WO2020061229A2 - Arc-based capsids and uses thereof - Google Patents
Arc-based capsids and uses thereof Download PDFInfo
- Publication number
- WO2020061229A2 WO2020061229A2 PCT/US2019/051786 US2019051786W WO2020061229A2 WO 2020061229 A2 WO2020061229 A2 WO 2020061229A2 US 2019051786 W US2019051786 W US 2019051786W WO 2020061229 A2 WO2020061229 A2 WO 2020061229A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- amino acid
- acid sequence
- arc
- gag
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/0008—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'non-active' part of the composition delivered, e.g. wherein such 'non-active' part is not delivered simultaneously with the 'active' part of the composition
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/48—Preparations in capsules, e.g. of gelatin, of chocolate
- A61K9/50—Microcapsules having a gas, liquid or semi-solid filling; Solid microparticles or pellets surrounded by a distinct coating layer, e.g. coated microspheres, coated drug crystals
- A61K9/51—Nanocapsules; Nanoparticles
- A61K9/5107—Excipients; Inactive ingredients
- A61K9/513—Organic macromolecular compounds; Dendrimers
- A61K9/5169—Proteins, e.g. albumin, gelatin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/48—Preparations in capsules, e.g. of gelatin, of chocolate
- A61K9/50—Microcapsules having a gas, liquid or semi-solid filling; Solid microparticles or pellets surrounded by a distinct coating layer, e.g. coated microspheres, coated drug crystals
- A61K9/51—Nanocapsules; Nanoparticles
- A61K9/5107—Excipients; Inactive ingredients
- A61K9/5176—Compounds of unknown constitution, e.g. material from plants or animals
- A61K9/5184—Virus capsids or envelopes enclosing drugs
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/87—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/87—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
- C12N15/90—Stable introduction of foreign DNA into chromosome
- C12N15/902—Stable introduction of foreign DNA into chromosome using homologous recombination
- C12N15/907—Stable introduction of foreign DNA into chromosome using homologous recombination in mammalian cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
- C12N9/22—Ribonucleases [RNase]; Deoxyribonucleases [DNase]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55555—Liposomes; Vesicles, e.g. nanoparticles; Spheres, e.g. nanospheres; Polymers
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/20—Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPR]
Definitions
- recombinant and engineered Arc polypeptides and recombinant and engineered endogenous Gag (endo-Gag) polypeptides are also included.
- Arc-based capsids and endo-Gag based capsids are also included, and methods of preparing the capsids. Additionally included are methods of delivery of the Arc-based capsids and endo-Gag-based capsids to a site of interest.
- a capsid comprising a recombinant Arc polypeptide or a recombinant endogenous Gag polypeptide and a therapeutic agent.
- the therapeutic agent is a nucleic acid.
- the nucleic acid is an RNA.
- the recombinant Arc polypeptide is a human Arc polypeptide comprising an amino acid sequence that is SEQ ID NO: 1 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 1.
- the recombinant Arc polypeptide is an Arc polypeptide comprising: a) an amino acid sequence that is SEQ ID NO: 2 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 2; b) an amino acid sequence that is SEQ ID NO: 3 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 3; c) an amino acid sequence that is SEQ ID NO: 4 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 4; d) an amino acid sequence that is SEQ ID NO: 5 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 5; e) an amino acid sequence that is SEQ ID NO: 6 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 6; f) an amino acid sequence that is SEQ ID NO: 7 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 7; g) an amino acid sequence that is SEQ ID NO: 8 or an amino acid
- the recombinant endogenous Gag polypeptide is a human endogenous Gag polypeptide. In some embodiments, the recombinant endogenous Gag polypeptide is an
- endogenous Gag polypeptide comprising: a) an amino acid sequence that is SEQ ID NO: 16 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 16; b) an amino acid sequence that is SEQ ID NO: 17 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 17; c) an amino acid sequence that is SEQ ID NO: 18 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 18; d) an amino acid sequence that is SEQ ID NO: 19 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 19; e) an amino acid sequence that is SEQ ID NO: 20 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 20; f) an amino acid sequence that is SEQ ID NO: 21 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 21; or g) an amino acid sequence that is SEQ ID NO: 22 or an amino acid sequence that is at least 90% identical to the SEQ ID NO
- a capsid comprising a recombinant Arc polypeptide or a recombinant endogenous Gag polypeptide, wherein the recombinant Arc polypeptide is not a rat Arc polypeptide or a human Arc polypeptide.
- the capsid further comprises a cargo.
- the cargo is a nucleic acid.
- the cargo is an RNA.
- the cargo is a therapeutic agent.
- the recombinant Arc polypeptide is an Arc polypeptide comprising: a) an amino acid sequence that is SEQ ID NO: 2 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 2; b) an amino acid sequence that is SEQ ID NO: 3 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 3; c) an amino acid sequence that is SEQ ID NO: 4 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 4; d) an amino acid sequence that is SEQ ID NO: 5 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 5; e) an amino acid sequence that is SEQ ID NO: 6 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 6; f) an amino acid sequence that is SEQ ID NO: 7 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 7; g) an amino acid sequence that is SEQ ID NO: 8 or an amino acid
- the recombinant endogenous Gag polypeptide is an endogenous Gag polypeptide comprising: a) an amino acid sequence that is SEQ ID NO: 16 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 16; b) an amino acid sequence that is SEQ ID NO: 17 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 17; c) an amino acid sequence that is SEQ ID NO: 18 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 18; d) an amino acid sequence that is SEQ ID NO: 19 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 19; e) an amino acid sequence that is SEQ ID NO: 20 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 20; f) an amino acid sequence that is SEQ ID NO: 21 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 21; or g) an amino acid sequence that is SEQ ID NO: 16 or
- the vector further encodes a therapeutic agent.
- the therapeutic agent is a nucleic acid.
- the nucleic acid is an RNA.
- the recombinant Arc polypeptide is a human Arc polypeptide comprising an amino acid sequence that is SEQ ID NO: 1 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 1.
- the recombinant Arc polypeptide is an Arc polypeptide comprising: a) an amino acid sequence that is SEQ ID NO: 2 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 2; b) an amino acid sequence that is SEQ ID NO: 3 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 3; c) an amino acid sequence that is SEQ ID NO: 4 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 4; d) an amino acid sequence that is SEQ ID NO: 5 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 5; e) an amino acid sequence that is SEQ ID NO: 6 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 6; f) an amino acid sequence that is SEQ ID NO: 7 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 7; g) an amino acid sequence that is SEQ ID NO: 8 or an amino acid
- the recombinant endogenous Gag polypeptide is a human endogenous Gag polypeptide.
- the recombinant endogenous Gag polypeptide is an endogenous Gag polypeptide comprising: a) an amino acid sequence that is SEQ ID NO: 16 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 16; b) an amino acid sequence that is SEQ ID NO: 17 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 17; c) an amino acid sequence that is SEQ ID NO: 18 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 18; d) an amino acid sequence that is SEQ ID NO: 19 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 19; e) an amino acid sequence that is SEQ ID NO: 20 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 20; f) an amino acid sequence that is SEQ ID NO: 21 or
- a vector comprising DNA encoding a recombinant Arc polypeptide or a recombinant endogenous Gag polypeptide, wherein the recombinant Arc polypeptide is not a rat Arc polypeptide or a human Arc polypeptide.
- the vector further encodes a cargo.
- the cargo is a nucleic acid.
- the cargo is an RNA.
- the cargo is a therapeutic agent.
- the recombinant Arc polypeptide is an Arc polypeptide comprising: a) an amino acid sequence that is SEQ ID NO: 2 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 2; b) an amino acid sequence that is SEQ ID NO: 3 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 3; c) an amino acid sequence that is SEQ ID NO: 4 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 4; d) an amino acid sequence that is SEQ ID NO: 5 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 5; e) an amino acid sequence that is SEQ ID NO: 6 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 6; f) an amino acid sequence that is SEQ ID NO: 7 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 7; g) an amino acid sequence that is SEQ ID NO: 8 or an amino acid
- the recombinant endogenous Gag polypeptide is an endogenous Gag polypeptide comprising: a) an amino acid sequence that is SEQ ID NO: 16 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 16; b) an amino acid sequence that is SEQ ID NO: 17 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 17; c) an amino acid sequence that is SEQ ID NO: 18 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 18; d) an amino acid sequence that is SEQ ID NO: 19 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 19; e) an amino acid sequence that is SEQ ID NO: 20 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 20; f) an amino acid sequence that is SEQ ID NO: 21 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 21; or g) an amino acid sequence that is SEQ ID NO: 16 or
- a method of delivering a cargo to a cell comprising administering to the cell a capsid comprising a recombinant Arc polypeptide or a recombinant endogenous Gag polypeptide and a therapeutic agent.
- the therapeutic agent is a nucleic acid.
- the nucleic acid is an RNA.
- the recombinant Arc polypeptide is a human Arc polypeptide comprising an amino acid sequence that is SEQ ID NO: 1 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 1.
- the recombinant Arc polypeptide is an Arc polypeptide comprising: a) an amino acid sequence that is SEQ ID NO: 2 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 2; b) an amino acid sequence that is SEQ ID NO: 3 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 3; c) an amino acid sequence that is SEQ ID NO: 4 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 4; d) an amino acid sequence that is SEQ ID NO: 5 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 5; e) an amino acid sequence that is SEQ ID NO: 6 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 6; f) an amino acid sequence that is SEQ ID NO: 7 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 7; g) an amino acid sequence that is SEQ ID NO: 8 or an amino acid
- the recombinant endogenous Gag polypeptide is a human endogenous Gag polypeptide.
- the recombinant endogenous Gag polypeptide is an endogenous Gag polypeptide comprising: a) an amino acid sequence that is SEQ ID NO: 16 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 16; b) an amino acid sequence that is SEQ ID NO: 17 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 17; c) an amino acid sequence that is SEQ ID NO: 18 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 18; d) an amino acid sequence that is SEQ ID NO: 19 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 19; e) an amino acid sequence that is SEQ ID NO: 20 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 20; f) an amino acid sequence that is SEQ ID NO: 21 or
- the cell is a eukaryotic cell. In some embodiments, the cell is a vertebrate cell. In some embodiments, the cell is a mammalian cell. In some embodiments, the cell is a human cell. In some embodiments, the cargo is a nucleic acid.
- the cell expresses a gene encoded by the nucleic acid.
- the cargo is a therapeutic agent.
- a method of delivering a cargo to a cell comprising administering to the cell a capsid comprising a recombinant Arc polypeptide or a recombinant endogenous Gag polypeptide, wherein the recombinant Arc polypeptide is not a rat Arc polypeptide or a human Arc polypeptide.
- the capsid further comprises a cargo.
- the cargo is a nucleic acid.
- the cargo is an RNA.
- the cargo is a therapeutic agent.
- the capsid comprising a recombinant Arc polypeptide or a recombinant endogenous Gag polypeptide, wherein the recombinant Arc polypeptide is not a rat Arc polypeptide or a human Arc polypeptide.
- the capsid further comprises a cargo.
- the cargo is a nucleic acid.
- the cargo is an RNA.
- the cargo is a therapeutic agent.
- the cargo is a
- Arc polypeptide is an Arc polypeptide comprising: a) an amino acid sequence that is SEQ ID NO: 2 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 2; b) an amino acid sequence that is SEQ ID NO: 3 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 3; c) an amino acid sequence that is SEQ ID NO: 4 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 4; d) an amino acid sequence that is SEQ ID NO: 5 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 5; e) an amino acid sequence that is SEQ ID NO: 6 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 6; f) an amino acid sequence that is SEQ ID NO: 7 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 7; g) an amino acid sequence that is SEQ ID NO: 8 or an amino acid sequence that is at least 90%
- the recombinant endogenous Gag polypeptide is an endogenous Gag polypeptide comprising: a) an amino acid sequence that is SEQ ID NO: 16 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 16; b) an amino acid sequence that is SEQ ID NO: 17 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 17; c) an amino acid sequence that is SEQ ID NO: 18 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 18; d) an amino acid sequence that is SEQ ID NO: 19 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 19; e) an amino acid sequence that is SEQ ID NO: 20 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 20; f) an amino acid sequence that is SEQ ID NO: 21 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 21; or g) an amino acid sequence that is SEQ ID NO: 16 or
- the cell is a eukaryotic cell. In some embodiments, the cell is a vertebrate cell. In some embodiments, the cell is a mammalian cell. In some embodiments, the cell is a human cell. In some embodiments, the cargo is a nucleic acid. In some embodiments, the cell expresses a gene encoded by the nucleic acid. In some embodiments, the cargo is a therapeutic agent.
- a method of transfecting a nucleic acid into a cell comprising administering to the cell a capsid comprising a recombinant Arc polypeptide or a recombinant endogenous Gag polypeptide and a therapeutic agent.
- the therapeutic agent is a nucleic acid.
- the nucleic acid is an RNA.
- the recombinant Arc polypeptide is a human Arc polypeptide comprising an amino acid sequence that is SEQ ID NO: 1 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 1.
- the recombinant Arc polypeptide is an Arc polypeptide comprising: a) an amino acid sequence that is SEQ ID NO: 2 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 2; b) an amino acid sequence that is SEQ ID NO: 3 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 3; c) an amino acid sequence that is SEQ ID NO: 4 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 4; d) an amino acid sequence that is SEQ ID NO: 5 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 5; e) an amino acid sequence that is SEQ ID NO: 6 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 6; f) an amino acid sequence that is SEQ ID NO: 7 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 7; g) an amino acid sequence that is SEQ ID NO: 8 or an amino acid
- the recombinant endogenous Gag polypeptide is a human endogenous Gag polypeptide.
- the recombinant endogenous Gag polypeptide is an endogenous Gag polypeptide comprising: a) an amino acid sequence that is SEQ ID NO: 16 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 16; b) an amino acid sequence that is SEQ ID NO: 17 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 17; c) an amino acid sequence that is SEQ ID NO: 18 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 18; d) an amino acid sequence that is SEQ ID NO: 19 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 19; e) an amino acid sequence that is SEQ ID NO: 20 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 20; f) an amino acid sequence that is SEQ ID NO: 21 or
- a method of transfecting a nucleic acid into a cell comprising administering to the cell a capsid comprising a recombinant Arc polypeptide or a recombinant endogenous Gag polypeptide, wherein the recombinant Arc polypeptide is not a rat Arc polypeptide or a human Arc polypeptide.
- the capsid further comprises a cargo.
- the cargo is a nucleic acid.
- the cargo is an RNA.
- the cargo is a therapeutic agent.
- the recombinant Arc polypeptide is an Arc polypeptide comprising: a) an amino acid sequence that is SEQ ID NO: 2 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 2; b) an amino acid sequence that is SEQ ID NO: 3 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 3; c) an amino acid sequence that is SEQ ID NO: 4 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 4; d) an amino acid sequence that is SEQ ID NO: 5 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 5; e) an amino acid sequence that is SEQ ID NO: 6 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 6; f) an amino acid sequence that is SEQ ID NO: 7 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 7; g) an amino acid sequence that is SEQ ID NO: 8 or an amino acid
- the recombinant endogenous Gag polypeptide is an endogenous Gag polypeptide comprising: a) an amino acid sequence that is SEQ ID NO: 12 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 12; b) an amino acid sequence that is SEQ ID NO: 13 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 13; c) an amino acid sequence that is SEQ ID NO: 14 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 14; d) an amino acid sequence that is SEQ ID NO: 15 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 15; e) an amino acid sequence that is SEQ ID NO: 16 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 16; f) an amino acid sequence that is SEQ ID NO: 17 or an amino acid sequence that is at least 90% identical to the SEQ ID NO: 17; g) an amino acid sequence that is SEQ ID NO: 12 or an
- the cargo binding domain comprises a nucleic acid binding domain.
