WO2020077129A1 - Human amylin analog polypeptides and methods of use - Google Patents

Human amylin analog polypeptides and methods of use Download PDF

Info

Publication number
WO2020077129A1
WO2020077129A1 PCT/US2019/055696 US2019055696W WO2020077129A1 WO 2020077129 A1 WO2020077129 A1 WO 2020077129A1 US 2019055696 W US2019055696 W US 2019055696W WO 2020077129 A1 WO2020077129 A1 WO 2020077129A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
yglu
cib
spacer
isolated polypeptide
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2019/055696
Other languages
English (en)
French (fr)
Inventor
William Blackwell
Ved P. SRIVASTAVA
James M. Way
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Intarcia Therapeutics Inc
Original Assignee
Intarcia Therapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to MX2021004185A priority Critical patent/MX2021004185A/es
Priority to JP2021519698A priority patent/JP7636321B2/ja
Priority to IL320142A priority patent/IL320142A/en
Priority to CN202510801062.0A priority patent/CN120647747A/zh
Priority to CA3116023A priority patent/CA3116023C/en
Priority to EP19795724.4A priority patent/EP3864031A1/en
Priority to CN201980081630.7A priority patent/CN113195524A/zh
Priority to IL282079A priority patent/IL282079B2/en
Priority to BR112021006823-6A priority patent/BR112021006823A2/pt
Application filed by Intarcia Therapeutics Inc filed Critical Intarcia Therapeutics Inc
Priority to KR1020217013697A priority patent/KR102911883B1/ko
Priority to SG11202103586UA priority patent/SG11202103586UA/en
Priority to AU2019357621A priority patent/AU2019357621B2/en
Publication of WO2020077129A1 publication Critical patent/WO2020077129A1/en
Anticipated expiration legal-status Critical
Priority to JP2024155106A priority patent/JP2025000663A/ja
Priority to AU2025204716A priority patent/AU2025204716A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575Hormones
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22Hormones
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22Hormones
    • A61K38/28Insulins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0002Galenical forms characterised by the drug release technique; Application systems commanded by energy
    • A61K9/0004Osmotic delivery systems; Sustained release driven by osmosis, thermal energy or gas
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0019Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/04Anorexiants; Antiobesity agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2300/00Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides

Definitions

  • This invention relates to isolated polypeptides that are analogs of human amylin.
  • the disclosed amylin analog polypeptides have beneficial physicochemical properties relative to endogenous amylin, such as longer elimination half-lives (ti/2) and improved solubility and thermal stability.
  • This invention also relates to methods of using the presently disclosed amylin analog polypeptides in a variety of therapeutic indications, as well as methods of producing the same.
  • the disclosed amylin analog polypeptides are particularly useful in methods of treating metabolic diseases or disorders, such as types 1 and 2 diabetes, and providing weight loss.
  • Human amylin, or islet amyloid polypeptide (IAPP), is a 37-residue polypeptide hormone. Amylin is co-secreted with insulin from pancreatic b-cells in the ratio of approximately 100: 1 (insulin: amylin). Pro-islet amyloid polypeptide (i.e., pro-IAPP) is produced in the pancreatic b-cells as a 67 amino acid, 7404 Dalton pro-peptide that undergoes post-translational modifications including protease cleavage to produce the 37- residue amylin. Loss of b-cell function that occurs early in type 1 diabetics and can occur late in type 2 diabetics leads to deficiencies in the secretion of insulin and amylin.
  • pro-IAPP Pro-islet amyloid polypeptide
  • Amylin functions as part of the endocrine pancreas, those cells within the pancreas that synthesize and secrete hormones. Amylin contributes to glycemic control; it is secreted from the pancreatic islets into the blood circulation and is cleared by peptidases in the kidney. Amylin’ s metabolic function is well-characterized as an inhibitor of the appearance of nutrients, such as glucose, in the plasma. It thus functions as a synergistic partner to insulin, a peptide that regulates blood glucose levels and coordinates the body’s distribution and uptake of glucose. Insulin’s role in the body is, among other things, to prevent blood glucose levels from rising too high, particularly after a meal.
  • Amylin is believed to play a role in glycemic regulation by slowing gastric emptying and promoting satiety (i.e., feeling of fullness), thereby preventing post-prandial (i.e., after- meal) spikes in blood glucose levels.
  • the overall effect is to slow the rate of appearance of glucose in the blood after eating.
  • Amylin also lowers the secretion of glucagon by the pancreas.
  • Glucagon’s role in the body is, among other things, to prevent blood glucose levels dropping too low. This is significant because certain type 1 diabetics, for example, are prone to secrete excess amounts of the blood glucose-raising glucagon just after meals.
  • AstraZeneca plc, Cambridge, UK was developed as a synthetic analogue of human amylin for the treatment of patients with types 1 or 2 diabetes, who use meal-time insulin but cannot achieve desired glycemic control despite optimal insulin therapy.
  • Pramlintide differs from human amylin in 3 of its 37 amino acids. These modifications provide pramlintide a longer half-life of approximately 48 minutes in humans and reduce its propensity to aggregate, a characteristic found of human amylin.
  • pramlintide is administered up to four times per day, via subcutaneous injection before meals, as an adjunct to insulin therapy administered after meals.
  • Pramlintide cannot be mixed with insulin; separate syringes are used.
  • Reported side effects of pramlintide include nausea and vomiting.
  • Adverse reactions can include severe hypoglycemia, particularly for type 1 diabetics. Consequently, dosage of meal-time insulin is reduced for patients who initiate administration of pramlintide.
  • pramlintide is administered before each meal via subcutaneous injection at a recommended starting dose that is gradually increased to a target maintenance dose.
  • Another investigational analog of human amylin, davalintide AC2307; also developed by Amylin Pharmaceuticals, Inc.
  • amylin analog polypeptides that mimic amylin activity yet have greater therapeutic potential than both endogenous human amylin and existing amylin analogs such as pramlintide and davalintide.
  • polypeptides of this invention are effective as amylin analogs.
  • Such polypeptides have the general formula of SEQ ID NO: 199:
  • Xi is S, K, k, H or I;
  • X3 is N or S;
  • X5 is S or A;
  • Xe is T or S;
  • Xs is A or K;
  • X10 is Q or S;
  • X12 is L or K;
  • X13 is A, S, E or K;
  • X14 is N, n, d, Y or Q;
  • X15 is E, F, f, Y, I, k, K or a- aminoisobutyric acid (Aib);
  • Cib is k, K, L, Aib, A-methyl leucine (A-MeL), or 1;
  • X17 is H, V, Q, R, k, K or Aib;
  • Xis is K, H, or R;
  • X19 is S or Aib;
  • X20 is S or Aib;
  • X22 is N or E;
  • X29 is
  • each K independently represents an /.-lysine optionally covalently bound to a lipophilic substituent, optionally via a spacer;
  • each k independently represents a //-lysine optionally covalently bound to a lipophilic substituent, optionally via a spacer;
  • FIG 1 is a table illustrating comparative sequence alignments for certain reference polypeptides: human amylin, SEQ ID NO: 300; rat amylin, SEQ ID NO: 301; pramlintide, SEQ ID NO: 302; davalintide, SEQ ID NO: 303; hCT (human calcitonin), SEQ ID NO: 304; sCT (salmon calcitonin), SEQ ID NO: 305; and beta-calcitonin-gene-related peptide (b- CGRP), SEQ ID NO: 306.
  • FIGS 2A, 2B, 2C and 2D depict dose-response curves for an acylated amylin analog A73 at hAMY3R (FIG 2A), the acylated amylin analog A73 at hCTR (FIG 2B), pramlintide at hAMY3R (FIG 2C), and human calcitonin (hCalcitonin) at hCTR (FIG 2D).
  • acylated as used herein, in relation to disclosed polypeptides, means the disclosed polypeptide is substituted with one or more lipophilic substituents each optionally via a spacer, wherein“lipophilic substituent” and“spacer” are defined herein.
  • FIGS 3A and 3B depict data from pharmacokinetic studies to assess polypeptide clearance from the kidney (CL) following intravenous infusion of linear, i.e. non-acylated, polypeptides (FIG 3 A) and conjugated, i.e. acylated, polypeptides (FIG 3B).
  • linear, i.e. non-acylated, polypeptides FIGS 3A and 3B depict data from pharmacokinetic studies to assess polypeptide clearance from the kidney (CL) following intravenous infusion of linear, i.e. non-acylated, polypeptides (FIG 3 A) and conjugated, i.e. acylated, polypeptides (FIG 3B).
  • This invention relates to isolated polypeptides that are amylin analogs as well as pharmaceutical compositions comprising these polypeptides. This invention also relates to methods of producing and using such amylin analog polypeptides. These amylin analog polypeptides are particularly useful in methods of treating metabolic diseases or disorders, such as types 1 and 2 diabetes, obesity, and methods of providing weight loss.
  • the term“about” is understood as within a range of normal tolerance in the art, for example within 2 standard deviations of the mean. About can be understood as within 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1%, 0.05%, or 0.01% of the stated value. Unless otherwise clear from the context, all numerical values provided herein are modified by the term“about.”
  • the term “substantially” is understood as within a narrow range of variation or otherwise normal tolerance in the art. Substantially can be understood as within 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1%, 0.05%, 0.01% or 0.001% of the stated value.
  • the drug is a polypeptide.
  • the drug is a small molecule, for example, hormones such as androgens or estrogens.
  • the devices and methods of the present invention are well suited for the delivery of proteins, small molecules and combinations thereof.
  • peptide “peptide,”“polypeptide,” and“protein” are used interchangeably herein and typically refer to a molecule comprising a chain of two or more amino acids (e.g., most typically L-amino acids, but also including, e.g., D-amino acids, modified amino acids, amino acid analogs, and amino acid mimetics).
  • amino acids e.g., most typically L-amino acids, but also including, e.g., D-amino acids, modified amino acids, amino acid analogs, and amino acid mimetics.
  • naturally-occurring L-amino acids are represented by either conventional three-letter, or capitalized one-letter, amino acid designations of Table 1.
  • naturally-occurring L-amino acids and D-amino acids are both represented by either conventional three-letter, or capitalized one-letter, amino acid designations of Table 1.
  • D-amino acids are represented by lower-case one-letter amino acid designations corresponding to one-letter designations of
  • Table 1 i.e., g, a, 1, m, f, w, k, q, e, s, p, v, i, c, y, h, r, n, d, and t.
  • Peptides may be naturally occurring, synthetically produced, or recombinantly expressed. Peptides may also comprise additional groups modifying the amino acid chain, for example, functional groups added via post-translational modification. Examples of post translation modifications include, but are not limited to, acetylation, alkylation (including, methylation), biotinylation, glutamylation, glycylation, glycosylation, isoprenylation, lipoylation, phosphopantetheinylation, phosphorylation, selenation, and C-terminal amidation.
  • the term peptide also includes peptides comprising modifications of the amino terminus and/or the carboxy terminus.
  • Modifications of the terminal amino group include, but are not limited to, des-amino, N-lower alkyl, N-di-lower alkyl, and N-acyl modifications.
  • Modifications of the terminal carboxy group include, but are not limited to, amide, lower alkyl amide, dialkyl amide, and lower alkyl ester modifications (e.g., wherein lower alkyl is C1-C4 alkyl).
  • the term peptide also includes modifications, such as but not limited to those described above, of amino acids falling between the amino and carboxy termini. In one embodiment, a peptide may be modified by addition of a small-molecule drug.
  • the terminal amino acid at one end of the peptide chain typically has a free amino group (i.e., the amino terminus).
  • the terminal amino acid at the other end of the chain typically has a free carboxyl group (i.e., the carboxy terminus).
  • the amino acids making up a peptide are numbered in order, starting at the amino terminus and increasing in the direction of the carboxy terminus of the peptide.
  • amino acid residue refers to an amino acid that is incorporated into a peptide by an amide bond or an amide bond mimetic.
  • insulinotropic typically refers to the ability of a compound, e.g., a peptide, to stimulate or affect the production and/or activity of insulin (e.g., an insulinotropic hormone). Such compounds typically stimulate or otherwise affect the secretion or biosynthesis of insulin in a subject.
  • an“insulinotropic peptide” is an amino acid-containing molecule capable of stimulating or otherwise affecting secretion or biosynthesis of insulin.
  • insulinotropic peptide includes, but is not limited to, glucagon-like peptide 1 (GLP-l), as well as derivatives and analogues thereof, GLP-l receptor agonists, such as exenatide, exenatide having the amino acid sequence of SEQ ID NO; 307, as well as derivatives and analogues thereof.
  • GLP-l glucagon-like peptide 1
  • GLP-l receptor agonists such as exenatide, exenatide having the amino acid sequence of SEQ ID NO; 307, as well as derivatives and analogues thereof.
  • acylated in relation to disclosed polypeptides, means the disclosed polypeptide is substituted with one or more lipophilic substituents each optionally via a spacer, wherein“lipophilic substituent” and“spacer” are defined herein.
  • Certain lipophilic substituents, each optionally via a spacer can bind albumin and confer affinity to albumin to the resulting acylated polypeptide.
  • the extent is variable, and depending on numerous factors, to which lipophilic substituents, each optionally via a spacer, bind albumin and confer affinity to albumin to the resulting acylated polypeptide. Numerous factors include identities of the lipophilic substituent, optional spacer, polypeptide, and the site of covalent attachment to the polypeptide.
  • linear or“liner polypeptide” as used herein refer to a“non-acylated” polypeptide, in other words, a disclosed amylin analog polypeptide without a lipophilic substituents each optionally via a spacer, wherein“lipophilic substituent” and“spacer” are defined herein.
  • conjugated or conjugated polypeptide refer to an “acylated” polypeptide, in other words, a disclosed amylin analog polypeptide having one or more lipophilic substituents each optionally via a spacer, wherein“lipophilic substituent” and “spacer” are defined herein.
  • the term“pharmaceutically acceptable salt” refers to those salts which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of humans and lower animals without undue toxicity, irritation, allergic response and the like, and are commensurate with a reasonable benefit/risk ratio.
  • Pharmaceutically acceptable salts are well known in the art. For example, S. M. Berge et al, describe pharmaceutically acceptable salts in detail in J. Pharmaceutical Sciences, 1977, 66, 1-19, incorporated herein by reference.
  • Pharmaceutically acceptable salts of the compounds of this invention include those derived from suitable inorganic and organic acids and bases. Examples of
  • nontoxic acid addition salts are salts of an amino group formed with inorganic acids such as hydrochloric acid, hydrobromic acid, phosphoric acid, sulfuric acid and perchloric acid or with organic acids such as acetic acid, trifluoroacetic acid (TFA), oxalic acid, maleic acid, tartaric acid, citric acid, succinic acid or malonic acid or by using other methods used in the art such as ion exchange.
  • inorganic acids such as hydrochloric acid, hydrobromic acid, phosphoric acid, sulfuric acid and perchloric acid
  • organic acids such as acetic acid, trifluoroacetic acid (TFA), oxalic acid, maleic acid, tartaric acid, citric acid, succinic acid or malonic acid or by using other methods used in the art such as ion exchange.
  • salts include adipate, alginate, ascorbate, aspartate, benzenesulfonate, benzoate, bisulfate, borate, butyrate, camphorate, camphorsulfonate, citrate, cyclopentanepropionate, digluconate, dodecylsulfate, ethanesulfonate, formate, fumarate, glucoheptonate, glycerophosphate, gluconate, hemisulfate, heptanoate, hexanoate, hydroiodide, 2-hydroxy-ethanesulfonate, lactobionate, lactate, laurate, lauryl sulfate, malate, maleate, malonate, methanesulfonate, 2- naphthalenesulfonate, nicotinate, nitrate, oleate, oxalate, palmitate, pamoate, pectinate
  • Salts derived from appropriate bases include alkali metal, alkaline earth metal, ammonium and N+(Cl-4alkyl)4 salts.
  • Representative alkali or alkaline earth metal salts include sodium, lithium, potassium, calcium, magnesium, and the like.
  • pharmaceutically acceptable salts include, when appropriate, nontoxic ammonium, quaternary ammonium, and amine cations formed using counterions such as halide, hydroxide, carboxylate, sulfate, phosphate, nitrate, loweralkyl sulfonate and aryl sulfonate.
  • exenatide, exenatide having the amino acid sequence of exendin-4 the naturally-occurring form of exenatide, exenatide-LAR, lixisenatide, GLP-l (7- 36), liraglutide, semaglutide, dulaglutide, albiglutide, and taspoglutide.
  • Incretin mimetics are also referred to herein as“insulinotropic peptides.” Incretin mimetics which target the GLP-l receptor are also known in the literature as“GLP-l receptor agonists” or“GLP-l agonists,” with both terms being used interchangeably herein.
  • an exenatide as used herein includes, but is not limited to exenatide, exenatide having the amino acid sequence of
  • HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 SEQ ID NO: 307
  • native exendin-4 native exendin-4
  • exenatide peptides exenatide peptide analogs
  • exenatide peptide derivatives native exendin-4
  • GLP-l refers to a polypeptide that is produced by the L-cell located mainly in the ileum and colon, and to a lesser extent by L-cells in the duodenum and jejunum.
  • GLP-l is a regulatory peptide that binds to the extracellular region of the GLP-l receptor (GLP-1R), a G-coupled protein receptor on b cell and via adenyl cyclase activity and production of cAMP stimulates the insulin response to the nutrients that are absorbed from the gut [Baggio 2007,“Biology of incretins: GLP-l and GIP,” Gastroenterology, vol.
  • GLP-1R agonism The effects of GLP-1R agonism are multiple. GLP-l maintains glucose homeostasis by enhancing endogenous glucose dependent insulin secretion, rendering the b cells glucose competent and sensitive to GLP-l, suppressing glucagon release, restoring first and second phase insulin secretion, slowing gastric emptying, decreasing food intake, and increasing satiety [Holst 2008 Mol.
  • amylin analog polypeptides disclosed herein are provided in methods for treatment of type 1 diabetes, as an adjunct to treatment with insulin.
  • insulin refers to human insulin or any insulin analogs. Exemplary non-limiting insulin analogs include those listed in Table 2:
  • mean-time insulin refers to a fast-acting insulin formulation that reaches peak blood concentration in approximately 45-90 minutes and peak activity approximately 1 to 3 hours after administration and is administered at or around mealtime.
  • Vehicle refers to a medium used to carry a compound, e.g., a drug or a particle containing a drug.
  • Vehicles of the present invention typically comprise components such as polymers and solvents.
  • the suspension vehicles of the present invention typically comprise solvents and polymers that are used to prepare suspension formulations further comprising drug particle formulations.
  • phase separation refers to the formation of multiple phases (e.g., liquid and gel phases) in the suspension vehicle, such as when the suspension vehicle contacts the aqueous environment.
  • the suspension vehicle is formulated to exhibit phase separation upon contact with an aqueous environment having less than approximately 10% water.
  • single-phase refers to a solid, semisolid, or liquid homogeneous system that is physically and chemically uniform throughout.
  • dissolving refers to dissolving, dispersing, suspending, or otherwise distributing a compound, for example, a drug particle formulation, in a suspension vehicle.
  • chemically stable refers to formation in a formulation of an acceptable percentage of degradation products produced over a defined period of time by chemical pathways, such as deamidation (usually by hydrolysis), aggregation, or oxidation.
  • a physically stable formulation refers to formation in a formulation of an acceptable percentage of aggregates (e.g., dimers and other higher molecular weight products). Further, a physically stable formulation does not change its physical state as, for example, from liquid to solid, or from amorphous to crystal form.
  • viscosity typically refers to a value determined from the ratio of shear stress to shear rate (see, e.g., Considine, D. M. & Considine, G. D.,
  • V/L the velocity per layer thickness (shear rate). From this relationship, the ratio of shear stress to shear rate defines viscosity.
  • Measurements of shear stress and shear rate are typically determined using parallel plate rheometry performed under selected conditions (for example, a temperature of about 37° C.).
  • Other methods for the determination of viscosity include, measurement of a kinematic viscosity using viscometers, for example, a Cannon-Fenske viscometer, an Ubbelohde viscometer for the Cannon-Fenske opaque solution, or a Ostwald viscometer.
  • suspension vehicles of the present invention have a viscosity sufficient to prevent a particle formulation suspended therein from settling during storage and use in a method of delivery, for example, in an implantable, drug delivery device.
  • non-aqueous refers to an overall moisture content, for example, of a suspension formulation, typically of less than or equal to about 10 wt %, for example, less than or equal to about 7 wt %, less than or equal to about 5 wt %, and/or less than about 4 wt %. Also, a particle formulation of the present invention comprises less than about 10 wt %, for example, less than about 5 wt %, residual moisture.
  • subject refers to any member of the subphylum Chordata, including, without limitation, humans and other primates, including non-human primates such as rhesus macaques and other monkey species and chimpanzees and other ape species; farm animals such as cattle, sheep, pigs, goats and horses; domestic mammals such as dogs and cats; laboratory animals including rodents such as mice, rats and guinea pigs; birds, including domestic, wild and game birds such as chickens, turkeys and other gallinaceous birds, ducks, geese, and the like.
  • the term does not denote a particular age or gender. Thus, both adult and newborn individuals are intended to be covered.
  • treatment refers to reversing, alleviating, delaying the onset of, or inhibiting the progress of a disease or disorder, or one or more symptoms thereof, as described herein.
  • treatment may be administered after one or more symptoms have developed.
  • treatment may be administered in the absence of symptoms.
  • treatment may be administered to a susceptible individual prior to the onset of symptoms (e.g., in light of a history of symptoms and/or in light of genetic or other susceptibility factors). Treatment may also be continued after symptoms have resolved, for example to prevent or delay their recurrence.
  • osmotic delivery device typically refers to a device used for delivery of a drug (e.g., a disclosed amylin analog polypeptide) to a subject, wherein the device comprises, for example, a reservoir (made, e.g., from a titanium alloy) having a lumen that contains a suspension formulation comprising a drug (e.g., a disclosed amylin analog polypeptide) and an osmotic agent formulation.
  • a piston assembly positioned in the lumen isolates the suspension formulation from the osmotic agent formulation.
  • a semi-permeable membrane is positioned at a first distal end of the reservoir adjacent the osmotic agent formulation and a diffusion moderator (which defines a delivery orifice through which the suspension formulation exits the device) is positioned at a second distal end of the reservoir adjacent the suspension formulation.
  • the osmotic delivery device is implanted within the subject, for example, subdermally or subcutaneously (e.g., in the inside, outside, or back of the upper arm and in the abdominal area).
  • An exemplary osmotic delivery device is the DUROS® (ALZA Corporation, Mountain View, Calif.) delivery device.
  • “osmotic delivery device” examples include but are not limited to“osmotic drug delivery device”,“osmotic drug delivery system”,“osmotic device”,“osmotic delivery device”,“osmotic delivery system”,“osmotic pump”,“implantable drug delivery device”, “drug delivery system”,“drug delivery device”,“implantable osmotic pump”,“implantable drug delivery system”, and“implantable delivery system”.
  • Other terms for“osmotic delivery device” are known in the art.
  • continuous delivery typically refers to a substantially continuous release of drug from an osmotic delivery device and into tissues near the implantation site, e.g., subdermal and subcutaneous tissues.
  • an osmotic delivery device releases drug essentially at a predetermined rate based on the principle of osmosis.
  • Extracellular fluid enters the osmotic delivery device through the semi-permeable membrane directly into the osmotic engine that expands to drive the piston at a slow and consistent rate of travel. Movement of the piston forces the drug formulation to be released through the orifice of the diffusion moderator.
  • release of the drug from the osmotic delivery device is at a slow, controlled, consistent rate.
  • substantially steady-state delivery typically refers to delivery of a drug at or near a target concentration over a defined period of time, wherein the amount of the drug being delivered from an osmotic delivery device is substantially zero-order delivery.
  • Substantial zero-order delivery of an active agent e.g., a disclosed amylin analog polypeptide
  • the rate of drug delivered is constant and is independent of the drug available in the delivery system; for example, for zero-order delivery, if the rate of drug delivered is graphed against time and a line is fitted to the data the line has a slope of approximately zero, as determined by standard methods (e.g., linear regression).
  • drug half-life refers how long it takes a drug to be eliminated from blood plasma by one half of its concentration.
  • a drug is usually measured by monitoring how a drug degrades when it is administered via injection or intravenously.
  • a drug is usually detected using, for example, a radioimmunoassay (RIA), a chromatographic method, an electrochemiluminescent (ECL) assay, an enzyme linked immunosorbent assay (ELISA) or an immunoenzymatic sandwich assay (IEMA).
  • RIA radioimmunoassay
  • ECL electrochemiluminescent
  • ELISA enzyme linked immunosorbent assay
  • IEMA immunoenzymatic sandwich assay
  • the terms“pl” and“uL” are understood to mean“microliter”, and the terms“mM” and“uM” are understood to mean“micromolar”.
  • serum is meant to mean any blood product from which a substance can be detected.
  • serum includes at least whole blood, serum, and plasma.
  • an amount of [a substance] in a subject’s serum would cover“an amount of [the substance] in a subject’s plasma”.
  • Baseline is defined as the last assessment on or before the day of the initial placement of an osmotic delivery device (containing drug or placebo).
  • Amylin is believed to play a role in glycemic regulation by slowing gastric emptying and promoting satiety, thereby preventing post-prandial spikes in blood glucose levels. The overall effect is to slow the rate of appearance of glucose in the blood after eating.
  • Amylin s amino acid sequence is most closely related to that of calcitonin gene- related peptide (CGRP). CGRP also shares a similarly positioned disulfide bond and an amidated C-terminus. This is also the case for calcitonin, adrenomedullin, and
  • FIG 1 illustrates comparative sequence alignments for amylin and certain related reference polypeptides.
  • CT calcitonin
  • CGRP calcitonin gene-related peptide
  • ADM1 ADM2 amylin
  • ADM1 ADM2 adrenomedullin 2/intermedin
  • CTR calcitonin receptor
  • CALCRL calcitonin receptor protein
  • RAMP1, RAMP2, RAMP3 receptor activity-modifying proteins
  • CTR dimerizes with RAMPs 1, 2, or 3 to reconstitute the AMY1, AMY2, or AMY3 receptors with pharmacology selective for amylin over calcitonin. In the absence of a RAMP, CTR pharmacology becomes calcitonin selective versus amylin.
  • CALCRL dimerized with RAMP1 generates CGRPR with high affinity for CGRP and reduced affinities for all other peptide family members including amylin.
  • CALCRL and RAMP2, or RAMP3, reconstitute the pharmacology of AM1, and AM2 respectively with very low to no affinity for amylin.
  • Amylin analog polypeptides having binding affinity to amylin receptor complexes, have been developed.
  • Pramlintide for example, was developed by Amylin Pharmaceuticals, and approved by the U.S. Food and Drug Administration (FDA), as a synthetic analogue of human amylin for the treatment of types 1 and 2 diabetics, who use meal-time insulin but cannot achieve desired glycemic control despite optimal insulin therapy.
  • Pramlintide is an amylinomimetic agent that is at least as potent as human amylin.
  • pramlintide is soluble, non-adhesive, and nonaggregating, thereby overcoming a number of the physicochemical liabilities of native human amylin.
  • the half-life of pramlintide is approximately 48 minutes in humans, longer than that of native human amylin (about 13 minutes). Pramlintide requires frequent and inconvenient administration.
  • pramlintide is administered up to four times per day, via subcutaneous injection in the thigh or abdomen before meals, as an adjunct to insulin therapy administered after meals.
  • Pramlintide cannot be mixed with insulin; separate syringes are used.
  • Pramlintide is administered with or prior to each meal or snack that consists of at least 250 calories or 30 g of carbohydrate.
  • the typical starting dose for type 1 diabetics is 15 pg subcutaneous pramlintide before each meal, with subsequent titration to a target dose of 60 pg before each meal.
  • Reported side effects of pramlintide include nausea and vomiting.
  • Adverse reactions, particularly for type 1 diabetics can include severe hypoglycemia. Consequently, dosage of meal-time insulin is reduced for diabetic patients who initiate administration of pramlintide.
  • pramlintide is administered via subcutaneous injection at a recommended starting dose of 60 pg, with a target maintenance dose of 120 pg before each meal.
  • Davabntide (AC2307) is another analog of human amylin. Davalintide is an investigational compound with a half-life of about 26 minutes. Like pramlintide, davalintide would likewise require frequent administration via injection.
  • Certain disclosed amylin analog polypeptides exhibit one or more of: excellent solubility, stability, biological activity and specificity, and longer half-lives than those for endogenous human amylin and known synthetic amylin analog polypeptides. Certain disclosed amylin analog polypeptides were developed to accommodate less frequent administration than is required for pramlintide. Certain disclosed amylin analog polypeptides were developed for administration via weekly or monthly injections.
  • amylin analog polypeptides were developed for administration via implantation of a delivery device comprising the amylin analog polypeptide, where the delivery device comprises a dose of the amylin analog polypeptide of up to 3 months, 6 months, 9 months, one year, 18 months or two years.
  • the present invention relates to isolated polypeptides that are amylin analogs.
  • an isolated polypeptide of the disclosure comprises an amino acid sequence, or a pharmaceutically acceptable salt thereof, selected from the group consisting of amino acid sequences represented by the consensus sequence of SEQ ID NO: 199:
  • Xi is S, K, k, H or I
  • X3 is N or S
  • X5 is S or A
  • Cb is T or S
  • X8 is A or K
  • Xi3 is A, S, E or K
  • Xi4 is N, n, d, Y or Q;
  • Xi5 is E, F, f, Y, I, k, K or a-aminoisobutyric acid (Aib);
  • Xi6 is k, K, L, Aib, A-methyl leucine (TV-MeL). or 1;
  • Xn is H, V, Q, R, k, K or Aib;
  • Xi8 is K, H, or R;
  • Xi9 is S or Aib
  • X20 is S or Aib
  • X22 is N or E
  • X29 is P, R or K
  • X 3i is k, K, N, or H
  • X35 is e, E, N, K, G, A, Y, or P;
  • X37 is Y or P
  • each K independently represents an /.-lysine optionally covalently bound to a lipophilic substituent, optionally via a spacer;
  • each k independently represents a //-lysine optionally covalently bound to a lipophilic substituent, optionally via a spacer;
  • X31 is K. In some embodiments, X31 is N.
  • X35 is E. In some embodiments, X35 is N.
  • certain amino acids represented by the consensus sequence of SEQ ID NO: 199 include the following:
  • carboxy terminal X37 is Y-(NH2). In some embodiments, carboxy terminal X37 is Y-(OH). In some embodiments, carboxy terminal X37 is P-(NH2). In some embodiments, carboxy terminal X37 is P-(OH).
  • Xi is S. In some embodiments, Xi is K. In some
  • Xi is k. In some embodiments, Xi is H. In some embodiments, Xi is I.
  • k refers to //-lysine.
  • X3 is N. In some embodiments, X3 is S.
  • X5 is S. In some embodiments, X5 is A. In some embodiments, Xe is T. In some embodiments, Xe is S.
  • Xx is A. In some embodiments, Xx is K.
  • Xio is Q. In some embodiments, Xio is S.
  • X12 is L. In some embodiments, X12 is K.
  • X13 is A. In some embodiments, X13 is S. In some embodiments, X13 is E. In some embodiments, X13 is K.
  • X14 is N. In some embodiments, X14 is n. In some embodiments, X14 is d. In some embodiments, Xu is Y. In some embodiments, Xu is Q.
  • n refers to //-asparagine.
  • d refers to //-aspartic acid.
  • X15 is E. In some embodiments, X15 is F. In some embodiments, X15 is f. In some embodiments, X15 is Y. In some embodiments, X15 is I. In some embodiments, X15 is K. In some embodiments, X15 is k. In some embodiments, X15 is Aib.
  • f refers to //-phenylalanine.
  • Aib refers alternatively to 2-aminoisobutyric acid, a-aminoisobutyric acid, a-methylalanine or 2-methylalanine.
  • Cib is L. In some embodiments, Cib is 1. In some embodiments, Cib is K. In some embodiments, Cib is k. In some embodiments, Cib is Aib. In some embodiments, Cib is X-MeL.
  • 1 refers to //-leucine
  • /V-MeL refers to /V-methyl leucine
  • X17 is H. In some embodiments, X17 is V. In some embodiments, Xn is Q. In some embodiments, Xn is R. In some embodiments, Xn is K. In some embodiments, X17 is k. In some embodiments, X17 is Aib.
  • Xi8 is K. In some embodiments, Xi8 is H. In some embodiments, Xis is R.
  • X19 is S. In some embodiments, X19 is Aib.
  • X20 is S. In some embodiments, X20 is Aib.
  • X22 is N. In some embodiments, X22 is E.
  • X29 is P. In some embodiments, X29 is R. In some embodiments, X29 is K. In some embodiments, X31 is k. In some embodiments, X31 is K. In some
  • X31 is N. In some embodiments, X31 is H.
  • X35 is e. In some embodiments, X35 is E. In some
  • X35 is N. In some embodiments, X35 is K. In some embodiments, X35 is G. In some embodiments, X35 is A. In some embodiments, X35 is Y. In some embodiments, X35 is
  • e refers to //-glutamic acid.
  • certain amino acids represented by the consensus sequence of SEQ ID NO: 199 include the following:
  • Xi is S and X5 is S. In some embodiments, Xi is S and X10 is
  • Xi is S and X15 is E. In some embodiments, Xi is S and Cib is L.
  • Xi is S and Cib is k. In some embodiments, Xi is S and X17 is H. In some embodiments, Xi is S and Xie is K. In some embodiments, Xi is S and X31 is K. In some embodiments, Xi is S and X35 is E. In some embodiments, Xi is S and X37 is Y.
  • Xi is K and X5 is S. In some embodiments, Xi is K and X10 is Q. In some embodiments, Xi is K and X15 is E. In some embodiments, Xi is K and Xi6 is L. In some embodiments, Xi is K and Cib is k. In some embodiments, Xi is K and X17 is H. In some embodiments, Xi is K and Xie is K. In some embodiments, Xi is K and X31 is K. In some embodiments, Xi is K and X35 is E. In some embodiments, Xi is K and X37 is Y.
  • Xi is k and X5 is S. In some embodiments, Xi is k and X10 is Q. In some embodiments, Xi is k and X15 is E. In some embodiments, Xi is k and Cib is L. In some embodiments, Xi is k and Cib is k. In some embodiments, Xi is k and X17 is H. In some embodiments, Xi is k and Xie is K. In some embodiments, Xi is k and X31 is K. In some embodiments, Xi is k and X35 is E. In some embodiments, Xi is k and X37 is Y.
  • X5 is S and X15 is E. In some embodiments, X5 is S and X10 is Q. In some embodiments, X5 is S and Cib is L. In some embodiments, X5 is S and Cib is k. In some embodiments, X5 is S and X17 is H. In some embodiments, X5 is S and Xie is K. In some embodiments, X5 is S and X31 is K. In some embodiments, X5 is S and X35 is E. In some embodiments, X5 is S and X37 is Y.
  • X10 is Q and X15 is E. In some embodiments, X10 is Q and Cib is L. In some embodiments, X10 is Q and Xi6 is k. In some embodiments, X10 is Q and Xn is H. In some embodiments, X10 is Q and Xie is K. In some embodiments, X10 is Q and X31 is K. In some embodiments, Xio is Q and X35 is E. In some embodiments, X10 is Q and X37 is Y.
  • X15 is E and Cib is L. In some embodiments, X15 is E and Cib is k. In some embodiments, X15 is E and X17 is H. In some embodiments, X15 is E and Xi8 is K. In some embodiments, X15 is E and X31 is K. In some embodiments, X15 is E and X35 is E. In some embodiments, X15 is E and X37 is Y.
  • Cib is L and X17 is H. In some embodiments, Cib is L and Xi8 is K. In some embodiments, Cib is L and X31 is K. In some embodiments, Cib is L and X35 is E. In some embodiments, Xi6 is L and X37 is Y.
  • Cib is k and X17 is H. In some embodiments, Cib is k and Xis is K. In some embodiments, Cib is k and X31 is K. In some embodiments, Cib is k and X35 is E. In some embodiments, Cib is k and X37 is Y.
  • X17 is H and Xis is K. In some embodiments, X17 is H and X31 is K. In some embodiments, X17 is H and X35 is E. In some embodiments, X17 is H and X37 is Y.
  • Xis is K and X31 is K. In some embodiments, Xis is K and X35 is E. In some embodiments, Xis is K and X37 is Y.
  • X31 is K and X35 is E. In some embodiments, X31 is K and X37 is Y.
  • X35 is E and X37 is Y.
  • certain amino acids represented by the consensus sequence of SEQ ID NO: 199 include the following:
  • Xi is S, X5 is S, and X15 is E. In some embodiments, Xi is S, X5 is S, and Xi6 is L. In some embodiments, Xi is S, X5 is S, and Xi6 is k. In some embodiments, Xi is S, X5 is S, and X17 is H. In some embodiments, Xi is S, X5 is S, and Xis is K. In some embodiments, Xi is S, X5 is S, and X31 is K. In some embodiments, Xi is S and X35 is E. In some embodiments, Xi is S, X5 is S, and X37 is Y.
  • Xi is K, X5 is S, and X15 is E. In some embodiments, Xi is K, X5 is S, and X1 ⁇ 2 is L. In some embodiments, Xi is K, X5 is S, and Cib is k. In some embodiments, Xi is K, X5 is S, and X17 is H. In some embodiments, Xi is K, X5 is S, and Xis is K. In some embodiments, Xi is K, X5 is S, and X31 is K. In some embodiments, Xi is K, X5 is S, and X35 is E.
  • Xi is K, X5 is S, and X37 is Y.
  • Xi is k, Xs is S, and Xis is E.
  • Xi is k, X5 is S, and X1 ⁇ 2 is L.
  • Xi is k, Xs is S, and Xi6 is k.
  • Xi is k, Xs is S, and Xn is H.
  • Xi is k, Xs is S, and Xi8 is K.
  • Xi is k, Xs is S, and X31 is K.
  • Xi is k, Xs is S, and X35 is E.
  • Xi is k, Xs is S, and X37 is Y.
  • Xs is S, Xis is E, and Cib is L. In some embodiments, Xs is S, X15 is E, and Cib is k. In some embodiments, Xs is S, Xis is E, and X17 is H. In some embodiments, Xs is S, Xis is E, and Xi8 is K. In some embodiments, Xs is S, Xis is E, and X31 is K. In some embodiments, Xs is S, Xis is E, and X35 is E. In some embodiments, Xs is S, X15 is E, and X37 is Y.
  • X10 is Q, Xis is E and Cib is L. In some embodiments, X10 is Q, and Cib is k and X17 is H. In some embodiments, X10 is Q, Xis is K, and X31 is K. In some embodiments, X10 is Q, X31 is K and X35 is E. In some embodiments, X10 is Q, X31 is K and X37 is Y.
  • Xis is E, Cib is L, and X17 is H. In some embodiments, Xis is E, Xi6 is L, and Xis is K. In some embodiments, Xis is E, Cib is L, and X31 is K. In some embodiments, Xis is E, Cib is L, and X35 is E. In some embodiments, Xis is E, Cib is L, and X37 is Y.
  • Xis is E, Cib is k, and X17 is H. In some embodiments, Xis is E, Xi6 is k, and Xis is K. In some embodiments, Xis is E, Cib is k, and X31 is K. In some embodiments, Xis is E, Cib is k, and X35 is E. In some embodiments, Xis is E, Cib is k, and X37 is Y.
  • Cib is L, X17 is H, and Xis is K. In some embodiments, Cib is L, X17 is H, and X31 is K. In some embodiments, Xi6 is L, Xn is H, and X35 is E. In some embodiments, Cib is L, Xn is H, and X37 is Y.
  • Cib is k, Xn is H, and Xis is K. In some embodiments, Cib is k, Xn is H, and X31 is K. In some embodiments, Cib is k, Xn is H, and X35 is E. In some embodiments, Cib is k, Xn is H, and X37 is Y.
  • Xn is H, Xis is K, and X31 is K. In some embodiments, Xn is H, Xis is K, and X35 is E. In some embodiments, Xn is H, Xis is K, and X37 is Y.
  • Xis is K, X31 is K, and X35 is E. In some embodiments, Xis is K, X31 is K, and X37 is Y.
  • X31 is K
  • X35 is E
  • X37 is Y.
  • carboxy terminal amino acid 37 is Y-(NH 2 ).
  • carboxy terminal amino acid 37 is Y-(OH).
  • carboxy terminal amino acid 37 is P-(NH 2 ).
  • carboxy terminal amino acid 37 is P-(OH).
  • an isolated polypeptide of the disclosure comprises an amino acid sequence, or a pharmaceutically acceptable salt thereof, selected from the group consisting of amino acid sequences represented by the consensus sequence of SEQ ID NO: 200:
  • Xi is S, K, k, H or I
  • X3 is N or S
  • X5 is S or A
  • Xe is T or S
  • X8 is A or K
  • X10 is Q or S
  • Xi 2 is L or K
  • X13 is A, S, E or K
  • X14 is N, n, d, Y or Q;
  • X15 is E, F, f, Y, I, k, K or a-aminoisobutyric acid (Aib);
  • Xi6 is k, K, L, Aib, X-methyl leucine GV-MeL). or 1;
  • Xn is H, V, Q, R, k, K or Aib;
  • Xi8 is K, H, or R;
  • X19 is S or Aib
  • X 2 o is S or Aib
  • X 22 is N or E
  • X 29 is P, R or K
  • X35 is e, E or N
  • each K independently represents an /.-lysine optionally covalently bound to a lipophilic substituent, optionally via a spacer;
