, and scalp.
- ageing constitutes a natural, physiological process or‘the greatest disease of them all’
- ageing generally refer to the process of growing old, separate from any age-related pathology, whereby subjects display the normal, natural or physiological effects or characteristics of increasing age.
- the present cosmetic uses or methods may prevent or reduce the appearance of one or more external signs of the ageing of the skin.
- the one or more external signs of the ageing of the skin may be perceivable by visual or tactile inspection.
- the one or more external signs of the ageing of the skin may be visible by naked eye.
- the one or more external signs of the ageing of the skin may be selected from the group comprising, consisting essentially of, or consisting of wrinkles, fine lines, sagging skin, loss of elasticity of skin fibres, withered skin, thinned skin, alteration in skin pigmentation, dull skin, skin without radiance, and combinations thereof.
- Signs of skin ageing that may be particularly associated with or caused by oxidative stress include fine lines, wrinkles, alteration in skin pigmentation, and thinned skin.
- the one or more external signs of the ageing of the skin may be selected from the group comprising, consisting essentially of, or consisting of fine lines, wrinkles, alteration in skin pigmentation, thinned skin, and combinations thereof.
- the present cosmetic uses or methods may be applied to a subject not yet displaying one or more external signs of skin ageing, and may prevent, such as prevent for a given duration of time (delay), the onset or arrival of said one or more external signs of skin ageing.
- the present cosmetic uses or methods may be applied to a subject already displaying one or more external signs of skin ageing, and may either lessen said one or more external signs (restoration, improvement) or may thwart or slow down further development or worsening of said one or more external signs (maintenance, management).
- the term“to reduce” can be interchangeable with terms such as“to decrease”,“to inhibit”,“to diminish”,“to interfere with”, or“to slow down”.
- composition generally refers to a thing composed of two or more components, and more specifically denotes a combination or mixture of two or more materials, such as elements, molecules or substances, as well as reaction products and decomposition products formed from the materials of the composition.
- present compositions may be configured as cosmetic compositions or as pharmaceutical compositions.
- Cosmetic compositions typically comprise one or more cosmetically active ingredients (chemically and/or biologically active substances having one or more cosmetic effects) and one or more cosmetically acceptable carriers.
- Pharmaceutical compositions typically comprise one or more pharmacologically active ingredients (chemically and/or biologically active substances having one or more pharmacological effects) and one or more pharmaceutically acceptable carriers.
- Compositions as typically used herein may be liquid or solid, and may include solutions or dispersions.
- a composition may be composed of components that are provided to a consumer or a practitioner as a mixture, i.e., the composition components are already admixed.
- a composition may be composed of components one or more of which are provided to a consumer or practitioner physically separated from (e.g., in separate containers or vials) from one or more other components of the composition, although typically as part of the same product package or dispensing device.
- the composition may comprise one or more components provided in one container, such as one chamber of a multiple-chamber device (e.g., a two-chamber dispensing system), and one or more components provided in another container, such as another chamber of the multiple-chamber device.
- the composition may comprise the live Cutibacterium acnes strain or strains secreting RoxP as taught herein provided in one container, such as one chamber of a multiple-chamber device (e.g., a two-chamber dispensing system), and one or more cosmetically or pharmaceutically acceptable carriers provided in another container, such as another chamber of the multiple-chamber device, to be admixed by the consumer or practitioner before use.
- a multiple-chamber device e.g., a two-chamber dispensing system
- Cosmetically or pharmaceutically acceptable carriers provided in another container, such as another chamber of the multiple-chamber device, to be admixed by the consumer or practitioner before use.
- Multiple-chamber (such as two- or dual chamber) dispensers such as bottles, tubes, jars, pumps, etc. are generally known and commercially available.
- WO 2012/153206, WO 2017/168263, and WO 2018/060799 by Bormioli Rocco SPA describe systems, marketed inter alia as the New Shaker® single-dose dispenser, comprising a container and a closure capsule for closing the container, wherein the closure capsule includes an enclosure defined at least partly by a frangible bottom or mouth. Changing the configuration of the frangible bottom or mouth from intact to open allows to mix the previously separated contents of the container and the enclosure directly before use.
- the live Cutibacterium acnes strain or strains secreting RoxP may be in a lyophilised form.
- such form is itself a composition comprising the live Cutibacterium acnes strain or strains and components of a suitable bacterial lyophilisation medium.
- the RoxP or a biologically active variant or fragment thereof may be in a lyophilised form.
- such form is itself a composition comprising the RoxP or biologically active variant or fragment thereof and optionally suitable protein lyophilisation excipient(s).
- a composition may be a mixture
- one or more components of the composition may nonetheless be substantially separated from (substantially not in contact with) one or more other components of the composition.
- dispersions such as colloids or suspensions, which comprise discrete particles dispersed in a continuous phase.
- component(s) of a dispersion which are comprised by the discrete particles will be substantially separated from component(s) of a dispersion comprised by the continuous phase.
- RoxP or a biologically active variant or fragment thereof may be formulated with one or more excipients to form discrete particles in a continuous phase composed of one or more other excipients, or vice versa.
- a live Cutibacterium acnes strain or strains secreting RoxP may be formulated with one or more excipients to form discrete particles in a continuous phase composed of one or more other excipients, or vice versa.
- a dispersion as intended herein may be an emulsion (liquid dispersed phase, liquid continuous phase), sol or suspension (solid dispersed phase, liquid continuous phase), gel (liquid dispersed phase, solid continuous phase), or solid sol (solid dispersed phase, solid continuous phase).
- Another example includes compositions in which one or more components of the composition are admixed and microencapsulated, before being admixed with one or more further components of the composition.
- RoxP or a biologically active variant or fragment thereof may be formulated with one or more excipients and microencapsulated, and the resulting microcapsules may be subsequently formulated with (dispersed in) one or more excipients.
- a live Cutibacterium acnes strain or strains secreting RoxP may be formulated with one or more excipients and microencapsulated, and the resulting microcapsules may be subsequently formulated with (dispersed in) one or more excipients.
- the microencapsulated formulation may be liquid or solid, such as a liquid or solid solution or dispersion.
- the microcapsules may be admixed with a formulation that is liquid or solid, such as a liquid or solid solution or dispersion.
- a formulation that is liquid or solid such as a liquid or solid solution or dispersion.
- Methods for microencapsulation are generally known, and the shell, coating, or membrane of microcapsules may be generally made of materials such as ethyl cellulose, polyvinyl alcohol, gelatin, or sodium alginate.
- a live C. acnes strain or strains or RoxP or a biologically active variant or fragment thereof may be maintained substantially in separation from components of the composition which, while being generally useful in the context of cosmetic or pharmaceutical compositions, may detract from the viability, stability or other desirable characteristics of the active.
- the live Cutibacterium acnes strain or strains secreting RoxP, or the RoxP or a biologically active variant or fragment thereof may be in a lyophilised form; optionally included in one chamber of a two-chamber dispensing system, the other chamber containing a suitable resuspension composition.
- Methods for lyophilisation of bacteria such as C. acnes are generally known (see for example, C Morgan & G Vesey:“Freeze- Drying of Microorganisms”, In: Encyclopedia of Microbiology, 3rd ed., 2009, Academic Press, 162-173).
- C. acnes are generally known (see for example, C Morgan & G Vesey:“Freeze- Drying of Microorganisms”, In: Encyclopedia of Microbiology, 3rd ed., 2009, Academic Press, 162-173).
- acnes strain or strains may be grown in a suitable growth medium as described elsewhere in this specification and harvested in the exponential or stationary phase.
- the bacteria are separated from the media by centrifugation or ultrafiltration and washed in a suitable buffer. After washing the bacteria are resuspended in mixture of excipients stabilising the bacteria.
- excipients include but not limited to sucrose, starch, mannitol, skim milk, bovine serum albumin (BSA), and combinations thereof.
- the excipients mix usually contains an external cryoprotectant (preventing ice crystal formation) an internal lyoprotectant (replacing the water as hydrogen bond donor) and storage stabilisers.
- the critical temperature is determined by an appropriate method, such as lyostat measurement or differential scanning calorimetry.
- the product containing the bacteria and excipients is frozen in the freeze dryer below the critical temperature.
- the programme parameters of the freeze dryer are chosen so that the product stays during entire freeze drying cycle at a temperature below the critical temperature of the mixture. After evaporation of all water from the product it can be removed from the freeze dryer and processed for the final packaging.
- Lyophilised bacteria may be provided as a lyophilised powder, optionally admixed with a solid carrier to increase the volume, or may be dispersed in a suitable oil or combination of oils.
- suitable oils include Simmondsia Chinensis (Jojoba) Seed Oil, Sesamum Indicum (Sesame) Seed Oil, Butyrospermum Parkii (Shea) Butter, Hydrogenated Vegetable Oil, Isoamyl Laurate, Sclerocarya Birrea (Marula) Seed Oil, Helianthus Annuus (Sunflower) Seed Oil, and combinations thereof.
- Such and other oils in particular hydrophilic oils, prevent moisture from reaching the bacteria, thereby preventing rehydration of the bacteria and extending the shelf life of the product.
- Lyophilisation of proteins is also a well-established procedure in the art and typically employs an aqueous solution of the protein to be lyophilised, optionally admixed with one or more suitable lyophilisation excipients, such as trehalose, sucrose, raffinose, maltodextrin, mannitol, and/or dextran.
- suitable lyophilisation excipients such as trehalose, sucrose, raffinose, maltodextrin, mannitol, and/or dextran.
- mannitol and particularly 2-6% w/v, preferably 2-5% w/v, more preferably 2-4% w/v, or even more preferably 2-3% w/v mannitol (relative to the volume of the solution to be lyophilised) was especially advantageous for production of stable cake and preservation of RoxP activity.
- bacteria may be applied without an intermediate lyophilisation step.
- bacteria may be grown to and harvested at exponential phase, pelleted and resuspended in dilute peptone solution (0,25% w/v tryptic peptone in sterile distilled water), which is then thickened with hydroxyethylcellulose (also known as HEC or Natrosol), at a suitable final concentration of bacteria, such as about 10 6 colony forming units per gram.
- HEC hydroxyethylcellulose
- the resulting gel can be stored at -80°C or -20°C or for short term at room temperature before it is applied to subjects.
- the composition is a cosmetic composition comprising a live C. acnes strain secreting RoxP and a cosmetically acceptable carrier.
- the composition is a cosmetic composition comprising RoxP or a biologically active variant or fragment thereof and a cosmetically acceptable carrier.
- the composition is a cosmetic composition comprising both i) a live C. acnes strain secreting RoxP and ii) RoxP or a biologically active variant or fragment thereof, and a cosmetically acceptable carrier.
- the cosmetic compositions may further comprise one or more additional cosmetically active ingredients. Such additional cosmetically active ingredient(s) may be capable of preventing or reducing skin ageing, or may possess cosmetic effects unrelated to skin ageing.
- the composition is a pharmaceutical composition comprising a live C. acnes strain secreting RoxP and a pharmaceutically acceptable carrier.
- the composition is a pharmaceutical composition comprising RoxP or a biologically active variant or fragment thereof and a pharmaceutically acceptable carrier.
- the composition is a pharmaceutical composition comprising both i) a live C. acnes strain secreting RoxP and ii) RoxP or a biologically active variant or fragment thereof, and a pharmaceutically acceptable carrier.
- the pharmaceutical compositions may further comprise one or more additional pharmaceutically active ingredients. Such additional pharmaceutically active ingredient(s) may be capable of preventing or treating the oxidative stress-associated skin disease, or may possess pharmaceutical effects unrelated to said disease.
- such cosmetic or pharmaceutical actives may include skin-applicable anti-oxidants, such as without limitation vitamin C, vitamin A, vitamin E, resveratrol, coenzyme Q10, niacinamide, polyphenols, flavonoids, or combinations thereof.
- skin-applicable anti-oxidants such as without limitation vitamin C, vitamin A, vitamin E, resveratrol, coenzyme Q10, niacinamide, polyphenols, flavonoids, or combinations thereof.
- such cosmetic or pharmaceutical actives may include alpha-lipoic acid, folic acid, phytoene, biotin, alpha-glucosyl rutin, carnitine, camosine, natural and/synthetic isoflavones, flavonoide, creatine, creatinine, taurine, B-alanine, dihydroxyacetone, 8-hexadecene- 1, 16-dicarboxylic acid, glyceryl glucoside, licorice extract, aloe vera, hyaluronic acid, aloe barbadensis leaf juice, (2-hydroxyethyl)urea, niacinamide, vitamin A, or combinations thereof.
- the terms “cosmetically acceptable” or“pharmaceutically acceptable” as used herein are consistent with the art and mean compatible with the other ingredients of a cosmetic or pharmaceutical composition and not deleterious to the recipient thereof.
- compositions comprise a live C. acnes strain secreting RoxP.
- the compositions may comprise exactly one live C. acnes strain secreting RoxP.
- the compositions may comprise two or more live C. acnes strains secreting RoxP.
- the compositions may comprise exactly two live C. acnes strains secreting RoxP.
- the compositions may comprise exactly 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 or may comprise more than 20 live C. acnes strains secreting RoxP.
- the compositions may comprise exactly 3, 4, or 5 live C. acnes strains secreting RoxP.
- Cutibacterium acnes (formerly Propionibacterium acnes ) is a species of facultative anaerobic Gram-positive rod bacteria.
- C. acnes is largely commensal and is an abundant colonizer of human skin fostering in the nutritious environment of sebum rich skin.
- the bacterium causes no symptoms in the majority of carriers, but certain strains have a suggested pro-inflammatory role in acne vulgaris.
- the bacterium is frequently isolated from various orthopaedic implant-associated infections.
- P. acnes comprises four highly distinct evolutionary lineages, known as type IA, IB, II and III that display differences in inflammatory properties, production of virulence determinants and association with various conditions (McDowell et al. 2005 J Clin Microbiol 43:326-334; McDowell et al. 2008 J Med Microbiol 57:218-224; Valanne et al.
- Type IA has been further subdivided into subtypes IA1 and IA2, and type IC has been identified using a multilocus sequence typing scheme (eMLST) based on six housekeeping genes and two putative virulence gene (McDowell et al., 2012 PLoS One 7:e41480). Scholz et al. (2014 PLoS ONE 9:el04199) later developed a single-locus sequence typing (SLST) scheme for P. acnes strains, involving PCR amplification and DNA sequencing of the target locus PPA2385.
- eMLST multilocus sequence typing scheme
- SST single-locus sequence typing
- SLST types for P. acnes strains include SLST types A1 to A24, Bl, Cl to C4, D1 to D3, El to E9, FI to F10, Gl, HI to H5, K1 to K14, and LI to L6.
- Other P. acnes strain typing schemes are know as MLST9, MLST8, and Ribotype schemes, reviewed in Scholz et al., especially Figure 1. Where SLST types are referred to in this specification, the types according to the SLST typing scheme of Scholz et al. are meant.
- Illustrative but non-limiting strains of C. acnes useful herein can be obtained from public microorganism collections maintained for example by Leibniz Institute DSMZ-German Collection of Microorganisms and Cell Cultures (Inhoffenstr. 7B, D-38124 Braunschweig, Germany, https://www.dsmz.de/catalogues.html), or by American Type Culture Collection (ATCC) (10801 University Boulevard. Manassas, Virginia 20110-2209, USA) or by European Collection of Cell Cultures (ECACC) (Health Protection Agency - Porton Down Salisbury, Wiltshire SP4 0JG, United Kingdom), including C. acnes strain KPA171202 (DSMZ acc. no. DSM-16379), C.
- ATCC American Type Culture Collection
- ECACC European Collection of Cell Cultures
- acnes subsp. defendens strain acc. no. ATCC 11828
- C. acnes strain acc. no. ATCC 6919
- C. acnes subsp. elongatum strain ECACC acc. no. NCTC 13655
- C. acnes strains of virtually any type or subtype useful herein can be readily sampled and isolated from the skin of adult humans, preferably healthy adults, or from C. acnes biofilms on infected orthopaedic prostheses. Any available protocol for isolation, culture and expansion of C. acnes can be adopted.
- a composition can be formed by isolating and culturing one or more C. acnes from a donor subject, particularly a donor subject not having oxidative stress-associated skin disease and preferably a donor subject having overall healthy skin, and combining it with other one or more carriers to form the composition.
- acnes using routine microbiological criteria, including characteristic macroscopic appearance (typical small colonies), Gram-staining characteristics, and the production of catalase and indole. Isolates were frozen at -80°C in glycerol (50% v/v). The bacteria could be further cultivated in Bacto Brain Heart Infusion broth (BHI; Becton and Dickinson, Sparks, MD, USA) supplemented with glucose (0.5%) and kept in an anaerobic chamber for 72 h at 37°C. When performed on 48 healthy individuals, this yielded 48 C. acnes isolates belonging to types IA, IB, II (see Table 2 of Holmberg et al., incorporated by reference herein).
- C. acnes cells can be further cultured and expanded in a variety of media, including rich or minimal media, preferably rich media such as those mentioned above.
- Media can be supplemented with various additional components, including sugar sources.
- Some non-limiting examples of supplemental components include glucose, amino acids, vitamins, lipids, glycerol, and ATCC Trace Mineral Supplement.
- other aspects of the medium, and growth conditions of the cells of the invention can be optimised through routine experimentation. For example, pH, temperature, and concentration of components within the compositions are non-limiting examples of factors which can be optimised. Liquid and/or solid cultures used to grow C.
- acnes cells can be housed in any of the culture vessels known and used in the art.
- the C. acnes strains are grown in batches.
- the bacterial strains are grown in fermenters.
- compositions comprising the bacterial strains are packaged.
- compositions comprising the bacterial strains are packaged in enteral syringes or sachets.
- the bacterial strains may be freeze-dried.
- acnes could be identified and selected based on their expression of active linoleic acid isomerase which specifically converts cis-9, cis-12 linoleic acid into trans-10, cis-12 linoleic acid. Accordingly, in certain embodiments, the C. acnes strain or strains as intended herein are not associated with, do not contribute to and are not causative of acne. Such C. acnes strains can be readily isolated from healthy human skin (as opposed to human skin affected by acne).
- strain is well-understood as a low-level taxonomic rank used within a species.
- a strain may be typically defined operatively - a strain is made up of the descendants of a single isolation in pure culture and usually is made up of a succession of cultures ultimately derived from an initial single colony; or alternatively, as an isolate or group of isolates that can be distinguished from other isolates of the same genus and species by phenotypic characteristics or genotypic characteristics or both.
- the term“strain” may be synonymous with the operative terms“isolate” or “clone”.
- live as used herein is synonymous with“viable” and refers to any living intact state of a microorganism, such as active growth or dormancy, from which state it can multiply and/or reproduce itself in a medium capable of supporting the growth of the microorganism.
- substantially all C. acnes bacteria comprised by the compositions intended herein may be live or viable.
- at least 50%, preferably at least 60%, more preferably at least 75%, still more preferably at least 90%, such as at least 95%, 96%, 97%, 98%, 99% or 100% of the bacteria in the composition are viable, such as capable of forming colonies when plated on a suitable solid medium.
- the C. acnes strain is capable of secreting RoxP.
- the term may more particularly denote the translocation of a polypeptide or protein from a cell interior across the plasma membrane, such that the protein can be released as soluble protein to the extracellular environment (cell supernatant).
- the authors also taught primers to PCR-amplify and sequence the roxP gene from other isolates (see Table 1 of Allhorn et al.), and deposited the RoxP protein sequences of isolates AD9, AD20, AD24, AD26, AS4, AS8, AS23, AS26, and AS39 under Genbank accession numbers AFJ11206.1, AFJ11207.1, AFJ11208.1, AFJ11209.1, AFJ11210.1, AFJ11211.1, AFJ11212.1, AFJ11213.1, and AFJ11214.1, respectively. By analysing an even larger number of C.
- RoxP homologues from various C. acnes strains can be characterised in terms of overall sequence identity to the RoxP protein from C. acnes strain KPA171202 (DSMZ acc. no. DSM-16379).
- amino acid sequence of the native RoxP polypeptide from C. acnes strain KPA171202 is:
- the amino acid sequence of the native RoxP polypeptide from C. acnes strain 266 (showing 99.4% sequence identity to RoxP from KPA171202) is:
- the amino acid sequence of the native RoxP polypeptide from C. acnes strain PMH-7 (showing 97.5% sequence identity to RoxP from KPA171202) is:
- the amino acid sequence of the native RoxP polypeptide from C. acnes strain 09-09 (showing 83.2% sequence identity to RoxP from KPA171202) is: MFV QI AASLAAASTIALGVPGAATPLN GSQLPT GPQ V S VTDPAQHT GPF STATPLTIKVK PSAPCVRADGRQQSLVARVLDDKGHQVWSGTFDESQLIGGTGRGTATFHVGSAAAAF NFHGGKRTTYRALGY C AYPHYYN GTRERLS Q V S VKTFTVDP AIN (SEQ ID NO: 4)
- the amino acid sequence of the native RoxP polypeptide from C. acnes strain AD24 (showing 83% sequence identity to RoxP from KPA171202) is:
- the amino acid sequence of the native RoxP polypeptide from C. acnes strain 09-109 is identical (i.e., 100% sequence identity) to RoxP from KPA171202 (SEQ ID NO: 1).
- RoxP thus denotes the RoxP polypeptide or protein as commonly known under this designation in the art, of any C. acnes strain or isolate.
- the above RoxP sequences or RoxP sequences deposited in sequence databases, or RoxP sequencing obtained by sequencing additional C. acnes strains can be of the RoxP precursor, including a signal peptide that may or may not be proteolytically removed in the secreted RoxP protein.
- protein sequence analysis tools predict that amino acids 1 to 22 of RoxP set forth in the above SEQ ID NO: 1 to 4 constitute respective signal peptides.
- the skilled person can further appreciate that the N-terminal Met residue of RoxP can be post- translationally removed from and thus absent in the secreted RoxP protein.
- the C. acnes strain may secrete RoxP endogenously.
- endogenous or“endogenously” commonly refer to a material, such as a polypeptide, protein, or nucleic acid, which is native to or own to a cell, and does not originate from outside of the cell, such as in particular is not introduced into the cell or into a predecessor of the cell by the action of man.
- an endogenous nucleic acid or gene may be present within the natural genome of the cell, and an endogenous polypeptide or protein may be encoded by the natural genome of the cell.
- the C. ctcnes strain secretes RoxP naturally, and need not be and is not genetically engineered to secrete RoxP.
- the C. acnes strain is not genetically engineered.
- the term“genetically engineered” broadly refers to a cell that has been subjected to recombinant DNA manipulations, resulting for example in a random or directed alteration of its genome, or in transient or stable introduction of exogenous nucleic acid molecule(s).
- a genetically engineered cell displays a genetic makeup not found originally in nature. Hence, preferably in such embodiments, not only is the cell not genetically engineered to secrete RoxP, but also does not contain any other man-made genetic alterations.
- the C. acnes strain, or the or the two or more C. acnes strains individually or collectively, comprised by the present cosmetic or pharmaceutical compositions may secrete, at least 1 pg RoxP per mL of medium when measured in stationary phase, such as for example at least 2 pg/mL, preferably at least 5 pg/mL, more preferably at least 8 pg/mL, and most preferably at least 10 pg/mL, such as at least 15 pg/mL, at least 20 pg/mL, at least 25 pg/mL or at least 30 pg/mL (pg RoxP per mL of medium when measured in stationary phase).