- the cargo binding domain comprises a polypeptide that binds to a small molecule.
- the cargo binding domain comprises a
- the cargo binding domain comprises a polypeptide that binds to a peptidomimetic or a nucleotidomimetic.
- the at least one capsid forming subunit comprises a polypeptide that corresponds to the CA N-lobe and/or CA C-lobe of SEQ ID NO: 1.
- the engineered Arc or endo-Gag polypeptide further comprises a second capsid forming subunit from a different species of an Arc or endo-Gag polypeptide.
- the second capsid forming subunit comprises a polypeptide that corresponds to the N-lobe and/or C-lobe of SEQ ID NO: 1.
- the at least one capsid forming subunit and the second capsid forming subunit are each independently selected from a species of Arc or endo-Gag selected from a mammal, a rodent, a bird, a reptile, a fish, an insect, a fungus, or a plant.
- the at least one capsid forming subunit and the second capsid forming subunit are from two different species.
- the cargo binding domain is fused either directly or via a linker to the C-terminus of the at least one capsid forming subunit. In some embodiments, the cargo binding domain is fused either directly or via a linker to the N-terminus of the at least one capsid forming subunit. In some embodiments, the second capsid forming subunit is fused either directly or via a linker to the C-terminus of the at least one capsid forming subunit. In some embodiments, the second capsid forming subunit is fused either directly or via a linker to the N- terminus of the at least one capsid forming subunit.
- the cargo binding domain is fused either directly or via a linker to the N-terminus of the at least one capsid forming subunit and the second capsid forming subunit is fused either directly or via a linker to the C- terminus of the at least one capsid forming subunit. In some embodiments, the cargo binding domain is fused either directly or via a linker to the C-terminus of the at least one capsid forming subunit and the second capsid forming subunit is fused either directly or via a linker to the N- terminus of the at least one capsid forming subunit. In some embodiments, the engineered Arc or endo-Gag polypeptide further comprises a second polypeptide.
- the second polypeptide is fused either directly or via a linker to the at least one capsid forming subunit. In some embodiments, the second polypeptide is fused either directly or via a linker to the cargo binding domain. In some embodiments, the second polypeptide is a protein or an antibody or its binding fragments thereof. In some embodiments, the protein is a human protein or a viral protein. In some embodiments, the protein is a human Gag-like protein. In some embodiments, the protein is a de novo engineered protein designed to bind to a target receptor of interest. In some
- the second polypeptide guides the delivery of a capsid formed by the engineered Arc or endo-Gag polypeptide to a target site of interest.
- the portion comprises a matrix (MA) domain, a reverse transcriptase (RT) domain, a nucleotide binding domain, or a combination thereof, provided that the nucleotide binding domain is not a human Arc RNA binding domain.
- the portion comprises a CA C-lobe domain.
- the portion comprises an N- terminal deletion, a C-terminal deletion, or a combination thereof.
- the N- terminal deletion comprises a deletion of up to 10 amino acids, 20 amino acids, 30 amino acids, or 50 amino acids.
- the C-terminal deletion comprises a deletion of up to 10 amino acids, 20 amino acids, 30 amino acids, or 50 amino acids.
- an Arc or endo-Gag-based capsid comprising an engineered Arc or endo-Gag polypeptide which may be a truncated Arc or endo-Gag
- the cargo is a nucleic acid molecule.
- the nucleic acid molecule is DNA, RNA, or a mixture of DNA and RNA.
- the DNA and the RNA are each independently single-stranded, double-stranded, or a mixture of single and double stranded.
- the cargo is a small molecule.
- the cargo is a protein.
- the cargo is a peptide.
- the cargo is an antibody or binding fragments thereof.
- the cargo is a nucleic acid molecule.
- the nucleic acid molecule is DNA, RNA, or a mixture of DNA and RNA.
- the DNA and the RNA are each independently single-stranded, double-stranded, or a mixture of single and double stranded.
- the cargo is a small molecule.
- the cargo is a protein.
- the cargo is a peptide.
- the cargo is an antibody or binding fragments thereof.
- the cargo is a
- the Arc or endo-Gag-based capsid comprises one or more additional capsid subunits from one or more species of Arc or endo-Gag proteins that are different than the engineered Arc or endo-Gag polypeptide.
- the Arc-based or endo-Gag-based capsid comprises one or more additional capsid subunits from non-Arc proteins.
- the one or more additional capsid subunits comprise Copia protein, ASPRV1 protein, a protein from the SCAN domain family, a protein encoded by the Paraneoplastic Ma antigen family (e.g.
- the one or more additional capsid subunits comprise BOP, LDOC1, MOAP1, PEG10, PNMA3, PNMA5, PNMA6A, PNMA6B, RTL3, RTL6, RTL8A, RTL8B, and ZNF18.
- the capsid has a diameter of at least 1 nm, 2nm, 3nm, 4nm, 5nm, lOnm, l5nm, 20nm, 25nm, 30nm, 50nm, 80nm, lOOnm, l20nm, l50nm, 200nm, 250nm, 300nm, 500nm, 600nm, or more.
- the capsid has a diameter of from about lnm to about 600nm, from about lnm to about 500nm, from about lnm to about 200nm, from about lnm to about lOOnm, from about lnm to about 50nm, or from about 1 nm to about 30 nm.
- the capsid has a reduced off-target effect.
- the capsid does not have an off-target effect.
- the capsid is formed ex-vivo. In some
- the capsid is formed in-vitro.
- nucleic acid polymer encoding a recombinant or engineered Arc polypeptide or a recombinant or engineered endogenous Gag polypeptide described herein.
- a vector comprising a nucleic acid polymer encoding a recombinant or engineered Arc polypeptide or a recombinant or engineered endogenous Gag polypeptide described herein.
- a method of preparing a loaded Arc-based or endo-Gag-based capsid comprising: incubating a plurality of recombinant or engineered Arc polypeptides or a plurality of recombinant or engineered endo-Gag polypeptides with a cargo in a solution for a time sufficient to generate the loaded capsid.
- the method further comprises mixing the solution comprising the plurality of engineered Arc or endo-Gag polypeptides with a plurality of non- Arc or non-endo-Gag capsid forming subunits prior to incubating with the cargo.
- the plurality of non-Arc or non-endo-Gag capsid forming subunits are mixed with the plurality of recombinant or engineered Arc or endo-Gag polypeptides at a ratio of 1 : 1, 2: 1, 3: 1, 4: 1, 5: 1, 6: 1, 7:1, 8: 1, 9:1, or 10:1.
- the plurality of non-Arc or non-endo-Gag capsid forming subunits are mixed with the plurality of engineered Arc or endo-Gag polypeptides at a ratio of 1 :2, 1 :3, 1 :4, 1 :5, 1 :6, 1 :7, 1 :8, 1 :9, or 1 : 10.
- the method further comprises mixing the solution comprising the plurality of truncated Arc or endo-Gag polypeptides with a plurality of non-Arc or endo-Gag capsid forming subunits prior to incubating with the cargo.
- the plurality of non-Arc or endo- Gag capsid forming subunits are mixed with the plurality of truncated Arc or endo-Gag
- the plurality of non-Arc or non-endo-Gag capsid forming subunits are mixed with the plurality of truncated Arc or endo-Gag polypeptides at a ratio of 1 :2, 1 :3, 1 :4, 1 :5, 1 :6, 1 :7, 1 :8, 1 :9, or 1 : 10.
- the plurality of engineered Arc or endo-Gag polypeptides is obtained from a bacterial cell system, an insect cell system, or a mammalian cell system.
- the plurality of engineered Arc or endo-Gag polypeptides is obtained from a cell-free system. In some embodiments, the plurality of truncated Arc or endo-Gag polypeptides is obtained from a bacterial cell system, an insect cell system, or a mammalian cell system. In some embodiments, the plurality of truncated Arc or endo-Gag polypeptides is obtained from a cell-free system. In some
- the loaded Arc-based or endo-Gag capsid is formulated for systemic administration. In some embodiments, the loaded Arc or endo-Gag-based capsid is formulated for local administration. In some embodiments, the loaded Arc or endo-Gag-based capsid is formulated for parenteral administration. In some embodiments, the loaded Arc or endo-Gag-based capsid is formulated for oral administration. In some embodiments, the loaded Arc or endo-Gag-based capsid is formulated for topical administration. In some embodiments, the loaded Arc or endo-Gag- based capsid is formulated for sublingual or aerosol administration.
- an engineered or recombinant Arc- based or endo-Gag-based capsid for delivery of a cargo to a site of interest, comprising contacting a cell at the site of interest with an Arc-based or endo-Gag-based capsid for a time sufficient to facilitate cellular uptake of the capsid.
- the cell is a tumor cell.
- the tumor cell is a solid tumor cell.
- the solid tumor cell is a cell from a bladder cancer, breast cancer, brain cancer, colorectal cancer, kidney cancer, liver cancer, lung cancer, pancreatic cancer, prostate cancer, skin cancer, stomach cancer, or thyroid cancer.
- the tumor cell is from a hematologic malignancy.
- the hematologic malignancy is a B-cell malignancy, or a T-cell malignancy.
- the hematologic malignancy is chronic lymphocytic leukemia (CLL), small lymphocytic lymphoma (SLL), diffuse large B cell lymphoma (DLBCL), follicular lymphoma, mantle cell lymphoma, Burkitt lymphoma, cutaneous T-cell lymphoma, or peripheral T cell lymphoma.
- the cell is a somatic cell.
- the cell is a stem cell or a progenitor cell.
- the cell is a mesenchymal stem or progenitor cell.
- the cell is a hematopoietic stem or progenitor cell.
- the cell is a muscle cell, a skin cell, a blood cell, or an immune cell.
- a target protein is overexpressed or is depleted in the cell.
- a target gene in the cell has one or more mutations.
- the cell comprises an impaired splicing mechanism.
- the use is an in vivo use.
- the Arc-based capsid is administered systemically to a subject. In some embodiments, the Arc-based capsid is administered systemically to a subject.
- the Arc-based or endo-Gag-based capsid is administered via local administration to a subject. In some embodiments, the Arc-based or endo-Gag-based capsid is administered parenterally to a subject. In some embodiments, the Arc-based capsid is administered orally to a subject. In some embodiments, the Arc-based or endo-Gag-based capsid is administered topically to a subject. In some embodiments, the Arc-based or endo-Gag-based capsid is administered via sublingual or aerosol administration to a subject. In some embodiments, the use is an in vitro or ex vivo use.
- kits comprising an engineered Arc or endo-Gag polypeptide, a truncated Arc or endo-Gag polypeptide, a vector encoding a recombinant or engineered Arc or endo-Gag polypeptide, or an Arc-based or endo-Gag-based capsid.
- Fig. 1 is a representation of exemplary Arc polypeptides.
- Fig. 2 is a representation of exemplary engineered Arc polypeptides.
- Fig. 3 illustrates an exemplary method of engineering an Arc polypeptide to (A) carry a specific cargo (e.g., an RNA payload) or (B) remove an off-function effect.
- a specific cargo e.g., an RNA payload
- B remove an off-function effect.
- Fig. 4A shows the isolation of 6xHis-tagged human Arc by elution from a HisTrap column with an imidazole gradient.
- Fig. 4B shows the separation of 6xHis-tagged human Arc from residual nucleic acids on a mono Q column eluted with a NaCl gradient.
- Fig. 5 shows a transmission electron microscope image of negatively stained human Arc capsids.
- Fig. 6 shows transmission electron microscope images of negatively stained capsids formed from recombinantly expressed Arc orthologs.
- Fig. 7 shows transmission electron microscope images of negatively stained capsids formed from recombinantly expressed endo-Gag proteins.
- Fig. 8 shows selective internalization of Alexa594-labeled Arc capsids by HeLa cells.
- Fig. 9 shows the delivery of Cre RNA to HeLa cells by Arc capsids.
- Fig. 10 illustrates methods for screening Arc and endo-Gag gene candidates for the ability to transmit a heterologous RNA payload.
- Administrating diagnostic or therapeutic agents to a site of interest with precision has presented an ongoing challenge.
- Available methods of delivering nucleic acids to cells have myriad limitations.
- AAV viral vectors often used for gene therapy are immunogenic, have a limited payload capacity of ⁇ 3kb, suffer from poor bio-distribution, can only be administered by direct injection, and pose a risk of disrupting host genes by integration.
- Non-viral methods have different limitations. Liposomes are primarily delivered to the liver. Extracellular vesicles have a limited payload capacity of ⁇ 1 kb, limited scalability, and purification difficulties. Thus, there is a recognized need for new methods of delivering therapeutic payloads.
- Method for improving delivery includes coating the agent of choice with hydrophobic compounds or polymers. Such an approach increases the duration of said agent in circulation and augments hydrophobicity for cellular uptake. On the other hand, this approach does not actively direct cargo to the site of interest for delivery.
- therapeutic compounds are optionally fused to moieties such as ligands, antibodies, and aptamers that recognize and bind to receptors displayed on the surface of targeted cells.
- the therapeutic compound is optionally further delivered to an intracellular target.
- a therapeutic RNA can be translated to a protein if it comes into contact with a ribosome in the cytoplasm of the cell.
- Arc activity-regulated cytoskeleton-associated protein regulates the endocytic trafficking of a-amino-3-hydroxy-5-methylisoxazole-4-propionic acid (AMP A) type glutamate receptors. Arc activities have been linked to synaptic strength and neuronal plasticity. Phenotypes of loss of Arc in experimental murine model included defective formation of long-term memory and reduced neuronal activity and plasticity.
- Arc exhibits similar molecular properties to retroviral Gag proteins.
- the Arc gene may have originated from the Ty3 /gypsy retrotransposon.
- An endogenous Gag (endo-Gag) protein is any protein endogenous to a eukaryotic organism, including Arc, that has predicted and annotated similarity to viral Gag proteins. Exemplary endo-Gag proteins are disclosed in Campillos M,
- An endo-Gag protein is optionally recombinantly expressed by any host cell, including a prokaryotic or eukaryotic cell, or a bacterial, yeast, insect, vertebrate, mammalian, or human cell. As described herein, in some embodiments an endo-Gag protein assembles into an endo-Gag capsid. [0036] Disclosed herein, in certain embodiments, are Arc and endo-Gag polypeptides which assemble into a capsid for delivery of a cargo of interest.
- engineered Arc and endo-Gag polypeptides which assemble into a capsid for delivery of a cargo of interest.
- capsids e.g., Arc-based or endo-Gag-based capsids, for delivery of a cargo of interest.
- an Arc polypeptide in certain embodiments, disclosed herein is an Arc polypeptide. In certain embodiments, disclosed herein is an endo-Gag polypeptide. It should be understood that endo-Gag sequences are optional substitutes for Arc sequences to form any type of engineered Arc polypeptide described in this section.
- Arc is a non-human Arc polypeptide.