  • each k independently represents a -lysine optionally covalently bound to a lipophilic substituent, optionally via a spacer; wherein the two cysteine residues of X1CX3TX5X6C are optionally further bound by a disulfide bridge;
  • X31 is K. In some embodiments, X31 is N.
  • X35 is E. In some embodiments, X35 is N.
  • an isolated polypeptide of the disclosure comprises an amino acid sequence, or a pharmaceutically acceptable salt thereof, selected from the group consisting of amino acid sequences represented by the consensus sequence of SEQ ID NO: 201:
  • Xi is S, K, k, H or I
  • X3 is N or S
  • X5 is S or A
  • Xe is T or S
  • X8 is A or K
  • X10 is Q or S
  • X12 is L or K
  • X13 is A, S, E or K
  • X14 is N, n, d, Y or Q;
  • Xi6 is k, K, L, Aib, A-MeL or 1;
  • Xn is H, V, Q, R, k, K or Aib;
  • Xi8 is K, H, or R;
  • X19 is S or Aib
  • X20 is S or Aib
  • X22 is N or E
  • X29 is P, R or K
  • each K independently represents an /.-lysine optionally covalently bound to a lipophilic substituent, optionally via a spacer;
  • each k independently represents a //-lysine optionally covalently bound to a lipophilic substituent, optionally via a spacer; wherein the two cysteine residues of X1CX3TX5X6C are optionally further bound by a disulfide bridge.
  • certain amino acids represented by the consensus sequence of SEQ ID NO: 200 or SEQ ID NO: 201 include the following:
  • carboxy terminal amino acid 37 is Y-(NEt 2 ). In some embodiments, carboxy terminal amino acid 37 is Y-(OH).
  • Xi is S. In some embodiments, Xi is K. In some
  • Xi is k. In some embodiments, Xi is H. In some embodiments, Xi is I.
  • k refers to //-lysine.
  • X3 is N. In some embodiments, X3 is S.
  • X5 is S. In some embodiments, X5 is A.
  • Cb is T. In some embodiments, Cb is S.
  • Xx is A. In some embodiments, Xx is K.
  • X10 is Q. In some embodiments, X10 is S.
  • X12 is L. In some embodiments, X12 is K.
  • X13 is A. In some embodiments, X13 is S. In some embodiments, X13 is E. In some embodiments, X13 is K.
  • X14 is N. In some embodiments, X14 is n. In some embodiments, X14 is d. In some embodiments, Xu is Y. In some embodiments, Xu is Q.
  • n refers to //-asparagine.
  • d refers to //-aspartic acid.
  • X15 is E. In some embodiments, X15 is F. In some embodiments, X15 is f. In some embodiments, X15 is Y. In some embodiments, X15 is I. In some embodiments, X15 is K. In some embodiments, X15 is k. In some embodiments, X15 is Aib.
  • f refers to //-phenylalanine.
  • Aib refers alternatively to 2-aminoisobutyric acid, a-aminoisobutyric acid, a-methylalanine or 2-methylalanine.
  • Cib is L. In some embodiments, Cib is 1. In some embodiments, Cib is K. In some embodiments, Cib is k. In some embodiments, Cib is Aib. In some embodiments, Xi6 is X-MeL.
  • 1 refers to //-leucine
  • X-MeL refers to A- methyl leucine.
  • Xn is H.
  • Xn is V.
  • Xn is Q.
  • Xn is R.
  • Xn is K.
  • Xn is k.
  • Xn is Aib.
  • Xi8 is K. In some embodiments, Xi8 is H. In some embodiments, Xis is R.
  • X19 is S. In some embodiments, X19 is Aib.
  • X20 is S. In some embodiments, X20 is Aib.
  • X22 is N. In some embodiments, X22 is E.
  • X29 is P. In some embodiments, X29 is R. In some embodiments, X29 is K.
  • X31 is k. In some embodiments, X31 is K. In some
  • X31 is N.
  • X35 is e. In some embodiments, X35 is E. In some
  • X35 is N.
  • e refers to //-glutamic acid.
  • certain amino acids represented by the consensus sequence of SEQ ID NO: 200 or SEQ ID NO: 201 include the following:
  • Xi is S and X5 is S. In some embodiments, Xi is S and X10 is Q. In some embodiments, Xi is S and X15 is E. In some embodiments, Xi is S and Cib is L. In some embodiments, Xi is S and Cib is k. In some embodiments, Xi is S and Xn is H. In some embodiments, Xi is S and Xis is K. In some embodiments, Xi is S and X31 is K. In some embodiments, Xi is S and X35 is E.
  • Xi is K and X5 is S. In some embodiments, Xi is K and X10 is Q. In some embodiments, Xi is K and Xn is E. In some embodiments, Xi is K and Xi6 is L. In some embodiments, Xi is K and Cib is k. In some embodiments, Xi is K and Xn is H. In some embodiments, Xi is K and Xis is K. In some embodiments, Xi is K and X31 is K. In some embodiments, Xi is K and X35 is E.
  • Xi is k and Xs is S. In some embodiments, Xi is k and X10 is Q. In some embodiments, Xi is k and Xn is E. In some embodiments, Xi is k and Cib is L. In some embodiments, Xi is k and Cib is k. In some embodiments, Xi is k and Xn is H. In some embodiments, Xi is k and Xis is K. In some embodiments, Xi is k and X31 is K. In some embodiments, Xi is k and X35 is E. In some embodiments, Xs is S and Xis is E. In some embodiments, Xs is S and Xio is Q. In some embodiments, Xs is S and Xi6 is L. In some embodiments, Xs is S and Xi6 is k.
  • Xs is S and Xn is H. In some embodiments, Xs is S and Xi8 is K. In some embodiments, Xs is S and X31 is K. In some embodiments, Xs is S and X35 is E.
  • Xio is Q and Xis is E. In some embodiments, Xio is Q and Cib is L. In some embodiments, Xio is Q and Cib is k. In some embodiments, Xio is Q and X17 is H. In some embodiments, Xio is Q and Xi8 is K. In some embodiments, Xio is Q and X31 is K. In some embodiments, Xio is Q and X35 is E.
  • X15 is E and Cib is L. In some embodiments, X15 is E and Cib is k. In some embodiments, X15 is E and X17 is H. In some embodiments, X15 is E and Xis is K. In some embodiments, X15 is E and X31 is K. In some embodiments, X15 is E and X35 is E.
  • Cib is L and X17 is H. In some embodiments, Cib is L and Xis is K. In some embodiments, Cib is L and X31 is K. In some embodiments, Cib is L and X35 is E.
  • Cib is k and Xn is H. In some embodiments, Cib is k and Xis is K. In some embodiments, Cib is k and X31 is K. In some embodiments, Cib is k and X35 is E.
  • Xn is H and Xis is K. In some embodiments, Xn is H and X31 is K. In some embodiments, Xn is H and X35 is E.
  • Xis is K and X31 is K. In some embodiments, Xis is K and X35 is E.
  • X31 is K and X35 is E.
  • certain amino acids represented by the consensus sequence of SEQ ID NO: 200 or SEQ ID NO: 201 include the following:
  • Xi is S, Xs is S, and Xis is E. In some embodiments, Xi is S, Xs is S, and Cib is L. In some embodiments, Xi is S, Xs is S, and Cib is k. In some embodiments, Xi is S, Xs is S, and Xn is H. In some embodiments, Xi is S, Xs is S, and Xis is K. In some embodiments, Xi is S, Xs is S, and X31 is K. In some embodiments, Xi is S and X35 is E.
  • Xi is K, Xs is S, and Xis is E. In some embodiments, Xi is K, Xs is S, and Cib is L. In some embodiments, Xi is K, Xs is S, and Cib is k. In some embodiments, Xi is K, Xs is S, and Xn is H. In some embodiments, Xi is K, Xs is S, and Xis is K. In some embodiments, Xi is K, Xs is S, and X31 is K. In some embodiments, Xi is K, X5 is S, and X35 is E.
  • Xi is k, X5 is S, and X15 is E. In some embodiments, Xi is k, X5 is S, and X1 ⁇ 2 is L. In some embodiments, Xi is k, X5 is S, and Cib is k. In some embodiments, Xi is k, X5 is S, and X17 is H. In some embodiments, Xi is k, X5 is S, and Xi8 is K. In some embodiments, Xi is k, X5 is S, and X31 is K. In some embodiments, Xi is k, X5 is S, and X35 is E.
  • X5 is S, X15 is E, and Cib is L.
  • X5 is S, X15 is E, and Xi6 is k.
  • X5 is S, X15 is E, and Xn is H.
  • Xs is S, Xis is E, and Xi8 is K.
  • Xs is S, Xis is E, and X31 is K.
  • Xs is S, Xis is E, and X35 is E.
  • X10 is Q, Xis is E and Cib is L. In some embodiments, X10 is Q, and Cib is k and Xn is H. In some embodiments, X10 is Q, Xis is K, and X31 is K. In some embodiments, X10 is Q, X31 is K and X35 is E.
  • Xis is E, Cib is L, and Xn is H. In some embodiments, Xis is E, Xi6 is L, and Xis is K. In some embodiments, Xis is E, Cib is L, and X31 is K. In some embodiments, Xis is E, Cib is L, and X35 is E.
  • Xis is E, Cib is k, and Xn is H. In some embodiments, Xis is E, Xi6 is k, and Xis is K. In some embodiments, Xis is E, Cib is k, and X31 is K. In some embodiments, Xis is E, Cib is k, and X35 is E.
  • Cib is L, Xn is H, and Xis is K. In some embodiments, Cib is L, Xn is H, and X31 is K. In some embodiments, Cib is L, Xn is H, and X35 is E.
  • Cib is k, Xn is H, and Xis is K. In some embodiments, Cib is k, Xn is H, and X31 is K. In some embodiments, Xi6 is k, Xn is H, and X35 is E.
  • Xn is H, Xis is K, and X31 is K. In some embodiments, Xn is H, Xis is K, and X35 is E.
  • Xis is K
  • X31 is K
  • X35 is E
  • an isolated polypeptide of the disclosure comprises an amino acid sequence, or a pharmaceutically acceptable salt thereof, selected from the group consisting of amino acid sequences represented by the consensus sequence of SEQ ID NO: 202 X1CNTX5TCATX10RLANX15X16X17X18SSNNFGPILPPTX31VGSX35TY- (OH/NH2) (SEQ ID NO: 202), wherein:
  • Xi is S, k, or K; X5 is S or A;
  • Xio is Q or S
  • Xi6 is k, K or L
  • Xn H, V, and Q
  • Xi8 is K, H, or R;
  • X35 is E or N
  • each K independently represents an /.-lysine optionally covalently bound to a lipophilic substituent, optionally via a spacer;
  • each k independently represents a //-lysine optionally covalently bound to a lipophilic substituent, optionally via a spacer;
  • X31 is K. In some embodiments, X31 is N.
  • X35 is E. In some embodiments, X35 is N.
  • an isolated polypeptide of the disclosure comprises an amino acid sequence, or a pharmaceutically acceptable salt thereof, selected from the group consisting of amino acid sequences represented by the consensus sequence of SEQ ID NO: 203: XiCNTXsTCATXioRLANXisXieXnXisSSNNFGPILPPTKVGSETY-COH/NfE) (SEQ ID NO: 203), wherein:
  • Xi is S, k, or K
  • X5 is S or A
  • Xio is Q or S
  • Xi6 is k, K or L
  • X17 is H, V, and Q
  • Xi8 is K, H, or R;
  • each K independently represents an /.-lysine optionally covalently bound to a lipophilic substituent, optionally via a spacer;
  • each k independently represents a //-lysine optionally covalently bound to a lipophilic substituent, optionally via a spacer; wherein the two cysteine residues of X1CNTX5TC (SEQ ID NO: 308) are optionally further bound by a disulfide bridge.
  • certain amino acids represented by the consensus sequence of SEQ ID NO: 202 or SEQ ID NO: 203 include the following:
  • carboxy terminal amino acid 37 is Y-(NEt 2 ). In some embodiments, carboxy terminal amino acid 37 is Y-(OH).
  • Xi is S. In some embodiments, Xi is K. In some
  • Xi is k.
  • X5 is S. In some embodiments, X5 is A.
  • X10 is Q. In some embodiments, X10 is S.
  • X15 is E. In some embodiments, X15 is F.
  • Cib is L. In some embodiments, Cib is K. In some embodiments, Cib is k.
  • X17 is H. In some embodiments, X17 is V. In some embodiments, X17 is Q.
  • Xis is K. In some embodiments, Xis is H. In some embodiments, Xis is R.
  • X31 is K. In some embodiments, X31 is N.
  • X35 is E. In some embodiments, X35 is N.
  • certain amino acids represented by the consensus sequence of SEQ ID NO: 202 or SEQ ID NO: 203 include the following:
  • Xi is S and X5 is S. In some embodiments, Xi is S and Xio is E. In some embodiments, Xi is S and Cib is L. In some embodiments, Xi is S and Cib is k. In some embodiments, Xi is S and Xn is H. In some embodiments, Xi is S and Xis is K. In some embodiments, Xi is S and X31 is K. In some embodiments, Xi is S and X35 is E.
  • Xi is K and X5 is S. In some embodiments, Xi is K and X15 is E. In some embodiments, Xi is K and Cib is L. In some embodiments, Xi is K and Cib is k. In some embodiments, Xi is K and Xn is H. In some embodiments, Xi is K and Xis is K. In some embodiments, Xi is K and X31 is K. In some embodiments, Xi is K and X35 is E.
  • Xs is S and X15 is E. In some embodiments, Xs is S and Cib is L. In some embodiments, Xs is S and Xi6 is k. In some embodiments, Xs is S and Xn is H. In some embodiments, Xs is S and Xis is K. In some embodiments, Xs is S and X31 is K. In some embodiments, Xs is S and X35 is E. In some embodiments, Xio is Q and Xis is E. In some embodiments, Xio is Q and Cib is L. In some embodiments, Xio is Q and Cib is k. In some embodiments, Xio is Q and Xn is H. In some embodiments, Xio is Q and Xi8 is K. In some embodiments, Xio is Q and X31 is K. In some embodiments, Xio is Q and X35 is E.
  • X15 is E and Cib is L. In some embodiments, X15 is E and Cib is k. In some embodiments, X15 is E and Xn is H. In some embodiments, X15 is E and Xi8 is K. In some embodiments, X15 is E and X31 is K. In some embodiments, X15 is E and X35 is E.
  • Cib is L and Xn is H. In some embodiments, Cib is L and Xis is K. In some embodiments, Cib is L and X31 is K. In some embodiments, Cib is L and X35 is E.
  • Cib is k and Xn is H. In some embodiments, Cib is k and Xis is K. In some embodiments, Cib is k and X31 is K. In some embodiments, Cib is k and X35 is E.
  • Xn is H and Xis is K. In some embodiments, Xn is H and X31 is K. In some embodiments, Xn is H and X35 is E.
  • Xis is K and X31 is K. In some embodiments, Xis is K and X35 is E.
  • X31 is K and X35 is E.
  • certain amino acids represented by the consensus sequence of SEQ ID NO: 202 or SEQ ID NO: 203 include the following:
  • Xi is S, Xs is S, and Xio is Q. In some embodiments, Xi is S, X5 is S, and X15 is E. In some embodiments, Xi is S, Xs is S, and Cib is L. In some embodiments, Xi is S, Xs is S, and Cib is k. In some embodiments, Xi is S, Xs is S, and Xn is H. In some embodiments, Xi is S, Xs is S, and Xis is K. In some embodiments, Xi is S,
  • Xs is S, and X31 is K. In some embodiments, Xi is S and X35 is E.
  • Xi is K, Xs is S, and Xio is Q. In some embodiments, Xi is K, Xs is S, and Xis is E. In some embodiments, Xi is K, Xs is S, and Cib is L. In some embodiments, Xi is K, Xs is S, and Cib is k. In some embodiments, Xi is K, Xs is S, and Xn is H. In some embodiments, Xi is K, Xs is S, and Xis is K. In some embodiments, Xi is K, X5 is S, and X31 is K. In some embodiments, Xi is K, Xs is S, and X35 is E.
  • Xs is S, Xio is Q, and Xis is E. In some embodiments, Xs is S, Xio is Q, and Cib is L. In some embodiments, Xs is S, Xio is Q, and Cib is k. In some embodiments, Xs is S, Xio is Q, and Xn is H. In some embodiments, Xs is S, Xio is Q, and Xi8 is K. In some embodiments, Xs is S, Xio is Q, and X31 is K. In some embodiments, Xs is S, Xio is Q, and X35 is E.
  • Xio is Q, X15 is E, and Cib is L. In some embodiments, Xio is Q, X15 is E, and Cib is k. In some embodiments, Xio is Q, X15 is E, and X17 is H. In some embodiments, Xio is Q, X15 is E, and Xi8 is K. In some embodiments, Xio is Q, X15 is E, and X31 is K. In some embodiments, Xio is Q, X15 is E, and X35 is E.
  • X15 is E, Cib is L and X17 is H. In some embodiments, X15 is E, Xi6 is L, and Xis is K. In some embodiments, X15 is E, Cib is L, and X31 is K. In some embodiments, X15 is E, Cib is L, and X35 is E.
  • X15 is E, Cib is k and X17 is H. In some embodiments, X15 is E, Xi6 is k, and Xis is K. In some embodiments, X15 is E, Cib is k, and X31 is K. In some embodiments, X15 is E, Cib is k, and X35 is E.
  • Cib is L, X17 is H, and Xis is K. In some embodiments, Cib is L, X17 is H, and X31 is K. In some embodiments, Cib is L, X17 is H, and X35 is E.
  • Cib is k, Xn is H, and Xis is K. In some embodiments, Xi6 is k, Xn is H, and X31 is K. In some embodiments, Cib is k, Xn is H, and X35 is E.
  • Xn is H, Xis is K, and X31 is K. In some embodiments, Xn is H, Xis is K, and X35 is E.
  • Xis is K
  • X31 is K
  • X35 is E
  • an isolated polypeptide of the disclosure comprises an amino acid sequence, or a pharmaceutically acceptable salt thereof, selected from the group consisting of amino acid sequences represented by the consensus sequence of SEQ ID NO: 204: XiCNTSTCATXioRLANXisXieXnKSSNNFGPILPPTKVGSXssTY-COH/NfE) (SEQ ID NO: 204), wherein:
  • Xi is S, K or k
  • Xio is Q or S
  • Xi6 is L, K or k
  • Xn is H, V or Q
  • X35 is E or N
  • each K independently represents an /.-lysine optionally covalently bound to a lipophilic substituent, optionally via a spacer; each k independently represents a /Z-lysine optionally covalently bound to a lipophilic substituent, optionally via a spacer;
  • X35 is E. In some embodiments, X35 is N.
  • an isolated polypeptide of the disclosure comprises an amino acid sequence, or a pharmaceutically acceptable salt thereof, selected from the group consisting of amino acid sequences represented by the consensus sequence of SEQ ID NO: 205: XiCNTSTCATXioRLANXi5Xi6Xi7KSSNNFGPILPPTKVGSETY-(OH/NH 2 ) (SEQ ID NO: 205), wherein:
  • Xi is S, K or k
  • Xio is Q or S
  • Xi6 is L, K or k
  • Xn H, V or Q
  • each K independently represents an /.-lysine optionally covalently bound to a lipophilic substituent, optionally via a spacer;
  • each k independently represents a -lysine optionally covalently bound to a lipophilic substituent, optionally via a spacer;
  • certain amino acids represented by the consensus sequence of SEQ ID NO: 204 or SEQ ID NO: 205 include the following:
  • carboxy terminal amino acid 37 is Y-(NH2). In some embodiments, carboxy terminal amino acid 37 is Y-(OH).
  • Xi is S. In some embodiments, Xi is K. In some
  • Xi is k.
  • X10 is Q. In some embodiments, X10 is S.
  • X15 is E. In some embodiments, X15 is F.
  • Cib is L. In some embodiments, Cib is K. In some embodiments, Xi6 is k.
  • X17 is H. In some embodiments, X17 is V. In some embodiments, X17 is Q. In some embodiments, X35 is E. In some embodiments, X35 is N.
  • certain amino acids represented by the consensus sequence of SEQ ID NO: 204 or SEQ ID NO: 205 include the following:
  • Xi is S and X10 is Q. In some embodiments, Xi is S and X10 is S. In some embodiments, Xi is S and X15 is E. In some embodiments, Xi is S and X15 is F.
  • Xi is S and Cib is L. In some embodiments, Xi is S and Cib is K. In some embodiments, Xi is S and Cib is k. In some embodiments, Xi is S and X17 is H. In some embodiments, Xi is S and X17 is V. In some embodiments, Xi is S and X17 is Q. In some embodiments, Xi is S and X35 is E. In some embodiments, Xi is S and X35 is N.
  • Xi is K and X10 is Q. In some embodiments, Xi is K and X10 is S. In some embodiments, Xi is K and X15 is E. In some embodiments, Xi is K and X15 is F. In some embodiments, Xi is K and Cib is L. In some embodiments, Xi is K and Cib is K. In some embodiments, Xi is K and Cib is k. In some embodiments, Xi is K and X17 is H. In some embodiments, Xi is K and X17 is V. In some embodiments, Xi is K and X17 is Q. In some embodiments, Xi is K and X35 is E. In some embodiments, Xi is K and X35 is N.
  • Xi is k and X10 is Q. In some embodiments, Xi is k and X10 is S. In some embodiments, Xi is k and X15 is E. In some embodiments, Xi is k and X15 is F.
  • Xi is k and Cib is L. In some embodiments, Xi is k and Cib is K. In some embodiments, Xi is k and Cib is k. In some embodiments, Xi is k and X17 is H. In some embodiments, Xi is k and X17 is V. In some embodiments, Xi is k and X17 is Q. In some embodiments, Xi is k and X35 is E. In some embodiments, Xi is k and X35 is N.
  • X10 is Q and X15 is E. In some embodiments, X10 is Q and X15 is F. In some embodiments, X10 is Q and Cib is L. In some embodiments, X10 is Q and Cib is K. In some embodiments, X10 is Q and Xi6 is k. In some embodiments, X10 is Q and Xn is H. In some embodiments, X10 is Q and Xn is V. In some embodiments, X10 is Q and Xn is Q. In some embodiments, X10 is Q and X35 is E. In some embodiments, X10 is Q and X35 is N.
  • X10 is S and X15 is E. In some embodiments, X10 is S and X15 is F. In some embodiments, X10 is S and Cib is L. In some embodiments, X10 is S and Cib is K. In some embodiments, X10 is S and Cib is k. In some embodiments, X10 is S and Xn is H. In some embodiments, X10 is S and Xn is V. In some embodiments, X10 is S and Xn is Q.
  • X10 is S and X35 is E. In some embodiments, X10 is S and X35 is N. In some embodiments, Xis is E and Cib is L. In some embodiments, Xis is E and X1 ⁇ 2 is K. In some embodiments, Xi5 is E and Xi6 is k. In some embodiments, Xi5 is E and Xn is H. In some embodiments, Xis is E and Xn is V. In some embodiments, Xis is E and Xn is Q. In some embodiments, Xis is E and X35 is E. In some embodiments, Xis is E and X35 is N.
  • Xis is F and Cib is L. In some embodiments, Xis is F and Cib is K. In some embodiments, Xis is F and Cib is k. In some embodiments, Xis is F and Xn is H. In some embodiments, Xis is F and Xn is V. In some embodiments, Xis is F and Xn is Q. In some embodiments, Xis is F and X35 is E. In some embodiments, Xis is F and X35 is N.
  • Cib is L and Xn is H. In some embodiments, Cib is L and Xn is V. In some embodiments, Cib is L and Xn is Q. In some embodiments, Cib is L and X35 is E. In some embodiments, Cib is L and X35 is N.
  • Cib is K and Xn is H. In some embodiments, Cib is K and Xn is V. In some embodiments, Cib is K and Xn is Q. In some embodiments, Cib is K and X35 is E. In some embodiments, Xi6 is K and X35 is N.
  • Cib is k and Xn is H. In some embodiments, Cib is k and Xn is V. In some embodiments, Cib is k and Xn is Q. In some embodiments, Cib is k and X35 is E. In some embodiments, Cib is k and X35 is N.
  • Xn is H and X35 is E. In some embodiments, Xn is H and X35 is N.
  • Xn is V and X35 is E. In some embodiments, Xn is V and X35 is N.
  • Xn is Q and X35 is E. In some embodiments, Xn is Q and X35 is N.
  • an isolated polypeptide of the disclosure comprises an amino acid sequence, or a pharmaceutically acceptable salt thereof, selected from the group consisting of amino acid sequences represented by the consensus sequence of SEQ ID NO: 206: SCNTSTCATQRLANXisXieXnKSSNNFGPILPPTKVGSXssTY-COH/NfE) (SEQ ID NO: 206), wherein:
  • Xis is E or F
  • Xi6 is L, K or k
  • Xn is H, V or Q; and X35 is E or N;
  • each K independently represents an /.-lysine optionally covalently bound to a lipophilic substituent, optionally via a spacer;
  • each k independently represents a //-lysine optionally covalently bound to a lipophilic substituent, optionally via a spacer;
  • X35 is E. In some embodiments, X35 is N.
  • an isolated polypeptide of the disclosure comprises an amino acid sequence, or a pharmaceutically acceptable salt thereof, selected from the group consisting of amino acid sequences represented by the consensus sequence of SEQ ID NO: 207: SCNTSTCATQRLANXisXieXnKSSNNFGPILPPTKVGSETY-iOH/NfE) (SEQ ID NO: 207), wherein:
  • Xi6 is L, K or k
  • Xn H, V or Q
  • each K independently represents an /.-lysine optionally covalently bound to a lipophilic substituent, optionally via a spacer;
  • each k independently represents a //-lysine optionally covalently bound to a lipophilic substituent, optionally via a spacer;
  • certain amino acids represented by the consensus sequence of SEQ ID NO:206 or SEQ ID NO:207 include the following:
  • carboxy terminal amino acid 37 is Y-(NH 2 ). In some embodiments, carboxy terminal amino acid 37 is Y-(OH).
  • X15 is E. In some embodiments, X15 is F.
  • Cib is L. In some embodiments, Cib is K. In some embodiments, Cib is k.
  • X17 is H. In some embodiments, X17 is V. In some embodiments, Xn is Q.
  • X15 is E and Cib is L. In some embodiments, X15 is E and Cib is K. In some embodiments, X15 is E and Cib is k. In some embodiments, X15 is E and Xn is H. In some embodiments, Xis is E and Xn is V. In some embodiments, Xis is E and Xn is Q. In some embodiments, Xi5 is E and X35 is E. In some embodiments, X15 is E and X35 is N.
  • X15 is F and Cib is L. In some embodiments, X15 is F and Cib is K. In some embodiments, X15 is F and Cib is k. In some embodiments, X15 is F and X17 is H. In some embodiments, X15 is F and X17 is V. In some embodiments, X15 is F and X17 is Q. In some embodiments, X15 is F and X35 is E. In some embodiments, X15 is F and X35 is N.
  • Xi6 is L and Xn is H. In some embodiments, Xi6 is L and Xn is V. In some embodiments, Cib is L and Xn is Q. In some embodiments, Cib is L and X35 is E. In some embodiments, Cib is L and X35 is N.
  • Cib is K and Xn is H. In some embodiments, Cib is K and Xn is V. In some embodiments, Cib is K and Xn is Q. In some embodiments, Cib is K and X35 is E. In some embodiments, Cib is K and X35 is N.
  • Cib is k and Xn is H. In some embodiments, Cib is k and Xn is V. In some embodiments, Xi6 is k and Xn is Q. In some embodiments, Xi6 is k and X35 is E. In some embodiments, Cib is k and X35 is N.
  • Xn is H and X35 is E. In some embodiments, Xn is H and X35 is N.
  • Xn is V and X35 is E. In some embodiments, Xn is V and X35 is N.
  • Xn is Q and X35 is E. In some embodiments, Xn is Q and X35 is N.
  • an isolated polypeptide of the disclosure comprises an amino acid sequence selected from the group consisting of:
  • an isolated polypeptide of the disclosure comprises an amino acid sequence: SC*NTSTC*ATQRLANELHKSSNNFGPILPPTKVGSETY-(NH 2 ) (SEQ ID NO: 57), which is also referred to herein as Compound A57.
  • an isolated polypeptide of the disclosure comprises an amino acid sequence: SC*NTSTC*ATQRLANFkHKSSNNFGPILPPTKVGSETY-(NH 2 ) (SEQ ID NO: 127), which is also referred to herein as Compound A127.
  • an isolated polypeptide of the disclosure comprises an amino acid sequence: SC*NTSTC*ATQRLANEk*((YGlu) 2 -CO(CH 2 )i4CH 3 )HKSSNNFGPILPP TKVGSETY-NEE (SEQ ID NO: 27), which is also referred to herein as Compound A27.
  • an isolated polypeptide of the disclosure comprises an amino acid sequence, or a pharmaceutically acceptable salt thereof, selected from the group consisting of amino acid sequences represented by the consensus sequence of SEQ ID NO:208: XiCNTSTCATXioRLANXisXieXnKSSNNFGPILPPTKVGSXssTY- OH/NHQ (SEQ ID NO: 208), wherein:
  • Xi is K or k
  • Xio is Q or S
  • Xi5 is E or F
  • Xi6 is L, K or k
  • Xn is H, V or Q
  • X35 is E or N
  • each K independently represents an /.-lysine optionally covalently bound to a lipophilic substituent, optionally via a spacer;
  • each k independently represents a //-lysine optionally covalently bound to a lipophilic substituent, optionally via a spacer;
  • X35 is E. In some embodiments, X35 is N.
  • an isolated polypeptide of the disclosure comprises an amino acid sequence, or a pharmaceutically acceptable salt thereof, selected from the group consisting of amino acid sequences represented by the consensus sequence of SEQ ID NO:209: XiCNTSTCATXioRLANXi 5 Xi6Xi7KSSNNFGPILPPTKVGSETY-(OH/NH 2 )
  • Xi is K or k
  • Xio is Q or S
  • Xi5 is E or F
  • Xi6 is L, K or k
  • Xn H, V or Q
  • each K independently represents an /.-lysine optionally covalently bound to a lipophilic substituent, optionally via a spacer;
  • each k independently represents a //-lysine optionally covalently bound to a lipophilic substituent, optionally via a spacer;
  • certain amino acids represented by the consensus sequence of SEQ ID NO:208 or SEQ ID NO:209 include the following:
  • carboxy terminal amino acid 37 is Y-(NFh). In some embodiments, carboxy terminal amino acid 37 is Y-(OH).
  • Xi is K. In some embodiments, Xi is k.
  • Xio is Q. In some embodiments, Xio is S.
  • X15 is E. In some embodiments, X15 is F.
  • Cib is L. In some embodiments, X1 ⁇ 2 is K. In some embodiments, Cib is k.
  • Xn is H. In some embodiments, Xn is V. In some embodiments, Xn is Q.
  • Xi is K and Xio is Q. In some embodiments, Xi is K and Xio is S. In some embodiments, Xi is K and Xis is E. In some embodiments, Xi is K and Xis is F. In some embodiments, Xi is K and Cib is L. In some embodiments, Xi is K and Cib is K. In some embodiments, Xi is K and X1 ⁇ 2 is k. In some embodiments, Xi is K and Xn is H. In some embodiments, Xi is K and Xn is V. In some embodiments, Xi is K and Xn is Q. In some embodiments, Xi is K and X35 is E. In some embodiments, Xi is K and X35 is N.
  • Xi is k and Xio is Q. In some embodiments, Xi is k and Xio is S. In some embodiments, Xi is k and X15 is E. In some embodiments, Xi is k and X15 is F. In some embodiments, Xi is k and Cib is L. In some embodiments, Xi is k and Cib is K. In some embodiments, Xi is k and Cib is k. In some embodiments, Xi is k and Xn is H. In some embodiments, Xi is k and Xn is V. In some embodiments, Xi is k and Xn is Q. In some embodiments, Xi is k and X35 is E. In some embodiments, Xi is k and X35 is N.
  • X10 is Q and X15 is E. In some embodiments, X10 is Q and X15 is F. In some embodiments, X10 is Q and Cib is L. In some embodiments, X10 is Q and Cib is K. In some embodiments, X10 is Q and Cib is k. In some embodiments, X10 is Q and Xn is H. In some embodiments, X10 is Q and Xn is V. In some embodiments, X10 is Q and Xn is Q. In some embodiments, X10 is Q and X35 is E. In some embodiments, X10 is Q and X35 is N.
  • X10 is S and X15 is E. In some embodiments, X10 is S and X15 is F. In some embodiments, X10 is S and Cib is L. In some embodiments, X10 is S and Cib is K. In some embodiments, X10 is S and Cib is k. In some embodiments, X10 is S and Xn is H. In some embodiments, X10 is S and Xn is V. In some embodiments, X10 is S and Xn is Q.
  • X10 is S and X35 is E. In some embodiments, X10 is S and X35 is N.
  • X15 is E and Cib is L. In some embodiments, X15 is E and Cib is K. In some embodiments, Xn is E and Xi6 is k. In some embodiments, Xn is E and Xn is H. In some embodiments, Xn is E and Xn is V. In some embodiments, Xn is E and Xn is Q. In some embodiments, Xn is E and X35 is E. In some embodiments, Xn is E and X35 is N.
  • Xn is F and Cib is L. In some embodiments, Xn is F and Cib is K. In some embodiments, Xn is F and Cib is k. In some embodiments, Xn is F and Xn is H. In some embodiments, Xn is F and Xn is V. In some embodiments, Xn is F and Xn is Q. In some embodiments, Xn is F and X35 is E. In some embodiments, Xn is F and X35 is N.
  • Cib is L and Xn is H. In some embodiments, Cib is L and Xn is V. In some embodiments, Cib is L and Xn is Q. In some embodiments, Cib is L and X35 is E. In some embodiments, Cib is L and X35 is N.
  • Cib is K and Xn is H. In some embodiments, Cib is K and Xn is V. In some embodiments, Cib is K and Xn is Q. In some embodiments, Cib is K and X35 is E. In some embodiments, Cib is K and X35 is N.
  • Xi6 is K and Xn is H. In some embodiments, Xi6 is K and Xn is V. In some embodiments, Cib is K and Xn is Q. In some embodiments, Cib is K and X35 is E. In some embodiments, Cib is K and X35 is N. In some embodiments, Xn is H and X35 is E. In some embodiments, X17 is H and X35 is N.
  • X17 is V and X35 is E. In some embodiments, X17 is V and X35 is N.
  • X17 is Q and X35 is E. In some embodiments, X17 is Q and X35 is N.
  • an isolated polypeptide of the disclosure comprises an amino acid sequence selected from the group consisting of:
  • X31 is K. In some embodiments, X31 is N.
  • X35 is E. In some embodiments, X35 is N.
  • any of the disclosed polypeptides is optionally substituted with one or more lipophilic substituents each optionally via a spacer, wherein“lipophilic substituent” and“spacer” are defined herein.
  • any of the disclosed polypeptides comprising an amino acid sequence selected from the group consisting of amino acid sequences represented by any of the consensus sequences of SEQ ID NO: 1 through SEQ ID NO: 143, either comprises one or more lipophilic substituents each optionally via a spacer, or can be modified, or further modified, by covalent attachment of one or more lipophilic substituents each optionally via a spacer.
  • the lipophilic substituent may be attached to an amino group of the polypeptide (e.g., an e-amino group of a lysine residue) by means of a carboxyl group of the lipophilic substituent, or optionally an amino group of the spacer, wherein a carboxyl group of the spacer forms an amide bond with an e-amino group of a lysine residue.
  • an amino group of the polypeptide e.g., an e-amino group of a lysine residue
  • Conjugation of one or more“lipophilic substituents”, each optionally via a“spacer,” to any of the disclosed polypeptides of this invention is intended to prolong the action of the polypeptide by facilitating binding to serum albumin and delayed renal clearance of the conjugated polypeptide.
  • a“lipophilic substituent” comprises a substituent comprising 4 to 40 carbon atoms, 8 to 25 carbon atoms, 12 to 22 carbon atoms, or 6 to 20 carbon atoms.
  • the lipophilic substituent may be attached to an amino group of the polypeptide (e.g., an e-amino group of a lysine residue) by means of a carboxyl group of the lipophilic substituent, or optionally an amino group of the spacer, which carboxyl group of the spacer in turn forms an amide bond with an amino group of the amino acid (e.g., lysine) residue to which it is attached.
  • the polypeptide comprises three, two, or preferably one lipophilic substituent each with or without an optional spacer, which is defined in greater detail below.
  • the lipophilic substituent comprises a straight-chain or branched alkyl group. In some embodiments, the lipophilic substituent is an acyl group of a straight-chain or branched fatty acid. In some embodiments, the lipophilic substituent is an acyl group of a straight-chain or branched fatty acid, further substituted with one or more carboxylic acid and/or hydroxamic acid groups.
  • the polypeptide comprises three, two, or preferably one lipophilic substituents each without an optional spacer.
  • the lipophilic substituent is a monovalent group of Formula I:
  • Z is -CFb or -CO2H
  • n 4 to 24
  • lipophilic substituent forms an amide bond between an amino group (e.g., e- amino group of a lysine) of the disclosed polypeptide and a CO— group of the lipophilic substituent.
  • m is selected from the group consisting of 4-20, 8-20, 12-20, 14-20, 16-20, 14, 16, 18, and 20.
  • Z is -CO2H
  • the lipophilic substituent has the formula - C0-(CH 2 )m-C02H.
  • -CO-(CH2)m-Z is selected from the group consisting of -C0-(CH 2 )4-C0 2 H, -C0-(CH 2 )5-C0 2 H, -C0-(CH 2 )6-C0 2 H, -C0-(CH 2 )7-C0 2 H, -C0-(CH 2 )8-C0 2 H, -C0-(CH 2 )9-C0 2 H, -CO-(CH 2 )IO-C0 2 H, -C0-(CH 2 )II-C0 2 H, -CO- (CH 2 )i2-C0 2 H, -C0-(CH 2 )i3-C0 2 H, -C0-(CH 2 )i4-C0 2 H, -C0-(CH 2 )i5-C0 2
  • the lipophilic substituent is -C0-(CH2)i8-C02H.
  • Z is -CEE, and the lipophilic substituent has the formula -CO- (CH2)m-CH3.
  • -CO-(CH2)m-Z is selected from the group consisting of - CO-(CH 2 )4-CH 3 , -CO-(CH 2 ) 5 -CH 3 , -CO-(CH 2 )6-CH 3 , -CO-(CH 2 )7-CH 3 , -CO-(CH 2 )8-CH 3 , - CO-(CH 2 )9-CH 3 , -CO-(CH 2 )IO-CH 3 , -CO-(CH 2 )H-CH 3 , -CO-(CH 2 )I 2 -CH 3 , -CO-(CH 2 )I 3 -CH 3 , -CO-(CH 2 )i4-CH 3 , -
  • the lipophilic substituent is attached to the parent peptide by means of a“spacer.”
  • any of the disclosed polypeptides comprising an amino acid sequence selected from the group consisting of amino acid sequences represented by any of the consensus sequences of SEQ ID NO: 1 through SEQ ID NO: 143, comprising a lipophilic substituent, wherein the lipophilic substituent is linked to the e-amino group of a lysine via a spacer, which spacer forms a bridge between an amino group of the disclosed polypeptide and a CO— group of the lipophilic substituent.
  • the spacer comprises one or more amino acids, for example, single amino acid such as Glu, Asp, Gly or Lys, dipeptide such as 2(Glu), Glu-Gly, or polypeptide such as 3(Glu), 4(Glu) (SEQ ID NO: 317), 2(Glu)-Gly etc.
  • single amino acid such as Glu, Asp, Gly or Lys
  • dipeptide such as 2(Glu), Glu-Gly
  • polypeptide such as 3(Glu), 4(Glu) (SEQ ID NO: 317), 2(Glu)-Gly etc.
  • one carboxyl group of the spacer may form an amide bond with an amino group of the disclosed polypeptide, and an amino group of the spacer may form an amide bond with a carboxyl group of the lipophilic substituent.
  • the terminal carboxyl group of the sidechain of the Glu or Asp-containing spacer may form an amide bond with an amino group of the disclosed polypeptide, and an amino group of the Glu or Asp-containing spacer may form an amide bond with a carboxyl group of the lipophilic substituent, i.e., yGlu or bA£r.
  • the spacer is yGlu.
  • the spacer is 2(yGlu). In some embodiments, the spacer is 3(yGlu).
  • the polypeptide comprises three, two, or preferably one lipophilic substituent each with a spacer.
  • the lipophilic substituent and spacer are a monovalent group of Formula II:
  • Y is selected from the group consisting of yGl u. Asp, Lys and Gly;
  • Z is -CH 3 or -CC H
  • n is from 4 to 24;
  • n is from 1 to 10.
  • Y is selected from the group consisting of yGlu and Gly. In some embodiments, Y is yGlu. In some embodiments, Y is Gly.
  • the polypeptide comprises three, two, or preferably one lipophilic substituent each with a spacer.
  • the lipophilic substituent and spacer are a monovalent group of Formula III:
  • Z is -CH 3 or -CO2H
  • n is from 4 to 24;
  • n is from 1 to 10.
  • Z is -CH 3 . In some embodiments, Z is -CO2H.
  • m is selected from the group consisting of 4-20, 8-20, 12-20, 14-20, 16-20, 14, 16, 18, and 20.
  • n is selected from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9 and 10. In some embodiments, n is 1. In some embodiments, n is 2. In some embodiments, n is 3. In some embodiments, n is 4. In some embodiments, n is 5.
  • the polypeptide comprises three, two, or preferably one lipophilic substituent each with a spacer.
  • the lipophilic substituent and spacer are a monovalent group of Formula IV:
  • Z is -CH 3 or -CO2H
  • n is from 4 to 24;
  • n is from 1 to 10.
  • (yGlu) n is selected from the group consisting of yGl u: 2(yGlu); 3(yGlu); 4(yGlu) (SEQ ID NO: 313); and 5(yGlu) (SEQ ID NO: 314).
  • -(yGlu)n-(Gly)- (“(yGlu)n-(Gly)" disclosed as SEQ ID NO: 312) is selected from the group consisting of 2(yGlu),Gly; and 3(yGlu),Gly (SEQ ID NO: 315).
  • the polypeptide comprises three, two, or preferably one lipophilic substituent each with a spacer.
  • the lipophilic substituent and spacer are a monovalent group of Formula V:
  • Z is -CH 3 or -CC H
  • n is from 4 to 24;
  • n is from 1 to 10.
  • Z is -CFb. In some embodiments, Z is -CChH.
  • m is selected from the group consisting of 4-20, 8-20, 12-20, 14-20, 16-20, 14, 16, 18, and 20.
  • n is selected from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9 and 10. In some embodiments, n is 1. In some embodiments, n is 2. In some embodiments, n is 3. In some embodiments, n is 4. In some embodiments, n is 5.
  • n is 1 and Z is -CChH. In some embodiments, n is 1 and Z is - CH3. In some embodiments, n is 2 and Z is -CChH. In some embodiments, n is 2 and Z is -
  • n is 3 and Z is -CChH. In some embodiments, n is 3 and Z is -
  • n is 4 and Z is -CChH. In some embodiments, n is 4 and Z is -
  • n is 5 and Z is -CChH. In some embodiments, n is 5 and Z is -
  • n is 1, Z is -CChH, and m is 14-20. In some embodiments, n is 1, Z is -CChH, and m is 14. In some embodiments, n is 1, Z is -CChH, and m is 16. In some embodiments, n is 1, Z is -CChH, and m is 18.
  • n 1, Z is -CH3, and m is 14-20. In some embodiments, n is 1, Z is -CH3 and m is 14. In some embodiments, n is 1, Z is -CH3, and m is 16. In some embodiments, n is 1, Z is -CH3, and m is 18. In some embodiments, n is 2, Z is -CO2H, and m is 14-20. In some embodiments, n is 2, Z is -CO2H, and m is 14. In some embodiments, n is 2, Z is -CO2H, and m is 16. In some embodiments, n is 2, Z is -CO2H, and m is 18.
  • n is 2, Z is -CH3, and m is 14-20. In some embodiments, n is
  • Z is -CH3 and m is 14. In some embodiments, n is 2, Z is -CH3, and m is 16. In some embodiments, n is 2, Z is -CH3, and m is 18.
  • n is 3, Z is -CO2H, and m is 14-20. In some embodiments, n is
  • Z is -CO2H, and m is 14. In some embodiments, n is 3, Z is -CO2H, and m is 16. In some embodiments, n is 3, Z is -CO2H, and m is 18.
  • n is 3, Z is -CH3, and m is 14-20. In some embodiments, n is
  • Z is -CH3 and m is 14. In some embodiments, n is 3, Z is -CH3, and m is 16. In some embodiments, n is 3, Z is -CH3, and m is 18.
  • n is 4, Z is -CO2H, and m is 14-20. In some embodiments, n is
  • n 4, Z is -CO2H, and m is 14. In some embodiments, n is 4, Z is -CO2H, and m is 16. In some embodiments, n is 4, Z is -CO2H, and m is 18.
  • n 4, Z is -CH3, and m is 14-20. In some embodiments, n is
  • n 4, Z is -CH3 and m is 14. In some embodiments, n is 4, Z is -CH3, and m is 16. In some embodiments, n is 4, Z is -CH3, and m is 18.
  • n is 5, Z is -CO2H, and m is 14-20. In some embodiments, n is
  • n 5, Z is -CO2H, and m is 14. In some embodiments, n is 5, Z is -CO2H, and m is 16. In some embodiments, n is 5, Z is -CO2H, and m is 18.
  • n is 5, Z is -CH3, and m is 14-20. In some embodiments, n is 5, Z is -CH3 and m is 14. In some embodiments, n is 5, Z is -CH3, and m is 16. In some embodiments, n is 5, Z is -CH3, and m is 18.
  • the polypeptide comprises three, two, or preferably one lipophilic substituent each with a spacer.
  • the lipophilic substituent and spacer are a monovalent group of Formula VI:
  • Z is -CH3 or -CO2H
  • n is from 4 to 24;
  • Yl is selected from the group consisting of yGlu, Asp, and Gly;
  • Y2 is selected from the group consisting of yGlu, Asp, and Gly;
  • V is -[C0CH2(0(CH 2 )2)t0CH 2 NH]-, and t is from 1 to 8;
  • r is from 1 to 8;
  • nl is from 0 to 10;