- at least 1 pg RoxP per mL of medium when measured in stationary phase such as for example at least 2 pg/mL, preferably at least 5 pg/mL, more preferably at least 8 pg/mL, and most preferably at least 10 pg/mL, such as at least 15 pg/m
- C. acnes may be cultured in a rich complex medium, such as Trypticase Soy Broth (TSB, available for example from Beckton Dickinson, Franklin Lakes, New Jersey), or Brain Heart Infusion broth (BHI, available for example from Sigma- Aldrich), at 37°C, in anoxic conditions (such as 10% H 2 , 10% CCA, 80% N 2 ), until reaching stationary phase, typically for 3-7 days.
- TBS Trypticase Soy Broth
- BHI Brain Heart Infusion broth
- the supernatant (medium) can be separated from the cells by centrifugation (such as at 3600 g for 10 min).
- Any separation, detection and quantification method may be used to measure the quantity of RoxP in the supernatant / medium.
- Such methods may include densitometric methods, including SDS-PAGE plus Silver or Coomassie staining, biochemical assay methods, including inter alia assays of enzymatic activity, immunological assay methods, such as enzyme-linked immunosorbent assay (ELISA) and ELISPOT based techniques, radioimmunoassay (RIA), Western blot, etc., mass spectrometry (MS) analysis methods, such as matrix-assisted laser desorption/ionisation time-of-flight (MALDI-TOF) MS, chromatography methods, such as high-performance liquid chromatography (HPLC), cation or anion exchange chromatography, size exclusion chromatography (SEC), and the like.
- densitometric methods including SDS-PAGE plus Silver or Coomassie staining
- biochemical assay methods including inter alia assays of enzymatic activity
- the present inventors also extensively characterised naturally-occurring C. acnes RoxP upstream sequences including RoxP promoters, and identified the existence of at least 8 dominant sequences of the RoxP upstream region, set forth in SEQ ID NO: 5 to 12 in Fig. 8.
- the inventors further identified native -10 and -35 box sequences that may be advantageous for achieving high endogenous secretion of RoxP by the C. acnes, and may thus also be employed to select potentially high-expressing C. acnes strains.
- the endogenous RoxP promoter of the C. acnes strain may comprise the nucleic acid sequence as set forth in any one of SEQ ID NO: 5 to 12.
- acnes strains may comprise a nucleic acid sequence which is at least about 80%, preferably at least about 85%, more preferably at least about 90%, such as at least about 91%, at least about 92%, at least about 93%, or at least about 94%, and even more preferably at least about 95%, such as at least about 96%, at least about 97%, at least about 98%, or at least about 99% identical (preferably overall sequence identity) to the nucleic acid sequence as set forth in any one of SEQ ID NO: 5 to 12.
- type I C. acnes strains may be preferred as comparatively high expressors of endogenous RoxP.
- acnes strain or strains is or are type I strains
- the endogenous RoxP promoter of the C. acnes strain or of at least one of the two or more C. acnes strains (particularly wherein the C.
- acnes strain or strains is or are type I strains
- the endogenous RoxP promoter of the C. acnes strain or of at least one of the two or more C. acnes strains (particularly wherein the C.
- acnes strain or strains is or are type I strains
- the endogenous RoxP promoter of the C. acnes strain or of at least one of the two or more C.
- acnes strains may comprise the nucleic acid sequence as set forth in SEQ ID NO: 12, or a nucleic acid sequence which is at least about 80%, preferably at least about 85%, more preferably at least about 90%, such as at least about 91%, at least about 92%, at least about 93%, or at least about 94%, and even more preferably at least about 95%, such as at least about 96%, at least about 97%, at least about 98%, or at least about 99% identical (preferably overall sequence identity) to the nucleic acid sequence as set forth in SEQ ID NO: 12.
- type III C. acnes strains may be preferred as comparatively high expressors of endogenous RoxP.
- acnes strain or strains is or are type III strains
- certain type II C. acnes strains may be preferred as comparatively high expressors of endogenous RoxP.
- acnes strain or strains is or are type II strains
- the endogenous RoxP promoter of the C. acnes strain may comprise a -10 box having a sequence selected from TGCTATACT or TGCTACACT, preferably TGCTATACT.
- TGCTATACT a sequence selected from TGCTATACT or TGCTACACT, preferably TGCTATACT.
- Such -10 box may be frequently found in comparatively high RoxP-expressing type I (including type IA or IB) C. acnes strains, such as for example the strains exemplified in Fig. 8.
- Such -10 box may also be found in some type II C. acnes strains, which may thus be expected to express endogenous RoxP at a comparatively higher level than other type II C.
- acnes strains see for example the type II strain 09-23 in Table 2 having the RoxP promoter of SEQ ID NO: 11). Such -10 box may further be frequently found in comparatively high RoxP-expressing SLST types A, C, H or K (including K5 and Kl) C. acnes strains, such as for example the strains shown in Fig. 8 and Table 2 (see type II/K1 strain 09-23).
- the C. acnes strain, or at least one of the two or more C. acnes strains is a type I C. acnes strain, such as a type IA or type IB C. acnes strain, comprising a -10 box in the endogenous RoxP promoter, said -10 box having a sequence selected from TGCTATACT or TGCTACACT, preferably TGCTATACT.
- the C. acnes strain, or at least one of the two or more C. acnes strains is a type IA C. acnes strain comprising a -10 box in the endogenous RoxP promoter, said -10 box having the sequence TGCTATACT.
- the C. acnes strain is a type IA C. acnes strain comprising a -10 box in the endogenous RoxP promoter, said -10 box having the sequence TGCTATACT.
- the acnes strain, or at least one of the two or more C. acnes strains is a type IB C. acnes strain comprising a -10 box in the endogenous RoxP promoter, said -10 box having the sequence TGCTACACT.
- the C. acnes strain, or at least one of the two or more C. acnes strains is a type II C. acnes strain comprising a -10 box in the endogenous RoxP promoter, said -10 box having the sequence TGCTACACT.
- the C. acnes strain, or at least one of the two or more C. acnes strains is a SLST type A, C, H or K (such as K5 or Kl) C.
- the C. acnes strain comprising a - 10 box in the endogenous RoxP promoter, said -10 box having a sequence selected from TGCTATACT or TGCTACACT.
- the C. acnes strain, or at least one of the two or more C. acnes strains is a SLST type A C. acnes strain comprising a -10 box in the endogenous RoxP promoter, said -10 box having the sequence TGCTATACT.
- the C. acnes strain, or at least one of the two or more C. acnes strains is a SLST type C C. acnes strain comprising a -10 box in the endogenous RoxP promoter, said -10 box having the sequence TGCTATACT.
- the C. acnes strain, or at least one of the two or more C. ctcnes strains is a SLST type H C. ctcnes strain comprising a -10 box in the endogenous RoxP promoter, said -10 box having the sequence TGCTACACT.
- the C. ctcnes strain, or at least one of the two or more C. ctcnes strains is a SLST type K5 or K1 C. ctcnes strain comprising a -10 box in the endogenous RoxP promoter, said -10 box having the sequence TGCTACACT.
- the endogenous RoxP promoter of the C. acnes strain may comprise a -10 box having the sequence TGCTACGCT.
- Such -10 box may be frequently found in comparatively high RoxP-expressing type I (preferably type IA) C. ctcnes strains, such as for example the strain 523 exemplified in Fig. 8.
- Such -10 box may also be found in some type III C. ctcnes strains, which may thus be expected to express endogenous RoxP at a comparatively higher level than other type III C. acnes strains.
- Such -10 box may further be frequently found in comparatively high RoxP- expressing SLST types G or L C. ctcnes strains, such as for example the strains shown in Fig. 8.
- the C. ctcnes strain, or at least one of the two or more C. ctcnes strains is a type I C. ctcnes strain, preferably type IA C. ctcnes strain, comprising a -10 box in the endogenous RoxP promoter, said -10 box having the sequence TGCTACGCT.
- the C. ctcnes strain, or at least one of the two or more C. ctcnes strains is a type III C. acnes strain comprising a -10 box in the endogenous RoxP promoter, said -10 box having the sequence TGCTACGCT.
- the C. ctcnes strain, or at least one of the two or more C. ctcnes strains is a type III C. acnes strain comprising a -10 box in the endogenous RoxP promoter, said -10 box having the sequence TGCTACGCT.
- ctcnes strain or at least one of the two or more C. ctcnes strains, is a SLST type L or G C. ctcnes strain comprising a -10 box in the endogenous RoxP promoter, said -10 box having the sequence TGCTACGCT.
- the endogenous RoxP promoter of the C. ctcnes strain may comprise a -35 box having a sequence selected from ACTTCGAT or ACTTCAAT.
- Such -35 box may be frequently found in comparatively high RoxP-expressing type I (including type IA or IB) C. ctcnes strains, such as for example the strains exemplified in Fig. 8. Such -35 box may also be found in some type II C. ctcnes strains, which may thus be expected to express endogenous RoxP at a comparatively higher level than other type II C. ctcnes strains. Such -35 box may further be frequently found in comparatively high RoxP-expressing SLST types A, C, G, H or K (including K5 and Kl) C. ctcnes strains, such as for example the strains shown in Fig. 8 and Table 2 (see strain 9-23).
- the C. ctcnes strain or at least one of the two or more C. ctcnes strains, is a type I C. ctcnes strain, such as a type IA or type IB C. ctcnes strain, comprising a -35 box in the endogenous RoxP promoter, said -35 box having a sequence selected from ACTTCGAT or ACTTCAAT.
- the C. acnes strain, or at least one of the two or more C. ctcnes strains is a type IA C.
- the C. acnes strain, or at least one of the two or more C. acnes strains is a type IB C. ctcnes strain comprising a -35 box in the endogenous RoxP promoter, said -35 box having the sequence ACTTCGAT.
- the C. ctcnes strain, or at least one of the two or more C. ctcnes strains is a type II C.
- the C. ctcnes strain comprising a -35 box in the endogenous RoxP promoter, said -35 box having the sequence ACTTCGAT.
- the C. ctcnes strain, or at least one of the two or more C. ctcnes strains is a SLST type A, C, G, H or K (such as K5 and Kl) C. ctcnes strain comprising a -35 box in the endogenous RoxP promoter, said -35 box having a sequence selected from ACTTCGAT or ACTTCAAT.
- ctcnes strains is a SLST type A, C, H, K5 or Kl C. ctcnes strain comprising a -35 box in the endogenous RoxP promoter, said -35 box having the sequence ACTTCGAT.
- the C. ctcnes strain, or at least one of the two or more C. ctcnes strains is a SLST type G C. ctcnes strain comprising a -35 box in the endogenous RoxP promoter, said -35 box having the sequence ACTTCAAT.
- the endogenous RoxP promoter of the C. ctcnes strain may comprise a -10 box having a sequence selected from TGCTATACT or TGCTACACT, preferably TGCTATACT, and a -35 box having a sequence selected from ACTTCGAT or ACTTCAAT.
- TGCTATACT TGCTATACT
- ACTTCGAT ACTTCAAT
- the C. ctcnes strain, or at least one of the two or more C. ctcnes strains is a type I C. ctcnes strain, such as a type IA or type IB C. ctcnes strain, comprising a -10 box and a -35 box in the endogenous RoxP promoter, said -10 box having a sequence selected from TGCTATACT or TGCTACACT, preferably TGCTATACT, and said -35 box having a sequence selected from ACTTCGAT or ACTTCAAT.
- the C. ctcnes strain, or at least one of the two or more C. ctcnes strains is a type IA C.
- the C. acnes strain, or at least one of the two or more C. acnes strains is a type IB C. acnes strain comprising a -10 box and a -35 box in the endogenous RoxP promoter, said -10 box having the sequence TGCTACACT and said -35 box having the sequence ACTTCGAT.
- the C. acnes strain, or at least one of the two or more C. acnes strains is a type II C.
- the C. acnes strain comprising a -10 box and a -35 box in the endogenous RoxP promoter, said -10 box having the sequence TGCTACACT and said -35 box having the sequence ACTTCGAT.
- the C. acnes strain, or at least one of the two or more C. acnes strains is a SLST type A, C, H or K (such as K5 or Kl) C. acnes strain comprising a -10 box and a -35 box in the endogenous RoxP promoter, said -10 box having a sequence selected from TGCTATACT or TGCTACACT and said -35 box having a sequence selected from ACTTCGAT or ACTTCAAT.
- the C. acnes strain is a SLST type A, C, H or K (such as K5 or Kl) C. acnes strain comprising a -10 box and a -35 box in the endogenous RoxP promoter, said -10 box having a sequence selected from TGCTATACT or
- the C. acnes strain, or at least one of the two or more C. acnes strains is a SLST type G C. acnes strain comprising a -10 box and a -35 box in the endogenous RoxP promoter, said -10 box having the sequence TGCTACGCT and said -35 box having the sequence ACTTCAAT.
- the C. acnes strain, or at least one of the two or more C. acnes strains is a SLST type A C. acnes strain comprising a -10 box and a -35 box in the endogenous RoxP promoter, said -10 box having the sequence TGCTATACT and said -35 box having the sequence ACTTCGAT.
- the C. acnes strain, or at least one of the two or more C. acnes strains is a SLST type G C. acnes strain comprising a -10 box and a -35 box in the endogenous RoxP promoter, said -10 box having the sequence TGCTACGCT and said -35 box having
- the acnes strain, or at least one of the two or more C. acnes strains is a SLST type C C. acnes strain comprising a -10 box and a -35 box in the endogenous RoxP promoter, said -10 box having the sequence TGCTATACT and said -35 box having the sequence ACTTCGAT.
- the C. acnes strain, or at least one of the two or more C. acnes strains is a SLST type H C. acnes strain comprising a -10 box and a -35 box in the endogenous RoxP promoter, said -10 box having the sequence TGCTACACT and said -35 box having the sequence ACTTCGAT.
- the C. acnes strain, or at least one of the two or more C. acnes strains is a SLST type H C. acnes strain comprising a -10 box and a -35 box in the endogenous RoxP promoter, said -10 box having the sequence TGCTACACT and said -35 box having the sequence
- acnes strain or at least one of the two or more C. acnes strains, is a SLST type K5 or Kl C. acnes strain comprising a -10 box and a -35 box in the endogenous RoxP promoter, said -10 box having the sequence TGCTACACT and said -35 box having the sequence ACTTCGAT.
- the C. acnes strain or strains comprised by the present cosmetic or pharmaceutical compositions may be of any type.
- the C. acnes strain, or at least one of the two or more C. acnes strains each independently, comprised by the present cosmetic or pharmaceutical compositions may be a type I, II or III C. acnes.
- type I including subtype IA and IB, C. acnes strains display an advantageously high endogenous secretion of RoxP.
- the C. acnes strain, or at least one of the two or more C. acnes strains each independently may be type I, such as type IA or type IB.
- Type IA strains may be particularly preferred.
- the C. acnes strain, or at least one of the two or more C. a cues strains each independently may be type III.
- the C. acnes strain, or at least one of the two or more C. acnes strains each independently may be type I or III.
- the C. acnes strain, or at least one of the two or more C. acnes strains each independently may be type IA, IB or III.
- the C. acnes strain, or at least one of the two or more C. acnes strains each independently may be type II.
- High RoxP-expressing C. acnes strains type II may be particularly advantageous herein, since type II strains have been typically reported as not associated with acne, i.e., associated with normal or healthy skin.
- the C. acnes strain, or at least one of the two or more C. acnes strains each independently may be SLST type Kl, particularly type Kl comprising endogenous RoxP promoter as shown in SEQ ID NO: 11.
- the C. acnes strain, or at least one of the two or more C. acnes strains each independently may be type IA, IB, II or III.
- the C. acnes strain or strains comprised by the present cosmetic or pharmaceutical compositions may be of any SLST type.
- the present inventors further realised that some SLST types may be preferred, for example because of their high secretion of RoxP and/or other characteristics (e.g., not being associated with acne).
- the C. acnes strain, or at least one of the two or more C. acnes strains each independently, comprised by the present cosmetic or pharmaceutical compositions may be SLST type A, C, G, H, L or K (such as K5 or Kl).
- SLST types A or C including type IA strains may be particularly preferred.
- the C. acnes strain or strains may be selected from the group comprising, consisting essentially of or consisting of any one of the strains shown in the drawings, such as PM H5, 09-09, ATCC11828, 523, PM H7, 12.1.R1, 12.1.L1, KPA171202, 15.1.R1, 09-23, 266, 21.1.L1, 09-323, 09-109, 11-79, 30.2.L1, 10-43, AD24, and combinations thereof.
- the C. acnes strain or strains comprised by the present cosmetic or pharmaceutical compositions may grow equally well under aerobic and anaerobic conditions.
- the C. ctcnes strain, or the or the two or more C. ctcnes strains individually or collectively, comprised by the present cosmetic or pharmaceutical compositions may be present in the composition at any amount compatible with the desired cosmetic, prophylactic or therapeutic effect of the compositions.
- the C. acnes strain is, or the two or more C. acnes strains individually or collectively are, present in the composition at an amount of at least 100 colony forming units (CFU) per gram of the composition.
- the C. acnes strain is, or the two or more C.
- acnes strains individually or collectively are, present in the composition at an amount of at least 200, at least 500, at least 1000, at least 5000, at least lxlO 4 , at least 5x10 4 , at least lxlO 5 , at least 5x10 5 , or at least at least lxlO 6 CFU per gram of the composition.
- the C. acnes strain is, or the two or more C. acnes strains individually or collectively are, present in the composition at an amount of less than lxlO 4 , or less than lxlO 3 , or less than 500, or less than 200 CFU per gram of the composition.
- the protein or polypeptide may be isolated or purified from a naturally- occurring source of RoxP, such as from a RoxP-expressing C. acnes strain, or may be produced recombinantly by a suitable host cell or host organism expression system and isolated therefrom, or may be produced recombinantly by cell-free transcription or translation, or by non-biological peptide synthesis.
- a naturally- occurring source of RoxP such as from a RoxP-expressing C. acnes strain
- a suitable host cell or host organism expression system and isolated therefrom or may be produced recombinantly by cell-free transcription or translation, or by non-biological peptide synthesis.
- the reference to RoxP or a biologically active variant or fragment thereof encompasses naturally, recombinantly, semi-synthetically or synthetically produced proteins.
- purified in this context does not require absolute purity. Instead, it denotes that a protein or polypeptide is in a discrete environment in which its abundance (conveniently expressed in terms of mass or weight or concentration) relative to other components is greater than in the original material.
- a discrete environment denotes a single medium, such as for example a single solution, gel, precipitate, lyophilisate, etc.
- Purified proteins or polypeptides may preferably constitute by weight > 10%, more preferably > 50%, such as > 60%, yet more preferably > 70%, such as > 80%, and still more preferably > 90%, such as > 95%, > 96%, > 97%, > 98%, > 99% or even 100%, of the protein content of the discrete environment.
- Protein content may be determined, e.g., by the Lowry method (Lowry et al. 1951 J Biol Chem 193:265), optionally as described by Hartree 1972 Anal Biochem 48:422-427. Purity of peptides, polypeptides, or proteins may be determined by SDS-PAGE under reducing or non reducing conditions using Coomassie blue or, preferably, silver stain. Illustrative but non-limiting ways to isolate or purify native RoxP secreted by C. acnes are set forth in the Examples section. For example, the methodology of Allhom et al. 2016 ⁇ supra) may be adopted.
- acnes grown to stationary phase is collected by centrifugation at 3600 g for 10 min; the culture supernatant is sterile filtered (0.22 m m) and precipitated with 50% ammonium sulphate; the pellet is resolved in 10 mM Tris-HCl pH 8.8 and dialyzed overnight (MWCO 3,500); the sample is loaded on an equilibrated HiTrap Q FF column (GE Healthcare, Uppsala, Sweden), and eluted with 50 mM NaCl (10 mM Tris-HCl pH 8.8); a second dialysis is performed (50 mM NaOAc-HOAc pH 5.0); samples are run on a HiTrap SP FF column (GE Healthcare), and eluted with 100 mM NaCl (50 mM NaOAc-HOAc pH 5.0).
- fractions are run through a 50 kDa MWCO-filter (Amicon Ultra, Ultracel- 50K).
- a combination of ammonium sulphate precipitation of C. acnes supernatant and purification on a cryogel column can be employed.
- C. acnes supernatant can be concentrated by Tangential flow filtrations, using a 30kDa cut-off in a first step and a 3kDa cut-off in a second step.
- the composition may comprise, consist essentially of or consist of the supernatant of a cultured live C. acnes strain secreting RoxP, preferably endogenously secreting RoxP.
- the composition may comprise, consist essentially of or consist of a RoxP-enriched fraction of the supernatant of a cultured live C. acnes strain secreting RoxP, preferably endogenously secreting RoxP.
- the term“Rox-P enriched fraction” of the supernatant denotes a fraction or a discrete environment obtained by processing the supernatant, in which the abundance of RoxP is increased compared to the abundance of RoxP in the supernatant.
- RoxP may represent > 50%, such as > 60%, yet more preferably > 70%, such as > 80%, and still more preferably > 90%, such as > 95%, > 96%, > 97%, > 98%, > 99% or even 100%, of the protein content of the enriched fraction.
- RoxP or the biologically active variant or fragment thereof may be produced recombinantly by a suitable host cell or host organism expression system and isolated therefrom.
- an expression cassette or an expression vector is constructed comprising a nucleic acid molecule comprising a nucleic acid sequence encoding RoxP or the biologically active variant or fragment thereof (optionally codon-optimised for expression in a particular host) and a promoter operably linked to the nucleic acid molecule.
- the expression cassette or expression vector is then introduced into suitable host cells or a host organism which allows for the expression and preferably secretion of RoxP or the biologically active variant or fragment thereof. Nucleic acid sequences encoding RoxP are readily available.
- the nucleic acid encoding RoxP from C. acnes isolate AD26 which shows only one mismatch at amino acid level with native RoxP polypeptide from C. acnes strain KPA171202 as shown in SEQ ID NO: 1, is annotated under Genbank accession number JN051668.1.
- Allhorn et al. (2016 Sci Rep 6:36412) taught primers to PCR-amplify and isolate nucleic acid sequence of the roxP gene broadly from various C. acnes isolates.
- promoter refers to a DNA sequence that enables a gene to be transcribed.
- a promoter is recognised by RNA polymerase, which then initiates transcription.
- a promoter contains a DNA sequence that is either bound directly by, or is involved in the recruitment, of RNA polymerase.
- a promoter sequence can also include“enhancer regions”, which are one or more regions of DNA that can be bound with proteins (namely the trans-acting factors) to enhance transcription levels of genes in a gene-cluster.
- the enhancer while typically at the 5’ end of a coding region, can also be separate from a promoter sequence, e.g., can be within an intronic region of a gene or 3’ to the coding region of the gene.
- An“operable linkage” is a linkage in which regulatory sequences and sequences sought to be expressed are connected in such a way as to permit said expression.
- sequences such as, e.g., a promoter and an ORF
- sequences may be said to be operably linked if the nature of the linkage between said sequences does not: (1) result in the introduction of a frame-shift mutation, (2) interfere with the ability of the promoter to direct the transcription of the ORF, (3) interfere with the ability of the ORF to be transcribed from the promoter sequence.
- “operably linked” may mean incorporated into a genetic construct so that expression control sequences, such as a promoter, effectively control expression of a coding sequence of interest.
- the promotor may be a constitutive or inducible (conditional) promoter.