- the Arc polypeptide comprises a full-length Arc polypeptide (e.g., a full-length non-human Arc
- the Arc polypeptide comprises a fragment of non-human Arc, such as a truncated Arc polypeptide, that participates in the formation of a capsid.
- the Arc polypeptide comprises one or more domains of a non-human Arc polypeptide, in which at least one of the domains participates in the formation of a capsid.
- the Arc polypeptide is a recombinant Arc polypeptide.
- endo-Gag is a non-human endo-Gag polypeptide.
- the endo-Gag polypeptide comprises a full-length endo-Gag polypeptide (e.g., a full-length non human endo-Gag polypeptide).
- the endo-Gag polypeptide comprises a fragment of non-human endo-Gag, such as a truncated endo-Gag polypeptide, that participates in the formation of a capsid.
- the endo-Gag polypeptide comprises one or more domains of a non-human endo-Gag polypeptide, in which at least one of the domains participates in the formation of a capsid.
- the endo-Gag polypeptide is a recombinant endo- Gag polypeptide.
- the Arc is a human Arc polypeptide with at least its RNA binding domain modified to bind to a cargo that is not native to the human Arc.
- the Arc polypeptide comprises a full-length human Arc polypeptide with at least its RNA binding domain modified to bind to a cargo that is not native to the human Arc protein.
- the Arc polypeptide comprises a human Arc fragment comprising modification(s) in at least its RNA binding domain.
- the Arc polypeptide comprises one or more domains of a human Arc polypeptide, in which at least one of the domains participates in the formation of a capsid and in which the RNA binding domain is modified to bind to a cargo that native human Arc protein does not bind to.
- the Arc polypeptide is a recombinant human Arc polypeptide, with at least the RNA binding domain is modified to enable loading of a cargo that is not native to the human Arc protein.
- the Endo-Gag is a human Endo-Gag polypeptide with at least its RNA binding domain modified to bind to a cargo that is not native to the human endo-Gag.
- the endo-Gag polypeptide comprises a full-length human endo-Gag polypeptide with at least its RNA binding domain modified to bind to a cargo that is not native to the human endo-Gag protein.
- the endo-Gag polypeptide comprises a human endo-Gag fragment comprising modification(s) in at least its RNA binding domain to bind to a cargo that a native human endo-Gag protein does not bind to.
- the endo-Gag polypeptide comprises one or more domains of a human endo-Gag polypeptide, in which at least one of the domains participates in the formation of a capsid and in which the RNA binding domain is modified to bind to a cargo that is not native to the human endo-Gag protein.
- the endo-Gag polypeptide is a recombinant human endo-Gag polypeptide, with at least the RNA binding domain is modified to enable loading of a cargo that is not native to the human endo-Gag protein.
- the Arc or endo-Gag polypeptide is an engineered Arc or endo-Gag polypeptide.
- an engineered polypeptide is a recombinant polypeptide that is not identical in sequence to a full length, wild-type polypeptide.
- the engineered Arc or endo-Gag polypeptide comprises a fragment of an Arc or endo-Gag polypeptide from a first species and at least an additional fragment from an Arc or endo-Gag polypeptide of a second species.
- the first Arc or endo-Gag polypeptide is selected from a kingdom member of animalia, plantae, fungi, or protista.
- the first species is selected from a mammal, a rodent, a bird, a reptile, a fish, a vertebrate, a eukaryote, an insect, a fungus, or a plant.
- the second Arc polypeptide is selected from a kingdom member of animalia, plantae, fungi, or protista that is the same or different than the first Arc or endo-Gag polypeptide.
- the second species is selected from a mammal, a rodent, a bird, a reptile, a fish, a vertebrate, a eukaryote, an insect, a fungus, or a plant that is different from the first species.
- an exemplary mammalian Arc or endo-Gag protein for expression as a recombinant or engineered Arc polypeptide is from the species homo sapiens. Additional exemplary species of primate Arc or endo-Gag protein proteins for expression as a recombinant or engineered Arc polypeptide include: gorilla, pongo abelii, pan paniscus, macaca nemestrina, chlorocebus sabaeus, papio anubis, rhinopithecus roxellana, macaca fascicularis, nomascus leucogenys, callithrix jacchus, aotus nancymaae, cebus capucinus imitator, saimiri boliviensis boliviensis, otolemur garnettii, macaca mulatto , and macaca fascicularis .
- An exemplary species list of rodent Arc or endo-Gag proteins for expression as a recombinant or engineered Arc or endo-Gag polypeptide includes: fukomys damarensis, microcebus murinus, heterocephalus glaber, propithecus coquereli, marmota marmota marmota, galeopterus variegatus, cavia porcellus, dipodomys ordii, octodon degus, castor canadensis nannospalax galili, carlito syrichta, chinchilla lanigera, mus musculus, ictidomys tridecemlineatus, rattus norvegicus, microtus ochrogaster, otolemur garnettii, meriones unguiculatus, cricetulus griseus, rattus norvegicus, neotoma lepida,
- An exemplary species list of Arc or endo-Gag proteins for expression as a recombinant or engineered Arc or endo-Gag polypeptide includes: vulpes vulpes, canis lupus dingo, felis catus, panther a pardus, callorhinus ur sinus, odobenus rosmarus diver gens, equus asinus, sus scrofa, manis javanica, ceratotherium simum simum, leptonychotes weddellii, enhydra lutris kenyoni, lipotes vexillifer, bos grunniens, bubalus bubalis, camelus dromedarius, vicugna pacos, orcinus orca, neomonachus schauinslandi, tursiops truncatus, bos taurus, capra hircus, delphinaptrus leucas, ovi
- An exemplary species list of bird Arc or endo-Gag proteins for expression as a recombinant or engineered Arc or endo-Gag polypeptide includes: gallus gallus, corvus cornix, cornix, parus major, corvus brachyrhynchos, dromaius novaehollandiae , and apteryx rowi.
- An exemplary species list of reptile Arc protein for expression as a recombinant or engineered Arc or endo-Gag polypeptide includes: python bivittatus, pogona vitticeps, anolis carolinensis, protobothrops mucrosquamatus, alligator sinensis, crocodylus porosus, gavialis gangeticus, alligator mississippiensis, pelodiscus sinensis, terrapene mexicana triunguis, chrysemys picta bellii, chelonia mydas, nanorana parkeri, xenopus tropicalis, xenopus laevis, and latimeria chalumnae , [0048] An exemplary species list of fish Arc protein for expression as a recombinant or engineered Arc or endo-Gag polypeptide includes: oncorhynchus mykiss, a
- An exemplary species list of insect Arc or endo-Gag proteins for expression as a recombinant or engineered Arc or endo-Gag polypeptide includes: drosophila serrata, drosophila bipectinata, solenopsis invicta, temnothorax curvispinosus, drosophila melanogaster, agrilus planipennis, camponotus floridanus, pogonomyrmex barbatus, nilaparvata lugens, bombyx mori, tribolium castaneum , and leptinotarsa decemlineata.
- An exemplary species list of plant Arc or endo-Gag proteins for expression as a recombinant or engineered Arc or endo-Gag polypeptide includes spinacia oleracea and
- An exemplary species list of fungi proteins for expression as a recombinant or engineered Arc or endo-Gag polypeptide includes: saccharomyces cerevisiae, rhizopus delemar, fusarium oxysporum, cryptococcus neoformans, rhizophagus irregularis, fusarium fujikuroi, Candida albicans, trichophyton rubrum, pyrenophora tritici-repentis, rhizopus microsporus, rhizoctonia solani, aspergillus flavus, verticillium dahliae, fusarium verticillioides, aspergillus niger, fusarium graminearum, aspergillus fumigatus, zymoseptoria tritici, and trichoderma harzianum.
- An exemplary species list of protists Arc or endo-Gag proteins for expression as a recombinant or engineered Arc or endo-Gag polypeptide includes: entamoeba histolytica, paulinella micropora, guillardia theta, oxyrrhis marina, seminavis robusta, euglena longa, naegleria gruberi, and trichomonas vaginalis.
- Arc or endo-Gag comprises a capsid assembly/forming (CA) domain, a cargo binding domain (e.g., an RNA binding domain), and optionally a matrix (MA) domain, a reverse transcriptase (RT) domain, or a combination thereof.
- CA domain is further divided into an N-lobe domain and a C-lobe domain.
- the cargo binding domain comprises an RNA binding domain, a DNA binding domain, a protein binding domain, a peptide binding domain, an antibody binding domain, a small molecule binding domain, or a peptidomimetic/nucleotidomimetic binding domain.
- Exemplary cargo binding domains include, but are not limited to, domains from GPCRs, antibodies or binding fragments thereof, lipoproteins, integrins, tyrosine kinases, DNA-binding proteins, RNA-binding proteins, nucleases, ligases, proteases, integrases, isomerases, phosphatases, GTPases, aromatases, esterases, adaptor proteins, G-proteins, GEFs, cytokines, interleukins, interleukin receptors, interferons, interferon receptors, caspases, transcription factors, neurotrophic factors and their receptors, growth factors and their receptors, signal recognition particle and receptor components, extracellular matrix proteins, integral components of membrane, ribosomal proteins, translation elongation factors, translation initiation factors, GPI-anchored proteins, tissue factors, dystrophin, utrophin, dystrobrevin, any fusions, combinations, subunits, derivatives, or domains thereof.
- one or more non-essential regions which are not involved in capsid formation or nucleic acid binding are removed from an Arc or endo-Gag protein to generate an Arc or endo-Gag polypeptide.
- one or more non-essential regions e.g., an N- terminal region (e.g., up to 10 amino acids, up to 20 amino acids, up to 30 amino acids, or up to 50 amino acids), a C-terminal region (e.g., up to 10 amino acids, up to 20 amino acids, up to 30 amino acids, or up to 50 amino acids), a RT domain, a MA domain, or a combination thereof, are deleted from an Arc or endo-Gag protein to generate an Arc or endo-Gag polypeptide.
- only the essential regions involved in capsid assembly/forming and cargo binding remain in an Arc or endo-Gag polypeptide.
- assembly/forming e.g., the N-lobe and/or the C-lobe
- the RT domain, the MA domain, and/or the endogenous RNA binding domain are replaced with other cargo binding domains: for example, replaced with a DNA binding domain, a protein binding domain, a peptide binding domain, an antibody binding domain, a small molecule binding domain, a peptidomimetic binding domain, or a nucleotidomimetic binding domain.
- an Arc or endo-Gag polypeptide comprises truncations or modifications of domains involved in capsid forming, nucleic acid binding, or delivery.
- the Arc or endo-Gag polypeptide comprises a MA domain, a CA N-lobe, a CA C-lobe, a cargo binding domain, and a RT domain.
- the Arc polypeptide comprises from N-terminus to C-terminus the following domains: the MA domain, the CA N-lobe, the CA C-lobe, the RT domain, and the cargo binding domain.
- the Arc or endo-Gag polypeptide comprises from N-terminus to C-terminus the following domains: the MA domain, the RT domain, the cargo binding domain, the CA N-lobe, and the CA C-lobe.
- the Arc or endo-Gag polypeptide comprises from N-terminus to C-terminus the following domains: the cargo binding domain, the MA domain, the RT domain, the CA N-lobe, and the CA C-lobe.
- the domains are arranged in an order that does not impede capsid assembly and cargo binding.
- each of the domains is either directly or indirectly fused to the respective two flanking domains.
- the Arc or endo-Gag polypeptide comprises a MA domain, a CA N-lobe, a CA C-lobe, and a cargo binding domain.
- the Arc or endo-Gag polypeptide comprises from N-terminus to C-terminus the following domains: the MA domain, the CA N-lobe, the CA C-lobe, and the cargo binding domain.
- the Arc polypeptide comprises from N-terminus to C-terminus the following domains: the MA domain, the cargo binding domain, the CA N-lobe, and the CA C-lobe.
- the Arc or endo-Gag polypeptide comprises from N-terminus to C-terminus the following domains: the cargo binding domain, the MA domain, the CA N-lobe, and the CA C-lobe.
- the domains are arranged in an order that does not impede capsid assembly and cargo binding.
- each of the domains is either directly or indirectly fused to the respective two flanking domains.
- the Arc or endo-Gag polypeptide comprises a CA N-lobe, a CA C-lobe, and a cargo binding domain.
- the Arc or endo-Gag polypeptide comprises from N-terminus to C-terminus the following domains: the CA N-lobe, the CA C-lobe, and the cargo binding domain.
- the Arc or endo-Gag polypeptide comprises from N- terminus to C-terminus the following domains: the cargo binding domain, the CA N-lobe, and the CA C-lobe.
- the domains are arranged in an order that does not impede capsid assembly and cargo binding.
- each of the domains is either directly or indirectly fused to the respective two flanking domains.
- the Arc or endo-Gag polypeptide comprises a CA N-lobe and a cargo binding domain. In some instances, the Arc or endo-Gag polypeptide comprises from N- terminus to C-terminus the following domains: the CA N-lobe and the cargo binding domain. In some instances, the Arc or endo-Gag polypeptide comprises from N-terminus to C-terminus the following domains: the cargo binding domain and the CA N-lobe. In some instances, the domains are arranged in an order that does not impede capsid assembly and cargo binding. In some instances, the two domains are either directly or indirectly fused to each other.
- the Arc or endo-Gag polypeptide is engineered to comprise a cargo binding domain, a CA domain, a MA domain, or a RT domain from one or more additional species to generate an engineered Arc polypeptide.
- the engineered Arc or endo-Gag polypeptide comprises a cargo binding domain, a CA domain, a MA domain, or a RT domain from a first species and a cargo binding domain, a CA domain, a MA domain, or a RT domain from a second species.
- the first species is selected from a eukaryote, a vertebrate, a human, a mammal, a rodent, a bird, a reptile, a fish, an insect, a fungus, or a plant.
- the second species is selected from a eukaryote, a vertebrate, a human, a mammal, a rodent, a bird, a reptile, a fish, an insect, a fungus, or a plant that is different from the first species.
- the engineered or endo-Gag Arc polypeptide comprises a cargo binding domain from a first species and a CA domain (e.g., a CA N-lobe and optionally a CA C- lobe) from a second species.
- the engineered Arc or endo-Gag polypeptide optionally comprises a MA domain and an RT domain from either the first species or the second species.
- the first species is selected from a eukaryote, a vertebrate, a human, a mammal, a rodent, a bird, a reptile, a fish, an insect, a fungus, or a plant.
- the second species is selected from a eukaryote, a vertebrate, a human, a mammal, a rodent, a bird, a reptile, a fish, an insect, a fungus, or a plant that is different from the first species.
- the engineered Arc or endo-Gag polypeptide comprises a cargo binding domain, a first CA domain, a second CA domain, and optionally a MA domain and/or a RT domain.
- the cargo binding domain, the first CA domain, and optionally a MA domain and/or a RT domain are from a first species and the second CA domain is from a second species.
- the first CA domain is from a first species and the cargo binding domain, the second CA domain, and optionally a MA domain and/or a RT domain are from a second species.
- the domains are arranged in an order that does not impede capsid assembly and cargo binding.
- each of the domains is either directly or indirectly fused to the respective two adjacent domains.
- the engineered Arc or endo-Gag polypeptide comprises a cargo binding domain, a first CA domain, and a second CA domain.
- the cargo binding domain and the first CA domain are from a first species and the second CA domain is from a second species.