  • n2 is from 0 to 10.
  • the polypeptide comprises three, two, or preferably one lipophilic substituent each with a spacer.
  • the lipophilic substituent and spacer are a monovalent group of Formula VII:
  • Z is -CH 3 or -CO2H
  • n is from 4 to 24;
  • Yl is selected from the group consisting of yGlu, Asp, and Gly;
  • Y2 is selected from the group consisting of yGlu, Asp, and Gly;
  • dpeg is -[C0(CH 2 )0(CH2)20(CH 2 )NH]-;
  • r is from 1 to 8;
  • nl is from 0 to 10;
  • n2 is from 0 to 10.
  • n2 - is selected from the group consisting of yGlu, dpeg, dpeg, yGlu; yGlu, dpeg, dpeg, 2(yGlu); yGlu, dpeg, dpeg, 3(yGlu);
  • yGlu dpeg, dpeg, 4(yGlu); 2(yGlu), dpeg, dpeg, yGlu; and 2(yGlu).dpeg.yGlu.
  • the polypeptide comprises three, two, or preferably one lipophilic substituent each with a spacer.
  • the lipophilic substituent and spacer are a monovalent group of Formula VIII:
  • Z is -CH 3 or -CO2H
  • n is from 4 to 24;
  • Y2 is selected from the group consisting of yGlu, Asp, and Gly;
  • V is -[C0CH 2 (0(CH2)2) t 0CH 2 NH]-, and t is from 1 to 8;
  • r is from 1 to 8; and n2 is from 0 to 10.
  • the polypeptide comprises three, two, or preferably one lipophilic substituent each with a spacer.
  • the lipophilic substituent and spacer are a monovalent group of Formula IX:
  • Z is -CH 3 or -CC H
  • n is from 4 to 24;
  • dpeg is -[C0(CH2)0(CH 2 )20(CH 2 )NH]-;
  • Y2 is selected from the group consisting of yGlu, Asp, and Gly;
  • r is from 1 to 8.
  • n2 is from 0 to 10.
  • -(dpeg)r-(Y2) n2 - is selected from the group consisting of dpeg.yGlu: and dpeg, dpeg, yGlu.
  • the polypeptide comprises three, two, or preferably one lipophilic substituent each with a spacer.
  • the lipophilic substituent and spacer are a monovalent group of Formula X:
  • Z is -CH 3 or -CChH
  • n is from 4 to 24;
  • Yl is selected from the group consisting of yGlu, Asp, and Gly;
  • dpeg is -[C0(CH2)0(CH 2 )20(CH 2 )NH]-;
  • r is from 1 to 8.
  • nl is from 0 to 10.
  • -(Yl)ni-(dpeg)r- is 2(yGlu),dpeg.
  • the spacer comprises a bivalent group of Formula XI:
  • each Ri and R 3 is hydrogen or C1-C4 alkyl; each R.2 is H or CO2H;
  • p 1, 2, 3, 4, 5 or 6;
  • q 1, 2 or 3;
  • r is 0 or 1.
  • spacer forms a bridge between an amino group of the disclosed polypeptide and a CO— group of the lipophilic substituent.
  • the spacer comprises a bivalent group of Formula XII:
  • each R.3 is hydrogen or C1-C4 alkyl
  • q 1, 2 or 3;
  • r is 0 or 1.
  • spacer forms a bridge between an amino group of the disclosed polypeptide and a CO— group of the lipophilic substituent.
  • certain variables represented in Formula XI or Formula XII include the following:
  • each Ri is hydrogen. In some embodiments, each R3 is hydrogen. In some embodiments, each Ri and each R3 are hydrogen.
  • At least one R2 is CO2H. In some embodiments, one R2 is
  • p is 1. In some embodiments, p is 2. In some embodiments, p is 3. In some embodiments, p is 4. In some embodiments, p is 5. In some embodiments, p is 6
  • q is 1. In some embodiments, q is 2. In some embodiments, q is 3.
  • r is 0. In some embodiments, r is 1.
  • the spacer is g-glutamyl, i.e., -NH(CHC02H)(CH2)2C0— . In some embodiments, the spacer is g-aminobutanoyl, i.e., -NH(CH2)3CO— . In some embodiments, the spacer is b-asparagyl, i.e., -NH(CHC02H)(CH2)C0— . In some embodiments, the spacer is -NH(CH2)2CO— . In some embodiments, the spacer is glycyl. In some embodiments, the spacer is b-alanyl. In some embodiments, the spacer is -NHCH(C02H)(CH2)2C0—
  • the spacer is -NH(CFh) 3 CO- -[N(R 3 )((CH2)20(CH2)20) q (CH 2 )C0— ]r. In some embodiments, the spacer is - NHCH(C02H)(CH 2 )2C0-NH((CH2)20(CH2)20)2(CH 2 )C0-. In some embodiments, the spacer is -NH(CH2) 3 C0-NH((CH2)20(CH2)20)2(CH2)C0-.
  • the spacer is -NHCH(C02H)CH 2 C0--[N(R 3 )((CH2)20(CH2)20) q (CH2)C0— ] r . In some embodiments, the spacer is -NH(CH2)2CO— [N(R 3 )((CH2)20(CH2)20) q (CH2)C0— ]r.
  • the spacer comprises a bivalent group of Formula XIII:
  • Y is selected from the group consisting of yGl u. Asp, Lys and Gly;
  • n is from 1 to 10.
  • Y is selected from the group consisting of yGlu and Gly. In some embodiments, Y is yGlu. In some embodiments, Y is Gly.
  • the spacer forms a bridge between an amino group of the disclosed polypeptide and a CO— group of a lipophilic substituent.
  • one end of the spacer forms a covalent bond with an amino group of the disclosed polypeptide and the other end of the spacer forms a covalent bond with a hydrogen atom or a protecting group.
  • the spacer comprises a bivalent group of Formula XIV:
  • n is from 1 to 10.
  • n is selected from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9 and 10. In some embodiments, n is 1. In some embodiments, n is 2. In some embodiments, n is 3. In some embodiments, n is 4. In some embodiments, n is 5.
  • the spacer forms a bridge between an amino group of the disclosed polypeptide and a CO— group of a lipophilic substituent. In some embodiments, one end of the spacer forms a covalent bond with an amino group of the disclosed polypeptide and the other end of the spacer forms a covalent bond with a hydrogen atom or a protecting group. In some embodiments, the spacer comprises a bivalent group of Formula XV:
  • n is from 1 to 10.
  • (yGlu) n is selected from the group consisting of yGlu; 2(yGlu); 3(yGlu); 4(yGlu) (SEQ ID NO: 313); and 5(yGlu) (SEQ ID NO: 314).
  • -(yGlu)n-(Gly)- (“(yGlu)n-(Gly)" disclosed as SEQ ID NO: 312) is selected from the group consisting of 2(yGlu),Gly; and 3(yGlu),Gly (SEQ ID NO: 315).
  • the spacer forms a bridge between an amino group of the disclosed polypeptide and a CO— group of a lipophilic substituent.
  • one end of the spacer forms a covalent bond with an amino group of the disclosed polypeptide and the other end of the spacer forms a covalent bond with a hydrogen atom or a protecting group.
  • the spacer comprises a bivalent group of Formula XVI:
  • n is from 1 to 10.
  • the spacer forms a bridge between an amino group of the disclosed polypeptide and a CO— group of a lipophilic substituent.
  • one end of the spacer forms a covalent bond with an amino group of the disclosed polypeptide and the other end of the spacer forms a covalent bond with a hydrogen atom or a protecting group.
  • n is selected from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9 and 10.
  • n is 1. In some embodiments, n is 2. In some embodiments, n is 3. In some embodiments, n is 4. In some embodiments, n is 5.
  • the spacer comprises a bivalent group of Formula XVII:
  • Yl is selected from the group consisting of yGlu, Asp, and Gly;
  • Y2 is selected from the group consisting of yGlu, Asp, and Gly;
  • V is -[C0CH2(0(CH 2 )2)t0CH 2 NH]-, and t is from 1 to 8;
  • r is from 1 to 8;
  • nl is from 0 to 10;
  • n2 is from 0 to 10.
  • the spacer forms a bridge between an amino group of the disclosed polypeptide and a CO— group of a lipophilic substituent.
  • one end of the spacer forms a covalent bond with an amino group of the disclosed polypeptide and the other end of the spacer forms a covalent bond with a hydrogen atom or a protecting group.
  • the spacer comprises a bivalent group of Formula XVIII:
  • Yl is selected from the group consisting of yGlu, Asp, and Gly;
  • Y2 is selected from the group consisting of yGlu, Asp, and Gly;
  • dpeg is -[C0(CH 2 )0(CH2)20(CH 2 )NH]-;
  • r is from 1 to 8;
  • nl is from 0 to 10;
  • n2 is from 0 to 10.
  • n2 - is selected from the group consisting of yGlu, dpeg, dpeg, yGlu; yGlu, dpeg, dpeg, 2(yGlu); yGlu, dpeg, dpeg, 3(yGlu);
  • yGlu dpeg, dpeg, 4(yGlu); 2(yGlu), dpeg, dpeg, yGlu; and 2(yGlu).dpeg.yGlu.
  • the spacer forms a bridge between an amino group of the disclosed polypeptide and a CO— group of a lipophilic substituent.
  • one end of the spacer forms a covalent bond with an amino group of the disclosed polypeptide and the other end of the spacer forms a covalent bond with a hydrogen atom or a protecting group.
  • an isolated polypeptide provided herein comprises an amino acid sequence, or a pharmaceutically acceptable salt thereof, selected from the group consisting of amino acid sequences represented by a consensus sequence selected from the group consisting of SEQ ID NO: 199, SEQ ID NO: 200, SEQ ID NO: 201, SEQ ID NO: 202, SEQ ID NO: 203, SEQ ID NO: 204, SEQ ID NO: 205, SEQ ID NO: 206, SEQ ID NO: 207, SEQ ID NO: 208, and SEQ ID NO: 209, wherein the isolated peptide further comprises a lipophilic substituent, and optionally comprises a spacer.
  • the isolated polypeptide comprises an amino acid sequence of SEQ ID NO: 199, or a pharmaceutically acceptable salt thereof, further comprising a lipophilic substituent of Formula I.
  • the isolated polypeptide comprises an amino acid sequence of SEQ ID NO: 199, or a pharmaceutically acceptable salt thereof, further comprising a lipophilic substituent and spacer selected from the group consisting of Formula II, Formula III, Formula IV, Formula V, Formula VI, Formula VII, Formula VIII, Formula IX, and Formula X.
  • the isolated polypeptide comprises an amino acid sequence of SEQ ID NO: 199, or a pharmaceutically acceptable salt thereof, further comprising a lipophilic substituent and spacer of Formula III.
  • the isolated polypeptide comprises an amino acid sequence of SEQ ID NO: 199, or a pharmaceutically acceptable salt thereof, further comprising a lipophilic substituent and spacer of Formula VI. In an embodiment the isolated polypeptide comprises an amino acid sequence of SEQ ID NO: 199, or a pharmaceutically acceptable salt thereof, further comprising a lipophilic substituent and spacer of Formula VII.
  • the isolated polypeptide comprises an amino acid sequence of SEQ ID NO: 200, or a pharmaceutically acceptable salt thereof, further comprising a lipophilic substituent of Formula I.
  • the isolated polypeptide comprises an amino acid sequence of SEQ ID NO: 200, or a pharmaceutically acceptable salt thereof, further comprising a lipophilic substituent and spacer selected from the group consisting of Formula II, Formula III, Formula IV, Formula V, Formula VI, Formula VII, Formula VIII, Formula IX, and Formula X.
  • the isolated polypeptide comprises an amino acid sequence of SEQ ID NO: 200, or a pharmaceutically acceptable salt thereof, further comprising a lipophilic substituent and spacer of Formula III.
  • the isolated polypeptide comprises an amino acid sequence of SEQ ID NO: 200, or a pharmaceutically acceptable salt thereof, further comprising a lipophilic substituent and spacer of Formula VI. In an embodiment the isolated polypeptide comprises an amino acid sequence of SEQ ID NO: 200, or a pharmaceutically acceptable salt thereof, further comprising a lipophilic substituent and spacer of Formula VII.
  • the isolated polypeptide comprises an amino acid sequence of SEQ ID NO: 204, or a pharmaceutically acceptable salt thereof, further comprising a lipophilic substituent of Formula I.
  • the isolated polypeptide comprises an amino acid sequence of SEQ ID NO: 204, or a pharmaceutically acceptable salt thereof, further comprising a lipophilic substituent and spacer selected from the group consisting of Formula II, Formula III, Formula IV, Formula V, Formula VI, Formula VII, Formula VIII, Formula IX, and Formula X.
  • the isolated polypeptide comprises an amino acid sequence of SEQ ID NO: 204, or a pharmaceutically acceptable salt thereof, further comprising a lipophilic substituent and spacer of Formula III.
  • the isolated polypeptide comprises an amino acid sequence of SEQ ID NO: 204, or a pharmaceutically acceptable salt thereof, further comprising a lipophilic substituent and spacer of Formula VI. In an embodiment the isolated polypeptide comprises an amino acid sequence of SEQ ID NO: 204, or a pharmaceutically acceptable salt thereof, further comprising a lipophilic substituent and spacer of Formula VII.
  • the isolated polypeptide comprises an amino acid sequence of SEQ ID NO: 206, or a pharmaceutically acceptable salt thereof, further comprising a lipophilic substituent of Formula I.
  • the isolated polypeptide comprises an amino acid sequence of SEQ ID NO: 206, or a pharmaceutically acceptable salt thereof, further comprising a lipophilic substituent and spacer selected from the group consisting of Formula II, Formula III, Formula IV, Formula V, Formula VI, Formula VII, Formula VIII, Formula IX, and Formula X.
  • the isolated polypeptide comprises an amino acid sequence of SEQ ID NO: 206, or a pharmaceutically acceptable salt thereof, further comprising a lipophilic substituent and spacer of Formula III.
  • the isolated polypeptide comprises an amino acid sequence of SEQ ID NO: 206, or a pharmaceutically acceptable salt thereof, further comprising a lipophilic substituent and spacer of Formula VI. In an embodiment the isolated polypeptide comprises an amino acid sequence of SEQ ID NO: 206, or a pharmaceutically acceptable salt thereof, further comprising a lipophilic substituent and spacer of Formula VII.
  • the isolated polypeptide comprises an amino acid sequence of SEQ ID NO: 208, or a pharmaceutically acceptable salt thereof, further comprising a lipophilic substituent of Formula I.
  • the isolated polypeptide comprises an amino acid sequence of SEQ ID NO: 208, or a pharmaceutically acceptable salt thereof, further comprising a lipophilic substituent and spacer selected from the group consisting of Formula II, Formula III, Formula IV, Formula V, Formula VI, Formula VII, Formula VIII, Formula IX, and Formula X.
  • the isolated polypeptide comprises an amino acid sequence of SEQ ID NO: 208, or a pharmaceutically acceptable salt thereof, further comprising a lipophilic substituent and spacer of Formula III.
  • the isolated polypeptide comprises an amino acid sequence of SEQ ID NO: 208, or a pharmaceutically acceptable salt thereof, further comprising a lipophilic substituent and spacer of Formula VI. In an embodiment the isolated polypeptide comprises an amino acid sequence of SEQ ID NO: 208, or a pharmaceutically acceptable salt thereof, further comprising a lipophilic substituent and spacer of Formula VII.
  • an isolated polypeptide provided herein comprises an amino acid sequence, or a pharmaceutically acceptable salt thereof, selected from the group consisting of amino acid sequences represented by the consensus sequence of SEQ ID NO: 200:
  • Xi is S, K, k, H or I; X3 is N or S; X5 is S or A; Xe is T or S; Xs is A or K; X10 is Q or S; X12 is L or K; X13 is A, S, E or K; X14 is N, n, d, Y or Q; X15 is E, F, f, Y, I, k, K or Aib; Xi6 is k, K, L, Aib, V-MeL or 1; X17 is H, V, Q, R, k, K or Aib; Xis is K, H, or R; X19 is S or Aib; X20 is S or Aib; X22 is N or E; X29 is P, R or K; X31 is k, K or N; and X35 is e, E or N; each K independently represents an /.-lysine optionally covalently bound to
  • Z is -CEE or -CO2H
  • m is from 4 to 24.
  • an isolated polypeptide provided herein comprises an amino acid sequence, or a pharmaceutically acceptable salt thereof, selected from the group consisting of amino acid sequences represented by the consensus sequence of SEQ ID NO: 200:
  • X1CX3TX5X6CX8TX10RX12X13X14X15X16X17X18X19X20NX22FGPILPX29TX31VGSX35TY- (OH/NH2) (SEQ ID NO: 200), or a pharmaceutically acceptable salt thereof, wherein: Xi is S, K, k, H or I; X3 is N or S; Xs is S or A; Xe is T or S; Xs is A or K; X10 is Q or S; X12 is L or K; X13 is A, S, E or K; X14 is N, n, d, Y or Q; X15 is E, F, f, Y, I, k, K or Aib; Xi6 is k, K, L, Aib, A-MeL or 1; X17 is H, V, Q, R, k, K or Aib; Xi8 is K, H, or R; X
  • Z is -CH3 or -CO2H
  • n is from 4 to 24;
  • n is from 1 to 10.
  • an isolated polypeptide provided herein comprises an amino acid sequence, or a pharmaceutically acceptable salt thereof, selected from the group consisting of amino acid sequences represented by the consensus sequence of SEQ ID NO: 200:
  • Xi is S, K, k, H or I; X3 is N or S; Xs is S or A; Xe is T or S; Xs is A or K; X10 is Q or S; X12 is L or K; X13 is A, S, E or K; Xi4 is N, n, d, Y or Q; X15 is E, F, f, Y, I, k, K or Aib; Xi6 is k, K, L, Aib, A-MeL or 1; Xn is H, V, Q, R, k, K or Aib; Xis is K, H, or R; X19 is S or Aib; X20 is S or Aib; X22 is N or E; X29 is P, R or K; X31 is k, K or N; and X35 is e, E or N; each K independently represents an /.-lysine optionally covalently bound to
  • Z is -CH 3 or -CC H
  • n is from 4 to 24;
  • Yl is selected from the group consisting of yGlu, Asp, and Gly;
  • Y2 is selected from the group consisting of yGlu. Asp, and Gly;
  • V is -[C0CH 2 (0(CH 2 )2) t 0CH 2 NH]-, and t is from 1 to 8;
  • r is from 1 to 8;
  • nl is from 0 to 10;
  • n2 is from 0 to 10.
  • an isolated polypeptide provided herein comprises an amino acid sequence, or a pharmaceutically acceptable salt thereof, selected from the group consisting of amino acid sequences represented by the consensus sequence of SEQ ID NO: 200:
  • Xi is S, K, k, H or I; X3 is N or S; X5 is S or A; Xe is T or S; Xs is A or K; X10 is Q or S; Xi 2 is L or K; X13 is A, S, E or K; X14 is N, n, d, Y or Q; X15 is E, F, f, Y, I, k, K or Aib; Xi6 is k, K, L, Aib, A-MeL or 1; X17 is H, V, Q, R, k, K or Aib; Xis is K, H, or R; X19 is S or Aib; X 2 o is S or Aib; X 22 is N or E; X29 is P, R or K; X31 is k, K or N; and X35 is e, E or N; each K independently represents an /.-lysine optionally covalently
  • Z is -CEE or -C0 2 H
  • n is from 4 to 24;
  • Yl is selected from the group consisting of yGlu, Asp, and Gly;
  • Y2 is selected from the group consisting of yGlu. Asp, and Gly;
  • dpeg is -[C0(CH 2 )0(CH 2 )20(CH 2 )NH]-;
  • r is from 1 to 8;
  • nl is from 0 to 10;
  • n2 is from 0 to 10.
  • the isolated polypeptide comprises a lipophilic substituent at position Xi, X15, or Cib.
  • the isolated polypeptide comprising a lipophilic substituent at position Xi, X15, or Cib is conjugated via a lysine at that position.
  • the isolated polypeptide comprises a lipophilic substituent at position Xi.
  • the isolated polypeptide comprises a lipophilic substituent at position X15.
  • the isolated polypeptide comprises a lipophilic substituent at position Cib.
  • the isolated polypeptide comprising a lipophilic substituent at position Xi is conjugated via a lysine at that position.
  • the isolated polypeptide comprising a lipophilic substituent at position X15 is conjugated via a lysine at that position.
  • the isolated polypeptide comprising a lipophilic substituent at position Cib is conjugated via a lysine at that position.
  • an isolated polypeptide of the disclosure comprises an amino acid sequence: SC*NTSTC*ATQRLANEk*((YGlu) 2 -CO(CH 2 )i4CH 3 )HKSSNNFGPILPP TKVGSETY-NH 2 (SEQ ID NO: 27), which is also referred to herein as Compound A27.
  • an isolated polypeptide of the disclosure comprises an amino acid sequence:
  • an isolated polypeptide of the disclosure comprises an amino acid sequence:
  • an isolated polypeptide of the disclosure comprises an amino acid sequence: K*(yGlu-1) (C0(CH 2 )i6C0 2 H))C*NTSTC*ATQRLANELHKSSNNFGPILPPTKVGSETY- (NH 2 ) (SEQ ID NO: 65), which is also referred to herein as Compound A65.
  • an isolated polypeptide of the disclosure comprises an amino acid sequence: K*(yGlu-1) (C0(CH 2 )i6C0 2 H))C*NTSTC*ATQRLANELHKSSNNFGPILPPTKVGSETY- (NH 2 ) (SEQ ID NO: 65), which is also referred to herein as Compound A65.
  • an isolated polypeptide of the disclosure comprises an amino acid sequence: K*(yGlu-
  • an isolated polypeptide of the disclosure comprises an amino acid sequence selected from the group consisting of the following peptides listed in Table 3:
  • each K* independently represents an /.-lysine optionally covalently bound to a
  • lipophilic substituent optionally via a spacer
  • each k* independently represents a //-lysine optionally covalently bound to a
  • lipophilic substituent optionally via a spacer
  • (yGl u)r and 2(yGlu) both mean -(yGlu)-(yGlu)-: (yGlu)i and 3(yGlu) both mean -(yGl u)-(yGl u)-(yGl u)- etc.; and
  • each occurrence of that variable is independently determined.
  • Y may be yGl u. Asp, Lys, or Gly
  • each Y is independently selected to be one of the four amino acids.
  • -(Y)3- may be -(yGlu)-(yGlu)-(yGlu)-, -(yGlu)-(Asp)-(yGlu)-, -(Gly)-(Asp)-(yGlu)-, or -(Gly)-(yGlu)-(yGlu)-.
  • the present invention provides a compound set forth in the Table 3, above, or a pharmaceutically acceptable salt thereof.
  • the pharmaceutically acceptable salt is an acetate salt.
  • the pharmaceutically acceptable salt is a trifluoroacetic acid (TFA) salt.
  • the pharmaceutically acceptable salt is a hydrochloric acid (HC1) salt.
  • the compound is A27.
  • the compound is the acetate salt of compound A27.
  • the compound is the TFA salt of compound A27.
  • the compound is the HC1 salt of compound A27.
  • the compound is A57.
  • the compound is the acetate salt of compound A57.
  • the compound is the TFA salt of compound A57. In some embodiments, the compound is the HC1 salt of compound A57. In one embodiment, the compound is A64. In some embodiments, the compound is the acetate salt of compound A64. In some embodiments, the compound is the TFA salt of compound A64. In some embodiments, the compound is the HC1 salt of compound A64.
  • a polypeptide intermediate of the disclosure is an isolated polypeptide comprising an amino acid sequence selected from the group consisting of amino acid sequences represented by the consensus sequence of SEQ ID NO: 210:
  • Xi is S, K, k, H or I
  • X3 is N or S
  • X5 is S or A
  • Cb is T or S
  • X8 is A or K
  • X10 is Q or S
  • X12 is L or K
  • X13 is A, S, E or K
  • X14 is N, n, d, Y or Q;
  • X15 is E, F, f, Y, I, k, K or a-aminoisobutyric acid (Aib);
  • Xi6 is k, K, L, Aib, X-methyl leucine GV-MeL). or 1;
  • Xn is H, V, Q, R, k, K or Aib;
  • Xi8 is K, H, or R; Xi9 is S or Aib;
  • X20 is S or Aib
  • X22 is N or E
  • X29 is P, R or K
  • X35 is e, E or N
  • each K independently represents an /.-lysine optionally covalently bound to a protecting group or a spacer optionally bound to a protecting group;
  • each k independently represents a //-lysine optionally covalently bound to a protecting group or a spacer optionally bound to a protecting group;
  • X31 is K. In some embodiments, X31 is N.
  • X35 is E. In some embodiments, X35 is N.
  • X31 is K and X35 is E.
  • certain amino acids represented by the consensus sequence of SEQ ID NO: 210 include the following:
  • carboxy terminal amino acid 37 is Y-(NH2). In some embodiments, carboxy terminal amino acid 37 is Y-(OH).
  • Xi is S. In some embodiments, Xi is K. In some
  • Xi is k. In some embodiments, Xi is H. In some embodiments, Xi is I.
  • X3 is N. In some embodiments, X3 is S.
  • X5 is S. In some embodiments, X5 is A.
  • Cb is T. In some embodiments, Cb is S.
  • Xx is A. In some embodiments, Xx is K.
  • X10 is Q. In some embodiments, X10 is S.
  • X12 is L. In some embodiments, X12 is K.
  • X13 is A. In some embodiments, X13 is S. In some embodiments, X13 is E. In some embodiments, X13 is K.
  • X14 is N. In some embodiments, X14 is n. In some embodiments, X14 is d. In some embodiments, Xu is Y. In some embodiments, Xu is Q. In some embodiments, Xis is E. In some embodiments, Xis is F. In some embodiments, Xi5 is f. In some embodiments, Xi5 is Y. In some embodiments, Xi5 is I. In some embodiments, X15 is K. In some embodiments, X15 is k. In some embodiments, X15 is Aib.
  • Cib is L. In some embodiments, X1 ⁇ 2 is 1. In some
  • Cib is K. In some embodiments, Cib is k. In some embodiments, Cib is Aib. In some embodiments, Cib is A-MeL.
  • Xn is H. In some embodiments, Xn is V. In some embodiments, Xn is Q. In some embodiments, Xn is R. In some embodiments, Xn is K. In some embodiments, Xn is k. In some embodiments, Xn is Aib.
  • Xi8 is K. In some embodiments, Xi8 is H. In some embodiments, Xis is R.
  • X19 is S. In some embodiments, X19 is Aib.
  • X20 is S. In some embodiments, X20 is Aib.
  • X22 is N. In some embodiments, X22 is E.
  • X29 is P. In some embodiments, X29 is R. In some embodiments, X29 is K.
  • X31 is k. In some embodiments, X31 is K. In some
  • X31 is N.
  • X35 is e. In some embodiments, X35 is E. In some
  • X35 is N.
  • certain amino acids represented by the consensus sequence of SEQ ID NO: 210 include the following:
  • Xi is S and X5 is S. In some embodiments, Xi is S and X10 is Q. In some embodiments, Xi is S and X15 is E. In some embodiments, Xi is S and Cib is L. In some embodiments, Xi is S and Cib is k. In some embodiments, Xi is S and Xn is H. In some embodiments, Xi is S and Xis is K. In some embodiments, Xi is S and X31 is K. In some embodiments, Xi is S and X35 is E.
  • Xi is K and X5 is S. In some embodiments, Xi is K and X10 is Q. In some embodiments, Xi is K and X15 is E. In some embodiments, Xi is K and Cib is L. In some embodiments, Xi is K and Xi6 is k. In some embodiments, Xi is K and Xn is H. In some embodiments, Xi is K and Xis is K. In some embodiments, Xi is K and X31 is K. In some embodiments, Xi is K and X35 is E. In some embodiments, Xi is k and Xs is S. In some embodiments, Xi is k and Xio is Q. In some embodiments, Xi is k and Xis is E. In some embodiments, Xi is k and Xi6 is L.
  • Xi is k and Cib is k. In some embodiments, Xi is k and Xn is H. In some embodiments, Xi is k and Xi8 is K. In some embodiments, Xi is k and X31 is K. In some embodiments, Xi is k and X35 is E.
  • X5 is S and X15 is E. In some embodiments, X5 is S and Xio is Q. In some embodiments, X5 is S and Cib is L. In some embodiments, X5 is S and Cib is k.
  • X5 is S and X17 is H. In some embodiments, X5 is S and Xi8 is K. In some embodiments, X5 is S and X31 is K. In some embodiments, X5 is S and X35 is E.
  • Xio is Q and X15 is E. In some embodiments, Xio is Q and Cib is L. In some embodiments, Xio is Q and Cib is k. In some embodiments, Xio is Q and X17 is H. In some embodiments, Xio is Q and Xis is K. In some embodiments, Xio is Q and X31 is K. In some embodiments, Xio is Q and X35 is E.
  • X15 is E and Cib is L. In some embodiments, X15 is E and Cib is k. In some embodiments, X15 is E and X17 is H. In some embodiments, X15 is E and Xis is K. In some embodiments, X15 is E and X31 is K. In some embodiments, X15 is E and X35 is E.
  • Cib is L and X17 is H. In some embodiments, Cib is L and Xis is K. In some embodiments, Cib is L and X31 is K. In some embodiments, Cib is L and X35 is E.
  • Cib is k and X17 is H. In some embodiments, Cib is k and Xis is K. In some embodiments, Cib is k and X31 is K. In some embodiments, Cib is k and X35 is E.
  • Xn is H and Xis is K. In some embodiments, Xn is H and X31 is K. In some embodiments, Xn is H and X35 is E.
  • Xis is K and X31 is K. In some embodiments, Xis is K and X35 is E.
  • X31 is K and X35 is E.
  • certain amino acids represented by the consensus sequence of SEQ ID NO: 210 include the following:
  • Xi is S, Xs is S, and Xis is E. In some embodiments, Xi is S, Xs is S, and Cib is L. In some embodiments, Xi is S, Xs is S, and Cib is k. In some embodiments, Xi is S, Xs is S, and Xn is H. In some embodiments, Xi is S, Xs is S, and Xis is K. In some embodiments, Xi is S, Xs is S, and X31 is K. In some embodiments, Xi is S and X35 is E.
  • Xi is K, X5 is S, and X15 is E. In some embodiments, Xi is K, X5 is S, and X1 ⁇ 2 is L. In some embodiments, Xi is K, X5 is S, and Cib is k. In some embodiments, Xi is K, X5 is S, and X17 is H. In some embodiments, Xi is K, X5 is S, and Xi8 is K. In some embodiments, Xi is K, X5 is S, and X31 is K. In some embodiments, Xi is K, X5 is S, and X35 is E.
  • Xi is k, X5 is S, and X15 is E. In some embodiments, Xi is k, X5 is S, and Xi6 is L. In some embodiments, Xi is k, X5 is S, and Xi6 is k. In some embodiments, Xi is k, X5 is S, and X17 is H. In some embodiments, Xi is k, X5 is S, and Xi8 is K. In some embodiments, Xi is k, X5 is S, and X31 is K. In some embodiments, Xi is k, X5 is S, and X35 is E.
  • X5 is S, X15 is E, and Cib is L. In some embodiments, X5 is S, X15 is E, and Cib is k. In some embodiments, X5 is S, X15 is E, and X17 is H. In some embodiments, X5 is S, X15 is E, and Xis is K. In some embodiments, X5 is S, X15 is E, and X31 is K. In some embodiments, X5 is S, X15 is E, and X35 is E.
  • X10 is Q, X15 is E and Cib is L. In some embodiments, X10 is Q, and Cib is k and X17 is H. In some embodiments, X10 is Q, Xis is K, and X31 is K. In some embodiments, X10 is Q, X31 is K and X35 is E.
  • X15 is E, Cib is L, and X17 is H. In some embodiments, X15 is E, Xi6 is L, and Xis is K. In some embodiments, X15 is E, Cib is L, and X31 is K. In some embodiments, X15 is E, Cib is L, and X35 is E.
  • X15 is E, Cib is k, and X17 is H. In some embodiments, X15 is E, Xi6 is k, and Xis is K. In some embodiments, X15 is E, Cib is k, and X31 is K. In some embodiments, X15 is E, Cib is k, and X35 is E.
  • Cib is L, X17 is H, and Xis is K. In some embodiments, Cib is L, X17 is H, and X31 is K. In some embodiments, Cib is L, X17 is H, and X35 is E.
  • Cib is k, X17 is H, and Xis is K. In some embodiments, Cib is k, X17 is H, and X31 is K. In some embodiments, Cib is k, X17 is H, and X35 is E.
  • X17 is H, Xis is K, and X31 is K. In some embodiments, X17 is H, Xis is K, and X35 is E.
  • a polypeptide intermediate of the disclosure is an isolated polypeptide comprising an amino acid sequence selected from the group consisting of amino acid sequences represented by the consensus sequence of SEQ ID NO: 211 :
  • Xi is S, K or k
  • Xio is Q or S
  • Xi5 is E or F
  • Xi6 is L, K or k
  • Xn is H, V or Q
  • X35 is E or N
  • each K independently represents an /.-lysine optionally covalently bound to a protecting group or a spacer optionally bound to a protecting group;
  • each k independently represents a //-lysine optionally covalently bound to a protecting group or a spacer optionally bound to a protecting group
  • X35 is E. In some embodiments, X35 is N.
  • certain amino acids represented by the consensus sequence of SEQ ID NO: 211 include the following:
  • carboxy terminal amino acid 37 is Y-(NFh). In some embodiments, carboxy terminal amino acid 37 is Y-(OH).
  • Xi is S. In some embodiments, Xi is K. In some embodiments, Xi is k.
  • X10 is Q. In some embodiments, X10 is S.
  • X15 is E. In some embodiments, X15 is F.
  • Cib is L. In some embodiments, Cib is K. In some embodiments, Cib is k.
  • X17 is H. In some embodiments, X17 is V. In some embodiments, X17 is Q.
  • X35 is E. In some embodiments, X35 is N.
  • certain amino acids represented by the consensus sequence of SEQ ID NO: 211 include the following:
  • Xi is S and Xio is Q.
  • Xi is S and Xio is S.
  • Xi is S and Xn is E.
  • Xi is S and Xn is F.
  • Xi is S and X1 ⁇ 2 is L. In some embodiments, Xi is S and Cib is K. In some embodiments, Xi is S and Cib is k. In some embodiments, Xi is S and Xn is H. In some embodiments, Xi is S and Xn is V. In some embodiments, Xi is S and Xn is Q. In some embodiments, Xi is S and X35 is E. In some embodiments, Xi is S and X35 is N.
  • Xi is K and Xio is Q. In some embodiments, Xi is K and Xio is S. In some embodiments, Xi is K and X15 is E. In some embodiments, Xi is K and X15 is F. In some embodiments, Xi is K and Cib is L. In some embodiments, Xi is K and Cib is K. In some embodiments, Xi is K and Cib is k. In some embodiments, Xi is K and Xn is H. In some embodiments, Xi is K and Xn is V. In some embodiments, Xi is K and Xn is Q. In some embodiments, Xi is K and X35 is E. In some embodiments, Xi is K and X35 is N.
  • Xi is k and Xio is Q. In some embodiments, Xi is k and Xio is S. In some embodiments, Xi is k and X15 is E. In some embodiments, Xi is k and X15 is F.
  • Xi is k and Cib is L. In some embodiments, Xi is k and Cib is K. In some embodiments, Xi is k and Cib is k. In some embodiments, Xi is k and Xn is H. In some embodiments, Xi is k and Xn is V. In some embodiments, Xi is k and Xn is Q. In some embodiments, Xi is k and X35 is E. In some embodiments, Xi is k and X35 is N.
  • Xio is Q and X15 is E. In some embodiments, Xio is Q and X15 is F. In some embodiments, Xio is Q and Cib is L. In some embodiments, Xio is Q and Cib is K. In some embodiments, Xio is Q and Cib is k. In some embodiments, Xio is Q and Xn is H. In some embodiments, Xio is Q and Xn is V. In some embodiments, Xio is Q and Xn is Q. In some embodiments, Xio is Q and X35 is E. In some embodiments, Xio is Q and X35 is N.
  • Xio is S and X15 is E. In some embodiments, Xio is S and X15 is F. In some embodiments, Xio is S and Cib is L. In some embodiments, Xio is S and Cib is K. In some embodiments, Xio is S and Cib is k. In some embodiments, Xio is S and Xn is H. In some embodiments, Xio is S and Xn is V. In some embodiments, Xio is S and Xn is Q.
  • Xio is S and X35 is E. In some embodiments, Xio is S and X35 is N.
  • X15 is E and Cib is L. In some embodiments, X15 is E and Cib is K. In some embodiments, X15 is E and Cib is k. In some embodiments, X15 is E and Xn is H. In some embodiments, X15 is E and Xn is V. In some embodiments, X15 is E and Xn is Q. In some embodiments, Xis is E and X35 is E. In some embodiments, X15 is E and X35 is N.
  • X15 is F and Cib is L. In some embodiments, X15 is F and Cib is K. In some embodiments, X15 is F and Cib is k. In some embodiments, X15 is F and X17 is H. In some embodiments, X15 is F and X17 is V. In some embodiments, X15 is F and X17 is Q. In some embodiments, X15 is F and X35 is E. In some embodiments, X15 is F and X35 is N.
  • Cib is L and X17 is H. In some embodiments, Cib is L and X17 is V. In some embodiments, Xi6 is L and Xn is Q. In some embodiments, Xi6 is L and X35 is E. In some embodiments, Cib is L and X35 is N.
  • Cib is K and Xn is H. In some embodiments, Cib is K and Xn is V. In some embodiments, Cib is K and Xn is Q. In some embodiments, Cib is K and X35 is E. In some embodiments, Cib is K and X35 is N.
  • Cib is k and Xn is H. In some embodiments, Cib is k and Xn is V. In some embodiments, Cib is k and Xn is Q. In some embodiments, Cib is k and X35 is E. In some embodiments, Xi6 is k and X35 is N.
  • Xn is H and X35 is E. In some embodiments, Xn is H and X35 is N.
  • Xn is V and X35 is E. In some embodiments, Xn is V and X35 is N.
  • Xn is Q and X35 is E. In some embodiments, Xn is Q and X35 is N.
  • a polypeptide intermediate of the disclosure is an isolated polypeptide comprising an amino acid sequence selected from the group consisting of amino acid sequences represented by the consensus sequence of SEQ ID NO: 212:
  • Xi6 is L, K or k
  • Xn is H, V or Q
  • X35 is E or N
  • each K independently represents an /.-lysine optionally covalently bound to a protecting group or a spacer optionally bound to a protecting group; each k independently represents a //-lysine optionally covalently bound to a protecting group or a spacer optionally bound to a protecting group;
  • X35 is E. In some embodiments, X35 is N.
  • certain amino acids represented by the consensus sequence of SEQ ID NO: 212 include the following:
  • carboxy terminal amino acid 37 is Y-(NEt 2 ). In some embodiments, carboxy terminal amino acid 37 is Y-(OH).
  • X15 is E. In some embodiments, X15 is F.
  • Cib is L. In some embodiments, Cib is K. In some embodiments, Cib is k.
  • X17 is H. In some embodiments, X17 is V. In some embodiments, X17 is Q.
  • X15 is E and Cib is L. In some embodiments, X15 is E and Cib is K. In some embodiments, X15 is E and Xi6 is k. In some embodiments, X15 is E and Xn is H. In some embodiments, X15 is E and Xn is V. In some embodiments, X15 is E and Xn is Q. In some embodiments, X15 is E and X35 is E. In some embodiments, X15 is E and X35 is N.
  • X15 is F and Cib is L. In some embodiments, X15 is F and Cib is K. In some embodiments, X15 is F and Cib is k. In some embodiments, X15 is F and Xn is H. In some embodiments, X15 is F and Xn is V. In some embodiments, X15 is F and Xn is Q. In some embodiments, X15 is F and X35 is E. In some embodiments, X15 is F and X35 is N.
  • Cib is L and Xn is H. In some embodiments, Cib is L and Xn is V. In some embodiments, Cib is L and Xn is Q. In some embodiments, Cib is L and X35 is E. In some embodiments, Cib is L and X35 is N.
  • Cib is K and Xn is H. In some embodiments, Cib is K and Xn is V. In some embodiments, Cib is K and Xn is Q. In some embodiments, Cib is K and X35 is E. In some embodiments, Cib is K and X35 is N.
  • Xi6 is k and Xn is H. In some embodiments, Xi6 is k and Xn is V. In some embodiments, Cib is k and Xn is Q. In some embodiments, Cib is k and X35 is E. In some embodiments, Cib is k and X35 is N. In some embodiments, Xn is H and X35 is E. In some embodiments, X17 is H and X35 is N.
  • X17 is V and X35 is E. In some embodiments, X17 is V and X35 is N.
  • X17 is Q and X35 is E. In some embodiments, X17 is Q and X35 is N.
  • the isolated peptide comprising the amino acid sequence of SEQ ID NO: 210, SEQ ID NO: 211, or SEQ ID NO: 212 further comprises a protecting group or a spacer optionally bound to a protecting group. In some embodiments, the isolated peptide further comprises a protecting group. In some embodiments, the isolated peptide further comprises a spacer. In some embodiments, the isolated peptide further comprises a spacer bound to a protecting group.
  • the isolated polypeptide comprises a protecting group or a spacer optionally bound to a protecting group at position Xi, X15, or Cib.
  • the isolated polypeptide comprising a protecting group or a spacer optionally bound to a protecting group at position Xi, X15, or Cib is conjugated via a lysine at that position.
  • the isolated polypeptide comprises a protecting group or a spacer optionally bound to a protecting group at position Xi.
  • the isolated polypeptide comprises a protecting group or a spacer optionally bound to a protecting group at position X15.
  • the isolated polypeptide comprises a protecting group or a spacer optionally bound to a protecting group at position Cib.
  • the isolated polypeptide comprising a protecting group or a spacer optionally bound to a protecting group at position Xi is conjugated via a lysine at that position.
  • the isolated polypeptide comprising a protecting group or a spacer optionally bound to a protecting group at position X15 is conjugated via a lysine at that position.
  • the isolated polypeptide comprising a protecting group or a spacer optionally bound to a protecting group at position X1 ⁇ 2 is conjugated via a lysine at that position.
  • the protecting group is selected from the group consisting of is acetyl, allyloxy carbonyl, Benzyl, Boc, Cbz, Dmb, (dimethyl-2,6-dioxocyclohex-l- ylidene)ethyl, Fmoc, tert-butyl, or trityl.
  • the protecting group is acetyl, allyloxy carbonyl, dimethyl-2,6-dioxocyclohex-l-ylidene)ethyl, Fmoc, tert-butyl, or trityl. In some embodiments, the protecting group is acetyl, allyloxy carbonyl, dimethyl-2, 6- dioxocyclohex-l-ylidene)ethyl, or Fmoc,
  • the spacer is selected from the group consisting of Formula XI, Formula XII, Formula XIII, Formula XIV, Formula XV, Formula XVI, Formula XVII, and Formula XVIII.
  • the isolated polypeptide further comprises a spacer of Formula XIII.
  • the isolated polypeptide further comprises a spacer of Formula XIV.
  • the isolated polypeptide further comprises a spacer of Formula XVII.
  • the isolated polypeptide further comprises a spacer of Formula XVIII.
  • the spacer is bound to a protecting group.
  • the protecting group is selected from the group consisting of is acetyl, allyloxy carbonyl, Benzyl, Boc, Cbz, Dmb, (dimethyl-2,6-dioxocyclohex-l-ylidene)ethyl, Fmoc, tert-butyl, or trityl.
  • the protecting group is acetyl,
  • the protecting group is acetyl, trityl, or tert-butyl.
  • the spacer is not bound to a protecting group.
  • an isolated polypeptide of the disclosure comprises an amino acid sequence selected form the group consisting of the following peptides listed in Table 4:
  • the present invention provides a peptide intermediate set forth in the Table 4, above.
  • the peptide intermediate is a peptide having the amino acid sequence of SEQ ID NO: 129, SEQ ID NO: 144, SEQ ID NO: 145, or SEQ ID NO: 156.
  • the peptide intermediate has the amino acid sequence of SEQ ID NO: 129.
  • the peptide intermediate has the amino acid sequence of SEQ ID NO: 145.
  • the peptide intermediate is a peptide having the amino acid sequence of SEQ ID NO: 129, SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149 or SEQ ID NO: 150.
  • the peptide intermediate has the amino acid sequence of SEQ ID NO: 147. In some embodiments, the peptide intermediate is a peptide having the amino acid sequence of SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, or SEQ ID NO: 154. In some embodiments, the peptide intermediate has the amino acid sequence of SEQ ID NO: 151.