- a constitutive promoter is understood to be a promoter whose expression is constant under the standard culturing conditions.
- Inducible promoters are promoters that are responsive to one or more induction cues.
- an inducible promoter can be chemically regulated (e.g., a promoter whose transcriptional activity is regulated by the presence or absence of a chemical inducing agent such as an alcohol, tetracycline, a steroid, a metal, or other small molecule) or physically regulated (e.g., a promoter whose transcriptional activity is regulated by the presence or absence of a physical inducer such as light or high or low temperatures).
- An inducible promoter can also be indirectly regulated by one or more transcription factors that are themselves directly regulated by chemical or physical cues.
- the host cell may be a bacterial cell, a fungal cell, including yeast cells, an animal cell, or a mammalian cell, including human cells and non-human mammalian cells.
- the host organism may for example be a plant organism whereby the secretion of RoxP or the biologically active variant or fragment thereof is directed to the plant as a whole or to a particular part of the plant such as to leaves; or may be a lactating non-human mammal, whereby the secretion of RoxP or the biologically active variant or fragment thereof is directed to the product of the mammary gland of the mammal.
- Expression systems that can be used for small or large scale production of polypeptides include, without limitation, microorganisms such as bacteria (e.g., Escherichia coli, Yersinia enterocolitica, Brucella sp., Salmonella tymphimurium, Serratia marcescens, or Bacillus subtilis), for example transformed with recombinant bacteriophage DNA, plasmid DNA, or cosmid DNA expression vectors; or fungal cells (e.g., Yarrowia lipolytica, Arxula adeninivorans, methylotrophic yeast (e.g., methylotrophic yeast of the genus Candida, Hansenula, Oogataea, Pichia or Torulopsis, e.g., Pichia pastoris, Hansenula polymorpha, Ogataea minuta, or Pichia methanolica), or filamentous fungi of the genus Aspergillus,
- Useful expression systems also include insect cell systems (e.g., cells derived from Drosophila melanogaster, such as Schneider 2 cells, cell lines derived from the army worm Spodoptera frugiperda, such as Sf9 and Sf21 cells, or cells derived from the cabbage looper Trichoplusia ni, such as High Five cells) infected with recombinant virus expression vectors (e.g., baculovirus) containing the nucleic acid molecules, and plant cell systems infected with recombinant virus expression vectors (e.g., tobacco mosaic virus) or transformed with recombinant plasmid expression vectors (e.g., Ti plasmid).
- insect cell systems e.g., cells derived from Drosophila melanogaster, such as Schneider 2 cells, cell lines derived from the army worm Spodoptera frugiperda, such as Sf9 and Sf21 cells, or cells derived from the cabbage looper Trichoplusia ni,
- Mammalian expression systems include human and non-human mammalian cells, such as rodent cells, primate cells, or human cells.
- Mammalian cells such as human or non-human mammalian cells, may include primary cells, secondary, tertiary etc. cells, or may include immortalised cell lines, including clonal cell lines.
- Preferred animal cells can be readily maintained and transformed in tissue culture.
- Non- limiting example of human cells include the human HeLa (cervical cancer) cell line.
- human cell lines common in tissue culture practice include inter alia human embryonic kidney 293 cells (HEK cells), DU145 (prostate cancer), Lncap (prostate cancer), MCF-7 (breast cancer), MDA-MB-438 (breast cancer), PC3 (prostate cancer), T47D (breast cancer), THP-1 (acute myeloid leukemia), U87 (glioblastoma), SHSY5Y (neuroblastoma), or Saos-2 cells (bone cancer).
- a non-limiting example of primate cells are Vero (African green monkey Chlorocebus kidney epithelial cell line) cells, and COS cells.
- Non- limiting examples of rodent cells are rat GH3 (pituitary tumor), CHO (Chinese hamster ovary), PC 12 (pheochromocytoma) cell lines, or mouse MC3T3 (embryonic calvarium) cell line.
- Such cells prior to the genetic engineering as specified herein, can be obtained from a variety of commercial sources and research resource facilities, such as, for example, the American Type Culture Collection (Rockville, MD).
- Various promoters may be suitable for expression in mammalian cells, e.g., the metallothionein promoter, the adenovirus late promoter, or the cytomegalovirus promoter.
- Such tools and methods for heterologous protein expression are generally well known in the art.
- RoxP or the biologically active variant or fragment thereof may carry one or more co- or post-expression-type modifications of the polypeptide chain, such as, without limitation, glycosylation, acetylation, phosphorylation, sulphonation, methylation, ubiquitination, signal peptide removal, N-terminal Met removal, etc.
- Non-naturally occurring post-translational modifications are also foreseen.
- variant of RoxP encompasses proteins or polypeptides the amino acid sequence of which is substantially identical (i.e., largely but not wholly identical) to the amino acid sequence of RoxP, such as to the amino acid sequence of a native or wild-type C.
- acnes RoxP for example at least about 80% identical or at least about 83% identical or at least about 85% identical, e.g., preferably at least about 90% identical, e.g., at least 91% identical, at least 92% identical, more preferably at least about 93% identical, e.g., at least 94% identical, even more preferably at least about 95% identical, e.g., at least 96% identical, yet more preferably at least about 97% identical, e.g., at least 98% identical, and most preferably at least 99% identical.
- a variant may display such degrees of identity to RoxP when the whole sequence of the variant and RoxP are queried in the sequence alignment (i.e., overall sequence identity).
- the variant may display at least about 80%, or at least about 83%, or at least about 85%, or at least about 90%, or at least about 91%, or at least about 92%, or at least about 93%, or at least about 94%, or at least about 95%, or at least about 96%, or at least about 97%, or at least about 98%, or at least about 99% sequence identity to RoxP of C. acnes strain KPA171202 as set forth in SEQ ID NO: 1 above, or to the portion of said RoxP of SEQ ID NO: 1 lacking the N-terminal signal peptide.
- Sequence identity between proteins or polypeptides or nucleic acids as envisaged herein may be determined using suitable algorithms for performing sequence alignments and determination of sequence identity as know per se.
- suitable algorithms include those based on the Basic Local Alignment Search Tool (BLAST) originally described by Altschul et al.
- Sequence identity as envisaged herein may preferably denote overall sequence identity, i.e., sequence identity calculated from aligning the whole sequences of the compared proteins, polypeptides or nucleic acids.
- An example procedure to determine the percent identity between a particular amino acid sequence and the amino acid sequence of a query polypeptide will entail aligning the two amino acid sequences using the Blast 2 sequences (B12seq) algorithm, available as a web application or as a standalone executable programme (BLAST version 2.2.31+) at the NCBI web site (www.ncbi.nlm.nih.gov), using suitable algorithm parameters.
- the output will not present aligned sequences.
- the number of matches will be determined by counting the number of positions where an identical amino acid residue is presented in both sequences.
- the percent identity is determined by dividing the number of matches by the length of the query polypeptide, followed by multiplying the resulting value by 100.
- the percent identity value may, but need not, be rounded to the nearest tenth. For example, 78.11, 78.12, 78.13, and 78.14 may be rounded down to 78.1, while 78.15, 78.16, 78.17, 78.18, and 78.19 may be rounded up to 78.2.
- RoxP may but need not be a homologue (e.g., orthologue or paralogue) of RoxP.
- homologue e.g., orthologue or paralogue
- the term“homology” generally denotes structural similarity between two macromolecules from same or different taxons, wherein said similarity is due to shared ancestry.
- a variant of RoxP may comprise one or more amino acid additions, deletions, or substitutions relative to (i.e., compared with) the corresponding RoxP protein or polypeptide.
- a variant (substitution variant) of RoxP may comprise up to 30 (e.g., not more than one, two, three, four, five, six, seven, eight, nine, ten, 12, 15, 20, 25, or 30) conservative amino acid substitutions relative to (i.e., compared with) the corresponding RoxP protein or polypeptide; or a variant (substitution variant) of RoxP may comprise up to 30 (e.g., not more than one, two, three, four, five, six, seven, eight, nine, ten, 12, 15, 20, 25, or 30) non conservative amino acid substitutions relative to the corresponding RoxP protein or polypeptide; or a variant (substitution variant) of RoxP may comprise up to 30 (e.g., not more than one, two, three, four, five, six, seven, eight, nine, ten, 12, 15, 20, 25, or 30) conservative and non conservative amino acid substitutions combined relative to the corresponding RoxP protein or polypeptide.
- a conservative amino acid substitution is a substitution of one amino acid for another with similar characteristics.
- Conservative amino acid substitutions include substitutions within the following groups: valine, alanine and glycine; leucine, valine, and isoleucine; aspartic acid and glutamic acid; asparagine and glutamine; serine, cysteine, and threonine; lysine and arginine; and phenylalanine and tyrosine.
- the nonpolar hydrophobic amino acids include alanine, leucine, isoleucine, valine, proline, phenylalanine, tryptophan and methionine.
- the polar neutral amino acids include glycine, serine, threonine, cysteine, tyrosine, asparagine and glutamine.
- the positively charged (i.e., basic) amino acids include arginine, lysine and histidine.
- the negatively charged (i.e., acidic) amino acids include aspartic acid and glutamic acid. Any substitution of one member of the above-mentioned polar, basic, or acidic groups by another member of the same group can be deemed a conservative substitution. By contrast, a non conservative substitution is a substitution of one amino acid for another with dissimilar characteristics.
- a variant (deletion variant) of RoxP may lack up to 30 (e.g., not more than one, two, three, four, five, six, seven, eight, nine, ten, 12, 15, 20, 25, or 30) amino acids relative to the corresponding RoxP protein or polypeptide.
- amino acids When two or more amino acid are deleted, these may non-contiguous or two or more or all of the deleted amino acids may be contiguous in the corresponding RoxP protein or polypeptide.
- the term“fragment” of RoxP typically refers to N-terminally and/or C-terminally deleted or truncated forms of RoxP protein or polypeptide.
- the term encompasses fragments arising by any mechanism, such as, without limitation, by heterologous expression of a truncated form of the full-length RoxP protein or polypeptide, or by physical, chemical or enzymatic proteolysis of the full length RoxP protein or polypeptide in vivo or in vitro.
- a fragment of RoxP may represent at least about 50% (by amino acid number), e.g., at least about 60%, or at least about 70%, or at least about 80%, or at least about 90%, or at least about 91%, or at least about 92%, or at least about 93%, or at least about 94%, or at least about 95%, or at least about 96%, or at least about 97%, or at least about 98%, or at least about 99% of the contiguous amino acid sequence of said RoxP protein or polypeptide.
- a fragment of RoxP may include a sequence of at least about 80, or at least about 90, or at least about 100, or at least about 110, or at least about 120, or at least about 130, or at least about 140, or at least about 150, or at least about 155 consecutive amino acids of the corresponding full-length RoxP protein or polypeptide.
- a fragment of RoxP may be N-terminally and/or C- terminally truncated by between 1 and about 20 amino acids, such as by between 1 and about 15 amino acids, or by between 1 and about 10 amino acids, or by between 1 and about 5 amino acids, compared with the corresponding full-length RoxP protein or polypeptide.
- a fragment of RoxP may comprise, consist essentially of or consist of a contiguous stretch of amino acids corresponding to positions 66-83 of the native RoxP protein shown in SEQ ID NO: 1.
- a fragment of RoxP may include the contiguous stretch of amino acids corresponding to positions 66-83 of the native RoxP protein shown in SEQ ID NO: 1 and may further include: a) 1-5 or 6-10 or 11-15 or 16-20 or 21-30 or 31-50 contiguous amino acids immediately N-terminally adjacent to said stretch in the RoxP protein and/or b) 1-5 or 6-10 or 11-15 or 16-20 or 21-30 or 31-50 contiguous amino acids immediately C-terminally adjacent to said stretch in the RoxP protein.
- a fragment of RoxP may comprise, consist essentially of or consist of the contiguous stretch of amino acids YRADGYQESMVTRVLDDK (SEQ ID NO: 20).
- a fragment of RoxP may be the peptide denoted herein as“RoxP-Peptide 1” the amino acid sequence of which is as set forth in SEQ ID NO: 20.
- RoxP-Peptide 1 was shown to display antioxidant activity.
- a fragment of RoxP may comprise, consist essentially of or consist of a contiguous stretch of amino acids corresponding to positions 128-140 of the native RoxP protein shown in SEQ ID NO: 1.
- a fragment of RoxP may include the contiguous stretch of amino acids corresponding to positions 128-140 of the native RoxP protein shown in SEQ ID NO: 1 and may further include: a) 1-5 or 6-10 or 11-15 or 16-20 or 21-30 or 31-50 contiguous amino acids immediately N-terminally adjacent to said stretch in the RoxP protein and/or b) 1-5 or 6-10 or 11-15 or 16-20 or 21 contiguous amino acids immediately C-terminally adjacent to said stretch in the RoxP protein.
- a fragment of RoxP may comprise, consist essentially of or consist of the contiguous stretch of amino acids RTLSYCAYPHYVN (SEQ ID NO: 21).
- a fragment of RoxP may be the peptide denoted herein as “RoxP-Peptide 2” the amino acid sequence of which is as set forth in SEQ ID NO: 21.
- RoxP-Peptide 2 was shown to display antioxidant activity.
- Reference to“fragment or variant” or“variant or fragment” of any protein or polypeptide encompasses fragments of variants of such protein or polypeptide, and variants of fragments of such protein or polypeptide.
- biologically active is interchangeable with terms such as“functionally active” or “functional”, denoting that the fragment and/or variant at least partly retains the biological activity or intended functionality of the corresponding RoxP protein or polypeptide.
- Reference to the“activity” of a protein or polypeptide, or peptide may generally encompass any one or more aspects of the biological activity of the protein or polypeptide, such as without limitation any one or more aspects of its biochemical activity, enzymatic activity, signalling activity, interaction activity, ligand activity, and/or structural activity, e.g., within a cell, tissue, organ or an organism.
- a biologically active fragment or variant of RoxP shall at least partly retain the antioxidant activity of the corresponding RoxP protein or polypeptide.
- a functionally active fragment or variant of RoxP may retain at least about 20%, e.g., at least about 25%, or at least 30%, or at least about 40%, or at least about 50%, e.g., at least 60%, more preferably at least about 70%, e.g., at least 80%, yet more preferably at least about 85%, still more preferably at least about 90%, and most preferably at least about 95% or even about 100% of the antioxidant activity or functionality compared with the corresponding RoxP protein or polypeptide.
- a functionally active fragment or variant of RoxP may even display higher antioxidant activity or functionality compared with the corresponding RoxP protein or polypeptide, for example may display at least about 100%, or at least about 150%, or at least about 200%, or at least about 300%, or at least about 400%, or at least about 500% of the antioxidant activity or functionality compared with the corresponding RoxP protein or polypeptide.
- a functionally active fragment or variant of RoxP may produce a signal which is at least about 20%, or at least about 25%, or at least 30%, or at least about 40%, or at least about 50%, or at least 60%, more preferably at least about 70%, or at least 80%, or at least about 85%, or at least about 90%, or at least about 95%, or at least about 100%, or at least about 150%, or at least about 200%, or at least about 300%, or at least about 400%, or at least about 500% of the signal produced by the corresponding RoxP protein or polypeptide.
- ABTS radical cation assay ABTS radical cation assay
- Example 4 protection of human cells in vitro from paraquat-caused oxidative damage
- Examples 7-11 protection of reconstituted human epidermis from UV or ozone-caused oxidative damage
- the ABTS radical cation assay may be particularly straightforward and may be preferred.
- RoxP or the biologically active variant or fragment thereof may be comprised by the present cosmetic or pharmaceutical compositions at any amount or quantity compatible with the desired cosmetic, prophylactic or therapeutic effect of the compositions.
- the pharmaceutical compositions may comprise at least lxlO 9 M RoxP or the biologically active variant or fragment thereof, such as for example at least at least lxl 0 8 M, at least 5x10 8 M, at least lxlO 7 M, or at least 5x10 7 M, preferably at least lxlO 6 M, at least 5x10 6 M, at least lxlO 5 M, or at least 5x10 5 M, and more preferably at least lxlO 4 M, such as at least 2xl0 4 M, at least 3xl0 4 M, at least 4xl0 4 M, at least 5xl0 4 M, at least 6xl0 4 M, at least 7xl0 4 M, at least 8xl0 4 M, at least 9xl0 4 M, or at least lx
- the pharmaceutical compositions may comprise between lxlO 9 M and lxlO 3 M, or between lxlO 7 M and lxlO 3 M, or between lxlO 6 M and lxlO 3 M, or between lxlO 5 M and lxlO 3 M, or between lxlO 4 M and lxlO 3 M RoxP or the biologically active variant or fragment thereof.
- the cosmetic compositions may comprise comparable quantities of RoxP or the biologically active variant or fragment thereof, substantially lower quantities may meet the cosmetic expectations of the compositions.
- the cosmetic compositions may comprise lxlO 9 M or less RoxP or the biologically active variant or fragment thereof, such as 5xlO 10 M or less, lxlO 11 M or less, 5xl0 12 M or less, or lxlO 13 M or less RoxP or the biologically active variant or fragment thereof.
- the cosmetic or pharmaceutical composition comprising one or more live C. a cues strains secreting RoxP as taught herein, may further comprise RoxP or the biologically active variant or fragment thereof as taught herein.
- Such compositions will allow for co-administration of both actives as disclosed herein.
- the cosmetic or pharmaceutical composition comprising one or more live C. acnes strains secreting RoxP as taught herein, and the cosmetic or pharmaceutical composition comprising RoxP or the biologically active variant or fragment thereof may be provided as a combined product or kit of parts for simultaneous, separate or sequential (in any order) administration of the respective actives.
- the terms“therapy” or“treatment” refer to the alleviation or measurable lessening of one or more symptoms or measurable markers of a pathological condition such as a disease or disorder. Measurable lessening includes any statistically significant decline in a measurable symptom or marker.
- the terms encompass both curative treatments and treatments directed to reduce symptoms and/or slow progression of the disease.
- the terms encompass both the therapeutic treatment of an already developed pathological condition, as well as prophylactic or preventative measures, wherein the aim is to prevent or lessen the chances of incidence of a pathological condition.
- Beneficial or desired clinical results include, but are not limited to, prevention of a disease, reduction of the incidence of a disease, alleviation of symptoms associated with a disease, diminishment of extent of a disease, stabilisation of the disease, delay or slowing of the progression of a disease, amelioration or palliation of a disease, or combinations thereof.
- the terms may relate to therapeutic treatments.
- the terms may relate to preventative treatments. Treatment of a chronic pathological condition during the period of remission may also be deemed to constitute a therapeutic treatment.
- the term may encompass ex vivo or in vivo treatments as appropriate in the context of the present invention.
- non-human animals typically and preferably denotes humans, but may also encompass reference to non-human animals, preferably warm-blooded animals, even more preferably mammals, such as, e.g., non-human primates, rodents, canines, felines, equines, ovines, porcines, etc.
- non-human animals includes all vertebrates, e.g.,”oxidativ mammals, such as non-human primates, particularly higher primates, sheep, dogs, rodents (e.g., mice or rats), guinea pigs, goats, pigs, cats, rabbits, cows, and non-mammals such as chickens, amphibians, reptiles etc.
- the subject is a non-human animal. In certain embodiments, the subject is a non-human mammal. In certain embodiments, the subject is a transgenic non-human animal or non-human mammal. In preferred embodiments, the subject is human. In other embodiments, the subject is an experimental animal or animal disease model. The term does not denote a particular age or sex, and includes inter alia newborns, children, adolescents, and adults including the elderly, whether male or female.
- Suitable subjects or patients in need of preventing or treating a disease as taught herein include those that would benefit from treating the disease or those in whom said disease is to be prevented.
- Such subjects or patients include without limitation patients presenting to a physician for a screening for the disease, patients presenting to a physician with symptoms and signs indicative of the disease, patients diagnosed with the disease, patients prone to contract or develop the disease, patients who have received or are undergoing treatment of the disease, and patients having a disease as taught herein in remission.
- the term“subject” which does not imply the presence of a pathological condition in the subject, may be preferred over the term“patient”.
- the presence or absence of a need for the subject to receive a given intervention such as treatment may be inferred by various diagnostic or benefit-evaluation methods, including the methods and uses described elsewhere in the specification.
- oxidative stress-associated skin disease broadly refers to diseases or symptoms of diseases associated with, contributed to, caused by or resulting from an imbalance between the production and detoxification of free radicals such as in particular reactive oxygen species (ROS) or reactive nitrogen species (RNS) in favour of the pro-oxidant, in skin tissue or cells leading to tissue or cell damage in the skin.
- ROS reactive oxygen species
- RNS reactive nitrogen species
- Non-limiting examples of ROS include superoxide anion, hydroperoxide anion, hydroxyl radical, singlet oxygen, hypochloride anion, tert-Butyl hydroperoxide, and the like.
- RNS include nitric oxide (NO), peroxynitrite (ONOO ), and the like.
- An oxidative stress-associated skin disease may affect only skin or may affect one or more other tissues or organs in addition to the skin.
- An oxidative stress-associated skin disease may be chronic or acute. Without wishing to be bound to any theory, oxidative stress in the skin may lead to chronic inflammation, which in turn can cause collagen fragmentation and disorganisation of collagen fibres and skin cell functions; moreover oxidative stress was reported to also participate in most if not all stages of carcinogenesis.
- the oxidative stress-associated skin disease is selected from the group comprising, consisting essentially of, or consisting of actinic keratosis (AK), basal cell carcinoma (BCC), squamous cell carcinoma (SCC), dandruff, seborrheic dermatitis, acne, inflammation, dermatitis, psoriasis, eczema, rosacea, urticaria and vitiligo.
- the oxidative stress-associated skin disease is AK.
- the oxidative stress-associated skin disease is BCC.
- the oxidative stress-associated skin disease is SCC.
- the oxidative stress-associated skin disease is dandruff.
- the oxidative stress-associated skin disease is seborrheic dermatitis.
- any such diseases may include components, aspects or processes other than those related to the oxidative stress.
- the present prophylactic uses or methods treat, address or impinge on the oxidative stress component(s), aspect(s) or process(es) of any such disease, for example, they improve or restore the redox balance in the skin tissue or cells.
- the cosmetic uses or methods as taught herein generally comprise administering to the skin of the subject a cosmetically effective amount of the cosmetic composition as taught herein, that is an amount sufficient to elicit the cosmetic effect relating to the prevention or reduction of skin aging in the subject, that is being sought by the cosmetician or beautician, in either a single or multiple doses.
- the prophylactic or therapeutic uses or methods as taught herein generally comprise administering to the skin of the subject a prophylactically or therapeutically effective amount of the pharmaceutical composition as taught herein.
- terapéuticaally effective amount generally denotes an amount sufficient to elicit the pharmacological effect or medicinal response in a subject that is being sought by a medical practitioner such as a medical doctor, clinician, surgeon, veterinarian, or researcher, which may include inter alia alleviation of the symptoms of the disease being treated, in either a single or multiple doses.
- prophylactically effective amount generally denotes an amount sufficient to elicit the preventative effect, such as inhibition or delay of the onset of a disease, in a subject that is being sought by the medical practitioner, in either a single or multiple doses.
- Appropriate cosmetically effective doses of the present compositions may be determined by a cosmetician with due regard to the age and skin condition of the patient.
- compositions described herein to be administered can depend on many different factors and can be determined by one of ordinary skill in the art through routine experimentation. Several non-limiting factors that might be considered include biological activity of the active ingredient, nature of the active ingredient, characteristics of the subject to be treated, etc.