- the first CA domain is from a first species and the cargo binding domain and the second CA domain are from a second species.
- the engineered Arc or endo-Gag polypeptide comprises from the N-terminus to the C-terminus the following domains: a cargo binding domain, a first CA domain, and a second CA domain.
- the engineered Arc or endo-Gag polypeptide comprises from the N-terminus to the C-terminus the following domains: a first CA domain, a cargo binding domain, and a second CA domain.
- the engineered Arc or endo-Gag polypeptide comprises from the N-terminus to the C-terminus the following domains: a first CA domain, a second CA domain, and a cargo binding domain.
- the domains are arranged in an order that does not impede capsid assembly and cargo binding.
- each of the domains is either directly or indirectly fused to the respective two flanking domains.
- the engineered Arc or endo-Gag polypeptide further comprises a second polypeptide.
- the second polypeptide is fused directly or indirectly via a linker to one or more of: a cargo binding domain, a first CA domain, a second CA domain, a MA domain if present, or a RT domain if present.
- the second polypeptide is a protein (e.g., a human protein), an antibody or binding fragment thereof, a viral protein, a Gag-like protein (e.g., a human Gag-like protein), or a de novo engineered protein designed to bind to a target receptor of interest.
- the antibody or binding fragment thereof comprises a humanized antibody or binding fragments thereof, a murine antibody or binding fragment thereof, a chimeric antibody or binding fragment thereof, a monoclonal antibody or binding fragment thereof, a multi-specific antibody or binding fragment thereof, a bispecific antibody or biding fragment thereof, a monovalent Fab’, a divalent Fab 2 , F(ab)' 3 fragments, a single-chain variable fragment (scFv), a bis-scFv, an (scFv) 2 , a diabody, a minibody, a nanobody, a triabody, a tetrabody, a disulfide stabilized Fv protein (dsFv), a single-domain antibody (sdAb), an Ig NAR, a camelid antibody or binding fragment thereof, or a chemically modified derivative thereof.
- the second polypeptide guides the delivery of a capsid formed by the engineered Arc polypeptide to a target site of interest.
- a nucleic acid sequence or amino acid sequence of the disclosure (for example, encoding an Arc polypeptide or endo-Gag polypeptide) has at least 70% homology, at least 71% homology, at least 72% homology, at least 73% homology, at least 74% homology, at least 75% homology, at least 76% homology, at least 77% homology, at least 78% homology, at least 79% homology, at least 80% homology, at least 81% homology, at least 82% homology, at least 83% homology, at least 84% homology, at least 85% homology, at least 86% homology, at least 87% homology, at least 88% homology, at least 89% homology, at least 90% homology, at least 91% homology, at least 92% homology, at least 93% homology, at least 94% homology, at least 95% homology, at least 96% homology, at least 97% homology, at least 98% homology, at least 99% homology
- the Arc polypeptide is a human polypeptide having the amino acid sequence of SEQ ID NO: 1 or a sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 1.
- the Arc polypeptide is a killer whale polypeptide having the amino acid sequence of SEQ ID NO: 2 or a sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 2.
- the Arc polypeptide is a white tailed deer polypeptide having the amino acid sequence of SEQ ID NO: 3 or a sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 3.
- the Arc polypeptide is a platypus polypeptide having the amino acid sequence of SEQ ID NO: 4 or a sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 4.
- the Arc polypeptide is a goose polypeptide having the amino acid sequence of SEQ ID NO: 5 or a sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 5.
- the Arc polypeptide is a Dalmatian pelican polypeptide having the amino acid sequence of SEQ ID NO: 6 or a sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 6.
- the Arc polypeptide is a white tailed eagle polypeptide having the amino acid sequence of SEQ ID NO: 7 or a sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 7.
- the Arc polypeptide is a king cobra polypeptide having the amino acid sequence of SEQ ID NO: 8 or a sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 8.
- the Arc polypeptide is a ray finned fish polypeptide having the amino acid sequence of SEQ ID NO: 9 or a sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 9.
- the Arc polypeptide is a sperm whale polypeptide having the amino acid sequence of SEQ ID NO: 10 or a sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 10.
- the Arc polypeptide is a turkey polypeptide having the amino acid sequence of SEQ ID NO: 11 or a sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 11.
- the Arc polypeptide is a central bearded dragon polypeptide having the amino acid sequence of SEQ ID NO: 12 or a sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 12.
- the Arc polypeptide is a Chinese alligator polypeptide having the amino acid sequence of SEQ ID NO: 13 or a sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 13.
- the Arc polypeptide is an American alligator polypeptide having the amino acid sequence of SEQ ID NO: 14 or a sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 14.
- the Arc polypeptide is a Japanese ko polypeptide having the amino acid sequence of SEQ ID NO: 15 or a sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 15.
- the endo-Gag polypeptide is a human PNMA3 polypeptide having the amino acid sequence of SEQ ID NO: 16 or a sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 16.
- the endo-Gag polypeptide is a human PNMA5 polypeptide having the amino acid sequence of SEQ ID NO: 17 or a sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 17.
- the endo-Gag polypeptide is a human PNMA6A polypeptide having the amino acid sequence of SEQ ID NO: 18 or a sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 18.
- the endo-Gag polypeptide is a human PNMA6B polypeptide having the amino acid sequence of SEQ ID NO: 19 or a sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 19.
- the endo-Gag polypeptide is a human RTL3 polypeptide having the amino acid sequence of SEQ ID NO: 20 or a sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 20.
- the endo-Gag polypeptide is a human RTL6 polypeptide having the amino acid sequence of SEQ ID NO: 21 or a sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 21.
- the endo-Gag polypeptide is a human RTL8A polypeptide having the amino acid sequence of SEQ ID NO: 22 or a sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 22.
- the endo-Gag polypeptide is a human RTL8B polypeptide having the amino acid sequence of SEQ ID NO: 23 or a sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 23.
- the endo-Gag polypeptide is a human BOP polypeptide having the amino acid sequence of SEQ ID NO: 24 or a sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 24.
- the endo-Gag polypeptide is a human LDOC1 polypeptide having the amino acid sequence of SEQ ID NO: 25 or a sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 25.
- the endo-Gag polypeptide is a human ZNF18 polypeptide having the amino acid sequence of SEQ ID NO: 26 or a sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 26.
- the endo-Gag polypeptide is a human MOAP1 polypeptide having the amino acid sequence of SEQ ID NO: 27 or a sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 27.
- the endo-Gag polypeptide is a human PEG10 polypeptide having the amino acid sequence of SEQ ID NO: 28 or a sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 28.
- the recombinant Arc or endo-Gag polypeptide is an Arc polypeptide illustrated in Fig. 1.
- the engineered Arc or endo-Gag polypeptide is an engineered Arc polypeptide illustrated in Fig. 2.
- a polypeptide of the disclosure comprises a linker.
- the linker is a peptide linker.
- the linker is a rigid linker.
- the linker is a flexible linker.
- the linker is a non-cleavable linker.
- the linker is a cleavable linker.
- the linker comprises a linear structure, or a non-linear structure (e.g., a cyclic structure).
- non-cleavable linkers comprise short peptides of varying lengths.
- exemplary non-cleavable linkers include (EAAAK)n (SEQ ID NO: 70), or (EAAAR)n (SEQ ID NO: 71), where n is from 1 to 5, and up to 30 residues of glutamic acid-proline or lysine- proline repeats.
- the non-cleavable linker comprises (GGGGS)n (SEQ ID NO: 72) or (GGGS)n (SEQ ID NO: 73), wherein n is 1 to 10; KESGS V S SEQL AQFRSLD (SEQ ID NO: 74); or EGKSSGSGSESKST (SEQ ID NO: 75).
- the non-cleavable linker comprises a poly-Gly/Ala polymer.
- the linker is a cleavable linker, e.g., an extracellular cleavable linker or an intracellular cleavable linker.
- the linker is designed for cleavage in the presence of particular conditions or in a particular environment (e.g., under physiological condition).
- the design of a linker for cleavage by specific conditions, such as by a specific enzyme allows the targeting of cellular uptake to a specific location.
- the linker is a pH-sensitive linker. In one instance, the linker is cleaved under basic pH conditions. In other instance, the linker is cleaved under acidic pH conditions.
- the linker is cleaved in vivo by endogenous enzymes (e.g., proteases) such as serine proteases including but not limited to thrombin, metalloproteases, furin, cathepsin B, necrotic enzymes (e.g., calpains), and the like.
- endogenous enzymes e.g., proteases
- serine proteases including but not limited to thrombin, metalloproteases, furin, cathepsin B, necrotic enzymes (e.g., calpains), and the like.
- Exemplary cleavable linkers include, but are not limited to, GGAANLVRGG (SEQ ID NO: 76); SGRIGFLRTA (SEQ ID NO: 77); SGRSA (SEQ ID NO: 78); GFLG (SEQ ID NO: 79); ALAL (SEQ ID NO: 80); FK; PIC(Et)F-F (SEQ ID NO: 81), where C(Et) indicates S-ethylcysteine; PR(S/T)(L/I)(S/T) (SEQ ID NO: 82); DEVD (SEQ ID NO: 83); GWEHDG (SEQ ID NO: 84); RPLALWRS (SEQ ID NO: 85); or a combination thereof.
- the capsid comprises an Arc polypeptide and/or an endo-Gag polypeptide such as a Copia protein, ASPRV1 protein, a protein from the SCAN domain family, a protein encoded by the Paraneoplastic Ma antigen family, a protein or a combination of proteins chosen from the retrotransposon Gag-like family, or a combination thereof.
- exemplary endo-Gag polypeptides are BOP, LDOC1, MOAP1, PEG 10, PNMA3, PNMA5, PNMA6A, PNMA6B, RTL3, RTL6, RTL8A, RTL8B, and ZNF18.
- the Arc polypeptide, the Copia protein, the ASPRV1 protein, the protein from the SCAN domain family, the protein encoded by the Paraneoplastic Ma antigen family, and the protein or a combination of proteins chosen from the retrotransposon Gag-like family are each independently a full-length polypeptide.
- the Arc polypeptide, the Copia protein, the ASPRV1 protein, the protein from the SCAN domain family, the protein encoded by the Paraneoplastic Ma antigen family, and the protein or a combination of proteins chosen from the retrotransposon Gag-like family are each independently a functional fragment thereof, e.g., that is capable of forming a subunit of a capsid.
- the capsid comprises an Arc-based capsid. In some embodiments, the capsid comprises an Arc-based capsid.
- the capsid comprises an endo-Gag-based capsid.
- the Arc-based and/or endo-Gag capsid comprises a plurality of recombinant Arc polypeptides and/or endo-Gag polypeptides described above, a plurality of engineered Arc polypeptides and/or endo-Gag polypeptides described above, or a combination thereof.
- the Arc-based capsid comprises a plurality of recombinant Arc polypeptides.
- the Arc-based capsid comprises a plurality of engineered Arc polypeptides.
- the endo-Gag-based capsid comprises a plurality of recombinant endo-Gag polypeptides. In other cases, the endo-Gag-based capsid comprises a plurality of engineered endo-Gag polypeptides.
- the Arc-based or endo-Gag-based capsid comprises a first plurality of Arc and/or endo-Gag polypeptides from a first species and a second plurality of Arc and/or endo-Gag polypeptides from at least a second species.
- the first species is selected from a eukaryote, a vertebrate, a human, a mammal, a rodent, a bird, a reptile, a fish, an insect, a fungus, or a plant.
- the second species is selected from a eukaryote, a vertebrate, a human, a mammal, a rodent, a bird, a reptile, a fish, an insect, a fungus, or a plant that is different from the first species.
- the ratio of the first plurality of Arc or endo-Gag polypeptides to the second plurality of Arc or endo-Gag polypeptides is 1 : 1, 2: 1, 3: 1, 4: 1, 5: 1, 6: 1, 7: 1, 8: 1, 9: 1, 10: 1, 20: 1, 50: 1, or 100: 1. In some cases, the ratio of the first plurality of Arc or endo-Gag polypeptides to the second plurality of Arc or endo-Gag polypeptides is 1 : 1. In some cases, the ratio of the first plurality of Arc or endo-Gag polypeptides to the second plurality of Arc or endo-Gag polypeptides is 2: 1.
- the ratio of the first plurality of Arc or endo-Gag polypeptides to the second plurality of Arc or endo-Gag polypeptides is 4: 1. In some cases, the ratio of the first plurality of Arc or endo-Gag polypeptides to the second plurality of Arc or endo-Gag polypeptides is 5: 1. In some cases, the ratio of the first plurality of Arc or endo-Gag polypeptides to the second plurality of Arc or endo-Gag polypeptides is 8: 1. In some cases, the ratio of the first plurality of Arc or endo- Gag polypeptides to the second plurality of Arc polypeptides is 10: 1.
- the ratio of the first plurality of Arc or endo-Gag polypeptides to the second plurality of Arc or endo-Gag polypeptides is 20: 1. In some cases, the ratio of the first plurality of Arc or endo-Gag polypeptides to the second plurality of Arc or endo-Gag polypeptides is 50: 1. In some cases, the ratio of the first plurality of Arc or endo-Gag polypeptides to the second plurality of Arc or endo-Gag polypeptides is 100: 1. In some instances, the ratio is the comparison in molar concentration. In some instances, the ratio is the comparison in the number of capsid forming subunits (e.g., each of the or engineered Arc polypeptide forms a capsid subunit).
- the ratio of the first plurality of Arc or endo-Gag polypeptides to the second plurality of Arc or endo-Gag polypeptides is 1 :2, 1 :3, 1 :4, 1 :5, 1 :6, 1 :7, 1 :8, 1 :9, 1 : 10, 1 :20, or 1 :50. In some cases, the ratio of the first plurality of Arc or endo-Gag polypeptides to the second plurality of Arc or endo-Gag polypeptides is 1 :2.
- the ratio of the first plurality of Arc or endo-Gag polypeptides to the second plurality of Arc or endo-Gag polypeptides is 1 :5. In some cases, the ratio of the first plurality of Arc or endo-Gag polypeptides to the second plurality of Arc or endo-Gag polypeptides is 1 :8. In some cases, the ratio of the first plurality of Arc or endo- Gag polypeptides to the second plurality of Arc or endo-Gag polypeptides is 1 :10.
- the ratio of the first plurality of Arc or endo-Gag polypeptides to the second plurality of Arc or endo-Gag polypeptides is 1 :20. In some cases, the ratio of the first plurality of Arc or endo-Gag polypeptides to the second plurality of Arc or endo-Gag polypeptides is 1 :50. In some instances, the ratio is the comparison in molar concentration. In some instances, the ratio is the comparison in the number of capsid forming subunits (e.g., each of the recombinant or engineered Arc or endo-Gag polypeptide forms a capsid subunit).
- the Arc-based capsid or endo-Gag-based capsid comprises a plurality of recombinant or engineered Arc polypeptides and a plurality of non-Arc proteins.
- non-Arc proteins include but are not limited to, Copia, ASPRV1, a protein or a combination of proteins chosen from the SCAN domain family, a protein or a combination of proteins chosen from the Paraneoplastic Ma antigen family, and a protein or a combination of proteins chosen from the retrotransposon Gag-like family.
- Exemplary species of non-Arc proteins include BOP, LDOC1, MOAP1, PEG10, PNMA3, PNMA5, PNMA6A, PNMA6B, RTL3, RTL6, RTL8A, RTL8B, and ZNF18.