  • the peptide intermediate is a peptide having the amino acid sequence of SEQ ID NO: 155 or SEQ ID NO: 156. In some embodiments, the peptide intermediate is a peptide having the amino acid sequence of SEQ ID NO: 155. In some embodiments, the peptide intermediate is a peptide having the amino acid sequence of SEQ ID NO: 157, SEQ ID NO: 158, SEQ ID NO: 159, or SEQ ID NO: 160. In some
  • the peptide intermediate is a peptide having the amino acid sequence of SEQ ID NO: 157. In some embodiments, the peptide intermediate is a peptide having the amino acid sequence of SEQ ID NO: 161, SEQ ID NO: 162, SEQ ID NO: 163, or SEQ ID NO: 164. In some embodiments, the peptide intermediate is a peptide having the amino acid sequence of SEQ ID NO: 164.
  • the invention relates to a method of treating metabolic disease or disorder in a subject in need of treatment, comprising providing the subject with an effective amount of an amylin analog polypeptide of the disclosure or a pharmaceutical composition thereof.
  • Metabolic diseases or disorders include type 1 diabetes, type 2 diabetes, and obesity.
  • the invention relates to a method of effecting weight loss in a subject, including a diabetic subject, comprising providing the subject with an effective amount of an amylin analog polypeptide of the disclosure.
  • Amylin analog polypeptides of the disclosure are particularly useful for the treatment of diabetes, the method comprising providing a diabetic subject with an effective amount of an amylin analog polypeptide.
  • an amylin analog polypeptide of the disclosure is used for the treatment of a subject with type 1 or type 2 diabetes to control, or reduce, concentrations of blood sugar in the subject, where blood sugar levels can be monitored or approximated based on measured blood concentrations of glycated
  • hemoglobin (hemoglobin Ale, HbAlc).
  • an amylin analog polypeptide of the disclosure is used for the treatment of a subject with type 1 diabetes
  • an amylin analog polypeptide of the disclosure is used for the treatment of a subject with type 2 diabetes; (iii) In some embodiments, an amylin analog polypeptide of the disclosure is used for the treatment of obesity; and
  • an amylin analog polypeptide of the disclosure is used to provide weight loss to a subject, such as a diabetic subject, wherein the amylin analog polypeptide of usage (i), (ii), (iii) or (iv) comprises any amino acid sequence of this disclosure including those selected from the group consisting of SEQ ID NOS: 199, 200, 204, 206, 127, 57, 128, 129, 43, 209, 130, 64, 65, 131, 109 and 27.
  • the amylin analog polypeptide is used for the treatment of a subject with type 1 diabetes wherein the amylin analog polypeptide comprises the amino acid sequence of SEQ ID NO 27. In some embodiments, the amylin analog polypeptide is used for the treatment of a subject with type 1 diabetes wherein the amylin analog polypeptide comprises the amino acid sequence of SEQ ID NO 64. In some embodiments, the amylin analog polypeptide is used for the treatment of a subject with type 1 diabetes wherein the amylin analog polypeptide comprises the amino acid sequence of SEQ ID NO 65. In some embodiments, the amylin analog polypeptide is used for the treatment of a subject with type 1 diabetes wherein the amylin analog polypeptide comprises the amino acid sequence of SEQ ID NO 131.
  • the amylin analog polypeptide is used for the treatment of a subject with type 2 diabetes wherein the amylin analog polypeptide comprises the amino acid sequence of SEQ ID NO 27. In some embodiments, the amylin analog polypeptide is used for the treatment of a subject with type 2 diabetes wherein the amylin analog polypeptide comprises the amino acid sequence of SEQ ID NO 64. In some embodiments, the amylin analog polypeptide is used for the treatment of a subject with type 2 diabetes wherein the amylin analog polypeptide comprises the amino acid sequence of SEQ ID NO 65. In some embodiments, the amylin analog polypeptide is used for the treatment of a subject with type 2 diabetes wherein the amylin analog polypeptide comprises the amino acid sequence of SEQ ID NO 131.
  • the amylin analog polypeptide is used for the treatment of a subject with obesity wherein the amylin analog polypeptide comprises the amino acid sequence of SEQ ID NO 27. In some embodiments, the amylin analog polypeptide is used for the treatment of a subject with obesity wherein the amylin analog polypeptide comprises the amino acid sequence of SEQ ID NO 64. In some embodiments, the amylin analog polypeptide is used for the treatment of a subject with obesity wherein the amylin analog polypeptide comprises the amino acid sequence of SEQ ID NO 65. In some embodiments, the amylin analog polypeptide is used for the treatment of a subject with obesity wherein the amylin analog polypeptide comprises the amino acid sequence of SEQ ID NO 131.
  • the amylin analog polypeptide is used to provide weight loss to a subject wherein the amylin analog polypeptide comprises the amino acid sequence of SEQ ID NO 27. In some embodiments, the amylin analog polypeptide is used to provide weight loss to a subject wherein the amylin analog polypeptide comprises the amino acid sequence of SEQ ID NO 64. In some embodiments, the amylin analog polypeptide is used to provide weight loss to a subject wherein the amylin analog polypeptide comprises the amino acid sequence of SEQ ID NO 65. In some embodiments, the amylin analog polypeptide is used to provide weight loss to a subject wherein the amylin analog polypeptide comprises the amino acid sequence of SEQ ID NO 131.
  • Amylin analog polypeptides of the disclosure like insulin, are provided (i.e., administered) to a diabetic subject to maintain, control, or reduce blood sugar concentrations in the subject.
  • Diabetic subjects who are treated with an amylin analog polypeptide of the disclosure as an adjunct to insulin therapy are at risk of hypoglycemia (i.e., low blood sugar), particularly severe hypoglycemia. Accordingly, reducing the dose of meal time insulin for diabetic subjects upon treatment with an amylin analog polypeptide of the disclosure is intended to decrease the risk of hypoglycemia, particularly severe hypoglycemia.
  • Severe hypoglycemia refers to an episode of hypoglycemia requiring the assistance of another individual (including help administering oral carbohydrate) or requiring the administration of glucagon, intravenous glucose, or other medical intervention.
  • an amylin analog polypeptide of the disclosure as an adjunct to insulin therapy, particularly meal-time insulin therapy, generally requires a dose reduction in the meal-time insulin necessary to properly maintain healthy blood sugar concentrations in the subject.
  • type 1 or type 2 diabetics who already self- administer meal-time insulin at a particular dose before commencing treatment with an amylin analog polypeptide of the disclosure, will reduce (for example, up to 25%, 50%, 75%, or 100%) the dose of meal -time insulin they continue to self-administer upon commencing treatment with an amylin analog polypeptide of the disclosure.
  • the method comprises providing an amylin analog polypeptide of the disclosure or a pharmaceutical composition thereof, to a subject in need of treatment, via injection. In some embodiments, the method comprises providing an amylin analog polypeptide of the disclosure or a pharmaceutical composition thereof, formulated for oral administration, to a subject in need of treatment.
  • the method comprises providing an amylin analog polypeptide of the disclosure or a pharmaceutical composition thereof, to a subject in need of treatment, via implantation.
  • the method comprises providing continuous delivery of an amylin analog polypeptide, to a subject in need of treatment, from an osmotic delivery device.
  • the delivery device such as an osmotic delivery device, comprises sufficient amylin analog polypeptide of the disclosure for continuous administration for up to 3 months, 6 months, 9 months, 12 months, 18 months or 24 months.
  • continuous administration of an amylin analog polypeptide of the disclosure via osmotic delivery device eliminates daily, or multiple daily dosing of existing amylin analog polypeptides, such as pramlintide.
  • Diabetics who are treated with pramlintide must coordinate dosing of pramlintide before meals with meal-time insulin administered after meals.
  • diabetics who are treated with an amylin analog polypeptide of the disclosure via osmotic delivery device receive continuous delivery of the amylin analog polypeptide and need only administer meal-time insulin at reduced doses.
  • the substantial steady-state delivery of the amylin analog polypeptide from the osmotic delivery device is continuous over an administration period.
  • the subject or patient is a human subject or human patient.
  • the administration period is, for example, at least about 3 months, at least about 3 months to about a year, at least about 4 months to about a year, at least about 5 months to about a year, at least about 6 months to about a year, at least about 8 months to about a year, at least about 9 months to about a year, at least about 10 months to about a year, at least about one year to about two years, at least about two years to about three years.
  • the treatment methods of the present invention provide significant decrease in the subject’s fasting plasma glucose concentration after implantation of the osmotic delivery device in the subject (relative to the subject’s fasting plasma glucose concentration before implantation of the osmotic delivery device) that is achieved within about 7 days, 6 days, 5 days, 4 days, 3 days, 2 days, 1 day or less after implantation of the osmotic delivery device in the subject.
  • the significant decrease in fasting plasma glucose is typically statistically significant as demonstrated by application of an appropriate statistical test or is considered significant for the subject by a medical practitioner.
  • a significant decrease in fasting plasma glucose relative to the baseline before implantation is typically maintained over the administration period.
  • the present invention relates to a method of treating a disease or condition in a subject in need of treatment.
  • the method comprises providing continuous delivery of a drug from an osmotic delivery device, wherein substantial steady-state delivery of the drug at therapeutic concentrations is achieved in the subject.
  • the substantial steady- state delivery of the drug from the osmotic delivery device is continuous over an
  • the drug has a known or determined half- life in a typical subject. Humans are preferred subjects for the practice of the present invention.
  • the present invention includes a drug effective for treatment of the disease or condition, as well as an osmotic delivery device comprising the drug for use in the present methods of treating the disease or condition in a subject in need of treatment. Advantages of the present invention include mitigation of peak-associated drug toxicities and attenuation of sub-optimal drug therapy associated with troughs.
  • the substantial steady-state delivery of a drug at therapeutic concentrations is achieved within a period of about 1 month, 7 days, 5 days, 3 days or 1 day after implantation of the osmotic delivery device in the subject.
  • the invention also provides a method for promoting weight loss in a subject in need thereof, a method for treating excess weight or obesity in a subject in need thereof, and/or a method for suppressing appetite in a subject in need thereof.
  • the method comprises providing delivery of an isolated amylin analog polypeptide.
  • the isolated amylin analog polypeptide is continuously delivered from an implantable osmotic delivery device.
  • substantial steady-state delivery of the amylin analog polypeptide from the osmotic delivery device is achieved and is substantially continuous over an administration period.
  • the subject is human.
  • the present invention includes an isolated amylin analog polypeptide, as well as an osmotic delivery device comprising an isolated amylin analog polypeptide for use in the present methods in a subject in need of treatment.
  • the subject may have type 2 diabetes.
  • the subject in need thereof may have a baseline HbAlc % of greater than 10.0%, i.e., a high baseline (HBL) subject.
  • HBL high baseline
  • the subject may not have previously received a drug for treating type 2 diabetes mellitus.
  • the treatment methods of the present invention provide significant decrease in the subject’s fasting plasma glucose concentration after implantation of the osmotic delivery device in the subject (relative to the subject’s fasting plasma glucose concentration before implantation of the osmotic delivery device) that is achieved within about 7 days or less after implantation of the osmotic delivery device in the subject, within about 6 days or less after implantation of the osmotic delivery device in the subject, within about 5 days or less after implantation of the osmotic delivery device in the subject, within about 4 days or less after implantation of the osmotic delivery device in the subject, within about 3 days or less after implantation of the osmotic delivery device in the subject, within about 2 days or less after implantation of the osmotic delivery device in the subject, or within about 1 day or less after implantation of the osmotic delivery device in the subject.
  • the significant decrease in the subject’s fasting plasma glucose concentration after implantation of the osmotic delivery device, relative to the subject’s fasting plasma glucose concentration before implantation is achieved within about 2 days or less, preferably within about 1 day or less after implantation of the osmotic delivery device in the subject, or more preferably within about 1 day after implantation of the osmotic delivery device in the subject.
  • the significant decrease in fasting plasma glucose is typically statistically significant as demonstrated by application of an appropriate statistical test or is considered significant for the subject by a medical practitioner.
  • a significant decrease in fasting plasma glucose relative to the baseline before implantation is typically maintained over the administration period.
  • an exemplary osmotic delivery device comprises the following: an impermeable reservoir comprising interior and exterior surfaces and first and second open ends; a semi-permeable membrane in sealing relationship with the first open end of the reservoir; an osmotic engine within the reservoir and adjacent the semi-permeable membrane; a piston adjacent the osmotic engine, wherein the piston forms a movable seal with the interior surface of the reservoir, the piston divides the reservoir into a first chamber and a second chamber, the first chamber comprising the osmotic engine; a drug formulation or suspension formulation comprising the drug, wherein the second chamber comprises the drug formulation or suspension formulation and the drug formulation or suspension formulation is flowable; and a diffusion moderator inserted in the second open end of the reservoir, the diffusion moderator adjacent the suspension formulation.
  • the reservoir comprises titanium or a titanium alloy.
  • the drug formulation can comprise the drug and a vehicle formulation.
  • suspension formulations are used in the methods and can, for example, comprise a particle formulation comprising the drug and a vehicle formulation.
  • Vehicle formulations for use in forming the suspension formulations of the present invention can, for example, comprise a solvent and a polymer.
  • the reservoir of the osmotic delivery devices may, for example, comprise titanium or a titanium alloy.
  • the implanted osmotic delivery device can be used to provide subcutaneous delivery.
  • the continuous delivery can, for example, be zero-order, controlled continuous delivery.
  • an amylin analog polypeptide of the disclosure is co formulated in combination with a second agent. In some embodiments, an amylin analog polypeptide of the disclosure is co-formulated in combination with a second agent, wherein the second agent is an insulinotropic peptide. In some embodiments, an amylin analog polypeptide of the disclosure is co-formulated in combination with a second agent, wherein the second agent is a GLP-l receptor agonist.
  • an amylin analog polypeptide of the disclosure is co-formulated in combination with a second agent, wherein the second agent is a (GLP-l) agonist such as exenatide, a derivative of exenatide, an analogue of exenatide, or semaglutide.
  • the GLP-l receptor agonist is exenatide.
  • the GLP-l receptor agonist is semaglutide.
  • an amylin analog polypeptide of the disclosure without being co-formulated with a second agent, is administered to a subject in combination with the second agent wherein the second agent is a (GLP-l) agonist such as exenatide, a derivative of exenatide, an analogue of exenatide, or semaglutide.
  • a (GLP-l) agonist such as exenatide, a derivative of exenatide, an analogue of exenatide, or semaglutide.
  • an amylin analog polypeptide of the disclosure is co- formulated in combination with insulin or an insulin derivative. In some embodiments, an amylin analog polypeptide of the disclosure is co-formulated in combination with a long- acting basal insulin or long-acting basal insulin derivative. In some embodiments, an amylin analog polypeptide of the disclosure, without being co-formulated with insulin or an insulin derivative, is administered to a subject in combination with the insulin or an insulin derivative, i.e., as an adjunct to insulin therapy. In some embodiments, an amylin analog peptide of the disclosure, without being co-formulated with insulin or an insulin derivative, is administered to a subject in combination with meal time insulin. In some embodiments, the subject has type 1 diabetes. In some embodiments, the subject has type 2 diabetes.
  • an amylin analog polypeptide of the disclosure is co administered to a human patient with insulin or an insulin derivative to provide a so-called dual-hormone“artificial pancreas” therapy.
  • an amylin analog polypeptide of the disclosure without being co-formulated with the insulin or insulin derivative, is co-administered to a subject in combination with the insulin or insulin derivative to provide dual-hormone“artificial pancreas” therapy.
  • an amylin analog polypeptide of the disclosure is co-formulated with the insulin or insulin derivative and thus singly administered to a subject in combination with the insulin or insulin derivative to provide dual -hormone“artificial pancreas” therapy.
  • the artificial pancreas therapy includes rapid acting insulin or a rapid acting insulin derivative.
  • the artificial pancreas therapy includes a long acting or basal insulin or a long acting or basal insulin derivative.
  • any of the amylin analogs of the disclosure is formulated in combination with exenatide. In some embodiments, any of the amylin analogs of the disclosure is formulated in combination with a GLP-l receptor agonist.
  • Some embodiments of the present invention comprise use of a amylin analog polypeptide in combination with a second therapeutic agent, such as a second polypeptide, such as, by way of, non-limiting example, insulinotropic peptides, peptide hormones, for example, glucagon and incretin mimetics (e.g., GLP-l receptor agonists such as exenatide), as well as peptide analogs and peptide derivatives thereof; PYY (also known as peptide YY, peptide tyrosine tyrosine), as well as peptide analogs and peptide derivatives thereof, for example, PYY(3-36); oxyntomodulin, as well as peptide analogs and peptide derivatives thereof); and gastric inhibitory peptide (GIP), as well as peptide analogs and peptide derivatives thereof.
  • a second therapeutic agent such as a second polypeptide
  • insulinotropic peptides such as, by way of, non-
  • a pharmaceutical composition comprising an amylin analog polypeptide in combination with a GLP-l receptor agonist is used to treat type 2 diabetes.
  • GLP-l including three forms of the peptide, GLP-l(l-37), GLP-l(7-37) and GLP- 1(7-36) amide, as well as peptide analogs of GLP-l have been shown to stimulate insulin secretion (i.e., is insulinotropic), which induces glucose uptake by cells and results in decreases in serum glucose concentrations (see, e g., Mojsov, S., Int. J. Peptide Protein Research, 40:333-343 (1992)).
  • GLP-l receptor agonists e.g., GLP-l peptide derivatives and peptide analogs
  • insulinotropic action is known in the art (see, e.g., U.S. Pat. Nos. 5,118,666; 5,120,712; 5,512,549; 5,545,618; 5,574,008; 5,574,008; 5,614,492; 5,958,909; 6,191,102; 6,268,343; 6,329,336; 6,451,974; 6,458,924; 6,514,500; 6,593,295; 6,703,359; 6,706,689; 6,720,407; 6,821,949; 6,849,708; 6,849,714; 6,887,470; 6,887,849; 6,903,186; 7,022,674; 7,041,646; 7,084,243; 7,101,843; 7,138,486; 7,141,547; 7,144,863; and
  • a GLP-l receptor agonist in the practice of the present invention is Victoza® (Novo Nordisk A/S, Bagsvaerd D K) (liraglutide; U.S. Pat. Nos. 6,268,343, 6,458,924, and 7,235,627). Once-daily injectable Victoza® (liraglutide) is commercially available in the United States, Europe, and Japan.
  • a GLP-l receptor agonist is Ozempic® (Novo Nordisk A/S, Bagsvaerd D K) (semaglutide).
  • GLP-L the family of GLP- 1 receptor agonists, GLP-l peptides, GLP-l peptide derivatives and GLP-l peptide analogs having insulinotropic activity.
  • the molecule exenatide has the amino acid sequence of exendin-4 (Kolterman O.
  • exenatide peptides e.g., including exendin-3, exendin-4, and exendin-4-amide
  • exenatide peptide derivatives e.g., including exendin-3, exendin-4, and exendin-4-amide
  • exenatide peptide analogs e.g., exenatide peptide analogs
  • PYY Peptide YY
  • PYY is a 36 amino acid residue peptide amide. PYY inhibits gut motility and blood flow (Laburthe, M., Trends Endocrinol Metab. 1(3): 168-74 (1990), mediates intestinal secretion (Cox, H. M., et al, Br J Pharmacol 101(2):247-52 (1990);
  • PYY(l-36) and PYY(3-36) Two major in vivo variants, PYY(l-36) and PYY(3-36), have been identified (e.g., Eberlein, G. A., et al, Peptides 10(4), 797-803 (1989)).
  • the sequence of PYY, as well as peptide analogs and peptide derivatives thereof, are known in the art (e.g., U.S. Pat. Nos. 5,574,010 and 5,552,520).
  • Oxyntomodulin is a naturally occurring 37 amino acid peptide hormone found in the colon that has been found to suppress appetite and facilitate weight loss (Wynne K, et al., Int J Obes (Lond) 30(12): 1729-36(2006)).
  • the sequence of oxyntomodulin, as well as peptide analogs and peptide derivatives thereof, are known in the art (e.g., Bataille D, et al., Peptides 2(Suppl 2):4l-44 (1981); and U.S. Patent Publication Nos. 2005/0070469 and
  • GIP Gastric Inhibitory Peptide
  • GIP circulates as a biologically active 42-amino acid peptide. GIP is also known as glucose-dependent insulinotropic protein. GIP is a 42-amino acid gastrointestinal regulatory peptide that stimulates insulin secretion from pancreatic beta cells in the presence of glucose (Tseng, C., et al, PNAS 90: 1992-1996 (1993)).
  • GIP glycosylcholine
  • peptide analogs and peptide derivatives thereof are known in the art (e.g., Meier J. J., Diabetes Metab Res Rev. 2l(2):9l-l 17 (2005) and Efendic S., Horm Metab Res. 36(11- 12):742-6 (2004)).
  • Glucagon is a peptide hormone, produced by alpha cells of the pancreas, which raises the concentration of glucose in the bloodstream. Its effect is opposite that of insulin, which lowers the glucose concentration.
  • the pancreas releases glucagon when the concentration of glucose in the bloodstream falls too low.
  • Glucagon causes the liver to convert stored glycogen into glucose, which is released into the bloodstream. High blood glucose levels stimulate the release of insulin. Insulin allows glucose to be taken up and used by insulin- dependent tissues. Thus, glucagon and insulin are part of a feedback system that keeps blood glucose levels at a stable level.
  • compositions are provided.
  • the invention provides a composition
  • a composition comprising a compound, i.e., isolated polypeptide, of this invention or a pharmaceutically acceptable derivative thereof and a pharmaceutically acceptable carrier, adjuvant, or vehicle.
  • the amount of compound in compositions of this invention is such that is effective to measurably activate one or more amylin and/or calcitonin receptors, in a biological sample or in a patient.
  • the amount of compound in compositions of this invention is such that is effective to measurably activate human amylin 3 receptor (hAMY3) and/or human calcitonin receptor (hCTR), in the absence or presence of human serum albumin, in a biological sample or in a patient.
  • a composition of this invention is formulated for administration to a patient in need of such composition.
  • a composition of this invention is formulated for injectable administration to a patient. In some embodiments, a composition of this invention is formulated for
  • an implantable delivery device such as an osmotic deliver device.
  • patient or“subject” as used herein, refer to an animal, preferably a mammal, and most preferably a human.
  • A“pharmaceutically acceptable derivative” means any non-toxic salt, ester, salt of an ester or other derivative of a compound of this invention that, upon administration to a recipient, is capable of providing, either directly or indirectly, a compound of this invention or an inhibitorily active metabolite or residue thereof.
  • compositions suitable for administration can be incorporated into pharmaceutical compositions suitable for administration.
  • Such compositions typically comprise the isolated polypeptide, or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable carrier.
  • pharmaceutically acceptable carrier is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration. Suitable carriers are described in the most recent edition of Remington’s Pharmaceutical Sciences, a standard reference text in the field, which is incorporated herein by reference.
  • Such carriers or diluents include, but are not limited to, water, saline, ringer’s solutions, dextrose solution, and 5% human serum albumin. Liposomes and non-aqueous vehicles such as fixed oils may also be used.
  • the use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the compositions is contemplated. Supplementary active compounds can also be incorporated into the compositions.
  • a pharmaceutical composition of the invention is formulated to be compatible with its intended route of administration.
  • routes of administration include parenteral, e.g., intravenous, intradermal, subdermal, subcutaneous, oral (e.g., inhalation), transdermal (i.e., topical), transmucosal, rectal, or combinations thereof.
  • a pharmaceutical composition or an isolated polypeptide of the disclosure is formulated for administration by topical administration.
  • a pharmaceutical composition or an isolated polypeptide of the disclosure is formulated for administration by inhalation administration.
  • the pharmaceutical composition is formulated for administration by a device or other suitable delivery mechanism that is suitable for subdermal or subcutaneous implantation and delivers the pharmaceutical composition subcutaneously.
  • the pharmaceutical composition is formulated for administration by an implant device that is suitable for subdermal or subcutaneous implantation and delivers the pharmaceutical composition subcutaneously.
  • the pharmaceutical composition is formulated for administration by an osmotic delivery device, e.g., an implantable osmotic delivery device, that is suitable for subdermal or subcutaneous placement or other implantation and delivers the pharmaceutical composition subcutaneously.
  • Solutions or suspensions used for parenteral application, intradermal application, subdermal application, subcutaneous application, or combinations thereof can include the following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid (EDTA); buffers such as acetates, citrates or phosphates, and agents for the adjustment of tonicity such as sodium chloride or dextrose.
  • the pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide.
  • the parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic.
  • compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
  • suitable carriers include physiological saline, bacteriostatic water, Cremophor EL (BASF, Parsippany, N.J.) or phosphate buffered saline (PBS).
  • the composition must be sterile and should be fluid to the extent that easy syringeability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms such as bacteria and fungi.
  • the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof.
  • the proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
  • Prevention of the action of microorganisms can be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like.
  • isotonic agents for example, sugars, polyalcohols such as manitol, sorbitol, sodium chloride in the composition.
  • Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent which delays absorption, for example, aluminum monostearate and gelatin.
  • Sterile injectable solutions can be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization.
  • dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above.
  • methods of preparation are vacuum drying and freeze-drying that yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
  • Oral compositions generally include an inert diluent or an edible carrier. They can be enclosed in gelatin capsules or compressed into tablets. For the purpose of oral therapeutic administration, the active compound can be incorporated with excipients and used in the form of tablets, troches, or capsules. Oral compositions can also be prepared using a fluid carrier for use as a mouthwash, wherein the compound in the fluid carrier is applied orally and swished and expectorated or swallowed. Pharmaceutically compatible binding agents, and/or adjuvant materials can be included as part of the composition.
  • the tablets, pills, capsules, troches and the like can contain any of the following ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or com starch; a lubricant such as magnesium stearate or Sterotes; a glidant such as colloidal silicon dioxide; a sweetening agent such as sucrose or saccharin; or a flavoring agent such as peppermint, methyl salicylate, or orange flavoring.
  • a binder such as microcrystalline cellulose, gum tragacanth or gelatin
  • an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or com starch
  • a lubricant such as magnesium stearate or Sterotes
  • a glidant such as colloidal silicon dioxide
  • the compounds are delivered in the form of an aerosol spray from pressured container or dispenser which contains a suitable propellant, e.g., a gas such as carbon dioxide, or a nebulizer.
  • a suitable propellant e.g., a gas such as carbon dioxide, or a nebulizer.
  • Systemic administration can also be by transmucosal or transdermal means.
  • penetrants appropriate to the barrier to be permeated are used in the formulation.
  • penetrants are generally known in the art, and include, for example, for transmucosal administration, detergents, bile salts, and fusidic acid derivatives.
  • Transmucosal administration can be accomplished through the use of nasal sprays or suppositories.
  • the active compounds are formulated into ointments, salves, gels, or creams as generally known in the art.
  • the active compounds are prepared with carriers that will protect the compound against rapid elimination from the body, such as a controlled release formulation, including implants and microencapsulated delivery systems.
  • a controlled release formulation including implants and microencapsulated delivery systems.
  • Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, poly anhydrides, polygly colic acid, collagen, poly orthoesters, and polylactic acid. Methods for preparation of such formulations will be apparent to those skilled in the art.
  • the materials can also be obtained commercially from Alza Corporation and Nova Pharmaceuticals, Inc.
  • Liposomal suspensions can also be used as pharmaceutically acceptable carriers. These can be prepared according to methods known to those skilled in the art, for example, as described in U.S. Patent No. 4,522,811.
  • Dosage unit form refers to physically discrete units suited as unitary dosages for the subject to be treated; each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
  • the specification for the dosage unit forms of the invention are dictated by and directly dependent on the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and the limitations inherent in the art of compounding such an active compound for the treatment of individuals.
  • compositions can be included in a container, pack, or dispenser together with instructions for administration.
  • provided is a pharmaceutical composition comprising any of the disclosed polypeptides formulated as a trifluoroacetate salt, acetate salt or hydrochloride salt. In some embodiments, provided is a pharmaceutical composition comprising any of the disclosed polypeptides formulated as a trifluoroacetate salt. In some embodiments, provided is a pharmaceutical composition comprising any of the disclosed polypeptides formulated as an acetate salt. In some embodiments, provided is a pharmaceutical composition comprising any of the disclosed polypeptides formulated as a hydrochloride salt.
  • compositions i.e., isolated polypeptides or pharmaceutically acceptable salts thereof, for use in the practice of the present invention are typically added to particle formulations, which are used to make polypeptide-containing particles that are uniformly suspended, dissolved or dispersed in a suspension vehicle to form a suspension formulation.
  • the amylin analog polypeptide is formulated in a particle formulation and converted (e.g., spray dried) to particles.
  • the particles comprising the amylin analog polypeptide are suspended in a vehicle formulation, resulting in a suspension formulation of vehicle and suspended particles comprising the amylin analog polypeptide.
  • particle formulations are formable into particles using processes such as spray drying, lyophilization, desiccation, freeze-drying, milling, granulation, ultrasonic drop creation, crystallization, precipitation, or other techniques available in the art for forming particles from a mixture of components.
  • the particles are spray dried.
  • the particles are preferably substantially uniform in shape and size.
  • the present invention provides drug particle formulations for pharmaceutical use.
  • the particle formulation typically comprises a drug and includes one or more stabilizing component (also referred to herein as“excipients”).
  • stabilizing components include, but are not limited to, carbohydrates, antioxidants, amino acids, buffers, inorganic compounds, and surfactants.
  • the amounts of stabilizers in the particle formulation can be determined experimentally based on the activities of the stabilizers and the desired characteristics of the formulation, in view of the teachings of the present specification.
  • the particle formulation may comprise about 50 wt % to about 90 wt % drug, about 50 wt % to about 85 wt % drug, about 55 wt % to about 90 wt % drug, about 60 wt % to about 90 wt % drug, about 65 wt % to about 85 wt % drug, about 65 wt % to about 90 wt % drug, about 70 wt % to about 90 wt % drug, about 70 wt % to about 85 wt % drug, about 70 wt % to about 80 wt % drug, or about 70 wt % to about 75 wt % drug.
  • the amount of carbohydrate in the particle formulation is determined by aggregation concerns. In general, the carbohydrate amount should not be too high so as to avoid promoting crystal growth in the presence of water due to excess carbohydrate unbound to drug.
  • the amount of antioxidant in the particle formulation is determined by oxidation concerns, while the amount of amino acid in the formulation is determined by oxidation concerns and/or formability of particles during spray drying.
  • the amount of buffer in the particle formulation is determined by pre processing concerns, stability concerns, and formability of particles during spray drying.
  • Buffer may be required to stabilize drug during processing, e.g., solution preparation and spray drying, when all stabilizers are solubilized.
  • carbohydrates examples include, but are not limited to, monosaccharides (e.g., fructose, maltose, galactose, glucose, D- mannose, and sorbose), disaccharides (e.g., lactose, sucrose, trehalose, and cellobiose), polysaccharides (e.g., raffmose, melezitose, maltodextrins, dextrans, and starches), and alditols (acyclic polyols; e.g., mannitol, xylitol, maltitol, lactitol, xylitol sorbitol, pyranosyl sorbitol, and myoinsitol).
  • Suitable carbohydrates include disaccharides and/or non-reducing sugars, such as sucrose, trehalose, and raffmose.
  • antioxidants examples include, but are not limited to, methionine, ascorbic acid, sodium thiosulfate, catalase, platinum, ethylenediaminetetraacetic acid (EDTA), citric acid, cysteine, thioglycerol, thiogly colic acid, thiosorbitol, butylated hydroxanisol, butylated hydroxyltoluene, and propyl gallate.
  • amino acids that readily oxidize can be used as antioxidants, for example, cysteine, methionine, and tryptophan.
  • amino acids examples include, but are not limited to, arginine, methionine, glycine, histidine, alanine, leucine, glutamic acid, iso-leucine, L-threonine, 2-phenylamine, valine, norvaline, proline, phenylalanine, tryptophan, serine, asparagines, cysteine, tyrosine, lysine, and norleucine.
  • Suitable amino acids include those that readily oxidize, e.g., cysteine, methionine, and tryptophan.
  • buffers examples include, but are not limited to, citrate, histidine, succinate, phosphate, maleate, tris, acetate, carbohydrate, and gly-gly. Suitable buffers include citrate, histidine, succinate, and tris.
  • inorganic compounds that may be included in the particle formulation include, but are not limited to, NaCl, Na2S04, NaHC03, KC1, KH2P04, CaCl2, and MgCl2.
  • the particle formulation may include other stabilizers/excipients, such as surfactants and salts.
  • surfactants include, but are not limited to, Polysorbate 20, Polysorbate 80, PLURONIC® (BASF Corporation, Mount Olive, N.J.) F68, and sodium dodecyl sulfate (SDS).
  • salts include, but are not limited to, sodium chloride, calcium chloride, and magnesium chloride.
  • the particles are typically sized such that they can be delivered via an implantable osmotic delivery device. Uniform shape and size of the particles typically helps to provide a consistent and uniform rate of release from such a delivery device; however, a particle preparation having a non-normal particle size distribution profile may also be used.
  • the size of the particles is less than about 30%, more preferably is less than about 20%, more preferably is less than about than 10%, of the diameter of the delivery orifice.
  • particle sizes may be, for example, less than about 150 microns to about 50 microns. In an embodiment of the particle formulation for use with an osmotic delivery system, wherein the delivery orifice diameter of the implant is about 0.1 mm, particle sizes may be, for example, less than about 30 microns to about 10 microns. In one embodiment, the orifice is about 0.25 mm (250 microns) and the particle size is about 2 microns to about 5 microns.
  • Particles of a particle formulation have diameters of between about 2 microns to about 150 micron, e.g., less than 150 microns in diameter, less than 100 microns in diameter, less than 50 microns in diameter, less than 30 microns in diameter, less than 10 microns in diameter, less than 5 microns in diameter, and about 2 microns in diameter.
  • particles Preferably, particles have diameters of between about 2 microns and about 50 microns.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Diabetes (AREA)
  • Organic Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Endocrinology (AREA)
  • Epidemiology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Hematology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Obesity (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biochemistry (AREA)
  • Toxicology (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Child & Adolescent Psychology (AREA)
  • Emergency Medicine (AREA)
  • Immunology (AREA)
  • Dermatology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)
PCT/US2019/055696 2018-10-11 2019-10-10 Human amylin analog polypeptides and methods of use Ceased WO2020077129A1 (en)