- the term“to administer” generally means to dispense or to apply, and typically includes both in vivo administration and ex vivo administration to a tissue, preferably in vivo administration.
- compositions may be administered systemically or locally. Given the nature of the present cosmetic, prophylactic or therapeutic treatments, and the nature of the active ingredient, the present compositions may be preferably configured for topical administration to the skin of the subject.
- topical administration as generally used in the cosmetic and medical fields denotes the application of compositions directly to a part of the body. Particularly in the present case the term refers to topical administration onto the skin of a subject, more particularly onto the surface of the skin of the subject, and even more particularly onto a part, region or area of the surface of the subject’s skin where the cosmetic or pharmacological effect is sought. Topical administration is typically not intended to and does not elicit any systemic effects.
- compositions disclosed herein typically comprise, in addition to the one or more actives, one or more cosmetically or pharmaceutically or acceptable carriers.
- the terms“carrier” or“excipient” are used interchangeably and broadly include any and all solvents, diluents, buffers (such as, e.g., neutral buffered saline, phosphate buffered saline, or optionally Tris-HCI, acetate or phosphate buffers), solubilisers (such as, e.g., Tween® 80, Polysorbate 80), colloids, dispersion media, vehicles, fillers, chelating agents (such as, e.g., EDTA or glutathione), amino acids (such as, e.g., glycine), proteins, disintegrants, binders, lubricants, wetting agents, emulsifiers, sweeteners, colorants, flavourings, aromatisers, thickeners, agents for achieving a depot effect, coatings, antifungal agents, preservatives (such as, e.g., ThimerosalTM, benzyl alcohol
- Aqueous, powder or oily bases, or thickeners may also be used in preparations for topical administration to the skin.
- ingredients include various hydroxylated compounds, such as monomeric glycols, e.g., propylene glycol, ethyl alcohol, glycerin and butylene glycol, polymeric moisturizers such as polyglycerylmethacrylate, derivatives of palmitates and stearates, triglycerides of fatty acids, lanolin, vegetable or mineral oils, and waxes.
- the compositions comprising a live C. acnes strain may further comprise media for stabilising the bacteria.
- these media may include, for example, pure water, phosphate buffer saline (PBS), peptone (e.g. trypsin-digested or acid-digested peptone from casein or meat), a diluted or undiluted version of a suitable growth medium or any combination thereof.
- PBS phosphate buffer saline
- peptone e.g. trypsin-digested or acid-digested peptone from casein or meat
- a suitable growth medium is used in addition to or instead of peptone.
- the compositions may comprise a buffer.
- the buffer can help stabilizing the pH of the composition.
- the pH is between 4.5 and 8.
- the pH can be approximately 4.5, 4.6, 4.7, 4.8, 4.9, 5.0, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, 7.0, 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8, 7.9 or 8.0, including any value in between.
- the pH is approximately 7.0.
- Non-limiting examples of buffers include ACES, acetate, ADA, ammonium hydroxide, AMP (2-amino-2-methyl-l-propanol), AMPD (2-amino-2-methyl-l, 3-propanediol), AMPSO, BES, BICINE, bis-tris, BIS-TRIS propane, borate, CABS, cacodylate, CAPS, CAPSO, carbonate (pKl), carbonate (pK2), CHES, citrate (pKl), citrate (pK2), citrate (pK3), DIPSO, EPPS, HEPPS, ethanolamine, formate, glycine (pKl), glycine (pK2), glycylglycine (pKl), glycylglycine (pK2), HEPBS, HEPES, HEPPSO, histidine, hydrazine, imidazole, malate (pKl), malate (pK2), maleate (
- the compositions may comprise a thickener.
- thickeners include hydroxyethylcelluloses (e.g. NATROSOL®), starch, gums such as gum arabic, kaolin or other clays, hydrated aluminum silicate, fumed silica, carboxyvinyl polymer, sodium carboxymethyl cellulose or other cellulose derivatives, ethylene glycol monostearate and sodium alginates.
- the viscosity type of hydroxyethylcellulose is HHR-P, HH, H4, H, MH, M, K, G, E or L.
- the concentration of the thickener, such as hydroxyethyl cellulose is between approximately l%-5% w/v.
- the concentration can be about 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2.0, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3.0, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4.0, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8, 4.9, or 5.0% w/v.
- the concentration of thickener such as hydroxyethyl cellulose, is less than 1% w/v or more than 5% w/v.
- the concentration of thickener such as hydroxyethyl cellulose
- the concentration of thickener is approximately 1.5% w/v. In some embodiments, the concentration of thickener, such as hydroxyethyl cellulose, is approximately 2.5% w/v.
- the compositions may comprise a solvent or a surfactant.
- solvents include water, ethyl alcohol, toluene, methylene chloride, isopropanol, n- butyl alcohol, castor oil, ethylene glycol monoethyl ether, diethylene glycol monobutyl ether, diethylene glycol monoethyl ether, dimethyl sulphoxide, dimethyl formamide and tetrahydrofuran.
- Anionic surfactants such as metallic or alkanolamine salts of fatty acids for example sodium laurate and triethanolamine oleate; alkyl benzene sulphones, for example triethanolamine dodecyl benzene sulphonate; alkyl sulphates, for example sodium lauryl sulphate; alkyl ether sulphates, for example sodium lauryl ether sulphate (2 to 8 EO); sulphosuccinates, for example sodium dioctyl sulphonsuccinate; monoglyceride sulphates, for example sodium glyceryl monostearate monosulphate; isothionates, for example sodium isothionate; methyl taurides, for example Igepon T; acylsarcosinates, for example sodium myristyl sarcosinate; acyl peptides, for example Maypons and lamepons; acyl lactylates,
- the compositions may comprise an emollient.
- emollients include stearyl alcohol, glyceryl monoricinoleate, glyceryl monostearate, propane- 1,2-diol, butane- 1,3-diol, mink oil, cetyl alcohol, isopropyl isostearate, stearic acid, isobutyl palmitate, isocetyl stearate, oleyl alcohol, isopropyl laurate, hexyl laurate, decyl oleate, octadecan-2-ol, isocetyl alcohol, cetyl palmitate, dimethylpolysiloxane, di-n-butyl sebacate, isopropyl myristate, isopropyl palmitate, isopropyl stearate, butyl stearate, polthylene glycol, triethylene glycol, lanolin, sesame
- compositions may comprise a humectant.
- humectants include glycerin, sorbitol, sodium 2-pyrrolidone-5-carboxylate, soluble collagen, dibutylphthalate, or gelatin.
- compositions may comprise an astringent agent.
- astringent agents include arnica flowers or extracts thereof, lower alkyl alcohols, witch hazel, boric acid, lactic acid, methol, camphor, zinc phenol sulphonate, aluminum acetate, aluminum sulfate, and zinc chloride or sulfate.
- the compositions may comprise a pigment.
- pigments include titanium dioxide, micas, iron oxides, barium lake, calcium lake, aluminum lake, bismuth oxychloride, zirconium lake and calcium oxides.
- the compositions comprise a coloring agent.
- coloring agent include shikonin, b-carotene, paprika, monascus, safflower red, safflower yellow, red cabbage color, purple sweet potato color, lycopene, cacao color, grape color, cochineal, lac color, beet red, hematein, Red. No. 215, Red. No. 218, Red. No. 223, Red. No. 225, Orange No. 201, Orange No. 206, Yellow No. 201, Green No. 202, and Purple No. 201, Red. No. 2, Red. No. 3, Red. No. 102, Red. No. 104 (1), Red. No. 105 (1), Red. No.
- compositions may comprise any one or more of UV-A and UV-B radiation filters, sunscreens, free-radical blockers, vitamin extracts, or antioxidants.
- compositions may comprise a perfume.
- compositions disclosed herein are further described herein.
- one or more thickening agents may be selected from the group consisting of carbomer, acrylates/C 10-30 alkyl acrylate crosspolymer, ammonium acryloyldimethyltaurate/VP copolymer, xanthan gum, sodium polyacrylate, calcium carboxymethyl cellulose, carboxymethyl cellulose acetate butyrate, carboxymethyl hydroxyethylcellulose, cellulose gum, cellulose acetate propionate carboxylate, cetyl hydroxyethylcellulose, ethylcellulose, hydrolyzed cellulose gum, hydroxybutyl methylcellulose, hydroxyethylcellulose, hydroxyethyl ethylcellulose, hydroxypropylcellulose, hydroxypropyl methylcellulose, methylcellulose, methyl ethylcellulose, methyl hydroxyethylcellulose, microcrystalline cellulose, sodium cellulose sulfate, acrylates copolymer, acrylates crosspolymer-4, polyacrylate- 1 crosspol
- one or more UV-filters may be selected from the group consisting of 2-phenyl-3H-benzimidazole-5-sulfonic acid and/or the salt thereof; phenylene-1 ,4- bis-(2-benzimidazyl)-3,3'-5,5'-tetrasulfonic acid and salts thereof (For example (CTFA): Disodium Phenyl Dibenzimidazole Tetrasulfonate); 1 ,4-di(2-oxo-10-sulfo-3-bornyliden-methyl) benzene and salts thereof; 4-Hydroxy-2-methoxy-5-(oxo-phenylmethyl)benzenesulfonic acid and salts thereof (For example (CTFA): Benzophenone-4, Benzophenone-5); 4-(2-oxo-3- bomylidenemethyl)benzene sulfonic acid and salts thereof; 2-methyl-5-(2-oxo-3- bomyliden
- compositions may comprise polar oils, for example those from the group of lecithins and fatty acid triglycerides, namely the triglycerol esters of saturated and / or unsaturated, branched and / or unbranched alkanecarboxylic acids having a chain length of 8 to 24, in particular 12 to 18 C-atoms.
- polar oils for example those from the group of lecithins and fatty acid triglycerides, namely the triglycerol esters of saturated and / or unsaturated, branched and / or unbranched alkanecarboxylic acids having a chain length of 8 to 24, in particular 12 to 18 C-atoms.
- the fatty acid triglycerides can, for example, advantageously be chosen from the group of synthetic, semisynthetic and natural oils, such as olive oil, sunflower oil, soybean oil, peanut oil, rapeseed oil, almond oil, palm oil, coconut oil, castor oil, wheat germ oil, grape seed oil, safflower oil, evening primrose oil, macadamia nut and the like ,
- synthetic oils such as olive oil, sunflower oil, soybean oil, peanut oil, rapeseed oil, almond oil, palm oil, coconut oil, castor oil, wheat germ oil, grape seed oil, safflower oil, evening primrose oil, macadamia nut and the like
- Particularly preferred examples of polar oils are Triisostearin, caprylic / capric triglycerides or carbonates, such as di-n-octyl carbonates, and combinations thereof.
- More polar oil components can be selected from the group of esters of saturated and / or unsaturated, branched and / or unbranched alkanecarboxylic acids having a chain length of 3 to 30 carbon atoms and saturated and / or unsaturated, branched and / or unbranched alcohols having a chain length of 3 to 30 carbon atoms, and from the group of esters of aromatic carboxylic acids and saturated and / or unsaturated, branched and / or unbranched alcohols with chain length of 3 to 30 carbon atoms, and combinations thereof.
- esters can then advantageously be selected from the group consisting of isopropyl myristate, isopropyl palmitate, isopropyl stearate, isopropyl oleate, n-butyl stearate, n-hexyl laurate, n-decyl oleate, isooctyl stearate, Isooctylnonanoate, Isononylstearat, isononyl isononanoate, isodecylneopentanoate, cetearyl isononanoate, octyl cocoate, tridecyl, Hexacaprat, tridecyl, Cetearylisononanoate, Hexacaprylat, dicaprate, Dicaprilat, 2-ethylhexyl palmitate, 2-ethylhexyl laurate, 2-hexyldecyl stearate, 2-o
- the oil phase can advantageously be chosen from the group of dialkyl ethers, the group of saturated or unsaturated, branched or unbranched alcohols, such as octyldodecanol.
- the oil phase of W / O emulsions may have a content of C12-15- alkyl benzoate.
- Ri and R2 are unbranched alkyl radicals.
- the Guerbet alcohols may be selected from the group, in which Ri is propyl, butyl, pentyl, hexyl, heptyl or octyl and R2 is hexyl, heptyl, octyl, nonyl, decyl, undecyl, dodecyl, tridecyl or tetradecyl.
- Preferred Guerbet alcohols may be 2-butyl octanol:
- the total amount of Guerbet alcohols in finished cosmetic or dermatological preparations may be advantageously chosen from a range up to 25.0 wt %, preferably 0.5-15.0 wt %, based on the total weight of the preparations.
- a further suitable ester is cetyl palmitate.
- Non-polar oils may be, for example, chosen from the group of branched and unbranched hydrocarbons and waxes, in particular petroleum jelly (petrolatum), paraffin oil, squalane and squalene, polyolefins and hydrogenated polyisobutenes.
- petroleum jelly petroleum jelly
- paraffin oil squalane and squalene
- polyolefins polyolefins
- hydrogenated polyisobutenes Among the polyolefins, polydecenes are the preferred substances.
- excipients may be selected from the group of cyclic and / or linear silicones, and silicone oils.
- Phenyltrimethicone may be advantageously chosen as silicone oil.
- Other silicone oils such as dimethicone, phenyldimethicone, cyclomethicone (octamethylcyclotetrasiloxane), for example hexamethylcyclotrisiloxane, polydimethylsiloxane, poly (methylphenylsiloxane), cetyl dimethicone, behenoxydimethicone may advantageously be used.
- cyclomethicone and isotridecyl isononanoate are furthermore advantageous. It is also advantageous to choose silicone oils of similar constitution to the above-described compounds whose organic side chains are derivatized, for example, polyethoxylated and / or polypropoxylated.
- silicone oils of similar constitution to the above-described compounds whose organic side chains are derivatized, for example, polyethoxylated and / or polypropoxylated.
- polysiloxane-polyalkyl-polyether copolymers such as cetyl dimethicone copolyol, include, for example (cetyl dimethicone copolyol (and) polyglyceryl-4 isostearate (and) hexyl laurate).
- excipients may be selected from the group of vegetable waxes, animal waxes, mineral waxes, petrochemical waxes, and combinations thereof.
- An oil phase may be advantageously selected from the group 2-ethylhexyl isostearate, octyldodecanol, isotridecyl, butylene glycol dicaprylate / dicaprate, Cl 2- 15-alkyl benzoate, caprylic-capric acid triglyceride, dicaprylyl ether, and combinations thereof.
- Advantageous may be mixtures of octyldodecanol, caprylic-capric acid triglyceride, dicaprylyl ether, octyl carbonates, cocoglycerides, or mixtures of Cl 2- 15-alkyl benzoate and 2-ethylhexyl isostearate, mixtures of Cl 2- 15-alkyl benzoate and butylene glycol dicaprylate / dicaprate and mixtures of C12 -15-alkyl benzoate, 2-ethylhexyl isostearate, isotridecyl, and combinations thereof.
- hydrocarbons paraffin oil, cycloparaffin, squalane, squalene, hydrogenated polyisobutene, polydecene, and combinations thereof may be used advantageously.
- Further excipients may include lecithin, lanolin, microcrystalline wax (Cera microcristallina) mixed with paraffin oil (Paraffmum liquidum), ozokerite, hydrogenated castor oil, polyglyceryl- 3 oleate, wool wax acid mixtures, wool wax alcohol mixtures Pentaerythrithylisostearat, polyglyceryl-3-diisostearate, beeswax (Cera alba) and stearic acid, Natriumdihydroxycetylphosphat in admixture with Isopropylhydroxycetylether, methyl glucose dioleate, methyl glucose mixed with hydroxystearate wax and beeswax, mineral oil mixed with petrolatum and ozokerite and glyceryl oleate and lanolin, petrolatum mixture with ozokerite and hydrogenated castor oil and glyceryl and polyglyceryl-3 oleate, PEG-7 hydrogenated castor oil, ozokerite and hydrogenated castor oil
- Water / oil emulsions may, if desired, contain one or more co-emulsifiers, especially advantageously selected from the group of the following substances that act generally as O / W emulsifiers:
- silicone emulsifiers Alkylmethiconco and / or alkyldimethicone copolyols, ABIL ® B 8842, ABIL ® B 8843, ABIL ® B 8847, ABIL ® B 8851, ABIL ® B 8852, ABIL ® B 8863, ABIL ® B 8873 and ABIL ® B 8883.
- the compositions may be formulated as a gel, cream, ointment, lotion, drops, spray including aerosol sprays, foam, or powder.
- the compositions may be comprised by a mask, pad, patch, a two-chamber device (two-component dispensing system), or make-up.
- the present compositions may typically be intended as Teave- on’ compositions.
- compositions can be administered once or multiple times.
- the composition is administered at regular intervals, while in other embodiments it is administered at irregular intervals.
- the composition may be administered four times a day, three times a day, or twice a day, or daily, or every 2 days, 3 days, 4 days, or 5 days, or once a week, or once in 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 7 weeks, or 8 weeks or more or less frequently including all values in between.
- the duration of the administration of the compositions may be limited or may be unlimited or open-ended.
- the administration may be sustained for 1 week, 2 weeks, 3 weeks, 4 weeks, 6 weeks, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 months, or 1, 2, 3, 4, or 5 or more years.
- kits comprises a container housing live bacteria or a container housing freeze-dried live bacteria.
- Kits can include a second container including media such as peptone.
- kits can include antibiotic(s), disinfectant(s) (e.g., BPO) and/or salicylic acid.
- the antibiotic(s), disinfectant(s) and/or salicylic acid are used to pre- treat the skin before application of the composition comprising live bacteria.
- Kits can also include instructions for administering the composition.
- instructions are provided for mixing the bacterial strains with other components of the composition.
- a kit further includes an applicator to apply the bacterial composition to a subject.
- a further aspect provides a method for diagnosing oxidative stress-associated skin disease in a subject, the method comprising determining the quantity of RoxP or the quantity of C. acnes in a skin sample from the subject.
- said oxidative stress-associated skin disease may be selected from the group comprising AK, BCC, SCC, dandruff, seborrheic dermatitis, acne, inflammation, dermatitis, psoriasis, eczema, rosacea, urticaria and vitiligo.
- Another aspect provides a method for determining whether a subject would benefit from administration of RoxP or a live C. acnes strain secreting RoxP, the method comprising determining the quantity of RoxP or the quantity of C. acnes in a skin sample from the subject.
- diagnosis is commonplace and well-understood in medical practice.
- diagnosis generally refers to the process or act of recognising, deciding on or concluding on a disease or condition in a subject on the basis of symptoms and signs and/or from results of various diagnostic procedures (such as, for example, from knowing the presence, absence and/or quantity of one or more biomarkers characteristic of the diagnosed disease or condition).
- diagnosis as used herein also broadly encompasses aspects of diagnostic practice which may be more specifically referred to as monitoring, prognosis or prediction of a disease.
- monitoring generally refers to the follow-up of a disease or a condition in a subject for any changes which may occur over time.
- prognosis generally refers to an anticipation on the progression of a disease or condition and the prospect (e.g., the probability, duration, and/or extent) of recovery.
- a good prognosis of a disease or condition may encompass anticipation of a satisfactory partial or complete recovery from the disease or condition, preferably within an acceptable time period.
- a good prognosis may also commonly encompass anticipation of not further worsening or aggravating of the disease or condition, preferably within a given time period.
- a poor prognosis of a disease or condition may generally encompass anticipation of a substandard recovery and/or unsatisfactorily slow recovery, or substantially no recovery or even further worsening of the disease or condition.
- predicting generally refer to an advance declaration, indication or foretelling of a disease or condition in a subject not (yet) having said disease or condition.
- a prediction of a disease or condition in a subject may indicate a probability, chance or risk that the subject will develop said disease or condition, for example within a certain time period or by a certain age.
- Said probability, chance or risk may be indicated inter alia as an absolute value, range or statistics, or may be indicated relative to a suitable control subject or subject population (such as, e.g., relative to a general, normal or healthy subject or subject population).
- the probability, chance or risk that a subject will develop a disease or condition may be advantageously indicated as increased or decreased, or as fold-increased or fold-decreased relative to a suitable control subject or subject population.
- the present methods for diagnosing diseases or conditions or for determining whether a subject would benefit from a given course of action or treatment may be adequately qualified as in vitro methods in that they apply one or more in vitro processing and/or analysis steps to a sample removed from the subject.
- the term“ in vitro” generally denotes outside, or external to, a body, e.g., an animal or human body.
- the present methods or uses may preferably allow for sensitivity and/or specificity (preferably, sensitivity and specificity) of at least 50%, at least 60%, at least 70% or at least 80%, e.g., > 85% or > 90% or >95%, e.g., between about 80% and 100% or between about 85% and 95%.
- sensitivity and/or specificity preferably, sensitivity and specificity
- RoxP or C. acnes constitute biomarkers to be determined in a skin sample from the subject. Accordingly, also disclosed is the use of RoxP or C. acnes as a biomarker for diagnosing oxidative stress-associated skin disease in a subject or for determining whether a subject would benefit from administration of RoxP or a live C. acnes strain secreting RoxP.
- the present methods or uses may evaluate a single variable, such as a single biomarker.
- the present methods or uses may evaluate two or more variables, such as two or more biomarkers.
- the methods or uses may evaluate RoxP and C. acnes.
- Each so-measured variable, such as each biomarker may be evaluated separately and independently, or one may generate a profile from the values or quantities for the two or more variables. It shall thus also be understood by the skilled man that any value or quantity as referred to herein may also encompass a profile. Similarly, any reference value as referred to herein may also encompass a reference profile.
- biomarker is widespread in the art and commonly broadly denotes a biological entity or substance, such as for example a biological molecule and/or a detectable portion thereof, or a cell such as a microbial (e.g., bacterial) cell, whose qualitative and/or quantitative evaluation in a subject is predictive or informative (e.g., predictive, diagnostic and/or prognostic) with respect to one or more aspects of the subject’s phenotype and/or genotype, such as, for example, with respect to the status of the subject as to a given disease or condition, or as to an expected benefit of a certain course of action or treatment of the subject
- biomarkers may be cell-based, or peptide-, polypeptide- and/or protein-based, or nucleic acid-based.
- a biomarker may be a microbial (e.g., bacterial) cell of a given genus, species, type (e.g., phylotype), subtype or strain, or a microbial (e.g., bacterial) cell of a given phenotype or genotype, or expressing a given protein or polypeptide, or carrying a given genetic element or sequence.
- a biomarker may be comprised of peptides, polypeptides and/or proteins encoded by a given gene.
- nucleic acid-based biomarkers may encompass DNA, RNA and DNA/RNA hybrid molecules, such as DNA of a given gene or a RNA-molecule transcribed from a given gene, or any RNA or DNA (e.g., copy DNA, cDNA) molecule originating from or derived from the transcribed RNA-molecule.
- any biomarker whether peptide-, polypeptide-, protein-, or nucleic acid- based, also encompasses fragments thereof.
- the reference to RoxP as a biomarker encompasses full-length RoxP and also encompasses any fragments thereof.
- the reference herein to determining or measuring (the quantity of) a given peptide, polypeptide, protein, or nucleic acid biomarker may encompass measuring (the quantity of) the recited peptide, polypeptide, protein, or nucleic acid, and/or measuring one or more fragments thereof.
- any biomarker peptide, polypeptide, protein, or nucleic acid, and/or one or more fragments thereof may be measured collectively, such that the measured quantity corresponds to the sum amounts of the collectively measured species.