- the ratio of the plurality of recombinant or engineered Arc polypeptides to the plurality of non-Arc proteins is 1 : 1, 2: 1, 3: 1, 4: 1, 5: 1, 6:1, 7: 1, 8: 1, 9: 1, 10: 1, 20: 1, 50: 1, or 100: 1. In some cases, the ratio of the plurality of recombinant or engineered Arc polypeptides to the plurality of non-Arc proteins is 1 : 1. In some cases, the ratio of the plurality of recombinant or engineered Arc polypeptides to the plurality of non-Arc proteins is 2: 1.
- the ratio of the plurality of recombinant or engineered Arc polypeptides to the plurality of non-Arc proteins is 4: 1. In some cases, the ratio of the plurality of recombinant or engineered Arc polypeptides to the plurality of non-Arc proteins is 5: 1. In some cases, the ratio of the plurality of recombinant or engineered Arc polypeptides to the plurality of non-Arc proteins is 8: 1. In some cases, the ratio of the plurality of recombinant or engineered Arc polypeptides to the plurality of non-Arc proteins is 10: 1.
- the ratio of the plurality of recombinant or engineered Arc polypeptides to the plurality of non-Arc proteins is 20: 1. In some cases, the ratio of the plurality of recombinant or engineered Arc polypeptides to the plurality of non-Arc proteins is 50: 1. In some cases, the ratio of the plurality of recombinant or engineered Arc polypeptides to the plurality of non-Arc proteins is 100: 1. In some instances, the ratio is the comparison in molar concentration. In some instances, the ratio is the comparison in the number of capsid forming subunits (e.g., each of the recombinant or engineered Arc polypeptide forms a capsid subunit).
- the ratio of the plurality of recombinant or engineered Arc polypeptides to the plurality of non -Arc proteins is 1 :2, 1 :3, 1 :4, 1 :5, 1 :6, 1 :7, 1 :8, 1 :9, 1 : 10, 1 :20, or 1 :50. In some cases, the ratio of the plurality of recombinant or engineered Arc polypeptides to the plurality of non-Arc proteins is 1 :2. In some cases, the ratio of the plurality of recombinant or engineered Arc polypeptides to the plurality of non-Arc proteins is 1 : 5.
- the ratio of the plurality of recombinant or engineered Arc polypeptides to the plurality of non-Arc proteins is 1 :8. In some cases, the ratio of the plurality of recombinant or engineered Arc polypeptides to the plurality of non-Arc proteins is 1 : 10. In some cases, the ratio of the plurality of recombinant or engineered Arc polypeptides to the plurality of non-Arc proteins is 1 :20. In some cases, the ratio of the plurality of recombinant or engineered Arc polypeptides to the plurality of non-Arc proteins is 1 :50. In some instances, the ratio is the comparison in molar concentration. In some instances, the ratio is the comparison in the number of capsid forming subunits (e.g., each of the recombinant or engineered Arc polypeptide forms a capsid subunit).
- the capsid has a diameter of at least 1 nm, or more. In some instances, the capsid has a diameter of at least 2nm, 3nm, 4nm, 5nm, lOnm, l5nm, 20nm, 25nm, 30nm, 40nm, 50nm, 60nm, 70nm, 80nm, 90nm, lOOnm, l50nm, 200nm, 300nm, 400nm, 500nm, 600nm, or more. In some instances, the capsid has a diameter of at least 5nm, or more. In some cases, the capsid has a diameter of at least lOnm, or more.
- the capsid has a diameter of at least 20nm, or more. In some cases, the capsid has a diameter of at least 30nm, or more. In some cases, the capsid has a diameter of at least 40nm, or more. In some cases, the capsid has a diameter of at least 50nm, or more. In some cases, the capsid has a diameter of at least 80nm, or more. In some cases, the capsid has a diameter of at least lOOnm, or more. In some cases, the capsid has a diameter of at least 200nm, or more. In some cases, the capsid has a diameter of at least 300nm, or more.
- the capsid has a diameter of at least 400nm, or more. In some cases, the capsid has a diameter of at least 500nm, or more. In some cases, the capsid has a diameter of at least 600nm, or more.
- the capsid has a diameter of at most 1 nm, or less. In some instances, the capsid has a diameter of at most 2nm, 3nm, 4nm, 5nm, lOnm, l5nm, 20nm, 25nm, 30nm, 40nm, 50nm, 60nm, 70nm, 80nm, 90nm, lOOnm, l50nm, 200nm, 300nm, 400nm, 500nm, 600nm, or less. In some instances, the capsid has a diameter of at most 5nm, or less. In some cases, the capsid has a diameter of at most lOnm, or less.
- the capsid has a diameter of at most 20nm, or less. In some cases, the capsid has a diameter of at most 30nm, or less. In some cases, the capsid has a diameter of at least 40nm, or less. In some cases, the capsid has a diameter of at least 50nm, or less. In some cases, the capsid has a diameter of at least 80nm, or less. In some cases, the capsid has a diameter of at least lOOnm, or less. In some cases, the capsid has a diameter of at least 200nm, or less. In some cases, the capsid has a diameter of at least 300nm, or less.
- the capsid has a diameter of at least 400nm, or less. In some cases, the capsid has a diameter of at least 500nm, or less. In some cases, the capsid has a diameter of at least 600nm, or less.
- the capsid has a diameter of about lnm, 2nm, 3nm, 4nm, 5nm, lOnm, l5nm, 20nm, 25nm, 30nm, 40nm, 50nm, 60nm, 70nm, 80nm, 90nm, lOOnm, l50nm,
- the capsid has a diameter of about 5nm. In some cases, the capsid has a diameter of about lOnm. In some instances, the capsid has a diameter of about 20nm. In some cases, the capsid has a diameter of about 30nm. In some cases, the capsid has a diameter of about 40nm. In some cases, the capsid has a diameter of about 50nm.
- the capsid has a diameter of about 80nm. In some cases, the capsid has a diameter of about lOOnm. In some cases, the capsid has a diameter of about 200nm. In some cases, the capsid has a diameter of about 300nm. In some cases, the capsid has a diameter of about 400nm. In some cases, the capsid has a diameter of about 500nm. In some cases, the capsid has a diameter of about 600nm.
- the capsid has a diameter of from about lnm to about 600nm. In some instances, the capsid has a diameter of from about 2nm to about 500nm, from about 2nm to about 400nm, from about 2nm to about 300nm, from about 2nm to about 200nm, from about 2nm to about lOOnm, from about 2nm to about 50nm, from about 2nm to about 30nm, from about 20nm to about 400nm, from about 20nm to about 300nm, from about 20nm to about 200nm, from about 20nm to about lOOnm, from about 20nm to about 50nm, from about 20nm to about 30nm, from about 30nm to about 500nm, from about 30nm to about 400nm, from about 30nm to about 300nm, from about 30nm to about 200nm, from about 30nm to about lOOnm, from about 30nm to about 50
- the capsid has a reduced off-target effect.
- the off- target effect is less than 10%, 5%, 4%, 3%, 2%, 1%, or 0.5%. In some cases, the off-target effect is no more than 10%, 5%, 4%, 3%, 2%, 1%, or 0.5%.
- the capsid does not have an off-target effect.
- the formation of Arc and/or endo-Gag-based capsids occurs either ex vivo or in vitro.
- the Arc and/or endo-Gag-based capsids is assembled in vivo.
- the Arc and/or endo-Gag-based capsids is stable at room temperature.
- the Arc and/or endo-Gag-based capsids is empty. In other cases, the Arc and/or endo-Gag-based capsids is loaded (for example, loaded with a cargo and/or a therapeutic agent, e.g., a DNA or an RNA).
- a therapeutic agent e.g., a DNA or an RNA
- the Arc and/or endo-Gag-based capsids is stable at a temperature from about 2°C to about 37°C. In some instances, the Arc and/or endo-Gag-based capsids is stable at a temperature from about 2°C to about 8°C, about 2°C to about 4°C, about 20°C to about 37°C, about 25°C to about 37°C, about 20°C to about 30°C, about 25°C to about 30°C, or about 30°C to about 37°C. In some cases, the Arc and/or endo-Gag-based capsid is empty. In other cases, the Arc and/or endo-Gag-based capsids is loaded (for example, loaded with a cargo and/or a therapeutic agent, e.g., a DNA or an RNA).
- a therapeutic agent e.g., a DNA or an RNA
- the Arc and/or endo-Gag-based capsids is stable for at least about 1 day, 2 days, 4 days, 5 days, 7 days, 14 days, 28 days, 30 days, 60 days, 2 months, 3 months, 4 months, 5 months, 6 months, 12 months, 18 months, 24 months, 3 years, 5 years, or longer.
- the Arc and/or endo-Gag-based capsids has minimum degradation, e.g., less than 10%, 5%, 4%, 3%, 2%, 1%, 0.5% based on the total population of the Arc and/or endo-Gag-based capsids that is degraded.
- the Arc and/or endo-Gag-based capsid is empty. In other cases, the Arc and/or endo-Gag-based capsids is loaded (for example, loaded with a therapeutic agent, e.g., a DNA or an RNA).
- a therapeutic agent e.g., a DNA or an RNA
- the capsid comprises the Copia protein.
- the Copia protein is from Drosophila melanogaster (UniProtKB - P04146), Ceratitis capitate
- the capsid comprises the protein ASPRV1.
- the ASPRV1 protein is a structural protein that participates in the development and maintenance of the skin barrier.
- the protein ASPRV1 is from Homo sapiens (UniProtKB - Q53RT3).
- the capsid comprises a protein from the SCAN domain family.
- SCAN domain is a superfamily of zinc finger transcription factors. SCAN domain is also known as leucine rich region (LeR) and functions as protein interaction domain that mediates self-association or selective association with other proteins.
- the capsid comprises a protein from the Paraneoplastic Ma antigen family.
- the Paraneoplastic Ma antigen family comprises about 14 members of neuro- and testis-specific proteins.
- the capsid comprises a protein encoded by a Retrotransposon Gag-like gene.
- the capsid comprises BOP, LDOC1, MOAP1, PEG10, PNMA3, PNMA5, PNMA6A, PNMA6B, RTL3, RTL6, RTL8A, RTL8B, and/or ZNF 18.
- a composition of the disclosure (for example, a capsid) comprises a cargo.
- the cargo is a therapeutic agent.
- the cargo is a nucleic acid molecule, a small molecule, a protein, a peptide, an antibody or binding fragment thereof, a peptidomimetic, or a nucleotidomimetic.
- the cargo is a therapeutic cargo, comprising e.g., one or more drugs.
- the cargo comprises a diagnostic tool, for profiling, e.g., one or more markers (such as markers associates with one or more disease phenotypes).
- the cargo comprises an imaging tool.
- the cargo is a nucleic acid molecule.
- exemplary nucleic acid molecules include DNA, RNA, or a mixture of DNA and RNA.
- the nucleic acid molecule is a DNA polymer.
- the DNA is a single stranded DNA polymer.
- the DNA is a double stranded DNA polymer.
- the DNA is a hybrid of single and double stranded DNA polymer.
- the nucleic acid molecule is a RNA polymer, e.g., a single stranded RNA polymer, a double stranded RNA polymer, or a hybrid of single and double stranded RNA polymers.
- the RNA comprises and/or encodes an antisense
- oligoribonucleotide a siRNA, an mRNA, a tRNA, an rRNA, a snRNA, a shRNA, microRNA, or a non-coding RNA.
- the nucleic acid molecule comprises a hybrid of DNA and RNA.
- the nucleic acid molecule is an antisense oligonucleotide, optionally comprising DNA, RNA, or a hybrid of DNA and RNA.
- the nucleic acid molecule comprises and/or encodes an mRNA molecule.
- the nucleic acid molecule comprises and/or encodes an RNAi molecule.
- the RNAi molecule is a microRNA (miRNA) molecule.
- the RNAi molecule is a siRNA molecule.
- the miRNA and/or siRNA are optionally double-stranded or as a hairpin, and further optionally encapsulated as precursor molecules.
- the nucleic acid molecule is for use in a nucleic acid-based therapy.
- the nucleic acid molecule is for regulating gene expression (e.g., modulating mRNA translation or degradation), modulating RNA splicing, or RNA interference.
- the nucleic acid molecule comprises and/or encodes an antisense oligonucleotide, microRNA molecule, siRNA molecule, mRNA molecule, for use in regulation of gene expression, modulating RNA splicing, or RNA interference.
- the nucleic acid molecule is for use in gene editing.
- Exemplary gene editing systems include, but are not limited to, CRISPR-Cas systems, zinc finger nuclease (ZFN) systems, and transcription activator-like effector nuclease (TALEN) systems.
- the nucleic acid molecule comprises and/or encodes a component involved in the CRISPR-Cas systems, ZFN systems, or the TALEN systems.
- the nucleic acid molecule is for use in antigen production for therapeutic and/or prophylactic vaccine production.
- the nucleic acid molecule encodes an antigen that is expressed and elicits a desirable immune response (e.g., a pro-inflammatory immune response, an anti-inflammatory immune response, an B cell response, an antibody response, a T cell response, a CD4+ T cell response, a CD8+ T cell response, a Thl immune response, a Th2 immune response, a Thl7 immune response, a Treg immune response, or a combination thereof).
- a desirable immune response e.g., a pro-inflammatory immune response, an anti-inflammatory immune response, an B cell response, an antibody response, a T cell response, a CD4+ T cell response, a CD8+ T cell response, a Thl immune response, a Th2 immune response, a Thl7 immune response, a Treg immune response, or a combination thereof.
- the nucleic acid molecule comprises a nucleic acid enzyme.
- Nucleic acid enzymes are RNA molecules (e.g., ribozymes) or DNA molecules (e.g., deoxyribozymes) that have catalytic activities.
- the nucleic acid molecule is a ribozyme. In other instances, the nucleic acid molecule is a deoxyribozyme.
- the nucleic acid molecule is a MNAzyme, which functions as a biosensor and/or a molecular switch (see, e.g., Mokany, et ak, “MNAzymes, a versatile new class of nucleic acid enzymes that can function as biosensors and molecular switches,” JACS 132(2): 1051-1059 (2010)).
- exemplary targets of the nucleic acid molecule include, but are not limited to, UL123 (human cytomegalovirus), APOB , AR (androgen receptor) gene, KRAS , PCSK9, CFTR, and SMN (e.g., SMN2).
- the nucleic acid molecule is at least 5 nucleotides or more in length. In some instances, the nucleic acid molecule is at least 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16,
- the nucleic acid molecule is at least 10 nucleotides or more in length. In some instances, the nucleic acid molecule is at least 12 nucleotides or more in length. In some instances, the nucleic acid molecule is at least 15 nucleotides or more in length. In some instances, the nucleic acid molecule is at least 18 nucleotides or more in length. In some instances, the nucleic acid molecule is at least 19 nucleotides or more in length. In some instances, the nucleic acid molecule is at least 20 nucleotides or more in length.