Priority Applications (14)

Application Number Priority Date Filing Date Title
BR112021006823-6A BR112021006823A2 (pt) 2018-10-11 2019-10-10 polipeptídeos análogos de amilina humana e métodos de uso
IL320142A IL320142A (en) 2018-10-11 2019-10-10 Human amylin analog polypeptides and methods of use
CN202510801062.0A CN120647747A (zh) 2018-10-11 2019-10-10 人类胰淀素类似物多肽和使用方法
CA3116023A CA3116023C (en) 2018-10-11 2019-10-10 Human amylin analog polypeptides and methods of use
EP19795724.4A EP3864031A1 (en) 2018-10-11 2019-10-10 Human amylin analog polypeptides and methods of use
CN201980081630.7A CN113195524A (zh) 2018-10-11 2019-10-10 人类胰淀素类似物多肽和使用方法
IL282079A IL282079B2 (en) 2018-10-11 2019-10-10 Human amylin analog polypeptides and methods of use
MX2021004185A MX2021004185A (es) 2018-10-11 2019-10-10 Polipeptidos analogos de la amilina humana y sus metodos de uso.
KR1020217013697A KR102911883B1 (ko) 2018-10-11 2019-10-10 인간 아밀린 유사체 폴리펩타이드 및 사용 방법
JP2021519698A JP7636321B2 (ja) 2018-10-11 2019-10-10 ヒトアミリンアナログペプチド及び使用方法
SG11202103586UA SG11202103586UA (en) 2018-10-11 2019-10-10 Human amylin analog polypeptides and methods of use
AU2019357621A AU2019357621B2 (en) 2018-10-11 2019-10-10 Human amylin analog polypeptides and methods of use
JP2024155106A JP2025000663A (ja) 2018-10-11 2024-09-09 ヒトアミリンアナログペプチド及び使用方法
AU2025204716A AU2025204716A1 (en) 2018-10-11 2025-06-23 Human amylin analog polypeptides and methods of use