- any biomarker peptide, polypeptide, protein, or nucleic acid, and/or one or more fragments thereof may be measured each individually.
- “RoxP” in this context encompasses biomarkers based on RoxP polypeptide or protein or fragments thereof, or RoxP nucleic acid or fragments thereof, including inter alia the RoxP promoter or any part thereof and/or the RoxP coding sequence or any part thereof.
- fragment in relation to peptides, polypeptides or proteins has been generally addressed elsewhere in this specification.
- any peptide, polypeptide or protein fragments which carry the information requisite for the performance of the present diagnostic or benefit-evaluation methods are intended herein.
- Such fragments may arise by any mechanism, in vivo and/or in vitro, such as, without limitation, by alternative transcription or translation, exo- and/or endo-proteolysis, or proteolytic degradation of the peptide, polypeptide, or protein, such as, for example, by physical, chemical and/or enzymatic proteolysis.
- Such fragments may preferably comprise at least about 30%, e.g., at least about 50% or at least about 70%, preferably at least about 80%, e.g., at least about 85%, more preferably at least about 90%, and yet more preferably at least about 95% or even about 99% of the contiguous amino acid sequence length of the full-length biomarker peptide, polypeptide, or protein, such as of RoxP.
- such RoxP fragment may include a sequence of > 5 consecutive amino acids, or > 10 consecutive amino acids, or > 20 consecutive amino acids, or > 30 consecutive amino acids, e.g., >40 consecutive amino acids, such as for example > 50 consecutive amino acids, e.g., > 60, > 70, > 80, > 90, > 100, > 110, > 120, > 130, > 140, or > 150 consecutive amino acids of the corresponding full-length RoxP peptide, polypeptide, or protein.
- fragment with reference to a nucleic acid (polynucleotide) generally denotes a 5’- and/or 3’-truncated form of a nucleic acid.
- any nucleic acid fragments which carry the information requisite for the performance of the present diagnostic or benefit- evaluation methods are intended herein.
- Such fragments may arise by any mechanism, in vivo and/or in vitro, such as, without limitation, by alternative transcription, exo- and/or endo nucleolysis, or nucleolytic degradation of the nucleic acid, such as, for example, by physical, chemical and/or enzymatic nucleolysis.
- Such fragments may preferably comprise at least about 30%, e.g., at least about 50% or at least about 70%, preferably at least about 80%, e.g., at least about 85%, more preferably at least about 90%, and yet more preferably at least about 95% or even about 99% of the contiguous nucleic acid sequence of the full-length biomarker nucleic acid, such as of RoxP nucleic acid.
- such RoxP nucleic acid fragments may include a sequence of > 15 consecutive nucleotides, or > 30 consecutive nucleotides, or > 60 consecutive nucleotides, or > 90 consecutive nucleotides, e.g., > 120 consecutive nucleotides, such as for example > 150 consecutive nucleotides, e.g., > 180, > 210, > 240, > 270, > 300, > 330, > 360, > 390, > 420, or > 450 consecutive nucleotides of the corresponding full-length RoxP nucleic acid, such as of the corresponding full-length RoxP promoter and/or RoxP coding sequence.
- the terms“quantity”,“amount” and“level” are synonymous and generally well-understood in the art.
- the terms as used herein may particularly refer to an absolute quantification of a biomarker in a sample, or to a relative quantification of a biomarker in a sample, i.e., relative to another value such as relative to a reference value, or to a range of values indicating a base-line of the biomarker.
- Such reference values or ranges may be obtained from a single subject or from a group of subjects.
- An absolute quantity of a biomarker such as a peptide-, protein-, polypeptide, or nucleic acid- based biomarker, in a sample may be advantageously expressed as weight or as molar amount, or more commonly as a concentration, e.g., weight per volume or mol per volume, or weight per surface area of skin, or mol per surface area of skin, such as 1.0 cm 2 of skin.
- An absolute quantity of a cell-based biomarker in a sample may be advantageously expressed as the number of cells or colony-forming units (CFU), or more commonly as the number of cells or CFU per volume of sample or per surface area of skin, such as 1.0 cm 2 of skin.
- a relative quantity of a biomarker in a sample may be advantageously expressed as an increase or decrease or as a fold- increase or fold-decrease relative to said another value, such as relative to a reference value.
- first and second variables e.g., first and second quantities
- a measurement method may produce quantifiable readouts (such as, e.g., signal intensities) for said first and second variables, wherein said readouts are a function of the value of said variables, and wherein said readouts may be directly compared to produce a relative value for the first variable vs.
- a relative quantity of a cell-based biomarker in a sample may be advantageously expressed as an increase or decrease or as a fold-increase or fold-decrease of the number, CFU or abundance (e.g., determined by genotyping or sequencing) of cells of a given taxon (e.g., phylum, genus, species, type such as phylotype, subtype or strain) compared to cells of one or more or all other taxa in the sample or cell of all taxa in the sample.
- a given taxon e.g., phylum, genus, species, type such as phylotype, subtype or strain
- a biomarker is“measured” or“determined” in a sample when the presence or absence and/or quantity of said biomarker is detected or determined in the sample, typically substantially to the exclusion of other entities, such as cells, molecules or analytes.
- the biomarker may be measured directly in the sample, or the sample may be subjected to one or more processing steps aimed at achieving an adequate measurement of the biomarker.
- the sample may be subjected to one or more isolation or separation steps, whereby the biomarker is isolated from the sample or whereby a fraction of the sample is prepared which is enriched for the biomarker.
- the biomarker is a peptide, polypeptide, or protein
- any known protein purification technique may be applied to the sample to isolate peptides, polypeptides, and proteins therefrom.
- the biomarker is a nucleic acid
- any known nucleic acid purification technique may be applied to the sample to isolate nucleic acids therefrom.
- Non-limiting examples of methods to purify peptides, polypeptides, proteins, or nucleic acids may include chromatography, preparative electrophoresis, centrifugation, precipitation, affinity purification, purification using molecular imprint cryogel matrix, etc. If the biomarker is a cell, any known cell isolation technique may be applied to the sample to isolate cells therefrom. Non- limiting examples of methods to isolate cells is cell sorting by flow cytometry, cell culture in solid or liquid media, etc.
- the terms“sample” or“biological sample” as used herein include any biological specimen obtained from a subject. Useful samples are those which comprise a biomarker or biomarkers of interest as taught herein in detectable quantities.
- a sample may be readily obtainable by minimally invasive methods allowing the removal / isolation of the sample from the subject.
- skin sample is broadly used herein to denote any sample obtained by sampling the skin of a subject or the surface of the skin of a subject.
- a skin sample may but need not contain skin cells of the subject.
- a convenient but non-limiting method to sample the skin surface of a subject is to swab a given area of the skin surface (e.g., l x l cm, or 2 x 2 cm, or 3 x 3 cm, or 4 x 4 cm, or 5 x 5 cm, or between 1 cm 2 and 25 cm 2 ) with conventional skin swabs (which may preferably buffer pre-soaked) for a given duration of time, such as between 10 seconds and 1 minute, e.g., about 30 seconds.
- the material collected on the swabs can be released into a suitable liquid medium or solvent by shaking, and prepared for analysis as required.
- suitable skin samples can be obtained by methods which sample (such as preferably unbiasedly) at least the microorganisms, such as bacteria, residing at the skin surface.
- suitable skin samples can be obtained by methods which sample (such as preferably unbiasedly) peptides, polypeptides or proteins residing at the skin surface.
- one or more skin samples e.g., at least 2, at least 3, at least 4, at least 5 or at least 6) may be used to measure the quantity of biomarkers therein. The use of multiple skin samples can compensate for possible variations in the biomarker quantity due to potentially heterogeneous distribution of the biomarker across skin surface.
- the sampling may particularly target skin areas that are suspected of being diseased or affected by a disease or condition, for example as concluded by visual or microscopic inspection.
- any separation, detection and quantification methods discussed elsewhere in this specification may be used to measure the quantity of biomarker peptides, polypeptides or proteins, such as of RoxP, in the sample.
- methods may include biochemical assay methods, immunoassay methods, mass spectrometry analysis methods, chromatography methods, capacitance biosensor methods, or combinations thereof.
- immunoassay generally refers to methods known as such for detecting one or more molecules or analytes of interest in a sample, wherein specificity of an immunoassay for the molecule(s) or analyte(s) of interest is conferred by specific binding between a specific-binding agent, commonly but without limitation an antibody, and the molecule(s) or analyte(s) of interest.
- Immunoassay technologies include without limitation immunohistochemistry, direct ELISA (enzyme-linked immunosorbent assay), indirect ELISA, sandwich ELISA, competitive ELISA, multiplex ELISA, radioimmunoassay (RIA), ELISPOT technologies, and other similar techniques known in the art. Principles of these immunoassay methods are known in the art, for example John R. Crowther,“The ELISA Guidebook”, 1st ed., Humana Press 2000, ISBN 0896037282.
- direct ELISA employs a labelled primary binding agent, e.g., antibody, to bind to and thereby quantify target antigen in a sample immobilised on a solid support such as a microwell plate.
- a labelled primary binding agent e.g., antibody
- Indirect ELISA uses a non-labelled primary binding agent, e.g., antibody, which binds to the target antigen and a secondary labelled binding agent, e.g., antibody, that recognises and allows the quantification of the antigen-bound primary binding agent.
- the target antigen is captured from a sample using an immobilised‘capture’ binding agent, e.g., antibody, which binds to one antigenic site within the antigen, and subsequent to removal of non-bound analytes the so-captured antigen is detected using a‘detection’ binding agent, e.g., antibody, which binds to another antigenic site within said antigen, where the detection binding agent may be directly labelled or indirectly detectable as above.
- Competitive ELISA uses a labelled‘competitor’ that may either be the primary binding agent, e.g., antibody, or the target antigen.
- non-labelled immobilised primary binding agent e.g., antibody
- a sample is incubated with a sample, this reaction is allowed to reach equilibrium, and then labelled target antigen is added.
- the latter will bind to the primary binding agent wherever its binding sites are not yet occupied by non-labelled target antigen from the sample.
- the detected amount of bound labelled antigen inversely correlates with the amount of non-labelled antigen in the sample.
- Multiplex ELISA allows simultaneous detection of two or more analytes within a single compartment (e.g., microplate well) usually at a plurality of array addresses (see, for example, Nielsen & Geierstanger 2004. J Immunol Methods 290: 107-20 and Ling et al. 2007.
- labelling in ELISA technologies is usually by enzyme (such as, e.g., horse-radish peroxidase) conjugation and the end-point is typically colourimetric, chemiluminescent or fluorescent, magnetic, piezo electric, pyroelectric and other.
- enzyme such as, e.g., horse-radish peroxidase conjugation
- end-point is typically colourimetric, chemiluminescent or fluorescent, magnetic, piezo electric, pyroelectric and other.
- Radioimmunoassay is a competition-based technique and involves mixing known quantities of radioactively-labelled (e.g., 125 I- or 131 I-labelled) target antigen with binding agent, e.g., antibody, to said antigen, then adding non-labelled or‘cold’ antigen from a sample and measuring the amount of labelled antigen displaced (see, e.g., “An Introduction to Radioimmunoassay and Related Techniques”, by Chard T, ed., Elsevier Science 1995, ISBN 0444821198 for guidance).
- binding agent e.g., antibody
- any mass spectrometric (MS) techniques that are capable of obtaining precise information on the mass of peptides, and preferably also on fragmentation and/or (partial) amino acid sequence of selected peptides (e.g., in tandem mass spectrometry, MS/MS; or in post source decay, TOF MS), are useful herein.
- Suitable peptide MS and MS/MS techniques and systems are well-known per se (see, e.g., Methods in Molecular Biology, vol. 146:“Mass Spectrometry of Proteins and Peptides”, by Chapman, ed., Humana Press 2000, ISBN 089603609x; Biemann 1990. Methods Enzymol 193: 455-79; or Methods in Enzymology, vol.
- MS arrangements, instruments and systems suitable for biomarker peptide analysis may include, without limitation, matrix-assisted laser desorption/ionisation time-of-flight (MALDI-TOF) MS; MALDI-TOF post-source-decay (PSD); MALDI-TOF/TOF; surface- enhanced laser desorption/ionization time-of-flight mass spectrometry (SELDI-TOF) MS; electrospray ionization mass spectrometry (ESI-MS); ESI- MS/MS; ESI-MS/(MS) n (n is an integer greater than zero); ESI 3D or linear (2D) ion trap MS; ESI triple quadrupole MS; ESI quadrupole orthogonal TOF (Q-TOF); ESI Fourier transform MS systems; desorption/ion
- MS/MS Peptide ion fragmentation in tandem MS
- CID collision induced dissociation
- Detection and quantification of biomarkers by mass spectrometry may involve multiple reaction monitoring (MRM), such as described among others by Kuhn et al. 2004 (Proteomics 4: 1175-86).
- MS peptide analysis methods may be advantageously combined with upstream peptide or protein separation or fractionation methods, such as for example with the chromatographic and other methods described herein below.
- Chromatography may also be used for measuring biomarkers.
- the term “chromatography” encompasses methods for separating chemical substances, referred to as such and vastly available in the art.
- chromatography refers to a process in which a mixture of chemical substances (analytes) carried by a moving stream of liquid or gas (“mobile phase”) is separated into components as a result of differential distribution of the analytes, as they flow around or over a stationary liquid or solid phase (“stationary phase”), between said mobile phase and said stationary phase.
- the stationary phase may be usually a finely divided solid, a sheet of filter material, or a thin film of a liquid on the surface of a solid, or the like.
- Chromatography is also widely applicable for the separation of chemical compounds of biological origin, such as, e.g., amino acids, proteins, fragments of proteins or peptides, etc.
- Chromatography as used herein may be preferably columnar (i.e., wherein the stationary phase is deposited or packed in a column), preferably liquid chromatography, and yet more preferably HPLC. While particulars of chromatography are well known in the art, for further guidance see, e.g., Meyer M., 1998, ISBN: 047198373X, and “Practical HPLC Methodology and Applications”, Bidlingmeyer, B. A., John Wiley & Sons Inc., 1993.
- Exemplary types of chromatography include, without limitation, high-performance liquid chromatography (HPLC), normal phase HPLC (NP-HPLC), reversed phase HPLC (RP-HPLC), ion exchange chromatography (IEC), such as cation or anion exchange chromatography, hydrophilic interaction chromatography (HILIC), hydrophobic interaction chromatography (HIC), size exclusion chromatography (SEC) including gel filtration chromatography or gel permeation chromatography, chromatofocusing, affinity chromatography such as immuno-affinity, immobilised metal affinity chromatography, and the like.
- HPLC high-performance liquid chromatography
- NP-HPLC normal phase HPLC
- RP-HPLC reversed phase HPLC
- IEC ion exchange chromatography
- HILIC hydrophilic interaction chromatography
- HIC hydrophobic interaction chromatography
- SEC size exclusion chromatography
- gel filtration chromatography or gel permeation chromatography chromatofocusing
- affinity chromatography such as immuno-affin
- Chromatography including single-, two- or more- dimensional chromatography, may be used as a peptide fractionation method in conjunction with a further peptide analysis method, such as for example, with a downstream mass spectrometry analysis as described elsewhere in this specification.
- peptide or polypeptide separation, identification or quantification methods may be used, optionally in conjunction with any of the above described analysis methods, for measuring biomarkers in the present disclosure.
- Such methods include, without limitation, chemical extraction partitioning, isoelectric focusing (IEF) including capillary isoelectric focusing (CIEF), capillary isotachophoresis (CITP), capillary electrochromatography (CEC), and the like, one- dimensional polyacrylamide gel electrophoresis (PAGE), two-dimensional polyacrylamide gel electrophoresis (2D-PAGE), capillary gel electrophoresis (CGE), capillary zone electrophoresis (CZE), micellar electrokinetic chromatography (MEKC), free flow electrophoresis (FFE), etc.
- IEF isoelectric focusing
- CITP capillary isotachophoresis
- CEC capillary electrochromatography
- PAGE polyacrylamide gel electrophoresis
- 2D-PAGE two-dimensional polyacrylamide gel electrophor
- Capacitive biosensors are affinity biosensors that operate by registering direct binding between a biorecognition element on the sensor surface and the cognate biomarker.
- a biorecognition element may be for example an immunological molecule such as an antibody, or a molecularly imprinted polymer (MIP) containing biorecognition cavities for the biomarker.
- MIP molecularly imprinted polymer
- the biosensors measures the changes in dielectric properties and/or thickness of the dielectric layer at the electro lyte/electrode interface. See for example Ertiirk et al. (2018 PLoS ONE 13:e0193754).
- the level of biomarkers at the nucleic acid level may be detected using standard quantitative DNA, RNA or cDNA measurement tools known in the art.
- Non-limiting examples include hybridisation-based analysis, microarray expression analysis, digital gene expression (DGE), RNA-in-situ hybridisation (RISH), Northern-blot analysis and the like; PCR, RT-PCR, RT- qPCR, end-point PCR, digital PCR, droplet digital PCR, or the like; supported oligonucleotide detection, pyrosequencing, polony cyclic sequencing by synthesis, simultaneous bi-directional sequencing, single-molecule sequencing, single molecule real time sequencing, true single molecule sequencing, hybridization-assisted nanopore sequencing, sequencing by synthesis, or the like.
- DNA may be isolated from a sample, and a suitable genetic element or region (such as for example ribosomal RNA gene, such as preferably 16S rRNA, such as more preferably the VI -V3 region of 16S rRNA) may be amplified and sequenced therefrom, typically at high sequencing depth.
- a suitable genetic element or region such as for example ribosomal RNA gene, such as preferably 16S rRNA, such as more preferably the VI -V3 region of 16S rRNA
- the resulting reads can be classified using known statistical tools and publically available microbiome sequence databases, such as Human Oral Microbiome Database (HOMD) (http://www.homd.org/) with a manual inclusion of relevant skin bacteria (Chen et al. 2010 Database : the journal of biological databases and curation baq013).
- HOMD Human Oral Microbiome Database
- MLST multilocus sequence typing schemes
- SLST single-locus sequence typing
- binding agents capable of specifically binding to markers, peptides, polypeptides, proteins, or nucleic acids as taught herein.
- Binding agents as intended throughout this specification may include inter alia an antibody, aptamer, photoaptamer, protein, peptide, peptidomimetic, nucleic acid such as an oligonucleotide, or a small molecule.
- an agent may be said to specifically bind to target(s) of interest if its affinity for such intended target(s) under the conditions of binding is at least about 2-fold greater, preferably at least about 5-fold greater, more preferably at least about 10-fold greater, yet more preferably at least about 25-fold greater, still more preferably at least about 50-fold greater, and even more preferably at least about 100-fold or more greater, than its affinity for a non-target molecule.
- Specific binding agents as used throughout this specification may include inter alia an antibody, aptamer, aptamer (L-aptamer), photoaptamer, protein, peptide, peptidomimetic, nucleic acid such as an oligonucleotide, or a small molecule.
- the term“antibody” is used in its broadest sense and generally refers to any immunologic binding agent.
- the term specifically encompasses intact monoclonal antibodies, polyclonal antibodies, multivalent (e.g., 2-, 3- or more-valent) and/or multi-specific antibodies (e.g., bi- or more-specific antibodies) formed from at least two intact antibodies, and antibody fragments insofar they exhibit the desired biological activity (particularly, ability to specifically bind an antigen of interest), as well as multivalent and/or multi-specific composites of such fragments.
- antibody is not only inclusive of antibodies generated by methods comprising immunisation, but also includes any polypeptide, e.g., a recombinantly expressed polypeptide, which is made to encompass at least one complementarity-determining region (CDR) capable of specifically binding to an epitope on an antigen of interest. Hence, the term applies to such molecules regardless whether they are produced in vitro or in vivo.
- CDR complementarity-determining region
- An antibody may be any of IgA, IgD, IgE, IgG and IgM classes, and preferably IgG class antibody.
- An antibody may be a polyclonal antibody, e.g., an antiserum or immunoglobulins purified there from (e.g., affinity-purified).
- An antibody may be a monoclonal antibody or a mixture of monoclonal antibodies.
- Monoclonal antibodies can target a particular antigen or a particular epitope within an antigen with greater selectivity and reproducibility. By means of example and not limitation, monoclonal antibodies may be made by the hybridoma method first described by Kohler et al.
- Monoclonal antibodies may also be isolated from phage antibody libraries using techniques as described by Clackson et al. 1991 (Nature 352: 624-628) and Marks et al. 1991 (J Mol Biol 222: 581-597), for example.
- Antibody binding agents may be antibody fragments.“Antibody fragments” comprise a portion of an intact antibody, comprising the antigen-binding or variable region thereof. Examples of antibody fragments include Fab, Fab’, F(ab’)2, Fv and scFv fragments; diabodies; linear antibodies; single-chain antibody molecules; and multivalent and/or multispecific antibodies formed from antibody fragment(s), e.g., dibodies, tribodies, and multibodies. The above designations Fab, Fab’, F(ab’)2, Fv, scFv etc. are intended to have their art-established meaning.
- antibody includes antibodies originating from or comprising one or more portions derived from any animal species, preferably vertebrate species, including, e.g., birds and mammals.
- the antibodies may be chicken, turkey, goose, duck, guinea fowl, quail or pheasant.
- the antibodies may be human, murine (e.g., mouse, rat, etc.), donkey, rabbit, goat, sheep, guinea pig, camel (e.g., Camelus bactrianus and Camelus dromaderius), llama (e.g., Lama paccos, Lama glama or Lama vicugna) or horse.
- an antibody can include one or more amino acid deletions, additions and/or substitutions (e.g., conservative substitutions), insofar such alterations preserve its binding of the respective antigen.
- An antibody may also include one or more native or artificial modifications of its constituent amino acid residues (e.g., glycosylation, etc.).
- aptamer refers to single-stranded or double-stranded oligo-DNA, oligo-RNA or oligo-DNA/RNA or any analogue thereof that specifically binds to a target molecule such as a peptide.
- aptamers display fairly high specificity and affinity (e.g., K A in the order lxlO 9 M 1 ) for their targets.
- photoaptamer refers to an aptamer that contains one or more photoreactive functional groups that can covalently bind to or crosslink with a target molecule.
- spiegelmer refers to an aptamer which includes L-DNA, L-RNA, or other left-handed nucleotide derivatives or nucleotide-like molecules. Aptamers containing left-handed nucleotides are resistant to degradation by naturally occurring enzymes, which normally act on substrates containing right- handed nucleotides.
- peptidomimetic refers to a non-peptide agent that is a topological analogue of a corresponding peptide. Methods of rationally designing peptidomimetics of peptides are known in the art.
- Preferred small organic molecules range in size up to about 5000 Da, e.g., up to about 4000, preferably up to 3000 Da, more preferably up to 2000 Da, even more preferably up to about 1000 Da, e.g., up to about 900, 800, 700, 600 or up to about 500 Da.
- oligonucleotide refers to a nucleic acid (including nucleic acid analogues and mimetics) oligomer or polymer as defined herein.
- an oligonucleotide such as more particularly an antisense oligonucleotide, is (substantially) single- stranded.
- Oligonucleotides as intended herein may be preferably between about 10 and about 100 nucleoside units (i.e., nucleotides or nucleotide analogues) in length, preferably between about 15 and about 50, more preferably between about 20 and about 40, also preferably between about 20 and about 30. Oligonucleotides as intended herein may comprise one or more or all non-naturally occurring heterocyclic bases and/or one or more or all non-naturally occurring sugar groups and/or one or more or all non-naturally occurring inter-nucleoside linkages, the inclusion of which may improve properties such as, for example, increased stability in the presence of nucleases and increased hybridization affinity, increased tolerance for mismatches, etc.