- the nucleic acid molecule is at least 21 nucleotides or more in length. In some instances, the nucleic acid molecule is at least 22 nucleotides or more in length. In some instances, the nucleic acid molecule is at least 23 nucleotides or more in length. In some instances, the nucleic acid molecule is at least 24
- nucleic acid molecule is at least 25
- nucleic acid molecule is at least 26
- nucleic acid molecule is at least 27
- nucleic acid molecule is at least 28
- nucleic acid molecule is at least 29
- nucleic acid molecule is at least 30
- nucleic acid molecule is at least 40
- nucleic acid molecule is at least 50
- nucleic acid molecule is at least 100 nucleotides or more in length. In some instances, the nucleic acid molecule is at least 200 nucleotides or more in length. In some instances, the nucleic acid molecule is at least 300 nucleotides or more in length. In some instances, the nucleic acid molecule is at least 500 nucleotides or more in length. In some instances, the nucleic acid molecule is at least 1000 nucleotides or more in length. In some instances, the nucleic acid molecule is at least 2000 nucleotides or more in length. In some instances, the nucleic acid molecule is at least 3000 nucleotides or more in length.
- the nucleic acid molecule is at least 4000 nucleotides or more in length. In some instances, the nucleic acid molecule is at least 5000 nucleotides or more in length. In some instances, the nucleic acid molecule is at least 8000 nucleotides or more in length.
- the nucleic acid molecule is at most 12 nucleotides or less in length. In some instances, the nucleic acid molecule is at most 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 400, 500, 1000,
- the nucleic acid molecule is at most 15 nucleotides or less in length. In some instances, the nucleic acid molecule is at most 18 nucleotides or less in length. In some instances, the nucleic acid molecule is at most 19 nucleotides or less in length. In some instances, the nucleic acid molecule is at most 20 nucleotides or less in length. In some instances, the nucleic acid molecule is at most 21 nucleotides or less in length. In some instances, the nucleic acid molecule is at most 22 nucleotides or less in length.
- the nucleic acid molecule is at most 23 nucleotides or less in length. In some instances, the nucleic acid molecule is at most 24 nucleotides or less in length. In some instances, the nucleic acid molecule is at most 25 nucleotides or less in length. In some instances, the nucleic acid molecule is at most 26 nucleotides or less in length. In some instances, the nucleic acid molecule is at most 27 nucleotides or less in length. In some instances, the nucleic acid molecule is at most 28 nucleotides or less in length. In some instances, the nucleic acid molecule is at most 29 nucleotides or less in length.
- the nucleic acid molecule is at most 30 nucleotides or less in length. In some instances, the nucleic acid molecule is at most 40 nucleotides or less in length. In some instances, the nucleic acid molecule is at most 50 nucleotides or less in length. In some instances, the nucleic acid molecule is at most 100 nucleotides or less in length. In some instances, the nucleic acid molecule is at most 200 nucleotides or less in length. In some instances, the nucleic acid molecule is at most 300 nucleotides or less in length. In some instances, the nucleic acid molecule is at most 500 nucleotides or less in length.
- the nucleic acid molecule is at most 1000 nucleotides or less in length. In some instances, the nucleic acid molecule is at most 2000 nucleotides or less in length. In some instances, the nucleic acid molecule is at most 3000 nucleotides or less in length. In some instances, the nucleic acid molecule is at most 4000 nucleotides or less in length. In some instances, the nucleic acid molecule is at most 5000 nucleotides or less in length. In some instances, the nucleic acid molecule is at most 8000 nucleotides or less in length.
- the nucleic acid molecule is about 5 nucleotides in length. In some instances, the nucleic acid molecule is about 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19,
- the nucleic acid molecule is about 10 nucleotides in length. In some instances, the nucleic acid molecule is about 12 nucleotides in length. In some instances, the nucleic acid molecule is about 15 nucleotides in length. In some instances, the nucleic acid molecule is about 18 nucleotides in length. In some instances, the nucleic acid molecule is about 19 nucleotides in length.
- the nucleic acid molecule is about 20 nucleotides in length. In some instances, the nucleic acid molecule is about 21 nucleotides in length. In some instances, the nucleic acid molecule is about 22 nucleotides in length. In some instances, the nucleic acid molecule is about 23 nucleotides in length. In some instances, the nucleic acid molecule is about 24 nucleotides in length. In some instances, the nucleic acid molecule is about 25 nucleotides in length. In some instances, the nucleic acid molecule is about 26 nucleotides in length. In some instances, the nucleic acid molecule is about 27 nucleotides in length.
- the nucleic acid molecule is about 28 nucleotides in length. In some instances, the nucleic acid molecule is about 29 nucleotides in length. In some instances, the nucleic acid molecule is about 30 nucleotides in length. In some instances, the nucleic acid molecule is about 40 nucleotides in length. In some instances, the nucleic acid molecule is about 50 nucleotides in length. In some instances, the nucleic acid molecule is about 100 nucleotides in length. In some instances, the nucleic acid molecule is about 200 nucleotides in length. In some instances, the nucleic acid molecule is about 300 nucleotides in length.
- the nucleic acid molecule is about 500 nucleotides in length. In some instances, the nucleic acid molecule is about 1000 nucleotides in length. In some instances, the nucleic acid molecule is about 2000 nucleotides in length. In some instances, the nucleic acid molecule is about 3000 nucleotides in length. In some instances, the nucleic acid molecule is about 4000 nucleotides in length. In some instances, the nucleic acid molecule is about 5000 nucleotides in length. In some instances, the nucleic acid molecule is about 8000 nucleotides in length.
- the nucleic acid molecule is from about 5 to about 10,000 nucleotides in length. In some instances, the nucleic acid molecule is from about 5 to about 9000 nucleotides in length, from about 5 to about 8000 nucleotides in length, from about 5 to about 7000 nucleotides in length, from about 5 to about 6000 nucleotides in length, from about 5 to about 5000 nucleotides in length, from about 5 to about 4000 nucleotides in length, from about 5 to about 3000 nucleotides in length, from about 5 to about 2000 nucleotides in length, from about 5 to about 1000 nucleotides in length, from about 5 to about 500 nucleotides in length, from about 5 to about 100 nucleotides in length, from about 5 to about 50 nucleotides in length, from about 5 to about 40 nucleotides in length, from about 5 to about 30 nucleotides in length, from about 5 to about 25 nucleo
- the nucleic acid molecule comprises natural, synthetic, or artificial nucleotide analogues or bases. In some cases, the nucleic acid molecule comprises combinations of DNA, RNA and/or nucleotide analogues. In some instances, the synthetic or artificial nucleotide analogues or bases comprise modifications at one or more of ribose moiety, phosphate moiety, nucleoside moiety, or a combination thereof.
- a nucleotide analogue or artificial nucleotide base described above comprises a nucleic acid with a modification at a T hydroxyl group of the ribose moiety.
- the modification includes an H, OR, R, halo, SH, SR, NH2, NHR, NR2, or CN, wherein R is an alkyl moiety.
- alkyl moiety includes, but is not limited to, halogens, sulfurs, thiols, thioethers, thioesters, amines (primary, secondary, or tertiary), amides, ethers, esters, alcohols and oxygen.
- the alkyl moiety further comprises a modification.
- the modification comprises an azo group, a keto group, an aldehyde group, a carboxyl group, a nitro group, a nitroso, group, a nitrile group, a heterocycle (e.g., imidazole, hydrazino or hydroxyl amino) group, an isocyanate or cyanate group, or a sulfur containing group (e.g., sulfoxide, sulfone, sulfide, or disulfide).
- the alkyl moiety further comprises a hetero substitution.
- the carbon of the heterocyclic group is substituted by a nitrogen, oxygen or sulfur.
- the heterocyclic substitution includes but is not limited to, morpholino, imidazole, and pyrrolidino.
- the modification at the T hydroxyl group is a 2’-0-methyl modification or a 2’-0-methoxyethyl (2’-0-MOE) modification.
- the 2’-0-methyl modification adds a methyl group to the T hydroxyl group of the ribose moiety whereas the 2 ⁇ - methoxyethyl modification adds a methoxyethyl group to the hydroxyl group of the ribose moiety.
- the modification at the T hydroxyl group is a 2’-0-aminopropyl modification in which an extended amine group comprising a propyl linker binds the amine group to the T oxygen.
- this modification neutralizes the phosphate-derived overall negative charge of the oligonucleotide molecule by introducing one positive charge from the amine group per sugar and thereby improves cellular uptake properties due to its zwitterionic properties.
- the modification at the T hydroxyl group is a locked or bridged ribose modification (e.g., locked nucleic acid or LNA) in which the oxygen molecule bound at the T carbon is linked to the 4’ carbon by a methylene group, thus forming a 2'-C,4'-C-oxy-methylene- linked bicyclic ribonucleotide monomer.
- a locked or bridged ribose modification e.g., locked nucleic acid or LNA
- additional modifications at the T hydroxyl group include 2'- deoxy, T-deoxy-2'-fluoro, 2'-0-aminopropyl (2'-0-AP), 2'-0-dimethylaminoethyl (2'-0-DMAOE), 2'-0-dimethylaminopropyl (2'-0-DMAP), T-O- dimethylaminoethyloxyethyl (2'-0-DMAEOE), or 2'-0-N-methylacetamido (2'-0-NMA).
- a nucleotide analogue comprises a modified base such as, but not limited to, 5-propynyluridine, 5-propynylcytidine, 6- methyladenine, 6-methylguanine, N, N, - dimethyladenine, 2-propyladenine, 2propyl guanine, 2-aminoadenine, l-methylinosine, 3- methyluridine, 5-methylcytidine, 5-methyluridine and other nucleotides having a modification at the 5 position, 5- (2- amino) propyl uridine, 5-halocytidine, 5-halouridine, 4-acetylcytidine, 1- methyladenosine, 2-methyladenosine, 3 -methyl cyti dine, 6-methyluridine, 2- methylguanosine, 7- methylguanosine, 2, 2-dimethylguanosine, 5- methylaminoethyluridine, 5-methyloxyuridine,
- a modified base such as
- Modified nucleotides also include those nucleotides that are modified with respect to the sugar moiety, as well as nucleotides having sugars or analogs thereof that are not ribosyl.
- the sugar moieties in some cases are or are based on, mannoses, arabinoses, glucopyranoses, galactopyranoses, 4'-thioribose, and other sugars, heterocycles, or carbocycles.
- nucleotide also includes universal bases.
- universal bases include but are not limited to 3-nitropyrrole, 5-nitroindole, or nebularine.
- a nucleotide analogue further comprises a morpholino, a peptide nucleic acid (PNA), a methylphosphonate nucleotide, a thiolphosphonate nucleotide, a 2’-fluoro N3-P5’-phosphoramidite, or a , 5’- anhydrohexitol nucleic acid (HNA).
- PNA peptide nucleic acid
- HNA 2’-fluoro N3-P5’-phosphoramidite
- HNA anhydrohexitol nucleic acid
- Morpholino or phosphorodiamidate morpholino oligo comprises synthetic molecules whose structure mimics natural nucleic acid structure but deviates from the normal sugar and phosphate structures.
- the five member ribose ring is substituted with a six member morpholino ring containing four carbons, one nitrogen, and one oxygen.
- the ribose monomers are linked by a phosphordiamidate group instead of a phosphate group.
- the backbone alterations remove all positive and negative charges making morpholinos neutral molecules capable of crossing cellular membranes without the aid of cellular delivery agents such as those used by charged oligonucleotides.
- peptide nucleic acid does not contain sugar ring or phosphate linkage and the bases are attached and appropriately spaced by oligoglycine-like molecules, therefore, eliminating a backbone charge.
- modified intemucleotide linkage includes, but is not limited to, phosphorothioates; phosphorodithioates; methylphosphonates; 5'- alkylenephosphonates; 5'- methylphosphonate; 3'-alkylene phosphonates; borontrifluoridates; borano phosphate esters and selenophosphates of 3'-5'linkage or 2'-5'linkage; phosphotriesters; thionoalkylphosphotriesters; hydrogen phosphonate linkages; alkyl phosphonates; alkylphosphonothioates;
- arylphosphonothioates phosphoroselenoates; phosphorodiselenoates; phosphinates;
- thionophosphoramidates phosphoropiperazidates; phosphoroanilothioates; phosphoroanilidates; ketones; sulfones; sulfonamides; carbonates; carbamates; methylenehydrazos;
- methylenemethyliminos thioamidates
- linkages with riboacetyl groups aminoethyl glycine
- silyl or siloxane linkages alkyl or cycloalkyl linkages with or without heteroatoms of, for example, 1 to 10 carbons that are saturated or unsaturated and/or substituted and/or contain heteroatoms
- one or more modifications comprise a modified phosphate backbone in which the modification generates a neutral or uncharged backbone.
- the phosphate backbone is modified by alkylation to generate an uncharged or neutral phosphate backbone.
- alkylation includes methylation, ethylation, and propylation.
- an alkyl group refers to a linear or branched saturated hydrocarbon group containing from 1 to 6 carbon atoms.
- exemplary alkyl groups include, but are not limited to, methyl, ethyl, n-propyl, isopropyl, n-butyl, isobutyl, sec-butyl, tert-butyl, n- pentyl, isopentyl, neopentyl, hexyl, isohexyl, 1, 1 -dimethylbutyl, 2,2- dimethylbutyl, 3.3- dimethylbutyl, and 2-ethylbutyl groups.
- a modified phosphate is a phosphate group as described in U.S. Patent No. 9481905.
- additional modified phosphate backbones comprise
- the modified phosphate is methylphosphonate, ethylphosphonate, methylthiophosphonate, or methoxyphosphonate.
- the modified phosphate is methylphosphonate.
- the modified phosphate is ethylphosphonate.
- the modified phosphate is methylthiophosphonate.
- the modified phosphate is methoxyphosphonate.
- one or more modifications further optionally include
- the 3’ terminus optionally include a
- the 3’-terminus is optionally conjugated with an aminoalkyl group, e.g., a 3’ C5- aminoalkyl dT.
- the 3’ -terminus is optionally conjugated with an abasic site, e.g., with an apurinic or apyrimidinic site.
- the S’-terminus is conjugated with an aminoalkyl group, e.g., a 5’ -O-alkyl amino substituent.
- the 5’-terminus is conjugated with an abasic site, e.g., with an apurinic or apyrimidinic site.
- exemplary nucleic acid cargos include, but are not limited to, Fomivirsen, Mipomersen, AZD5312 (AstraZeneca), Nusinersen, and SB010 (Sterna Biologicals).
- the cargo is a small molecule.
- the small molecule is an inhibitor (e.g., a pan inhibitor or a selective inhibitor).
- the small molecule is an activator.
- the small molecule is an agonist, antagonist, a partial agonist, a mixed agonist/antagonist, or a competitive antagonist.
- the small molecule is a drug that falls under the class of analgesics, antianxiety drugs, antiarrhythmics, antibacterials, antibiotics, anticoagulants and thrombolytics, anticonvulsants, antidepressants, antidiarrheals, antiemetics, antifungals, antihistamines, antihypertensives, anti-inflammatories, antineoplastics, antipsychotics, antipyretics, antivirals, barbiturates, beta-blockers, bronchodilators, cold cures, corticosteroids, cough suppressants, cytotoxics, decongestants, diuretics, expectorant, hormones, hypoglycemics, immunosuppressives, laxatives, muscle relaxants, sex hormones, sleeping drugs, or tranquilizers.
- analgesics antianxiety drugs, antiarrhythmics, antibacterials, antibiotics, anticoagulants and thrombolytics, anticonvulsants, antidepressants, anti
- the small molecule is an inhibitor, e.g., an inhibitor of a kinase pathway such as the Tyrosine kinase pathway or a Serine/Threonine kinase pathway.