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201862744236P 2018-10-11 2018-10-11
US62/744,236 2018-10-11

Publications (1)

Publication Number Publication Date
WO2020077129A1 true WO2020077129A1 (en) 2020-04-16

Family

ID=68393080

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2019/055696 Ceased WO2020077129A1 (en) 2018-10-11 2019-10-10 Human amylin analog polypeptides and methods of use

Country Status (13)

Country Link
US (2) US12018059B2 (enExample)
EP (1) EP3864031A1 (enExample)
JP (2) JP7636321B2 (enExample)
KR (1) KR102911883B1 (enExample)
CN (2) CN113195524A (enExample)
AR (1) AR116632A1 (enExample)
AU (2) AU2019357621B2 (enExample)
BR (1) BR112021006823A2 (enExample)
IL (2) IL282079B2 (enExample)
MX (1) MX2021004185A (enExample)
SG (1) SG11202103586UA (enExample)
TW (1) TW202028228A (enExample)
WO (1) WO2020077129A1 (enExample)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN113880935A (zh) * 2021-10-25 2022-01-04 杭州信海医药科技有限公司 一种索马鲁肽全保护肽树脂的制备方法、一种索马鲁肽制备方法
CN116018156A (zh) * 2020-04-20 2023-04-25 I2O治疗公司 使用人类胰淀素类似物多肽对1型糖尿病患者提供卓越的血糖控制
JP2023544959A (ja) * 2020-09-24 2023-10-26 グブラ エー/エス 改善されたアミリン受容体(hAMY3R)効力を有するhAM15-52類似体

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN115968376A (zh) * 2020-04-17 2023-04-14 I2O治疗公司 长效胰高血糖素受体选择性肽和使用方法
CR20230311A (es) * 2020-12-16 2023-09-01 Medimmune Ltd Polipéptidos y usos de los mismos
TWI815327B (zh) 2021-03-03 2023-09-11 美商美國禮來大藥廠 長效澱粉素受體促效劑及其用途