- Nucleic acid binding agents such as oligonucleotide binding agents, are typically at least partly antisense to a target nucleic acid of interest.
- the term“antisense” generally refers to an agent (e.g., an oligonucleotide) configured to specifically anneal with (hybridise to) a given sequence in a target nucleic acid, such as for example in a target DNA or RNA, and typically comprises, consist essentially of or consist of a nucleic acid sequence that is complementary or substantially complementary to said target nucleic acid sequence.
- Antisense agents suitable for use herein may typically be capable of annealing with (hybridising to) the respective target nucleic acid sequences at high stringency conditions, and capable of hybridising specifically to the target under physiological conditions.
- the terms“complementary” or“complementarity” as used herein with reference to nucleic acids refer to the normal binding of single-stranded nucleic acids under permissive salt (ionic strength) and temperature conditions by base pairing, preferably Watson-Crick base pairing. By means of example, complementary Watson-Crick base pairing occurs between the bases A and T, A and U or G and C.
- the sequence 5'-A-G-U-3' is complementary to sequence 5'-A-C-U-3'.
- the reference to oligonucleotides may in particular but without limitation include hybridisation probes and/or amplification primers and/or sequencing primers, etc., as commonly used in nucleic acid detection technologies.
- reagents such as binding agents as taught herein may comprise a detectable label.
- label refers to any atom, molecule, moiety or biomolecule that may be used to provide a detectable and preferably quantifiable read-out or property, and that may be atached to or made part of an entity of interest, such as a binding agent. Labels may be suitably detectable by for example mass spectrometric, spectroscopic, optical, colourimetric, magnetic, photochemical, biochemical, immunochemical or chemical means.
- Labels include without limitation dyes; radiolabels such as P, P, S, I, I; electron-dense reagents; enzymes (e.g., horse-radish peroxidase or alkaline phosphatase as commonly used in immunoassays); binding moieties such as biotin-streptavidin; haptens such as digoxigenin; luminogenic, phosphorescent or fluorogenic moieties; mass tags; and fluorescent dyes alone or in combination with moieties that may suppress or shift emission spectra by fluorescence resonance energy transfer (FRET).
- binding agents may be provided with a tag that permits detection with another agent (e.g., with a probe binding partner).
- Such tags may be, for example, biotin, streptavidin, his-tag, myc tag, maltose, maltose binding protein or any other kind of tag known in the art that has a binding partner.
- Example of associations which may be utilised in the probe:binding partner arrangement may be any, and includes, for example biotin: streptavidin, his-tag:metal ion (e.g., Ni 2+ ), maltose:maltose binding protein, etc.
- the biomarker - binding agent conjugate may be associated with or attached to a detection agent to facilitate detection.
- detection agents include, but are not limited to, luminescent labels; colourimetric labels, such as dyes; fluorescent labels; or chemical labels, such as electroactive agents (e.g., ferrocyanide); enzymes; radioactive labels; or radiofrequency labels.
- the detection agent may be a particle.
- Such particles include, but are not limited to, colloidal gold particles; colloidal sulphur particles; colloidal selenium particles; colloidal barium sulfate particles; colloidal iron sulfate particles; metal iodate particles; silver halide particles; silica particles; colloidal metal (hydrous) oxide particles; colloidal metal sulfide particles; colloidal lead selenide particles; colloidal cadmium selenide particles; colloidal metal phosphate particles; colloidal metal ferrite particles; any of the above-mentioned colloidal particles coated with organic or inorganic layers; protein or peptide molecules; liposomes; or organic polymer latex particles, such as polystyrene latex beads.
- Preferable particles may be colloidal gold particles.
- the present methods or uses may involve comparing the quantity of the one or more biomarker measured in a sample from a subject with a suitable reference value, wherein said reference value represents a known outcome.
- the methods or uses may comprise:
- the methods or uses may comprise:
- the methods or uses may comprise:
- the methods or uses may comprise:
- the methods or uses may comprise:
- the methods or uses may comprise: (a) determining the quantity of RoxP and the quantity of C. acnes in the skin sample from the subject;
- Reference values may be established according to known procedures previously employed for other biomarkers.
- a reference value may be established in an individual or a population of individuals characterised by a particular, known diagnosis of the stress-associated skin disease, or a particular, known indication of the benefit of administration of RoxP or a live C. acnes strain secreting RoxP.
- population may comprise without limitation > 2, > 5, > 10, > 50, > 100, or even more individuals.
- each biomarker may be evaluated separately and independently, or one may generate a profile from the values or quantities for the two or more biomarkers. Accordingly, any reference value as referred to herein may also encompass a reference profile.
- a method for establishing a reference value of the quantity of RoxP and/or of C. acnes said reference value representing:
- a diagnosis that a subject does not have an oxidative stress-associated skin disease may comprise:
- a method for establishing a reference value of the quantity of RoxP and/or of C. acnes said reference value representing:
- Comparisons between values may generally include any means to determine the presence or absence of at least one difference and optionally of the size of such difference between values being compared.
- a comparison may include a visual inspection, an arithmetical or statistical comparison of measurements. Such statistical comparisons include, but are not limited to, applying a rule.
- reference value(s) as intended herein may convey absolute quantities of the biomarkers as intended herein.
- the quantity of the biomarkers in a sample from a tested subject may be determined directly relative to the reference value (e.g., in terms of increase or decrease, or fold-increase or fold-decrease).
- this may allow the comparison of the quantity of the biomarkers in the sample from the subject with the reference value (in other words to measure the relative quantity of the biomarkers in the sample from the subject vis-a-vis the reference value) without the need first to determine the respective absolute quantities of the biomarkers.
- A“deviation” of a first value from a second value may generally encompass any direction (e.g ., increase: first value > second value; or decrease: first value ⁇ second value) and any extent of alteration.
- a deviation may encompass a decrease in a first value by, without limitation, at least about 10% (about 0.9-fold or less), or by at least about 20% (about 0.8-fold or less), or by at least about 30% (about 0.7-fold or less), or by at least about 40% (about 0.6-fold or less), or by at least about 50% (about 0.5-fold or less), or by at least about 60% (about 0.4-fold or less), or by at least about 70% (about 0.3-fold or less), or by at least about 80% (about 0.2-fold or less), or by at least about 90% (about 0.1 -fold or less), relative to a second value with which a comparison is being made.
- a deviation may encompass an increase of a first value by, without limitation, at least about 10% (about 1.1 -fold or more), or by at least about 20% (about 1 2-fold or more), or by at least about 30% (about 1.3-fold or more), or by at least about 40% (about 1.4-fold or more), or by at least about 50% (about 1.5-fold or more), or by at least about 60% (about 1.6- fold or more), or by at least about 70% (about 1.7-fold or more), or by at least about 80% (about 1.8-fold or more), or by at least about 90% (about 1.9-fold or more), or by at least about 100% (about 2-fold or more), or by at least about 150% (about 2.5-fold or more), or by at least about 200% (about 3-fold or more), or by at least about 500% (about 6-fold or more), or by at least about 700% (about 8-fold or more), or like, relative to a second value with which a comparison is being made.
- a deviation may refer to a statistically significant observed alteration.
- a deviation may refer to an observed alteration which falls outside of error margins of reference values in a given population (as expressed, for example, by standard deviation or standard error, or by a predetermined multiple thereof, e.g., ⁇ lxSD or ⁇ 2xSD, or ⁇ lxSE or ⁇ 2xSE).
- Deviation may also refer to a value falling outside of a reference range defined by values in a given population (for example, outside of a range which comprises >40%, > 50%, >60%, >70%, >75% or >80% or >85% or >90% or >95% or even >100% of values in said population).
- a deviation may be concluded if an observed alteration is beyond a given threshold or cut-off.
- threshold or cut-off may be selected as generally known in the art to provide for a chosen sensitivity and/or specificity of the prediction methods, e.g., sensitivity and/or specificity of at least 50%, or at least 60%, or at least 70%, or at least 80%, or at least 85%, or at least 90%, or at least 95%.
- receiver-operating characteristic (ROC) curve analysis can be used to select an optimal cut-off value of the quantity of a given biomarker based on acceptable sensitivity and specificity, or related performance measures which are well-known per se, such as positive predictive value (PPV), negative predictive value (NPV), positive likelihood ratio (LR+), negative likelihood ratio (LR-), Youden index, or similar.
- PV positive predictive value
- NDV negative predictive value
- LR+ positive likelihood ratio
- LR- negative likelihood ratio
- Youden index or similar.
- Such comparison may reveal the presence or absence of a deviation or no deviation between the quantity of any one or more biomarker as taught herein measured in a sample from a subject and a given reference value.
- the quantity of RoxP in a skin sample from a subject may be reduced compared to a reference value representing the diagnosis of the absence of an oxidative stress-associated skin disease (i.e., healthy state).
- the so-reduced quantity may allow for the diagnosis that the subject has the oxidative stress-associated skin disease and/or will benefit from administration of RoxP or a live C. acnes strain secreting RoxP.
- the quantity of C. acnes in a skin sample from a subject may be reduced compared to a reference value representing the diagnosis of the absence of an oxidative stress-associated skin disease (i.e., healthy state).
- the so-reduced quantity may allow for the diagnosis that the subject has the oxidative stress-associated skin disease and/or will benefit from administration of RoxP or a live C. acnes strain secreting RoxP.
- the quantity of RoxP in a skin sample from a subject may be reduced compared to the mean or median quantity of RoxP in a population of healthy subjects.
- the so-reduced quantity may allow to conclude that the subject has or is at a risk of developing an oxidative stress-associated skin disease and/or will benefit from administration of RoxP or a live C. acnes strain secreting RoxP.
- the quantity of C. acnes in a skin sample from a subject may be reduced compared to the mean or median quantity of C. acnes in a population of healthy subjects.
- the so-reduced quantity may allow to conclude that the subject has or is at a risk of developing an oxidative stress-associated skin disease and/or will benefit from administration of RoxP or a live C. acnes strain secreting RoxP.
- the quantity of C. acnes in a skin sample may be assessed relative to other microbial, and more particularly bacterial, taxa, such as genera or species (e.g., % abundance, such as % abundance by deep sequencing of 16S rRNA gene) in that skin sample. For example, relative to one or more genera selected from Kocuria, Corynebacterium, Micrococcus, or Staphylococcus.
- the relative abundance (%) of C. acnes in a skin sample from a subject may be reduced compared to the mean or median relative abundance (%) quantity of C. acnes in a population of healthy subjects. The so-reduced relative abundance may allow to conclude that the subject has or is at a risk of developing an oxidative stress-associated skin disease and/or will benefit from administration of RoxP or a live C. acnes strain secreting RoxP.
- the quantity of C. acnes types or subtypes may be assessed relative to other C. acnes types or subtypes (e.g., % abundance, such as % abundance by deep sequencing of 16S rRNA gene) in a skin sample.
- the methods and uses may further comprise determining the relative quantity of two or more C. acnes types (e.g., phylotypes), MLST types, SLST types, or strains in the skin sample from the subject.
- the C. acnes type I versus type II abundance e.g., ratio type I / type II
- the mean or median C may be reduced compared to the mean or median C.
- acnes type I versus type II abundance in a population of healthy subjects.
- the so-reduced C. acnes type I versus type II abundance may allow to conclude that the subject has or is at a risk of developing an oxidative stress-associated skin disease and/or will benefit from administration of RoxP or a live C. acnes strain secreting RoxP.
- the quantity of one or more RoxP promoter sequences, RoxP -35 box sequences, and/or RoxP -10 box sequences may be assessed in absolute terms or relative to all or relative to one or more or all other RoxP promoter sequences, RoxP -35 box sequences, and/or RoxP -10 box sequences (for example relative to all or relative to one or more or all other RoxP promoter sequences, RoxP -35 box sequences, and/or RoxP -10 box sequences shown in Fig. 8).
- the quantity of one or more RoxP promoter sequences associated with comparatively high RoxP expression may be assessed in absolute terms or relative to all RoxP promoter sequences or relative to one or more or all RoxP promoter sequences associated with low RoxP comparatively low RoxP expression, such as those of SEQ ID NO: 5-6 in Fig. 8.
- Such data is informative of the ability of the C. acnes present in the skin sample to produce RoxP.
- the quantity of one or more RoxP coding sequences may be assessed in absolute terms or relative to all RoxP coding sequences or relative to one or more or all other RoxP coding sequences (for example relative to all RoxP coding sequence types or relative to one or more or all other RoxP coding sequence types shown in Fig. 10).
- the quantity of one or more RoxP coding sequence types belonging to the second type as characterised in Fig. 10 e.g., containing KPA171202 RoxP coding sequence
- Such data is informative of the ability of the C. acnes present in the skin sample to produce RoxP.
- the absolute quantity of one or more RoxP promoter types and/or RoxP coding sequence types in a skin sample may be determined by known quantitative methods for nucleic acid measurements in biological samples, mentioned elsewhere in this specification, such as without limitation quantitative PCR, such as droplet digital PCR.
- the relative quantity of one or more RoxP promoter types and/or RoxP coding sequence types in a skin sample may be determined by known methods such as amplification of promoter or coding sequence amplicons and sequencing typically at high sequencing depth, and quantitative allocation of the sequence reads to said one or more RoxP promoter types and/or RoxP coding sequence types.
- a subject for determining whether a subject would benefit from administration of RoxP or a live C. acnes strain secreting RoxP, the method comprising determining the absolute or relative quantity of one or more RoxP coding sequence types and/or RoxP promoter types in a skin sample from the subject.
- the quantity of RoxP secreted by C. acnes measured in a skin sample may also be assessed.
- the methods and uses may further comprise determining the quantity of RoxP secreted by the C. acnes in the skin sample from the subject.
- the overall amount of RoxP produced by C. acnes or the relative abundance of high-RoxP expressing C. acnes types, subtypes or strains versus average- or-low RoxP expressing C. ctcnes types, subtypes or strains in a skin sample from a subject may be reduced compared to the corresponding measurements in a population of healthy subjects.
- the so- reduced overall amount of RoxP produced by C. ctcnes or the relative abundance of high-RoxP expressing C. ctcnes types, subtypes or strains may allow to conclude that the subject has or is at a risk of developing an oxidative stress-associated skin disease and/or will benefit from administration of RoxP or a live C. acnes strain secreting RoxP.
- the present methods and uses may also comprise affected versus unaffected skin areas of the same subject.
- certain embodiments of the method for diagnosing oxidative stress-associated skin disease in a subject may comprise:
- a lower quantity of RoxP determined in step a) compared to the quantity of RoxP determined in step b) indicates that the subject has or is at risk of having an oxidative stress- associated skin disease.
- a lower relative amount of P. acnes type I strains in the sample from an area of the subject’s skin suspected of being affected by an oxidative stress-associated skin disease compared to the relative amount of P. acnes type I strains in the sample from a healthy area of the subject’s skin indicates that the subject has or is at risk of having an oxidative stress- associated skin disease.
- companion diagnostic and personalised medicine approaches which employ the present diagnostic or benefit-evaluation methods or uses to select subjects as having or being at risk of having an oxidative stress-associated skin disease, or as ones that would benefit from administration of a live C. acnes strain secreting RoxP or from administration of RoxP.
- the so-selected subjects can undergo the prophylactic or therapeutic interventions disclosed herein comprising the administration of a live C. acnes strain secreting RoxP or administration of RoxP or a biologically active variant or fragment thereof.
- an aspect provides a composition comprising a live C. acnes strain secreting RoxP for use in a method of preventing or treating an oxidative stress-associated skin disease in a subject, wherein the subject has been selected as having or being at risk of having an oxidative stress- associated skin disease by the methods disclosed herein.
- a related aspect provides a method for preventing or treating an oxidative stress-associated skin disease in a subject in need thereof, the method comprising administering to the skin of the subject a prophylactically or therapeutically effective amount of a composition comprising a live C. acnes strain secreting RoxP, wherein the subject has been selected as having or being at risk of having an oxidative stress-associated skin disease by the methods disclosed herein.
- compositions comprising a live C. acnes strain secreting RoxP for the manufacture of a medicament for use in a method of preventing or treating an oxidative stress-associated skin disease in a subject, wherein the subject has been selected as having or being at risk of having an oxidative stress-associated skin disease by the methods disclosed herein.
- a further related aspect provides use of a composition comprising a live C. acnes strain secreting RoxP for preventing or treating an oxidative stress-associated skin disease in a subject, wherein the subject has been selected as having or being at risk of having an oxidative stress-associated skin disease by the methods disclosed herein.
- Another aspect provides a method comprising administering a live C. acnes strain secreting RoxP to a subject, wherein the subject has been selected as one that would benefit from administration of a live C. acnes strain secreting RoxP by the methods disclosed herein.
- Another aspect provides a composition comprising RoxP or a biologically active variant or fragment thereof for use in a method of preventing or treating an oxidative stress-associated skin disease in a subject, wherein the subject has been selected as having or being at risk of having an oxidative stress-associated skin disease by the methods disclosed herein.
- a related aspect provides a method for preventing or treating an oxidative stress-associated skin disease in a subject in need thereof, the method comprising administering to the skin of the subject a prophylactically or therapeutically effective amount of a composition comprising RoxP or a biologically active variant or fragment thereof, wherein the subject has been selected as having or being at risk of having an oxidative stress-associated skin disease by the methods disclosed herein.
- Another related aspect provides use of a composition comprising RoxP or a biologically active variant or fragment thereof for the manufacture of a medicament for use in a method of preventing or treating an oxidative stress-associated skin disease in a subject, wherein the subject has been selected as having or being at risk of having an oxidative stress-associated skin disease by the methods disclosed herein.
- a further related aspect provides use of a composition comprising RoxP or a biologically active variant or fragment thereof for preventing or treating an oxidative stress-associated skin disease in a subject, wherein the subject has been selected as having or being at risk of having an oxidative stress-associated skin disease by the methods disclosed herein.
- a further aspect provides a method comprising administering a composition comprising RoxP or a biologically active variant or fragment thereof to a subject, wherein the subject has been selected as one that would benefit from administration of RoxP by the methods disclosed herein.
- a cosmetic use of a composition comprising a live Cutibacterium acnes strain secreting RoxP (radical oxygenase of Propionibacterium acnes ) for preventing or reducing skin ageing in a subject.
- RoxP radical oxygenase of Propionibacterium acnes
- a composition comprising a live C. acnes strain secreting RoxP for use in a method of preventing or treating an oxidative stress-associated skin disease.
- composition for use according to Statement 2 wherein the oxidative stress- associated skin disease is selected from the group comprising actinic keratosis (AK), basal cell carcinoma (BCC), squamous cell carcinoma (SCC), dandruff, seborrheic dermatitis, acne, inflammation, dermatitis, psoriasis, eczema, rosacea, urticaria and vitiligo.
- AK actinic keratosis
- BCC basal cell carcinoma
- SCC squamous cell carcinoma
- dandruff seborrheic dermatitis
- acne inflammation
- dermatitis psoriasis
- eczema rosacea
- urticaria and vitiligo vitiligo
- Statement 5 The use according to Statement 1 or 4 or the composition for use according to any one of Statements 2 to 4, wherein the C. acnes strain is not genetically engineered.
- Statement 6 The use according to Statement 1, 4 or 5 or the composition for use according to any one of Statements 2 to 5, wherein the composition comprises two or more C. acnes strains secreting RoxP.
- Statement 7 The use according to any one of Statements 1 or 4 to 6 or the composition for use according to any one of Statements 2 to 5, wherein the C. acnes strain secretes, or the two or more C. acnes strains individually or collectively secrete, at least 1 pg RoxP per mL of medium when measured in stationary phase.
- Statement 8 The use according to any one of Statements 1 or 4 to 7 or the composition for use according to any one of Statements 2 to 7, wherein the endogenous RoxP promoter of the C. acnes strain, or of at least one of the two or more C. acnes strains, comprises -10 box having a sequence selected from TGCTATACT or TGCTACACT, preferably TGCTATACT, and/or -35 box having a sequence selected from ACTTCGAT or ACTTCAAT.
- Statement 9 The use according to any one of Statements 1 or 4 to 8 or the composition for use according to any one of Statements 2 to 8, wherein the C. acnes strain is, or at least one of the two or more C. acnes strains each independently is, type I, II or III, preferably type IA, IB or III.
- Statement 10 The use according to any one of Statements 1 or 4 to 8 or the composition for use according to any one of Statements 2 to 8, wherein the C. acnes strain is, or at least one of the two or more C. acnes strains each independently is, SLST type A, C, G, H, L or K.
- Statement 11 The use according to any one of Statements 1 or 4 to 10 or the composition for use according to any one of Statements 2 to 10, wherein the C. acnes strain is, or the two or more C. acnes strains individually or collectively are, present in the composition at an amount of at least 100 colony forming units (CFU) per gram of the composition.
- CFU colony forming units
- Statement 12 The use according to any one of Statements 1 or 4 to 11 or the composition for use according to any one of Statements 2 to 11, wherein the composition is configured for topical administration to the skin, such as wherein the composition is a gel, cream, ointment, lotion, drops, spray including aerosol sprays, foam, or powder, optionally wherein the composition is comprised by a mask, pad, patch, a two-chamber device, or make-up.
- the composition is configured for topical administration to the skin, such as wherein the composition is a gel, cream, ointment, lotion, drops, spray including aerosol sprays, foam, or powder, optionally wherein the composition is comprised by a mask, pad, patch, a two-chamber device, or make-up.
- a composition comprising RoxP or a biologically active variant or fragment thereof for use in a method of preventing or treating an oxidative stress-associated skin disease.
- Statement 15. The composition for use according to Statement 14, wherein the oxidative stress- associated skin disease is selected from the group comprising AK, BCC, SCC, dandruff, seborrheic dermatitis, acne, inflammation, dermatitis, psoriasis, eczema, rosacea, urticaria and vitiligo.
- Statement 16 The use according to Statement 13 or the composition for use according to Statements 14 or 15, wherein the composition comprises supernatant or a RoxP-enriched fraction of supernatant of a cultured live C. acnes strain secreting RoxP, preferably endogenously secreting RoxP.
- Statement 17 The composition for use according to any one of Statements 14 to 16, wherein the composition comprises at least lxlO 9 M RoxP or the biologically active variant or fragment thereof.
- Statement 18 The use according to any one of Statements 13 or 16 to 17 or the composition for use according to any one of Statements 14 to 17, wherein the composition is configured for topical administration to the skin, such as wherein the composition is a gel, cream, ointment, lotion, drops, spray including aerosol sprays, foam, or powder, optionally wherein the composition is comprised by a mask, pad, patch, a two-chamber device, or make-up.
- the composition is configured for topical administration to the skin, such as wherein the composition is a gel, cream, ointment, lotion, drops, spray including aerosol sprays, foam, or powder, optionally wherein the composition is comprised by a mask, pad, patch, a two-chamber device, or make-up.
- a method for diagnosing oxidative stress-associated skin disease in a subject or for determining whether a subject would benefit from administration of RoxP or a live C. acnes strain secreting RoxP comprising determining the quantity of RoxP or the quantity of C. acnes in a skin sample from the subject.
- Statement 20 The method according to Statement 19 comprising:
- Statement 21 The method according to Statement 19 or 20, further comprising determining the quantity of RoxP secreted by said C. acnes in the skin sample from the subject.