- the small molecule is a dual protein kinase inhibitor.
- the small molecule is a lipid kinase inhibitor.
- the small molecule is a neuraminidase inhibitor.
- the small molecule is a carbonic anhydrase inhibitor.
- exemplary targets of the small molecule include, but are not limited to, vascular endothelial growth factor receptor 1 (VEGFR1), vascular endothelial growth factor receptor 2 (VEGFR2), vascular endothelial growth factor receptor 3 (VEGFR3), fibroblast growth factor receptor 1 (FGFR1), fibroblast growth factor receptor 2 (FGFR2), fibroblast growth factor receptor 3 (FGFR3), fibroblast growth factor receptor 4 (FGFR4), cyclin-dependent kinase 4 (CDK4), cyclin-dependent kinase 6 (CDK6), a receptor tyrosine kinase, a phosphoinositide 3- kinase (PI3K) isoform (e.g., PI3K5, also known as pl 105), Janus kinase 1 (JAK1), Janus kinase 3 (JAK3), a receptor from the family of platelet-derived growth factor receptors (PDFG-
- the small molecule targets a viral protein, e.g., a viral envelope protein. In some embodiments, the small molecule decreases viral adsorption to a host cell. In some embodiments, the small molecule decreases viral entry into a host cell. In some embodiments, the small molecule decreases viral replication in a host or a host cell. In some embodiments, the small molecule decreases viral assembly.
- a viral protein e.g., a viral envelope protein.
- the small molecule decreases viral adsorption to a host cell. In some embodiments, the small molecule decreases viral entry into a host cell. In some embodiments, the small molecule decreases viral replication in a host or a host cell. In some embodiments, the small molecule decreases viral assembly.
- exemplary small molecule cargos include, but are not limited to, lenvatinib, palbociclib, regorafenib, idelalisib, tofacitinib, nintedanib, zanamivir, ethoxzol amide, and artemisinin.
- the cargo is a protein.
- the protein is a full- length protein.
- the protein is a fragment, e.g., a functional fragment.
- the protein is a naturally occurring protein.
- the protein is a de novo engineered protein.
- the protein is a fusion protein.
- the protein is a recombinant protein.
- Exemplary proteins include, but are not limited to, Fc fusion proteins, anticoagulants, blood factors, bone morphogenetic proteins, enzymes, growth factors, hormones, interferons, interleukins, and thrombolytics.
- the protein is for use in an enzyme replacement therapy.
- the protein is for use in antigen production for therapeutic and/or prophylactic vaccine production.
- the protein comprises an antigen that elicits a desirable immune response (e.g., a pro-inflammatory immune response, an anti-inflammatory immune response, an B cell response, an antibody response, a T cell response, a CD4+ T cell response, a CD8+ T cell response, a Thl immune response, a Th2 immune response, a Thl7 immune response, a Treg immune response, or a combination thereof).
- a desirable immune response e.g., a pro-inflammatory immune response, an anti-inflammatory immune response, an B cell response, an antibody response, a T cell response, a CD4+ T cell response, a CD8+ T cell response, a Thl immune response, a Th2 immune response, a Thl7 immune response, a Treg immune response, or a combination thereof.
- exemplary protein cargos include, but are not limited to, romiplostim, liraglutide, a human growth hormone (rHGH), human insulin (BHI), follicle-stimulating hormone (FSH), Factor VIII, erythropoietin (EPO), granulocyte colony-stimulating factor (G-CSF), alpha- galactosidase A, alpha-L-iduronidase, N-acetylgalactosamine-4-sulfatase, domase alfa, tissue plasminogen activator (TP A), glucocerebrosidase, interferon-beta-la, insulin-like growth factor 1 (IGF-l), or rasburicase.
- rHGH human growth hormone
- BHI human insulin
- FSH follicle-stimulating hormone
- FSH follicle-stimulating hormone
- EPO erythropoietin
- G-CSF
- the cargo is a peptide.
- the peptide is a naturally occurring peptide.
- the peptide is an artificial engineered peptide or a recombinant peptide.
- the peptide targets a G-protein coupled receptor, an ion channel, a microbe, an anti-microbial target, a catalytic or other Ig-family of receptors, an intracellular target, a membrane-anchored target, or an extracellular target.
- the peptide comprises at least 2 amino acids. In some cases, the peptide comprises at least 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100 amino acids. In some cases, the peptide comprises at least 10 amino acids. In some cases, the peptide comprises at least 15 amino acids. In some cases, the peptide comprises at least 20 amino acids. In some cases, the peptide comprises at least 30 amino acids. In some cases, the peptide comprises at least 40 amino acids. In some cases, the peptide comprises at least 50 amino acids. In some cases, the peptide comprises at least 60 amino acids. In some cases, the peptide comprises at least 70 amino acids. In some cases, the peptide comprises at least 80 amino acids. In some cases, the peptide comprises at least 90 amino acids. In some cases, the peptide comprises at least 100 amino acids.
- the peptide comprises at most 3 amino acids. In some cases, the peptide comprises at most 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100 amino acids. In some cases, the peptide comprises at most 10 amino acids. In some cases, the peptide comprises at most 15 amino acids. In some cases, the peptide comprises at most 20 amino acids. In some cases, the peptide comprises at most 30 amino acids. In some cases, the peptide comprises at most 40 amino acids. In some cases, the peptide comprises at most 50 amino acids. In some cases, the peptide comprises at most 60 amino acids. In some cases, the peptide comprises at most 70 amino acids. In some cases, the peptide comprises at most 80 amino acids. In some cases, the peptide comprises at most 90 amino acids. In some cases, the peptide comprises at most 100 amino acids.
- the peptide comprises from about 1 to about 10 kDa. In some cases, the peptide comprises from about 1 to about 9 kDa, about 1 to about 6 kDa, about 1 to about 5 kDa, about 1 to about 4 kDa, about 1 to about 3 kDa, about 2 to about 8 kDa, about 2 to about 6 kDa, about 2 to about 4 kDa, about 1.2 to about 2.8 kDa, about 1.5 to about 2.5 kDa, or about 1.5 to about 2 kDa.
- the peptide is a cyclic peptide.
- the cyclic peptide is a macrocyclic peptide.
- the cyclic peptide is a constrained peptide.
- the cyclic peptides are assembled with varied linkages, such as for example, head-to-taii, head - to -side- chain, side-chain-to-tail, and side-chain--to--side-chain linkages.
- a cyclic peptide e.g., a macrocyclic or a constrained peptide
- a cyclic peptide (e.g., a macrocyclic or a constrained peptide) ranges from about 10 amino acids to about 100 amino acids, from about 10 amino acids to about 70 amino acids, or from about 10 amino acids to about 50 amino acids.
- the peptide is for use in antigen production for therapeutic and/or prophylactic vaccine production.
- the peptide comprises an antigen that elicits a desirable immune response (e.g., a pro-inflammatory immune response, an anti-inflammatory immune response, an B cell response, an antibody response, a T cell response, a CD4+ T cell response, a CD8+ T cell response, a Thl immune response, a Th2 immune response, a Thl7 immune response, a Treg immune response, or a combination thereof).
- a desirable immune response e.g., a pro-inflammatory immune response, an anti-inflammatory immune response, an B cell response, an antibody response, a T cell response, a CD4+ T cell response, a CD8+ T cell response, a Thl immune response, a Th2 immune response, a Thl7 immune response, a Treg immune response, or a combination thereof.
- the peptide comprises natural amino acids, unnatural amino acids, or a combination thereof.
- an amino acid residue refers to a molecule containing both an amino group and a carboxyl group.
- Suitable amino acids include, without limitation, both the D- and L-isomers of the naturally-occurring amino acids, as well as non- naturally occurring amino acids prepared by organic synthesis or other metabolic routes.
- amino acid as used herein, includes, without limitation, a-amino acids, natural amino acids, non natural amino acids, and amino acid analogs.
- a-amino acid refers to a molecule containing both an amino group and a carboxyl group bound to a carbon which is designated the a-carbon.
- b-amino acid refers to a molecule containing both an amino group and a carboxyl group in a b configuration.
- an amino acid analog is a racemic mixture.
- the D isomer of the amino acid analog is used.
- the L isomer of the amino acid analog is used.
- the amino acid analog comprises chiral centers that are in the R or S configuration.
- exemplary peptide cargos include, but are not limited to, peginesatide, insulin, adrenocorticotropic hormone (ACTH), calcitonin, oxytocin, vasopressin, octreolide, and leuprorelin.
- exemplary peptide cargos include, but are not limited to, Telavancin, Dalbavancin, Oritavancin, Anidulafungin, Lanreotide, Pasireotide, Romidepsin, Linaclotide, and Peginesatide.
- the cargo is an antibody or a binding fragment thereof.
- the antibody or binding fragment thereof comprises a humanized antibody or binding fragment thereof, murine antibody or binding fragment thereof, chimeric antibody or binding fragment thereof, monoclonal antibody or binding fragment thereof, bispecific antibody or biding fragment thereof, monovalent Fab’, divalent Fab 2 , F(ab)' 3 fragments, single-chain variable fragment (scFv), bis-scFv, (scFv) 2 , diabody, minibody, nanobody, triabody, tetrabody, disulfide stabilized Fv protein (dsFv), single-domain antibody (sdAb), Ig NAR, camelid antibody or binding fragment thereof, or a chemically modified derivative thereof.
- the antibody or binding fragment thereof recognizes a cell surface protein.
- the cell surface protein is an antigen expressed by a cancerous cell.
- the cell surface protein is a neoepitope.
- the cell surface protein comprises one or more mutations compared to a wild-type protein.
- Exemplary cancer antigens include, but are not limited to, alpha fetoprotein, ASLG659, B7-H3, BAFF-R, Brevican, CA125 (MUC16), CA15-3, CA19-9, carcinoembryonic antigen (CEA), CA242, CRIPTO (CR, CR1,
- CRGF CRGF, CRIPTO, TDGF1, teratocarcinoma-derived growth factor
- CTLA-4 CXCR5, El 6 (LAT1, SLC7A5)
- FcRH2 IFGP4, IRTA4, SPAP1 A (SH2 domain containing phosphatase anchor protein la), SPAP1B, SPAP1C), epidermal growth factor, ETBR, Fc receptor-like protein 1 (FCRH1), GEDA, HLA-DOB (Beta subunit of MHC class II molecule (la antigen), human chorionic gonadotropin, ICOS, IL-2 receptor, IL20Ra, Immunoglobulin superfamily receptor translocation associated 2 (IRTA2), L6, Lewis Y, Lewis X, MAGE-l, MAGE-2, MAGE-3, MAGE 4, MART1, mesothelin, MDP, MPF (SMR, MSLN), MCP1 (CCL2), macrophage inhibitory factor (MIF),
- MIF macro
- MPG MSG783, mucin, MUC1-KLH, Napi3b (SLC34A2), nectin-4, Neu oncogene product, NCA, placental alkaline phosphatase, prostate specific membrane antigen (PMSA), prostatic acid phosphatase, PSCA hlg, anti-transferrin receptor, p97, Purinergic receptor P2X ligand-gated ion channel 5 (P2X5), LY64 (Lymphocyte antigen 64 (RP105), gplOO, P21, six transmembrane epithelial antigen of prostate (STEAP1), STEAP2, Serna 5b, tumor-associated glycoprotein 72 (TAG-72), TrpM4 (BR22450, FLJ20041, TRPM4, TRPM4B, transient receptor potential cation channel, subfamily M, member 4) and the like.
- PMSA prostate specific membrane antigen
- P2X5 Purinergic receptor P2X ligand-gated ion
- the cell surface protein comprises clusters of differentiation (CD) cell surface markers.
- CD cell surface markers include, but are not limited to, CD1, CD2, CD3, CD4, CD5, CD6, CD7, CD8, CD9, CD10, CDl la, CDl lb, CDl lc, CDl ld, CDwl2, CD13, CD 14, CD 15, CDl5s, CD16, CDwl7, CD18, CD19, CD20, CD21, CD22, CD23, CD24, CD25, CD26, CD27, CD28, CD29, CD30, CD31, CD32, CD33, CD34, CD35, CD36, CD37, CD38,
- exemplary antibodies or binding fragments thereof include, but are not limited to, zalutumumab (HuMax-EFGr, Genmab), abagovomab (Menarini), abituzumab (Merck), adecatumumab (MT201), alacizumab pegol, alemtuzumab (Campath®, MabCampath, or Campath-lH; Leukosite), AlloMune (BioTransplant), amatuximab (Morphotek, Inc.), anti-VEGF (Genetech), anatumomab mafenatox, apolizumab (hulDlO), ascrinvacumab (Pfizer Inc.), atezolizumab (MPDL3280A; Genentech/Roche), B43.13 (OvaRex, AltaRex Corporation), basiliximab (Simulect®, Novartis), belimumab (
- nesvacumab (Regeneron Pharmaceuticals), nimotuzumab (h-R3, BIOMAb EGFR, TheraCIM, Theraloc, or CIMAher; Biotech Pharmaceutical Co.), nivolumab (Opdivo®, Bristol-Myers Squibb), obinutuzumab (Gazyva or Gazyvaro; Hoffmann-La Roche), ocaratuzumab (AME-l33v, LY2469298; Mentrik Biotech, LLC), ofatumumab (Arzerra®, Genmab), onartuzumab (Genentech), Ontuxizumab (Morphotek, Inc.), oregovomab (OvaRex®, AltaRex Corp.), otlertuzumab (Emergent BioSolutions), panitumumab (ABX-EGF, Amgen), pankomab (Glycotope GMBH
- the antibody or binding fragments thereof is an antibody-drug conjugate (ADC).
- the payload of the ADC comprises, for example, but is not limited to, an auristatin derivative, maytansine, a maytansinoid, a taxane, a calicheamicin, cemadotin, a duocarmycin, a pyrrolobenzodiazepine (PDB), or a tubulysin.
- the payload comprises monomethyl auristatin E (MMAE) or monomethyl auristatin F (MMAF).
- the payload comprises DM2 (mertansine) or DM4.
- the payload comprises a pyrrolobenzodiazepine dimer.
- the cargo is a peptidomimetic.
- a peptidomimetic is a small protein-like polymer designed to mimic a peptide.
- the peptidomimetic comprises D-peptides.
- the peptidomimetic comprises L-peptides.
- peptidomimetics include peptoids and b-peptides.
- the cargo is a nucleotidomimetic.
- the Arc polypeptides, endo-Gag polypeptides, engineered Arc and engineered endo-Gag polypeptides described supra are encoded by plasmid vectors.
- vectors include any suitable vectors derived from either a eukaryotic or prokaryotic sources.
- vectors are obtained from bacteria (e.g. E. coli ), insects, yeast (e.g. Pichia pastoris ), algae, or mammalian sources.
- Exemplary bacterial vectors include pACYCl77, pASK75, pBAD vector series, pBADM vector series, pET vector series, pETM vector series, pGEX vector series, pHAT, pHAT2, pMal-c2, pMal-p2, pQE vector series, pRSET A, pRSET B, pRSET C, pTrcHis2 series, pZA3 l- Luc, pZE2l-MCS-l, pFLAG ATS, pFLAG CTS, pFLAG MAC, pFLAG Shift-l2c, pTAC-MAT-l, pFLAG CTC, or pTAC-MAT-2.