Citations (57)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4522811A (en) 1982-07-08 1985-06-11 Syntex (U.S.A.) Inc. Serial injection of muramyldipeptides and liposomes enhances the anti-infective activity of muramyldipeptides
US5118666A (en) 1986-05-05 1992-06-02 The General Hospital Corporation Insulinotropic hormone
US5120712A (en) 1986-05-05 1992-06-09 The General Hospital Corporation Insulinotropic hormone
US5512549A (en) 1994-10-18 1996-04-30 Eli Lilly And Company Glucagon-like insulinotropic peptide analogs, compositions, and methods of use
US5545618A (en) 1990-01-24 1996-08-13 Buckley; Douglas I. GLP-1 analogs useful for diabetes treatment
US5552520A (en) 1993-08-09 1996-09-03 Biomeasure, Inc. Therapeutic peptide derivatives
US5574010A (en) 1994-11-14 1996-11-12 The Regents Of The University Of California Treatment of pancreatic tumors with peptide YY and analogs thereof
US5574008A (en) 1994-08-30 1996-11-12 Eli Lilly And Company Biologically active fragments of glucagon-like insulinotropic peptide
US5609885A (en) 1992-09-15 1997-03-11 Alza Corporation Osmotic membrane and delivery device
US5614492A (en) 1986-05-05 1997-03-25 The General Hospital Corporation Insulinotropic hormone GLP-1 (7-36) and uses thereof
US5728396A (en) 1996-02-02 1998-03-17 Alza Corporation Sustained delivery of leuprolide using an implantable system
US5997527A (en) 1997-03-24 1999-12-07 Alza Corporation Self adjustable exit port
US6113938A (en) 1997-12-30 2000-09-05 Alza Corporation Beneficial agent delivery system with membrane plug and method for controlling delivery of beneficial agents
US6132420A (en) 1996-02-02 2000-10-17 Alza Corporation Osmotic delivery system and method for enhancing start-up and performance of osmotic delivery systems
US6156331A (en) 1996-02-02 2000-12-05 Alza Corporation Sustained delivery of an active agent using an implantable system
US6191102B1 (en) 1996-11-05 2001-02-20 Eli Lilly And Company Use of GLP-1 analogs and derivatives administered peripherally in regulation of obesity
US6261584B1 (en) 1996-02-02 2001-07-17 Alza Corporation Sustained delivery of an active agent using an implantable system
US6268343B1 (en) 1996-08-30 2001-07-31 Novo Nordisk A/S Derivatives of GLP-1 analogs
US6270787B1 (en) 1997-12-29 2001-08-07 Alza Corporation Osmotic delivery system with membrane plug retention mechanism
US6287295B1 (en) 1997-07-25 2001-09-11 Alza Corporation Osmotic delivery system, osmotic delivery system semimpermeable body assembly, and method for controlling delivery rate of beneficial agents from osmotic delivery systems
US6329336B1 (en) 1999-05-17 2001-12-11 Conjuchem, Inc. Long lasting insulinotropic peptides
US6375978B1 (en) 1997-12-22 2002-04-23 Alza Corporation Rate controlling membranes for controlled drug delivery devices
US6395292B2 (en) 1996-02-02 2002-05-28 Alza Corporation Sustained delivery of an active agent using an implantable system
US6451974B1 (en) 1999-03-17 2002-09-17 Novo Nordisk A/S Method of acylating peptides and novel acylating agents
US6458924B2 (en) 1996-08-30 2002-10-01 Novo Nordisk A/S Derivatives of GLP-1 analogs
US6508808B1 (en) 1999-12-21 2003-01-21 Alza Corporation Valve for osmotic devices
US6514500B1 (en) 1999-10-15 2003-02-04 Conjuchem, Inc. Long lasting synthetic glucagon like peptide {GLP-!}
US6544252B1 (en) 1998-12-31 2003-04-08 Alza Corporation Osmotic delivery system having space efficient piston
US6703359B1 (en) 1998-02-13 2004-03-09 Amylin Pharmaceuticals, Inc. Inotropic and diuretic effects of exendin and GLP-1
US6706689B2 (en) 2000-05-19 2004-03-16 Amylin Pharmaceuticals, Inc. Treatment of acute coronary syndrome with GLP-1
US6720407B1 (en) 1998-08-28 2004-04-13 Eli Lilly And Company Method for administering insulinotropic peptides
US6849714B1 (en) 1999-05-17 2005-02-01 Conjuchem, Inc. Protection of endogenous therapeutic peptides from peptidase activity through conjugation to blood components
US6849708B1 (en) 1986-05-05 2005-02-01 The General Hospital Corporation Insulinotropic hormone and uses thereof
US20050070469A1 (en) 2001-09-07 2005-03-31 Bloom Stephen Robert Oxyntomodulin for preventing or treating excess weight
US6887470B1 (en) 1999-09-10 2005-05-03 Conjuchem, Inc. Protection of endogenous therapeutic peptides from peptidase activity through conjugation to blood components
US6903186B1 (en) 1998-12-07 2005-06-07 Societe De Conseils De Recherches Et D'applications Scientifiques, S.A.S Analogues of GLP-1
US20050175701A1 (en) 2004-02-10 2005-08-11 Alza Corporation Capillary moderator for osmotic delivery system
US6939556B2 (en) 2002-06-26 2005-09-06 Alza Corporation Minimally compliant, volume efficient piston for osmotic drug delivery systems
US7014636B2 (en) 2002-11-21 2006-03-21 Alza Corporation Osmotic delivery device having a two-way valve and a dynamically self-adjusting flow channel
US7022674B2 (en) 1999-12-16 2006-04-04 Eli Lilly And Company Polypeptide compositions with improved stability
US20060094652A1 (en) 2004-02-11 2006-05-04 Levy Odile E Hybrid polypeptides with selectable properties
US7041646B2 (en) 2001-10-05 2006-05-09 Bayer Pharmaceuticals Corporation Methods of treating type 2 diabetes with peptides acting as both GLP-1 receptor agonists and glucagon receptor antagonists
US7084243B2 (en) 2000-06-16 2006-08-01 Eli Lilly And Company Glucagon-like peptide-1 analogs
US7101843B2 (en) 2001-08-23 2006-09-05 Eli Lilly And Company Glucagon-like peptide-1 analogs
US7138486B2 (en) 1986-05-05 2006-11-21 The General Hospital Corporation Insulinotropic hormone derivatives and uses thereof
US7141547B2 (en) 2001-12-21 2006-11-28 Human Genome Sciences, Inc. Albumin fusion proteins comprising GLP-1 polypeptides
US7144863B2 (en) 2001-06-01 2006-12-05 Eli Lilly And Company GLP-1 formulations with protracted time action
US7163688B2 (en) 2001-06-22 2007-01-16 Alza Corporation Osmotic implant with membrane and membrane retention means
US20070027105A1 (en) 2005-07-26 2007-02-01 Alza Corporation Peroxide removal from drug delivery vehicle
US7199217B2 (en) 2000-12-13 2007-04-03 Eli Lilly And Company Amidated glucagon-like peptide-1
US7207982B2 (en) 2003-03-31 2007-04-24 Alza Corporation Osmotic pump with means for dissipating internal pressure
US7235627B2 (en) 1996-08-30 2007-06-26 Novo Nordisk A/S Derivatives of GLP-1 analogs
US20070281024A1 (en) 2005-02-03 2007-12-06 Alza Corporation Two-Piece, Internal-Channel Osmotic Delivery System Flow Modulator
US20080091176A1 (en) 2006-08-09 2008-04-17 Alessi Thomas R Osmotic delivery systems and piston assemblies for use therein
US20090202608A1 (en) 2008-02-13 2009-08-13 Alessi Thomas R Devices, formulations, and methods for delivery of multiple beneficial agents
WO2010046357A1 (en) * 2008-10-21 2010-04-29 Novo Nordisk A/S Amylin derivatives
WO2012162547A2 (en) * 2011-05-25 2012-11-29 Amylin Pharmaceuticals, Inc. Long duration dual hormone conjugates

Family Cites Families (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5321008A (en) 1991-01-10 1994-06-14 Amylin Pharmaceuticals, Inc. Methods and compositions for treatment of diabetes mellitus, hypoglycemia, and other conditions
US5739106A (en) * 1995-06-07 1998-04-14 Rink; Timothy J. Appetite regulating compositions
WO2004037168A2 (en) 2002-10-18 2004-05-06 Amylin Pharmaceuticals, Inc. Treatment of pancreatitis with amylin
JP5252435B2 (ja) * 2006-03-15 2013-07-31 ノボ・ノルデイスク・エー/エス アミリン誘導体
ES2622877T3 (es) 2009-01-22 2017-07-07 Keybioscience Ag Tratamiento para la obesidad
CA2755068C (en) 2009-03-12 2018-11-06 Keybioscience Ag Treatment of diabetes and metabolic syndrome
CN102947335B (zh) 2010-04-15 2018-11-06 基因泰克公司 抗多聚遍在蛋白抗体及使用方法
JP6121992B2 (ja) 2011-06-10 2017-04-26 ノヴォ ノルディスク アー/エス ポリペプチド
ES2640285T3 (es) 2012-04-19 2017-11-02 Novo Nordisk A/S Análogos de amilina humana
ES2741507T3 (es) 2014-04-07 2020-02-11 Novo Nordisk As Compuestos de glp-1 acilados doblemente
WO2016034604A1 (en) 2014-09-04 2016-03-10 Novo Nordisk A/S Novel amylin and calcitonin receptor agonist
BR112017019378A2 (pt) 2015-03-18 2019-02-19 Zealand Pharma A/S análogos de amilina
US10071140B2 (en) 2016-09-09 2018-09-11 Zealand Pharma A/S Amylin analogues

Patent Citations (69)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4522811A (en) 1982-07-08 1985-06-11 Syntex (U.S.A.) Inc. Serial injection of muramyldipeptides and liposomes enhances the anti-infective activity of muramyldipeptides
US5958909A (en) 1986-05-05 1999-09-28 The General Hospital Corporation Insulinotropic hormones and uses thereof
US5120712A (en) 1986-05-05 1992-06-09 The General Hospital Corporation Insulinotropic hormone
US5614492A (en) 1986-05-05 1997-03-25 The General Hospital Corporation Insulinotropic hormone GLP-1 (7-36) and uses thereof
US6849708B1 (en) 1986-05-05 2005-02-01 The General Hospital Corporation Insulinotropic hormone and uses thereof
US7138486B2 (en) 1986-05-05 2006-11-21 The General Hospital Corporation Insulinotropic hormone derivatives and uses thereof
US5118666A (en) 1986-05-05 1992-06-02 The General Hospital Corporation Insulinotropic hormone
US5545618A (en) 1990-01-24 1996-08-13 Buckley; Douglas I. GLP-1 analogs useful for diabetes treatment
US5609885A (en) 1992-09-15 1997-03-11 Alza Corporation Osmotic membrane and delivery device
US5552520A (en) 1993-08-09 1996-09-03 Biomeasure, Inc. Therapeutic peptide derivatives
US5574008A (en) 1994-08-30 1996-11-12 Eli Lilly And Company Biologically active fragments of glucagon-like insulinotropic peptide
US5512549A (en) 1994-10-18 1996-04-30 Eli Lilly And Company Glucagon-like insulinotropic peptide analogs, compositions, and methods of use
US5574010A (en) 1994-11-14 1996-11-12 The Regents Of The University Of California Treatment of pancreatic tumors with peptide YY and analogs thereof
US6156331A (en) 1996-02-02 2000-12-05 Alza Corporation Sustained delivery of an active agent using an implantable system
US5728396A (en) 1996-02-02 1998-03-17 Alza Corporation Sustained delivery of leuprolide using an implantable system
US6132420A (en) 1996-02-02 2000-10-17 Alza Corporation Osmotic delivery system and method for enhancing start-up and performance of osmotic delivery systems
US5985305A (en) 1996-02-02 1999-11-16 Alza Corporation Sustained delivery of an active agent using an implantable system
US6635268B2 (en) 1996-02-02 2003-10-21 Alza Corporation Sustained delivery of an active agent using an implantable system
US6395292B2 (en) 1996-02-02 2002-05-28 Alza Corporation Sustained delivery of an active agent using an implantable system
US6261584B1 (en) 1996-02-02 2001-07-17 Alza Corporation Sustained delivery of an active agent using an implantable system
US6268343B1 (en) 1996-08-30 2001-07-31 Novo Nordisk A/S Derivatives of GLP-1 analogs
US6458924B2 (en) 1996-08-30 2002-10-01 Novo Nordisk A/S Derivatives of GLP-1 analogs
US7235627B2 (en) 1996-08-30 2007-06-26 Novo Nordisk A/S Derivatives of GLP-1 analogs
US6191102B1 (en) 1996-11-05 2001-02-20 Eli Lilly And Company Use of GLP-1 analogs and derivatives administered peripherally in regulation of obesity
US5997527A (en) 1997-03-24 1999-12-07 Alza Corporation Self adjustable exit port
US6217906B1 (en) 1997-03-24 2001-04-17 Alza Corporation Self adjustable exit port
US6287295B1 (en) 1997-07-25 2001-09-11 Alza Corporation Osmotic delivery system, osmotic delivery system semimpermeable body assembly, and method for controlling delivery rate of beneficial agents from osmotic delivery systems
US6923800B2 (en) 1997-07-25 2005-08-02 Alza Corporation Osmotic delivery system, osmotic delivery system semipermeable body assembly, and method for controlling delivery rate of beneficial agents from osmotic delivery systems
US6375978B1 (en) 1997-12-22 2002-04-23 Alza Corporation Rate controlling membranes for controlled drug delivery devices
US6976981B2 (en) 1997-12-29 2005-12-20 Alza Corporation Osmotic delivery system with membrane plug retention mechanism
US6270787B1 (en) 1997-12-29 2001-08-07 Alza Corporation Osmotic delivery system with membrane plug retention mechanism
US6113938A (en) 1997-12-30 2000-09-05 Alza Corporation Beneficial agent delivery system with membrane plug and method for controlling delivery of beneficial agents
US6703359B1 (en) 1998-02-13 2004-03-09 Amylin Pharmaceuticals, Inc. Inotropic and diuretic effects of exendin and GLP-1
US6720407B1 (en) 1998-08-28 2004-04-13 Eli Lilly And Company Method for administering insulinotropic peptides
US6903186B1 (en) 1998-12-07 2005-06-07 Societe De Conseils De Recherches Et D'applications Scientifiques, S.A.S Analogues of GLP-1
US6544252B1 (en) 1998-12-31 2003-04-08 Alza Corporation Osmotic delivery system having space efficient piston
US6997922B2 (en) 1998-12-31 2006-02-14 Alza Corporation Osmotic delivery system having space efficient piston
US6451974B1 (en) 1999-03-17 2002-09-17 Novo Nordisk A/S Method of acylating peptides and novel acylating agents
US6593295B2 (en) 1999-05-17 2003-07-15 Conjuchem, Inc. Long lasting insulinotropic peptides
US6849714B1 (en) 1999-05-17 2005-02-01 Conjuchem, Inc. Protection of endogenous therapeutic peptides from peptidase activity through conjugation to blood components
US6329336B1 (en) 1999-05-17 2001-12-11 Conjuchem, Inc. Long lasting insulinotropic peptides
US6887470B1 (en) 1999-09-10 2005-05-03 Conjuchem, Inc. Protection of endogenous therapeutic peptides from peptidase activity through conjugation to blood components
US6821949B2 (en) 1999-10-15 2004-11-23 Conjuchem, Inc. Long lasting synthetic glucagon-like peptide (GLP-1)
US6514500B1 (en) 1999-10-15 2003-02-04 Conjuchem, Inc. Long lasting synthetic glucagon like peptide {GLP-!}
US6887849B2 (en) 1999-10-15 2005-05-03 Conjuchem, Inc. Long lasting synthetic glucagon-like peptide {GLP-1}
US7022674B2 (en) 1999-12-16 2006-04-04 Eli Lilly And Company Polypeptide compositions with improved stability
US6682522B2 (en) 1999-12-21 2004-01-27 Alza Corporation Valve for osmotic devices
US6508808B1 (en) 1999-12-21 2003-01-21 Alza Corporation Valve for osmotic devices
US6706689B2 (en) 2000-05-19 2004-03-16 Amylin Pharmaceuticals, Inc. Treatment of acute coronary syndrome with GLP-1
US7084243B2 (en) 2000-06-16 2006-08-01 Eli Lilly And Company Glucagon-like peptide-1 analogs
US7199217B2 (en) 2000-12-13 2007-04-03 Eli Lilly And Company Amidated glucagon-like peptide-1
US7144863B2 (en) 2001-06-01 2006-12-05 Eli Lilly And Company GLP-1 formulations with protracted time action
US7163688B2 (en) 2001-06-22 2007-01-16 Alza Corporation Osmotic implant with membrane and membrane retention means
US7101843B2 (en) 2001-08-23 2006-09-05 Eli Lilly And Company Glucagon-like peptide-1 analogs
US20050070469A1 (en) 2001-09-07 2005-03-31 Bloom Stephen Robert Oxyntomodulin for preventing or treating excess weight
US7041646B2 (en) 2001-10-05 2006-05-09 Bayer Pharmaceuticals Corporation Methods of treating type 2 diabetes with peptides acting as both GLP-1 receptor agonists and glucagon receptor antagonists
US7141547B2 (en) 2001-12-21 2006-11-28 Human Genome Sciences, Inc. Albumin fusion proteins comprising GLP-1 polypeptides
US6939556B2 (en) 2002-06-26 2005-09-06 Alza Corporation Minimally compliant, volume efficient piston for osmotic drug delivery systems
US7112335B2 (en) 2002-06-26 2006-09-26 Alza Corporation Minimally compliant, volume-efficient piston for osmotic drug delivery systems
US7014636B2 (en) 2002-11-21 2006-03-21 Alza Corporation Osmotic delivery device having a two-way valve and a dynamically self-adjusting flow channel
US7207982B2 (en) 2003-03-31 2007-04-24 Alza Corporation Osmotic pump with means for dissipating internal pressure
US20050175701A1 (en) 2004-02-10 2005-08-11 Alza Corporation Capillary moderator for osmotic delivery system
US20060094652A1 (en) 2004-02-11 2006-05-04 Levy Odile E Hybrid polypeptides with selectable properties
US20070281024A1 (en) 2005-02-03 2007-12-06 Alza Corporation Two-Piece, Internal-Channel Osmotic Delivery System Flow Modulator
US20070027105A1 (en) 2005-07-26 2007-02-01 Alza Corporation Peroxide removal from drug delivery vehicle
US20080091176A1 (en) 2006-08-09 2008-04-17 Alessi Thomas R Osmotic delivery systems and piston assemblies for use therein
US20090202608A1 (en) 2008-02-13 2009-08-13 Alessi Thomas R Devices, formulations, and methods for delivery of multiple beneficial agents
WO2010046357A1 (en) * 2008-10-21 2010-04-29 Novo Nordisk A/S Amylin derivatives
WO2012162547A2 (en) * 2011-05-25 2012-11-29 Amylin Pharmaceuticals, Inc. Long duration dual hormone conjugates

Non-Patent Citations (24)

* Cited by examiner, † Cited by third party
Title
BAGGIO: "Biology of incretins: GLP-1 and GIP", GASTROENTEROLOGY, vol. 132, no. 6, 2007, pages 2131 - 57, XP022072503, DOI: 10.1053/j.gastro.2007.03.054
BATAILLE D ET AL., PEPTIDES, vol. 2, no. 2, 1981, pages 41 - 44
CONSIDINE, D. M.CONSIDINE, G. D.: "Encyclopedia of Chemistry", 1984, REINHOLD
COX, H. M. ET AL., BR J PHARMACOL, vol. 101, no. 2, 1990, pages 247 - 52
DATABASE Geneseq [online] 17 January 2013 (2013-01-17), "Human pegylated amylin agonist peptide (pramlintide) analog, SEQ ID 115.", XP002796348, retrieved from EBI accession no. GSP:BAH70267 Database accession no. BAH70267 *
DATABASE Geneseq [online] 22 June 2010 (2010-06-22), "Human amylin derivative peptide fragment, SEQ ID 22.", XP002796347, retrieved from EBI accession no. GSP:AXZ81076 Database accession no. AXZ81076 *
EBERLEIN, G. A. ET AL., PEPTIDES, vol. 10, no. 4, 1989, pages 797 - 803
EFENDIC, S. ET AL., HORM METAB RES., vol. 36, no. 11-12, 2004, pages 742 - 6
HOIST: "Incretin hormones and the satiation signal", INT J OBES (LOND, vol. 37, no. 9, 2013, pages 1161 - 69
HOIST: "The incretin system and its role in type 2 diabetes mellitus", MOL CELL ENDOCRINOLOGY, vol. 297, no. 1-2, 2008, pages 127 - 36
HOLST, MOL. CELL ENDOCRINOLOGY, 2008
KJEMS: "The influence of GLP-1 on glucose-stimulated insulin secretion: effects on beta-cell sensitivity in type 2 and nondiabetic subjects", DIABETES, vol. 52, no. 2, 2003, pages 380 - 86, XP055277761, DOI: 10.2337/diabetes.52.2.380
KOLTERMAN O. G. ET AL., J. CLIN. ENDOCRINOL. METAB., vol. 88, no. 7, 2003, pages 3082 - 9
LABURTHE, M., TRENDS ENDOCRINOL METAB., vol. 1, no. 3, 1990, pages 168 - 74
MACFAYDEN, R. J. ET AL., NEUROPEPTIDES, vol. 7, no. 3, 1986, pages 219 - 27
MEIER J. J., DIABETES METAB RES REV., vol. 21, no. 2, 2005, pages 91 - 117
MOJSOV, S., INT. J. PEPTIDE PROTEIN RESEARCH, vol. 40, 1992, pages 333 - 343
PLAYFORD, R. J. ET AL., LANCET, vol. 335, no. 8705, 1990, pages 1555 - 7
REBEKAH L BOWER ET AL: "Amylin structure-function relationships and receptor pharmacology: implications for amylin mimetic drug development : Amylin structure-function", BRITISH JOURNAL OF PHARMACOLOGY, vol. 173, no. 12, 1 June 2016 (2016-06-01), UK, pages 1883 - 1898, XP055648836, ISSN: 0007-1188, DOI: 10.1111/bph.13496 *
RENATA KOWALCZYK ET AL: "Convergent chemoenzymatic synthesis of a library of glycosylated analogues of pramlintide: structure-activity relationships for amylin receptor agonism", ORGANIC & BIOMOLECULAR CHEMISTRY, vol. 12, no. 41, 1 January 2014 (2014-01-01), pages 8142 - 8151, XP055648844, ISSN: 1477-0520, DOI: 10.1039/C4OB01208A *
S. M. BERGE ET AL.: "J. Pharmaceutical Sciences", vol. 66, 1977, article "pharmaceutically acceptable salts", pages: 1 - 19
SEUFERT: "The extra-pancreatic effects of GLP-1 receptor agonists: a focus on the cardiovascular, gastrointestinal and central nervous systems", DIABETES OBES METAB, vol. 16, no. 8, 2014, pages 673 - 88
TSENG, C. ET AL., PNAS, vol. 90, 1993, pages 1992 - 1996
WYNNE K ET AL., INT J OBES (LOND, vol. 30, no. 12, 2006, pages 1729 - 36

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN116018156A (zh) * 2020-04-20 2023-04-25 I2O治疗公司 使用人类胰淀素类似物多肽对1型糖尿病患者提供卓越的血糖控制
JP2023522944A (ja) * 2020-04-20 2023-06-01 アイツーオー・セラピューティクス・インコーポレイテッド 1型糖尿病患者に優れた血糖制御をもたらすためのヒトアミリンアナログポリペプチドの使用
JP2023544959A (ja) * 2020-09-24 2023-10-26 グブラ エー/エス 改善されたアミリン受容体(hAMY3R)効力を有するhAM15-52類似体
CN113880935A (zh) * 2021-10-25 2022-01-04 杭州信海医药科技有限公司 一种索马鲁肽全保护肽树脂的制备方法、一种索马鲁肽制备方法

Also Published As

Publication number Publication date
CA3116023A1 (en) 2020-04-16
BR112021006823A2 (pt) 2021-07-27
MX2021004185A (es) 2021-09-08
AU2019357621A1 (en) 2021-05-27
IL282079B1 (en) 2025-05-01
JP2022504596A (ja) 2022-01-13
CN120647747A (zh) 2025-09-16
US20240417438A1 (en) 2024-12-19
JP7636321B2 (ja) 2025-02-26
AR116632A1 (es) 2021-05-26
US12540168B2 (en) 2026-02-03
AU2025204716A1 (en) 2025-07-17
SG11202103586UA (en) 2021-05-28
IL320142A (en) 2025-06-01
JP2025000663A (ja) 2025-01-07
US12018059B2 (en) 2024-06-25
US20200115430A1 (en) 2020-04-16
TW202028228A (zh) 2020-08-01
IL282079A (en) 2021-05-31
AU2019357621B2 (en) 2025-04-03
EP3864031A1 (en) 2021-08-18
CN113195524A (zh) 2021-07-30
KR20210091705A (ko) 2021-07-22
IL282079B2 (en) 2025-09-01
KR102911883B1 (ko) 2026-01-13

Similar Documents

Publication Publication Date Title
EP3458084B1 (en) Glucagon-receptor selective polypeptides and methods of use thereof
US12540168B2 (en) Human amylin analog polypeptides and methods of use
IL297375A (en) Controlled-release cnp agonists with low npr–c binding
US12122816B2 (en) Long acting peptide tyrosine tyrosine (PYY) analogs and methods of use
IL303686A (en) Long acting glucagon like polypeptide-1 (glp-1) receptor agonists and methods of use
WO2017200944A1 (en) Glucagon receptor/glp-1 receptor selective analog polypeptides and methods of use thereof
CA3116023C (en) Human amylin analog polypeptides and methods of use
RU2839688C2 (ru) Полипептиды аналога амилина человека и способы их применения
US20240228572A1 (en) Long acting glucagon receptor selective peptides and methods of use
EA052603B1 (ru) Селективные к рецептору глюкагона пептиды длительного действия и способы их применения

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 19795724

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3116023

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2021519698

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112021006823

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 20217013697

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2021110342

Country of ref document: RU

ENP Entry into the national phase

Ref document number: 2019795724

Country of ref document: EP

Effective date: 20210511

ENP Entry into the national phase

Ref document number: 2019357621

Country of ref document: AU

Date of ref document: 20191010

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 112021006823

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20210409

WWD Wipo information: divisional of initial pct application

Ref document number: 320142

Country of ref document: IL

WWG Wipo information: grant in national office

Ref document number: 2021110342

Country of ref document: RU

WWG Wipo information: grant in national office

Ref document number: MX/A/2021/004185

Country of ref document: MX