- Statement 22 The method according to Statement 19 or 20, further comprising determining the relative quantity of two or more C. acnes types, MLST types, SLST types, or strains in the skin sample from the subject.
- Statement 23 The method according to Statement 19 or 20, wherein said oxidative stress- associated skin disease is selected from the group comprising AK, BCC, SCC, dandruff, seborrheic dermatitis, acne, inflammation, dermatitis, psoriasis, eczema, rosacea, urticaria and vitiligo.
- Statement 26 A composition comprising RoxP or a biologically active variant or fragment thereof for use in a method of preventing or treating an oxidative stress-associated skin disease in a subject, wherein the subject has been selected as having or being at risk of having an oxidative stress-associated skin disease by the method of any one of Statements 20 to 22.
- Statement 27 A method comprising administering a composition comprising RoxP or a biologically active variant or fragment thereof to a subject, wherein the subject has been selected as one that would benefit from administration of RoxP by the method of any one of Statements 19 to 23.
- Cutibacterium acnes isolates representative of type I, II and III strains, were grown at 37°C under anaerobic conditions in Wilkins-Chalgren anaerobe broth (WC) until reaching either exponential (1-3 days) or stationary phase (5-7 days). Further information about specific C. acnes strains and their isolation can be found in Homberg et al. 2009 Clin Microbiol Infect 15:787-95, and information about their respective RoxP homologs can be found in Allhom et al. 2016 Sci Rep 6:36412.
- PA 21 1 L1 (NZ CP012351.1/CP012351.1), PA 15 2 L1 (NZ CP012352.1/CP012352.1), PA 12 1 L1 (NZ CP012354.1/CP012354.1), KCOM 1315 (NZ CP031442.1/CP031442.1), PA 30 2 L1 (NZ CP012350.1/CP012350.1), PA 12 1 R1 (NZ CP012353.1/CP012353.1), Al-14 (NZ CP013693.1/CP013693.1).
- 155 C. acnes isolates or genome sequences available from the above sources have been analysed.
- RNA content of exponential and/or stationary phase C. acnes cultures was extracted using the RNeasy® Mini Kit (Qiagen, Hilden, Germany) complemented with Bacteria Protect Reagent (Qiagen), following the manufacturer’s instructions.
- C. acnes cultures were mixed with an equal volume Bacteria Protect Reagent to ensure RNA stabilization prior to disruption of membrane structures.
- Cell lysis was subsequently achieved through addition of TE-buffer (10 mM Tris-HCl, I mM EDTA, pH 8.0) supplemented with 15 mg/ml lysozyme (Sigma-Aldrich, Saint Louis, MO) and proteinase K (Qiagen).
- RNA concentrations were measured using NanoDrop® (Saveen Werner, Limhamn, Sweden) and samples stored at - 20°C until later use.
- qPCR quantitative real time PCR
- a Buffered Glycerol-complex medium (BM* (70%, v/v), 0.5 M potassium buffer pH 6.0 (10%, v/v), YNB (1.4%, w/v), >99% glycerol (1%, v/v), Biotin (4 x 10 7 %, w/v)) for 24 h prior to being re suspended in Buffered Methanol-complex medium (BM* (70%, v/v), 0.5 M potassium buffer pH 6.0 (10%, v/v), YNB (1.4%, w/v), 99.8% methanol (1.5%, v/v), Biotin (4 x 10 7 %, w/v)). Cultures were subsequently maintained
- the yeast supernatant was loaded onto nickel columns (His GravitrapTM, GE Healthcare, Chicago, IL) and eluted according to the manufacturer’s instructions, using an imidazole buffer (20 mM sodium phosphate pH 7.4, 500 mM NaCl, 500 mM imidazole). Purified protein was immediately re- buffered in sodium phosphate (20 mM, pH 7.4) by means of dialysis (MWCO: 6-8 kDa, Novagen®), after which the protein concentration was spectrophotometrically determined through NanoDrop® (Saveen Werner) and sample purity via a 15% SDS-PAGE. Cryogelation
- Bound RoxP was eluted using imidazole buffer (20 mM sodium phosphate, 500 mM NaCl, 500 mM imidazole, pH 7.4) and the resulting protein concentration and sample purity analysed through NanoDrop® (Saveen Werner) and a 15% SDS-PAGE, respectively.
- HaCat cells cultured to 90% confluency, or THP-1 cells (1.2 x 10 6 cells/well) in a 96-well plate were treated with 2 mM paraquat (Sigma-Aldrich) and/or 5 mM RoxP for 24-48 h.
- HaCat cells were kept in their culture medium, while monocytes were transferred to a HEPES-HBSS (Hank’s balanced salt solution) buffer at pH 7.4. Viability was measured by the addition of 0.5 mg/ml 3-(4,5-demethylthiazol-2-yl)-2,5-diphenyltetrazo bum bromide (MTT) for 1-5 hours.
- the cells were washed with PBS followed by the addition of DMSO.
- the samples incubated for 30 minutes and absorbance at 550 nm was measured using a Wallac 1420 Multilabel Counter (Bio- Rad).
- the resulting reads were then classified with the classify.seqs command using the Bayesian method and the taxonomic outline vl4.51 from the Human Oral Microbiome Database (HOMD) (http://www.homd.org/) with a manual inclusion of relevant skin bacteria (Chen et al. 2010 Database : the journal of biological databases and curation baq013).
- the confidence cut-off was set to 80 %.
- LDA Linear discriminant analysis
- LEfSe effect size measurement
- the alpha values for the factorial Kruskal-Wallis and pairwise Wilcoxon tests were set to 0.05 and the LDA score threshold for discriminative features was set to 3.5.
- the online version of the LEfSe program was used (Segata et al. 2011 Genome Biology 12:R60).
- Example 1 Expression of roxP is dependent on C. acnes phylotype
- roxP expression rates were determined through quantitative real-time PCR (qPCR) in all major C. acnes phylotypes.
- C. acnes isolates identified as phylotype I displayed significantly higher expression levels of roxP compared to most phylotype II or III strains (Fig. 1).
- Table 2 below presents the strain cohort utilised in the experiment underlying Fig. 1. Fold change represents the obtained values, normalised against gapdh and put in relation to the roxP expression noted from C. acnes strain 266.
- RoxP is highly conserved, with 99-100 % amino acid identity in the majority (approximately 93 %) of isolates, a subset of strains (approximately 7 %) classified as C. acnes phylotype II and III express a more distantly related protein, with approximately 83 % amino acid identity (Fig. 10).
- the reducing activity of different RoxP homologs was compared.
- the main variant could be successfully isolated from (type IB) C. acnes KPA171202 culture media, and the less common homolog from (type II) C. acnes AD24 culture media. The latter was purified using macroporous cryogels imprinted with recombinant RoxP (Fig.
- RoxP protein abundances in actinic keratosis (AK) and basal cell carcinoma (BCC) was studied.
- Samples were subsequently analysed using a highly sensitive capacitive biosensor, previously shown to detect concentrations of as little as 8.25 ng RoxP/cm 2 skin (Ertiirk and Lood et al. 2018 J Vis Exp, doi: 10.3791/57208), and the recorded capacitance changes equilibrated to a pre-established calibration curve (Fig. 12). Results were analysed on a population (Fig. 6) and individual basis (Fig. 13).
- Synelvia SAS (Labege, France) was instructed to test the protective effect of RoxP-containing C. acnes supernatant (included as an active ingredient at 10% v/v in the medium) against cellular stressors in a reconstituted human epidermis (RHE) model. Relevant results of the analysis are set forth below.
- the RoxP-containing C. acnes supernatant was prepared as follows. A HI strain was grown in a 20L fermentor at 37°C for 3 days in a suitable medium. Then the supernatant was concentrated using Tangential flow filtrations. In a first step a 30kDa cut-off was used and in a second step a 3kDa cut-off was used. The final concentrate was analysed by gel filtration on a iProminence HPLC (Shimadzu, Kyoto, Japan) using TSKgel QC-PAK (Tosoh Bioscience, Griesheim, Germany). The concentrate was 80% pure RoxP and at a concentration of around 2mM
- Ozone stress Ozone production was done at 0.3 L/min by introducing a mixture of O 2 and O 3 (99/1% (v/v)) in the RHE (reconstituted human epidermis) culture medium (bubbling). This process produced about 1% of ozone which is equivalent to 4 ppm of ozone exposure.
- the ozonolysis reaction induces several products called primary and secondary products according to Criegee rearrangement.
- the resulting primary ozonide decomposes into a primary carbonyl (an aldehyde or a ketone) and a carbonyl-O-oxide (often termed a Criegee intermediate).
- Secondary products react with the parent molecule under ozone to generate other degradation products.
- the ozonolysis reaction could also induce protein oxidation or DNA damage.
- Negative control 2 Unstressed RHEs with active ingredient (RoxP-enriched C. a cues supernatant). RHEs were produced during 10 days under 5% CO2, 37°C in incubator and the medium was changed every two days until day 8. At days 8, and 9, the active ingredient (RoxP- enriched C. acnes supernatant) was added in the medium at 10% v/v. At day 10, RHEs and medium were recovered and stored at -20°C until analysis.
- Positive control 1 RHEs stressed with UV. RHEs were produced during 10 days under 5% CO2, 37°C in incubator and the medium was changed every two days until day 8. At day 9, RHEs were introduced in the chamber and exposed at 2 MED (UVA: 9 J/cm 2 (365 nm) and UVB 300 mJ/cm 2 (312 nm)). After the stress, a new medium was added to the RHEs. At day 10, RHEs and medium were recovered and stored at -20°C until analysis.
- Test 1 RHEs stressed with UV in contact with the active ingredient (RoxP-enriched C. acnes supernatant). RHEs were produced during 10 days under 5% CO2, 37°C in incubator and the medium was changed every two days until day 8. At day 8, the active ingredient (RoxP- enriched C. acnes supernatant) was added in the medium at 10% v/v. At day 9, RHEs were introduced in the chamber and exposed at 2 MED (UVA: 9 J/cm2 (365 nm) and UVB 300 mJ/cm 2 (312 nm)) with the medium containing the active ingredient at 10% v/v. After the stress, a new medium containing the active ingredient at 10% v/v was added to RHE. At day 10, RHEs and medium were recovered and stored at -20°C until analysis.
- Positive control 2 RHE stressed with ozone. RHEs were produced during 10 days under 5% CO2, 37°C in incubator and the medium was changed every two days until day 8. At day 9, RHE were stressed with ozone (in the reaction chamber). The reaction medium was cooled at 5°C during the reaction with ozone (about 1 minute). After the stress, a new medium was added to RHE. At day 10, RHE and medium were recovered and stored at -20°C until analysis.
- Test 2 RHEs stressed with ozone in contact with the active ingredient (RoxP-enriched C. acnes supernatant). RHEs were produced during 10 days under 5% CO2, 37°C in incubator and the medium was changed every two days until day 8. At day 8, the active ingredient (RoxP- enriched C. acnes supernatant) was added in the medium at 10% v/v. At day 9, RHE were stressed with ozone (in the reaction chamber). The reaction medium was cooled at 5°C during the reaction with ozone (about 1 minute). After the stress, a new medium containing the active ingredient was added to RHE. At day 10, RHE and medium were recovered and stored at -20°C until analysis.
- Morphology was evaluated using Hemalun eosin coloration.
- DNA damage evaluation - CPDs immunostaining: To evaluate the inducible photo-protection afforded by the active, we evaluated DNA damage using CPDs immunostaining. UVB radiation (290-320 nm), the most energetic mutagenic and carcinogenic component of solar radiation, is directly absorbed by DNA, giving rise to dimeric photoproducts between adjacent pyrimidine bases. Two types of these bulky modifications are produced, namely cyclobutane pyrimidine dimers (CPDs) and pyrimidine (6-4) pyrimidone photoproducts (Cadet et al. 2005 Mutat Res 571 :3-17). Both of these products involve dimerization of adjacent pyrimidines on the same DNA strand. Relevance of the CPD formation is further described in Sproul et al. 2014 Photochem Photobiol 90:145-154).
- CPDs cyclobutane pyrimidine dimers
- 6-4 pyrimidine
- 8-hydroxy-2-deoxyguanosine (8-OHdG) or 8-oxo-7,8-dihydro-2- deoxyguanosine (8-oxodG) is one of the predominant forms of free radical-induced oxidative lesions, and has therefore been widely used as a biomarker for oxidative stress and carcinogenesis. Relevance of this biomarker is for example described in Valavanidis et al. 2009 J Environ Sci Health C Environ Carcinog Ecotoxicol Rev 27:120-39 and Nu et al. 1999 Br J Dermatol 140:226-31.
- Glutathione peroxidase represents a selenium-containing antioxidant enzyme family with peroxidase activity whose main biological role is to protect the organism from oxidative damage. GPx effectively reduces H O and lipid peroxides to water and lipid alcohols, respectively, and in turn oxidizes glutathione to glutathione disulphide (Arthur JR. 2000 Cell Mol Life Sci 57:1825-1835). The importance of glutathione peroxidase for protection from oxidative stress is also illustrated by the fact that inactivation of glutathione peroxidase activity contributes to UV-induced squamous cell carcinoma formation (Walshe et al. 2007 Cancer Res 67:4751-8). Cutaneous squamous cell carcinomas (CSCC) are a common malignancy of keratinocytes that arise in sites of the skin exposed to excessive UV radiation.
- CSCC Cutaneous squamous cell carcinomas
- Caspases cystyl aspartate-specific proteases
- the caspase 3 has been implicated as an “effector” caspase associated with the initiation of the“death cascade” and is therefore an important marker of the cell’s entry point into the apoptotic signaling pathway.
- Caspase-3 is activated by the upstream caspase-8 and caspase-9, and since it serves as a convergence point for different signalling pathways, it is well suited as a read-out in an apoptosis assay (Nicholson et al. 1995 Nature 376:37-43; Shi 2002 Molecular Cell 9:459-470).
- Negative control 1 Unstressed RHEs without C. acnes supernatant: The RHEs were fully differentiated with four layers (basal, spinous, granular and comified layers). The basal layer is the proliferative compartment, we could observe aligned columnar cells with elliptical nucleus rich in chromatin; basal cells are attached to the polycarbonate membrane. The four strata of the spinous layer showed polygonal cells in the lower layers that flattened in the upper layers. The granular cell layer was made of 2-3 strata of flattened granular cells which contained visible keratohyalin granules. See Fig. 15A.
- CPDs cyclobutane pyrimidine dimers
- 8-OHdG was detected in unstressed RHEs without active ingredient (Fig. 17A, E).
- the active ingredient slightly increased the production of 8-OHdG (Fig. 17B, E) that confirmed the limited toxicity of the active ingredient at the chosen concentration already observed in morphology evaluation.
- Glutathione peroxidase activity was determined using a colorimetric kit from BioAssay Systems (Hayward, CA) (EGPX-100). The results are set forth in Table 3 and Fig. 18.
- the active ingredient inhibited the effect of the stress on GPX activity.
- Example 11 Apoptosis evaluation (active caspase-3)
- RoxP-Peptide 2 RTLS Y CAYPHYVN (SEQ ID NO: 21).
- ORAC assays measure the oxidative degradation of a fluorescent molecule, such as fluorescein or beta-phycoerythrin, after being mixed with free radical generators, such as azo-initiator compounds, such as AAPH (2,2’-azobis(2-methylpropionamidine) dihydrochloride).
- Azo initiators typically produce peroxyl radicals upon thermal decomposition, which cause oxidation and thereby quenching of the fluorescence of the fluorescent molecule.
- the addition of an antioxidant prevents the oxidative degeneration of the fluorescent molecule, and the degree of this protection can be quantified by a fluorimeter.
- peroxyl free radical is commonly found in the body, which makes ORAC assays particularly informative of antioxidant properties of test compounds in vivo.
- the ORAC assay (Zenbio, ordering number AOX-2) was performed as follows:
- Deoxyribose assay is a well-established method to measure generation of hydroxyl radicals in biological systems and for evaluating the ability of antioxidants to reduce ⁇ OH radical generation. Such assays are described for example in Gutteridge & Halliwell (Biochem J. 1988, vol. 253(3), 932-933) and references therein.
- deoxyribose incubated with H2O2 and Fe2 + (or Fe3 + plus a reductant) is degraded into products that can react to form thiobarbituric acid-malondialdehyde (classic TBA-MDA assay) chromogen. This reaction is driven by ⁇ OH radicals. A reduction in prevalence of ⁇ OH radicals will result in fewer formed complexes and lower absorbance.
- buffer A (20 mM KH2PO4-KOH, pH 7,4), including or not 2 mg/ml RoxP, in triplicate
- Lipid peroxidation the oxidative degradation of lipids, results from the action of free radicals on lipids. Peroxidation of lipids in cell membranes may result in cell damage. Hydroperoxides react with Fe 2+ ions to produce Fe 3+ ions which are detected using thiocyanate ion as chromogen. Lower abundance of Fe 3+ ions results in lowered absorbance, indicating lower level of lipid hydroperoxides in irradiated plasma.
- lipid hydroperoxide assay kit (Cayman Chemical, item no. Item No. 705002).
- the reagents used in the ferrozine assay included 100 m ⁇ of 50 mM iron ammonium dodecahydrate, 100 pi 2 mM ferrozine in H 2 0, and RoxP (50 m ⁇ ) resulting in various RoxP concentrations indicated in the graph, diluted from a stock solution of 2 mg/ml RoxP in PBS. Incubation was Incubation 17 hours.
- Example 16 RoxP interaction with coproporphyrin III
- the reaction components included ABTS (oxidized according to the protocol), 20 x in PBS, pre-heated at 37° C, 89 ul added; RoxP, 2 mg/ml, 10 m ⁇ ; FMN/FDN 1 mM, 1 m ⁇ or 3 m ⁇ (“1FMN”,“1FDN” or“3FMN”,“3FDN” in the graph, respectively); total volume was adjusted to 100 m ⁇ with PBS. Results showed an increased reduction of ABTS radical by RoxP when FMN/FDN was added, especially FDN. (see Fig. 27).
- the Singlet Oxygen Sensor Green dye was dissolved in Methanol and added in PBS buffer to reach a final concentration of 0,4mM. This solution was distributed in a clear 96 well plate. To the wells ImM Coproporphyrin III, or ImM Protoporphyrin IX was added. Then varying amounts of RoxP were added. Each condition was set up as 4 replicas. Two of the replicas were covered by aluminium foil during the exposure, while two wells were exposed for 10 min to a UV lamp. After exposure, the flouresence of the Singlet Oxygen Sensor Green dye was read out indicating the amount of singlet oxygen generated.
- RoxP efficiently inhibited the generation of radicals formed through the porphyrins (see Fig. 32) and can thus be a preferential way to reduce damage caused by UV induced singlet oxygen generation.
- the objective of this study was to assess the UV-protection potential of three compositions containing RoxP in 7 healthy subjects by measuring the antioxidative effect and skin erythema. Oxidative stress was induced by exposition to UVA- and UVB-light to the skin on the upper back.
- the anti- oxidative activity of the test products was evaluated by measurement of sebum lipid oxidization levels (concentration of squalene monohydroperoxide) of swab-samples from the skin surface.
- the potential was assessed after two applications of RoxP in comparison to water, an untreated control and one hydrophilic standard antioxidant (HI) after induction of a light sunburn (1.25 MED). Specific sampling kits (Synelvia) were used to obtain lipid samples for analysis. Additionally, the UV-protection potential of the products was evaluated by measuring the produced erythema (Chromameter).
- the tested products were as follows: untreated (“UT”); demineralized water (“Aqua”); Antioxidant HI, a natural hydrophilic catechol 1 % in water (positive control) (“HI”); 0.3 mM (“EC-AA-001”), 1.2 mM (“YE-LU-001”) or 4.0 mM (“CA-FT-001”) full-length RoxP protein in an aqueous solution.
- the samples were provided as solutions and were stored at room temperature. For all reference the Aqua control was used as the samples were applied as an aqueous solution.
- the general test area was upper back. Treatment areas had a size of 4.5 cm x 4.5 cm. Irradiation areas had a size of 4 cm x 4 cm. The round swabbing area had a diameter of approx. 2.6 cm. Numbers of test areas were assigned starting on the left upper side of the back towards the right upper side of the back building a row (area 1 to 4). A second row started under the first row on the left side (area 5 and 6). Two areas were always irradiated together (e.g. Area 1 and 3, 2 and 4, 5 and 6). See Fig. 28. Treatments were balanced assigned to the test areas according to a 6 x 6 orthogonal Latin Squares with randomly permuted blocks of fixed size.
- test product 45 m ⁇ (approx. 2 mg/cm 2 ) of the respective test solution were applied with a pipette. After applying the test product to the test area, they were quickly spread by gently rubbing (soft touch with light pressure) with a non-saturated finger-cot, first with rotating followed by crosswise movements for a final uniform coating on the skin.
- Chromameter measurements were performed on all test areas (Baseline) to assess erythema.
- the study products were applied according to the randomization scheme. To avoid absorption of the test products by clothes, the subjects stayed undressed at room temperature for approximately 15 minutes. 45 mins ⁇ 5 mins after application, every treatment area was irradiated with 1.25 MED. 25 to 45 mins after irradiation, swabbing was performed on all treatment areas according to the Swab method and analyzed as described by Synelvia (Appendix 2). 5 to 10 minutes after swabbing, Chromameter measurements were repeated.
- the color is defined by the parameters a* (red-green axis; negative a*- value green, positive a*-value red) and b* (blue-yellow axis, negative b*-value blue, positive b*-value yellow).
- a* value correlates well with visual assessments of skin redness (erythema)
- a* is a measure for erythema.
- An increase in the a*-value corresponds to an increase in the degree of skin redness.
- UVA Spot 1000 Irradiations were performed with the UVA Spot 1000. It produces a large, homogenous field of irradiation (approximately 20 cm x 20 cm in 50 cm distance from radiation source). The spectrum is defined by specific filters. The "H2" filter was used (UVB and UVA radiation). The sun simulator was used to irradiate the test areas with the requested irradiation intensity on the test area. Multiple spots may have been irradiated at the same time. The sun stimulator irradiates an area of approx. 20 cm x 20 cm. 1 irradiation per test area.
- Swab sampling was performed on each test area by a trained technician. Cotton Swabs were wetted with the sampling buffer and a first swab is taken by applying pressure for 45 seconds during regular movements of the swab over the whole test area. The swab was cut with scissors, so it fits into the provided Eppendorf tube containing a buffer. The procedure was repeated on the same test area with a second buffer wetted swab. The second swab was stored in the same Eppendorf tube as the first swab.
- the higher amount of SQOOH on the irradiated area treated with water might be explained by the effect of water to make the skin more transparent and therefore more light might be absorbed by the skin leading to higher oxidation levels.
- the irradiated areas treated with the positive control "HI" showed very low values for SQOOH, as expected.
- the three test products resulted in decreasing values in SQOOH: the test product EC-AA-001 showed the lowest anti- oxidative efficacy, followed by YE-LU-001 and the test product CA-FT-001 showed the highest tendency for an anti- oxidative efficacy. This difference in product efficacy matched to the concentrations of antioxidants.
- the difference between the CA-FT-001 test product and the aqua control was statistically significant with a p-value ⁇ 0.05.
- compositions e.g., lotions, gels, or creams embodying the principles of the present invention, which can be suitably employed in cosmetic or pharmaceutical settings.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Medicinal Chemistry (AREA)
- Epidemiology (AREA)
- Immunology (AREA)
- Pharmacology & Pharmacy (AREA)
- Molecular Biology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Organic Chemistry (AREA)
- Biomedical Technology (AREA)
- Dermatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- Biochemistry (AREA)
- Hematology (AREA)
- Urology & Nephrology (AREA)
- Analytical Chemistry (AREA)
- Physics & Mathematics (AREA)
- Cell Biology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Birds (AREA)
- Tropical Medicine & Parasitology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- General Physics & Mathematics (AREA)
- Food Science & Technology (AREA)
- Pathology (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Gerontology & Geriatric Medicine (AREA)
- Mycology (AREA)
Priority Applications (11)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| BR112021008496-7A BR112021008496A2 (pt) | 2018-11-16 | 2019-11-15 | composições para o tratamento de doenças de pele associadas a estresse oxidativo e envelhecimento da pele e diagnóstico de doenças de pele associadas a estresse oxidativo |
| KR1020217018454A KR102913696B1 (ko) | 2018-11-16 | 2019-11-15 | 산화 스트레스 관련 피부 질환 및 피부 노화의 치료 및 산화 스트레스 관련 피부 질환의 진단을 위한 조성물 |
| CN201980075535.6A CN113038959B (zh) | 2018-11-16 | 2019-11-15 | 用于治疗氧化应激相关皮肤病和皮肤衰老的组合物和氧化应激相关皮肤病的诊断 |
| EP19800907.8A EP3880304B8 (en) | 2018-11-16 | 2019-11-15 | Compositions for treating oxidative stress-associated skin diseases and skin ageing |
| PL19800907.8T PL3880304T3 (pl) | 2018-11-16 | 2019-11-15 | Kompozycje do leczenia chorób skóry związanych ze stresem oksydacyjnym i starzenia się skóry |
| AU2019380669A AU2019380669B2 (en) | 2018-11-16 | 2019-11-15 | Compositions for treating oxidative stress-associated skin diseases and skin ageing and diagnosis of oxidative stress-associated skin diseases |
| US17/293,464 US20220000762A1 (en) | 2018-11-16 | 2019-11-15 | Compositions for treating oxidative stress-associated skin diseases and skin ageing and diagnosis of oxidative stress-associated skin diseases |
| CA3118524A CA3118524A1 (en) | 2018-11-16 | 2019-11-15 | Compositions for treating oxidative stress-associated skin diseases and skin ageing and diagnosis of oxidative stress-associated skin diseases |
| MX2021005755A MX2021005755A (es) | 2018-11-16 | 2019-11-15 | Composiciones para el tratamiento de enfermedades de la piel y envejecimiento de la piel asociados al estres oxidativo y diagnostico de enfermedades de la piel asociadas con estres oxidativo. |
| ES19800907T ES2994459T3 (en) | 2018-11-16 | 2019-11-15 | Compositions for treating oxidative stress-associated skin diseases and skin ageing |
| JP2021526737A JP7532361B2 (ja) | 2018-11-16 | 2019-11-15 | 酸化ストレスに関連付けられる皮膚疾患及び皮膚老化を処置するための組成物ならびに酸化ストレスに関連付けられる皮膚疾患の診断。 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP18206646.4 | 2018-11-16 | ||
| EP18206646 | 2018-11-16 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2020099663A1 true WO2020099663A1 (en) | 2020-05-22 |
Family
ID=64331864
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2019/081546 Ceased WO2020099663A1 (en) | 2018-11-16 | 2019-11-15 | Compositions for treating oxidative stress-associated skin diseases and skin ageing and diagnosis of oxidative stress-associated skin diseases |
Country Status (12)
| Country | Link |
|---|---|
| US (1) | US20220000762A1 (https=) |
| EP (1) | EP3880304B8 (https=) |
| JP (1) | JP7532361B2 (https=) |
| KR (1) | KR102913696B1 (https=) |
| CN (1) | CN113038959B (https=) |
| AU (1) | AU2019380669B2 (https=) |
| BR (1) | BR112021008496A2 (https=) |
| CA (1) | CA3118524A1 (https=) |
| ES (1) | ES2994459T3 (https=) |
| MX (1) | MX2021005755A (https=) |
| PL (1) | PL3880304T3 (https=) |
| WO (1) | WO2020099663A1 (https=) |
Cited By (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN113219097A (zh) * | 2021-01-15 | 2021-08-06 | 杭州海关技术中心 | 基于超高效合相色谱的婴幼儿配方奶粉中肉碱对映体拆分和测定方法 |
| WO2021262622A1 (en) * | 2020-06-23 | 2021-12-30 | Crown Laboratories, Inc. | Probiotic skin formulations |
| US11504404B2 (en) | 2016-02-24 | 2022-11-22 | Crown Laboratories, Inc. | Skin probiotic formulation |
| US11541081B2 (en) | 2016-10-19 | 2023-01-03 | S-Biomedic Nv | Methods and compositions for changing the composition of the skin microbiome using complex mixtures of bacterial strains |
| EP4197523A1 (en) * | 2021-12-17 | 2023-06-21 | DSM IP Assets B.V. | A freeze-dried composition and preparation thereof |
| WO2023110886A1 (en) * | 2021-12-17 | 2023-06-22 | S-Biomedic | A freeze-dried composition and preparation thereof |
| WO2023135186A1 (en) * | 2022-01-12 | 2023-07-20 | S-Biomedic Nv | Skin care composition and uses thereof |
| CN116940330A (zh) * | 2020-12-21 | 2023-10-24 | 南洋理工大学 | 短链脂肪酸作为去屑剂的用途 |
| US11987788B2 (en) | 2015-04-20 | 2024-05-21 | S-Biomedic Nv | Methods and compositions for changing the composition of the skin microbiome using complex mixtures of bacterial strains |
| US12049633B2 (en) | 2014-06-17 | 2024-07-30 | Crown Laboratories, Inc. | Genetically modified bacteria and methods for genetic modification of bacteria |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN115165819B (zh) * | 2022-05-27 | 2024-08-09 | 天津科技大学 | 一种快速定量分析芦丁的荧光分子印迹光子晶体凝胶条的制备方法及应用 |
| CN120173837B (zh) * | 2025-05-21 | 2025-12-05 | 杭州微致生物科技有限公司 | 痤疮丙酸杆菌vb208基因编辑方法及其应用 |
Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US5270163A (en) | 1990-06-11 | 1993-12-14 | University Research Corporation | Methods for identifying nucleic acid ligands |
| WO2012153206A1 (en) | 2011-05-06 | 2012-11-15 | Bormioli Rocco & Figlio S.P.A. | Closure |
| WO2017168263A1 (en) | 2016-03-31 | 2017-10-05 | Bormioli Rocco S.P.A. | A closure capsule |
| WO2018060799A1 (en) | 2016-09-28 | 2018-04-05 | Bormioli Rocco S.P.A. | Capsule with structure for containing and releasing a product |
| WO2018073651A1 (en) | 2016-10-19 | 2018-04-26 | S-Biomedic Nv | Methods and compositions for changing the composition of the skin microbiome using complex mixtures of bacterial strains |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2011037764A (ja) * | 2009-08-11 | 2011-02-24 | Shiseido Co Ltd | 皮膚外用剤、美白剤、抗酸化剤および抗老化剤 |
| FR2954140A1 (fr) * | 2009-12-17 | 2011-06-24 | Oreal | Compositions cosmetiques ou dermatologiques a base de bacteriocines et de prebiotiques |
| EP2825676B1 (en) * | 2012-03-17 | 2017-12-20 | The Regents of The University of California | Fast diagnosis and personalized treatments for acne |
-
2019
- 2019-11-15 CA CA3118524A patent/CA3118524A1/en active Pending
- 2019-11-15 JP JP2021526737A patent/JP7532361B2/ja active Active
- 2019-11-15 PL PL19800907.8T patent/PL3880304T3/pl unknown
- 2019-11-15 KR KR1020217018454A patent/KR102913696B1/ko active Active
- 2019-11-15 CN CN201980075535.6A patent/CN113038959B/zh active Active
- 2019-11-15 AU AU2019380669A patent/AU2019380669B2/en active Active
- 2019-11-15 EP EP19800907.8A patent/EP3880304B8/en active Active
- 2019-11-15 US US17/293,464 patent/US20220000762A1/en active Pending
- 2019-11-15 BR BR112021008496-7A patent/BR112021008496A2/pt unknown
- 2019-11-15 WO PCT/EP2019/081546 patent/WO2020099663A1/en not_active Ceased
- 2019-11-15 ES ES19800907T patent/ES2994459T3/es active Active
- 2019-11-15 MX MX2021005755A patent/MX2021005755A/es unknown
Patent Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US5270163A (en) | 1990-06-11 | 1993-12-14 | University Research Corporation | Methods for identifying nucleic acid ligands |
| WO2012153206A1 (en) | 2011-05-06 | 2012-11-15 | Bormioli Rocco & Figlio S.P.A. | Closure |
| WO2017168263A1 (en) | 2016-03-31 | 2017-10-05 | Bormioli Rocco S.P.A. | A closure capsule |
| WO2018060799A1 (en) | 2016-09-28 | 2018-04-05 | Bormioli Rocco S.P.A. | Capsule with structure for containing and releasing a product |
| WO2018073651A1 (en) | 2016-10-19 | 2018-04-26 | S-Biomedic Nv | Methods and compositions for changing the composition of the skin microbiome using complex mixtures of bacterial strains |
Non-Patent Citations (61)
| Title |
|---|
| "Genbank", Database accession no. NZ CP023676.1 |
| "Methods in Enzymology", vol. 402, 2005, ACADEMIC PRESS, article "Biological Mass Spectrometry" |
| "Methods in Molecular Biology", vol. 248, HUMANA PRESS 2004, article "Antibody Engineering: Methods and Protocols" |
| "Monoclonal Antibodies: A Manual of Techniques", 1987, CRC PRESS |
| "The Aptamer Handbook: Functional Oligonucleotides and Their Applications", 2006, WILEY-VCH |
| ALTSCHUL ET AL., J MOL BIOL, vol. 215, 1990, pages 403 - 10 |
| ARTHUR JR., CELL MOL LIFE SCI, vol. 57, 2000, pages 1825 - 1835 |
| BIDLINGMEYER, B. A.: "Practical HPLC Methodology and Applications", 1993, JOHN WILEY & SONS INC. |
| BIEMANN, METHODS ENZYMOL, vol. 193, 1990, pages 455 - 79 |
| BOUKAMP ET AL., J CELL BIOL, vol. 106, 1988, pages 761 - 71 |
| C MORGANG VESEY: "Encyclopedia of Microbiology", 2009, ACADEMIC PRESS, article "Freeze-Drying of Microorganisms", pages: 162 - 173 |
| CADET ET AL., MUTAT RES, vol. 571, 2005, pages 3 - 17 |
| CHEN ET AL., DATABASE : THE JOURNAL OF BIOLOGICAL DATABASES AND CURATION BAQ013, 2010 |
| CLACKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628 |
| EDGAR ET AL., BIOINFORMATICS, vol. 27, 2011, pages 2194 - 200 |
| ELLINGTONSZOSTAK, NATURE, vol. 346, 1990, pages 818 - 822 |
| ERTIIRK ET AL., J MOL RECOGNIT, vol. 26, 2013, pages 633 - 642 |
| ERTIIRK ET AL., PLOS ONE, vol. 13, 2018, pages e0193754 |
| ERTIIRKLOOD ET AL., J VIS EXP, 2018 |
| FITZ-GIBBON ET AL., J INVEST DERMATOL, vol. 133, 2013, pages 2152 - 2160 |
| FURTHER, ALLHORN ET AL., SCI REP, vol. 6, 2016, pages 36412 |
| GIZEM ERTÜ RK ET AL: "Highly sensitive detection and quantification of the secreted bacterial benevolence factor RoxP using a capacitive biosensor: A possible early detection system for oxidative skin diseases", 1 March 2018 (2018-03-01), XP055659372, Retrieved from the Internet <URL:https://journals.plos.org/plosone/article/file?id=10.1371/journal.pone.0193754&type=printable> [retrieved on 20200120] * |
| GUTTERIDGEHALLIWELL, BIOCHEM J., vol. 253, no. 3, 1988, pages 932 - 933 |
| HARTREE, ANAL BIOCHEM, vol. 48, 1972, pages 422 - 427 |
| HENIKOFF ET AL., PROC. NATL. ACAD. SCI., vol. 89, 1992, pages 10915 - 10919 |
| HOLLAND ET AL., BMC MICROBIOL, vol. 10, 2010, pages 230 |
| HOLMBERG ET AL., CLIN MICROBIOL INFECT, vol. 15, 2009, pages 787 - 95 |
| HORWELL, TRENDS BIOTECHNOL, vol. 13, 1995, pages 132 - 134 |
| HUSE ET AL., ENVIRONMENTAL MICROBIOLOGY, vol. 12, no. 7, 2010, pages 1889 - 98 |
| JOHNSONCUMMINS, J BACTERIOL, vol. 109, 1972, pages 1047 - 66 |
| KADAM ET AL., INDIAN J CLIN BIOCHEM, vol. 25, 2010, pages 388 - 392 |
| KOHLER ET AL., NATURE, vol. 256, 1975, pages 495 |
| KOZICH ET AL., APPLIED AND ENVIRONMENTAL MICROBIOLOGY, vol. 79, 2013, pages 5112 - 20 |
| KUHN ET AL., PROTEOMICS, vol. 4, 2004, pages 1175 - 86 |
| LIN ET AL., BMC GENOMICS, vol. 14, 2013, pages 620 |
| LING ET AL., EXPERT REV MOL DIAGN, vol. 7, 2007, pages 87 - 98 |
| LODES ET AL., MICROBIOLOGY, vol. 152, 2006, pages 3667 - 3681 |
| LOMHOLT ET AL., PLOS ONE, vol. 5, 2010, pages e12277 |
| LOWRY ET AL., J BIOL CHEM, vol. 193, 1951, pages 265 |
| MARIA ALLHORN ET AL: "A novel enzyme with antioxidant capacity produced by the ubiquitous skin colonizer Propionibacterium acnes", SCIENTIFIC REPORTS, vol. 6, no. 1, 2 November 2016 (2016-11-02), XP055659407, DOI: 10.1038/srep36412 * |
| MARKS ET AL., J MOL BIOL, vol. 222, 1991, pages 581 - 597 |
| MCDOWELL ET AL., J CLIN MICROBIOL, vol. 43, 2005, pages 326 - 334 |
| MCDOWELL ET AL., J MED MICROBIOL, vol. 57, 2008, pages 218 - 224 |
| MCDOWELL ET AL., PLOS ONE, vol. 7, 2012, pages e41480 |
| NICHOLSON ET AL., NATURE, vol. 376, 1995, pages 37 - 43 |
| NIELSENGEIERSTANGER, J IMMUNOL METHODS, vol. 290, 2004, pages 107 - 20 |
| NU ET AL., BR J DERMATOL, vol. 140, 1999, pages 226 - 31 |
| RE ET AL., FREE RADIC BIOL MED, vol. 26, 1999, pages 1231 - 1237 |
| SANDER ET AL., BR J DERMATOL, vol. 148, 2003, pages 913 - 922 |
| SCHOLZ ET AL., PLOS ONE, vol. 9, 2014, pages e104199 |
| SEGATA ET AL., GENOME BIOLOGY, vol. 12, 2011, pages R60 |
| SHI, MOLECULAR CELL, vol. 9, 2002, pages 459 - 470 |
| SOLOVYEVSALAMOV: "Metagenomics and its Applications in Agriculture, Biomedicine and Environmental Studies", 2011, NOVA SCIENCE PUBLISHERS, article "Automatic Annotation of Microbial Genomes and Metagenomic Sequences", pages: 61 - 78 |
| SPROUL ET AL., PHOTOCHEM PHOTOBIOL, vol. 90, 2014, pages 145 - 154 |
| TATUSOVAMADDEN, FEMS MICROBIOL LETT, vol. 174, 1999, pages 247 - 250 |
| TILDE ANDERSSON ET AL: "Common skin bacteria protect their host from oxidative stress through secreted antioxidant RoxP", SCIENTIFIC REPORTS, vol. 9, no. 1, 5 March 2019 (2019-03-05), XP055659361, DOI: 10.1038/s41598-019-40471-3 * |
| TSUCHIYA ET AL., INT J CANCER, vol. 26, 1980, pages 171 - 6 |
| TUERKGOLD, SCIENCE, vol. 249, 1990, pages 505 - 510 |
| VALANNE ET AL., MICROBIOLOGY, vol. 151, 2005, pages 1369 - 1379 |
| VALAVANIDIS ET AL., J ENVIRON SCI HEALTH C ENVIRON CARCINOG ECOTOXICOL REV, vol. 27, 2009, pages 120 - 39 |
| WALSHE ET AL., CANCER RES, vol. 67, 2007, pages 4751 - 8 |
Cited By (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12049633B2 (en) | 2014-06-17 | 2024-07-30 | Crown Laboratories, Inc. | Genetically modified bacteria and methods for genetic modification of bacteria |
| US11987788B2 (en) | 2015-04-20 | 2024-05-21 | S-Biomedic Nv | Methods and compositions for changing the composition of the skin microbiome using complex mixtures of bacterial strains |
| US11504404B2 (en) | 2016-02-24 | 2022-11-22 | Crown Laboratories, Inc. | Skin probiotic formulation |
| US11541081B2 (en) | 2016-10-19 | 2023-01-03 | S-Biomedic Nv | Methods and compositions for changing the composition of the skin microbiome using complex mixtures of bacterial strains |
| JP2023533202A (ja) * | 2020-06-23 | 2023-08-02 | クラウン ラボラトリーズ,インコーポレイテッド | プロバイオティクス皮膚製剤 |
| WO2021262622A1 (en) * | 2020-06-23 | 2021-12-30 | Crown Laboratories, Inc. | Probiotic skin formulations |
| EP4167937A4 (en) * | 2020-06-23 | 2024-11-13 | Crown Laboratories, Inc. | PROBIOTIC SKIN FORMULATIONS |
| US12102710B2 (en) | 2020-06-23 | 2024-10-01 | Crown Laboratories, Inc. | Probiotic skin formulations |
| CN116940330A (zh) * | 2020-12-21 | 2023-10-24 | 南洋理工大学 | 短链脂肪酸作为去屑剂的用途 |
| CN113219097A (zh) * | 2021-01-15 | 2021-08-06 | 杭州海关技术中心 | 基于超高效合相色谱的婴幼儿配方奶粉中肉碱对映体拆分和测定方法 |
| CN113219097B (zh) * | 2021-01-15 | 2022-06-24 | 杭州海关技术中心 | 婴幼儿配方奶粉中肉碱对映体拆分和测定方法 |
| WO2023110886A1 (en) * | 2021-12-17 | 2023-06-22 | S-Biomedic | A freeze-dried composition and preparation thereof |
| EP4197523A1 (en) * | 2021-12-17 | 2023-06-21 | DSM IP Assets B.V. | A freeze-dried composition and preparation thereof |
| WO2023135186A1 (en) * | 2022-01-12 | 2023-07-20 | S-Biomedic Nv | Skin care composition and uses thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| PL3880304T3 (pl) | 2025-03-03 |
| JP7532361B2 (ja) | 2024-08-13 |
| JP2022507616A (ja) | 2022-01-18 |
| AU2019380669A1 (en) | 2021-05-20 |
| EP3880304B1 (en) | 2024-10-16 |
| BR112021008496A2 (pt) | 2021-08-10 |
| US20220000762A1 (en) | 2022-01-06 |
| KR102913696B1 (ko) | 2026-01-16 |
| EP3880304B8 (en) | 2024-11-20 |
| ES2994459T3 (en) | 2025-01-24 |
| CN113038959B (zh) | 2024-09-13 |
| EP3880304C0 (en) | 2024-10-16 |
| MX2021005755A (es) | 2021-08-11 |
| KR20210094576A (ko) | 2021-07-29 |
| EP3880304A1 (en) | 2021-09-22 |
| AU2019380669B2 (en) | 2025-01-30 |
| CA3118524A1 (en) | 2020-05-22 |
| CN113038959A (zh) | 2021-06-25 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| AU2019380669B2 (en) | Compositions for treating oxidative stress-associated skin diseases and skin ageing and diagnosis of oxidative stress-associated skin diseases | |
| AU2019295067B2 (en) | Lactobacillus plantarum for skin care | |
| JP2017515829A (ja) | 抗微生物ペプチドの生成を誘導するためのナイアシンアミド | |
| KR20230046141A (ko) | 항노화 활성을 갖는 펩타이드 및 이의 용도 | |
| Feng et al. | A non-bactericidal cathelicidin with antioxidant properties ameliorates UVB-induced mouse skin photoaging via intracellular ROS scavenging and Keap1/Nrf2 pathway activation | |
| KR20230046874A (ko) | 항노화 활성을 갖는 펩타이드 및 이의 용도 | |
| KR102043473B1 (ko) | Saspase-flg2 복합체, 조정제, 및 용도 | |
| US11213472B2 (en) | VEGFC production promoter | |
| CA3074267C (en) | Anti-pollution compositions containing bacillus coagulans | |
| Wang et al. | Fermented tea leave extract against oxidative stress and ageing of skin in vitro and in vivo | |
| Sannasimuthu et al. | Peroxiredoxin of Arthrospira platensis derived short molecule YT12 influences antioxidant and anticancer activity | |
| US20160008252A1 (en) | Cosmetic use of queuine | |
| HK40049609B (en) | Compositions for treating oxidative stress-associated skin diseases and skin ageing | |
| HK40049609A (en) | Compositions for treating oxidative stress-associated skin diseases and skin ageing | |
| KR101252468B1 (ko) | 피부 트러블 개선용 화장품 조성물 | |
| KR20100022309A (ko) | 엔테로코커스 패컬리스 에스엘-5 유래 박테리오신을 포함하는 여드름 예방 및 치료용 조성물 | |
| AU2024310292A1 (en) | Modified peptides such as polypeptides la-19 and tm-19 having anti-aging and repairing effects and use thereof | |
| Mohanan et al. | Moisturizing and antioxidant factors of skin barrier restoring cream with shea butter, silkflo and vitamin E in human keratinocyte cells | |
| KR20200053068A (ko) | C-펩타이드를 유효성분으로 포함하는 미세먼지에 대한 피부보호용 화장료 조성물 | |
| Chen et al. | Plum blossom low molecular weight polypeptide protects HaCaT cells against UVB‐induced oxidative damage in vitro and underlying mechanism | |
| SE2030376A1 (en) | Plant extracts for improving skin barrier function | |
| KR20220136380A (ko) | 피부 병태의 치료 | |
| RU2840027C1 (ru) | Лечение кожных заболеваний | |
| KR102774179B1 (ko) | 항노화 활성을 갖는 펩타이드 및 이의 용도 | |
| JP5768113B2 (ja) | 前処置用の皮膚外用剤の製造方法 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 19800907 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3118524 Country of ref document: CA |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112021008496 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2021526737 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2019380669 Country of ref document: AU Date of ref document: 20191115 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20217018454 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2019800907 Country of ref document: EP Effective date: 20210616 |
|
| ENP | Entry into the national phase |
Ref document number: 112021008496 Country of ref document: BR Kind code of ref document: A2 Effective date: 20210430 |
|
| WWR | Wipo information: refused in national office |
Ref document number: 1020217018454 Country of ref document: KR |