- Exemplary insect vectors include pFastBacl, pFastBac DETAL, pFastBac ET, pFastBac HTa, pFastBac HTb, pFastBac HTc, pFastBac M30a, pFastBact M30b, pFastBac, M30c, pVLl392, pVLl393, pVLl393 M10, pVLl393 Ml l, pVLl393 M12, FLAG vectors such as pPolh-FLAGl or pPolh-MAT 2, or MAT vectors such as pPolh-MATl, or pPolh-MAT2.
- FLAG vectors such as pPolh-FLAGl or pPolh-MAT 2
- MAT vectors such as pPolh-MATl, or pPolh
- yeast vectors include Gateway ® pDEST TM 14 vector, Gateway ® pDEST TM 15 vector, Gateway ® pDEST TM 17 vector, Gateway ® pDEST TM 24 vector, Gateway ® pYES-DEST52 vector, pBAD-DEST49 Gateway ® destination vector, pA08l5 Pichia vector, pFLDl Pichi pastoris vector, pGAPZA,B, & C Pichia pastoris vector, pPIC3.5K Pichia vector, pPIC6 A, B, &
- Pichia vector pPIC9K Pichia vector, pTEFl/Zeo, pYES2 yeast vector, pYES2/CT yeast vector, pYES2/NT A, B, & C yeast vector, or pYES3/CT yeast vector.
- Exemplary algae vectors include pChlamy-4 vector or MCS vector.
- mammalian vectors include transient expression vectors or stable expression vectors.
- Mammalian transient expression vectors include p3xFLAG-CMV 8, pFLAG- Myc-CMV 19, pFLAG-Myc-CMV 23, pFLAG-CMV 2, pFLAG-CMV 6a,b,c, pFLAG-CMV 5.1, pFLAG-CMV 5a,b,c, p3xFLAG-CMV 7.1, pFLAG-CMV 20, p3xFLAG-Myc-CMV 24, pCMV- FLAG-MAT1, pCMV-FLAG-MAT2, pBICEP-CMV 3, or pBICEP-CMV 4.
- Mammalian stable expression vector include pFLAG-CMV 3, p3xFLAG-CMV 9, p3xFLAG-CMV 13, pFLAG-Myc- CMV 21, p3xFLAG-Myc-CMV 25, pFLAG-CMV 4, p3xFLAG-CMV 10, p3xFLAG-CMV 14, pFLAG-Myc-CMV 22, p3xFLAG-Myc-CMV 26, pBICEP-CMV 1, or pBICEP-CMV 2.
- a cell-free system is a mixture of cytoplas ic and/or nuclear components from a cell and is used for in vitro nucleic acid synthesis.
- a cell-free system utilizes either prokaryotic cell components or eukaryotic cell components.
- a nucleic acid synthesis is obtained in a cell-free system based on for example Drosophila cell, Xenopus egg, or HeLa cells (ATCC® CCL-2TM).
- Exemplary cell-free systems include, but are not limited to, E. coli S30 Extract system, E. coli T7 S30 system, or PURExpress®.
- a host cell includes any suitable cell such as a naturally derived cell or a genetically modified cell.
- a host cell is a production host cell.
- a host cell is a eukaryotic cell.
- a host cell is a prokaryotic cell.
- a eukaryotic cell includes fungi (e.g., a yeast cell), an animal cell, or a plant cell.
- a prokaryotic cell is a bacterial cell. Examples of bacterial cell include gram-positive bacteria or gram-negative bacteria. In some embodiments the gram-negative bacteria is anaerobic, rod-shaped, or both.
- gram-positive bacteria include Actinobacteria, Firmicutes or Tenericutes.
- gram-negative bacteria include Aquifwae, Deinococcus-Thermus, Fibrobacteres Chlorobi/Bacteroidetes (FCB group), Fusobacteria, Gemmatimonadetes,
- bacteria is Acidobacteria, Chloroflexi, Chrysiogenetes, Cyanobacteria, Deferribacteres, Dictyoglomi, Thermodesulfobacteria or
- a bacterial cell is Escherichia coli , Clostridium botulinum, or Coli bacilli.
- Exemplary prokaryotic host cells include, but are not limited to, BL21, MachlTM, DH10BTM, TOP10, DH5a, DHlOBacTM, OmniMaxTM, MegaXTM, DH12STM, INV110, TOP10F’, INVaF, TOP10/P3, ccdB Survival, PIR1, PIR2, Stbl2TM, Stbl3TM, or Stbl4TM.
- animal cells include a cell from a vertebrate or from an invertebrate.
- an animal cell includes a cell from a marine invertebrate, fish, insects, amphibian, reptile, mammal, or human.
- a fungus cell includes a yeast cell, such as brewer’s yeast, baker’s yeast, or wine yeast.
- Fungi include ascomycetes such as yeast, mold, filamentous fungi, basidiomycetes, or zygomycetes.
- yeast includes Ascomycota or Basidiomycota.
- Ascomycota includes Saccharomycotina (true yeasts, e.g. Saccharomyces cerevisiae (baker’s yeast)) or Taphrinomycotina (e.g. Schizosaccharomycetes (fission yeasts)).
- Basidiomycota includes Agaricomycotina (e.g. Tremellomycetes) or Pucciniomycotina (e.g.
- Exemplary yeast or filamentous fungi include, for example, the genus: Saccharomyces, Schizosaccharomyces, Candida, Pichia, Hansenula, Kluyveromyces, Zygosaccharomyces,
- yeast or filamentous fungi include, for example, the species: Saccharomyces cerevisiae,
- Exemplary yeast host cells include, but are not limited to, Pichia pastoris yeast strains such as GS115, KM71H, SMD1168, SMD1168H, and X-33; and Saccharomyces cerevisiae yeast strain such as INVScl.
- additional animal cells include cells obtained from a mollusk, arthropod, annelid or sponge.
- an additional animal cell is a mammalian cell, e.g., from a human, primate, ape, equine, bovine, porcine, canine, feline or rodent.
- a rodent includes mouse, rat, hamster, gerbil, hamster, chinchilla, fancy rat, or guinea pig.
- Exemplary mammalian host cells include, but are not limited to, 293 A cell line, 293FT cell line, 293F cells , 293 H cells, CHO DG44 cells, CHO-S cells, CHO-K1 cells, Expi293FTM cells, Flp-InTM T-RExTM 293 cell line, Flp-InTM-293 cell line, Flp-InTM-3T3 cell line, Flp-InTM-BHK cell line, Flp-InTM-CHO cell line, Flp-InTM-CV-l cell line, Flp-InTM-Jurkat cell line, FreeStyleTM
- 293 -F cells FreeStyleTM CHO-S cells, GripTiteTM 293 MSR cell line, GS-CHO cell line, HepaRGTM cells, T-RExTM Jurkat cell line, Per.C6 cells, T-RExTM-293 cell line, T-RExTM-CHO cell line, and T-RExTM-HeLa cell line.
- a mammalian host cell is a primary cell.
- a mammalian host cell is a stable cell line, or a cell line that has incorporated a genetic material of interest into its own genome and has the capability to express the product of the genetic material after many generations of cell division.
- a mammalian host cell is a transient cell line, or a cell line that has not incorporated a genetic material of interest into its own genome and does not have the capability to express the product of the genetic material after many generations of cell division.
- Exemplary insect host cell include, but are not limited to, Drosophila S2 cells, Sf9 cells, Sf2l cells, High FiveTM cells, and expresSF+® cells.
- plant cells include a cell from algae.
- Exemplary insect cell lines include, but are not limited to, strains from Chlamydomonas reinhardtii 137c, or Synechococcus elongatus PPC 7942.
- the method comprises incubating a plurality of Arc or endo-Gag polypeptides, engineered Arc or endo-Gag polypeptides, and/or recombinant Arc or endo-Gag polypeptides with a cargo in a solution for a time sufficient to generate a loaded Arc- based capsid or endo-Gag-based capsid.
- the method comprises mixing a solution comprising a plurality of engineered and/or recombinant Arc polypeptides with a plurality of non-Arc capsid forming subunits prior to incubating with the cargo.
- the plurality of non-Arc capsid forming subunits are mixed with the plurality of engineered and/or recombinant Arc polypeptides at a ratio of 1 : 1, 2: 1, 3: 1, 4: 1, 5: 1, 6: 1, 7: 1, 8: 1, 9: 1, or 10: 1.
- the plurality of non-Arc capsid forming subunits are mixed with the plurality of engineered and/or recombinant Arc polypeptides at a ratio of 1:2, 1 :3, 1 :4, 1 :5, 1 :6, 1 :7, 1 :8, 1 :9, or 1 : 10.
- the time sufficient to generate a loaded Arc-based capsid or endo-Gag- based capsid is at least about 5 minutes, at least about 10 minutes, at least about 20 minutes, at least about 30 minutes, at least about 1 hour, at least about 2 hours, at least about 4 hours, at least about 6 hours, at least about 10 hours, at least about 12 hours, at least about 24 hours, or more.
- the Arc-based capsid or endo-Gag-based capsid is prepared at a temperature from about 2°C to about 37°C. In some instances, the Arc-based capsid or endo-Gag-based capsid is prepared at a temperature from about 2°C to about 8°C, about 2°C to about 4°C, about 20°C to about 37°C, about 25°C to about 37°C, about 20°C to about 30°C, about 25°C to about 30°C, or about 30°C to about 37°C.
- the Arc-based capsid or endo-Gag-based capsid is prepared at room temperature.
- the Arc-based capsid or endo-Gag-based capsid is further formulated for systemic administration.
- the Arc-based capsid or endo-Gag-based capsid is further formulated for local administration.
- the Arc-based capsid or endo-Gag-based capsid is further formulated for parenteral (e.g., intra-arterial, intra-articular, intradermal, intralesional, intramuscular, intraocular, intraosseous infusion, intraperitoneal, intrathecal, intravenous, intravitreal, or subcutaneous) administration.
- parenteral e.g., intra-arterial, intra-articular, intradermal, intralesional, intramuscular, intraocular, intraosseous infusion, intraperitoneal, intrathecal, intravenous, intravitreal, or subcutaneous
- the Arc-based capsid or endo-Gag-based capsid is further formulated for topical administration.
- the Arc-based capsid or endo-Gag-based capsid is further formulated for oral administration.
- the Arc-based capsid or endo-Gag-based capsid is further formulated for sublingual administration.
- the Arc-based capsid or endo-Gag-based capsid is further formulated for aerosol administration.
- an Arc-based capsid or endo- Gag-based capsid for delivery of a cargo to a site of interest.
- the method comprises contacting a cell at the site of interest with an Arc-based capsid or endo-Gag-based capsid for a time sufficient to facilitate cellular uptake of the capsid.
- the cell is a muscle cell, a skin cell, a blood cell, or an immune cell (e.g., a T cell or a B cell).
- an immune cell e.g., a T cell or a B cell.
- the cell is a tumor cell, e.g., a solid tumor cell or a cell from a hematologic malignancy.
- the solid tumor cell is a cell from a bladder cancer, breast cancer, brain cancer, colorectal cancer, kidney cancer, liver cancer, lung cancer, pancreatic cancer, prostate cancer, skin cancer, stomach cancer, or thyroid cancer.
- the cell from a hematologic malignancy is from a B-cell malignancy or a T-cell malignancy.
- the cell is from a leukeuma, a lymphoma, a myeloma, chronic lymphocytic leukemia (CLL), small lymphocytic lymphoma (SLL), diffuse large B cell lymphoma (DLBCL), follicular lymphoma, mantle cell lymphoma, Burkitt lymphoma, cutaneous T-cell lymphoma, peripheral T cell lymphoma, multiple myeloma, plasmacyto a, acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), or chronic myeloid leukemia (CML).
- ALL acute lymphoblastic leukemia
- AML acute myeloid leukemia
- CML chronic myeloid leukemia
- the cell is a somatic cell.
- the cell is a blood cell, a skin cell, a connective tissue cell, a bone cell, a muscle cell, or a cell from an organ.
- the cell is an epithelial cell, a connective tissue cell, a muscular cell, or a neuron.
- the cell is an endodermal cell, a mesodermal cell, or an ectodermal.
- the endoderm comprises cells of the respiratory system, the intestine, the liver, the gallbladder, the pancreas, the islets of Langerhans, the thyroid, or the hindgut.
- the mesoderm comprises osteochondroprogenitor cells, muscle cells, cells from the digestive system, renal stem cells, cells from the reproductive system, cells from the circulatory system (such as endothelial cells).
- Exemplary cells from the ectoderm comprise epithelial cells, cells of the anterior pituitary, cells of the peripheral nervous system, cells of the neuroendocrine system, cells of the eyes, cells of the central nervous system, cells of the ependymal, or cells of the pineal gland.
- cells derived from the central and peripheral nervous system comprise neurons, Schwann cells, satellite glial cells, oligodendrocytes, or astrocytes. In some cases, neurons further comprise intemeurons, pyramidal neurons, gabaergic neurons, dopaminergic neurons,
- serotoninergic neurons glutamatergic neurons, motor neurons from the spinal cord, or inhibitory spinal neurons.
- the cell is a stem cell or a progenitor cell. In some cases, the cell is a mesenchymal stem or progenitor cell. In other cases, the cell is a hematopoietic stem or progenitor cell.
- a target protein is overexpressed or is depleted in the cell. In some cases, the target protein is overexpressed in the cell. In additional cases, the target protein is depleted in the cell.
- a target gene in the cell has one or more mutations.
- the cell comprises an impaired splicing mechanism.
- the Arc-based capsid is administered systemically to a subject in need thereof.
- the Arc-based capsid or endo-Gag-based capsid is administered locally to a subject in need thereof.
- the Arc-based capsid or endo-Gag-based capsid is administered parenterally, orally, topically, via sublingual, or by aerosol to a subject in need thereof.
- the Arc-based capsid or endo-Gag-based capsid is administered parenterally to a subject in need thereof.
- the Arc-based capsid or endo-Gag-based capsid is administered orally to a subject in need thereof.
- the Arc-based capsid or endo-Gag-based capsid is administered topically, via sublingual, or by aerosol to a subject in need thereof.
- a delivery component is combined with an Arc-based capsid or endo-Gag-based capsid for a targeted delivery to a site of interest.
- the delivery component comprises a carrier, e.g., an extracellular vesicle such as a micelle, a liposome, or a microvesicle; or a viral envelope.
- the delivery component serves as a primary delivery vehicle for an Arc-based capsid or endo-Gag-based capsid which does not comprise its own delivery component (e.g., in which the second polypeptide is not present).
- the delivery component directs the Arc-based capsid or endo-Gag-based capsid to a target site of interest and optionally facilitates intracellular uptake.
- the delivery component enhances target specificity and/or sensitivity of an Arc-based capsid’s second polypeptide.
- the delivery component enhances the specificity and/or affinity of the Arc-based capsid or endo-Gag-based capsid to the target site.
- the delivery components enhances the specificity and/or affinity by about 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, lO-fold, 20-fold, 30-fold, 50-fold, lOO-fold, 200-fold, 500-fold, or more.
- the delivery components enhances the specificity and/or affinity by about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 200%, 500%, or more. Further still, the delivery component optionally minimizes off-target effect by about 2- fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, lO-fold, 20-fold, 30-fold, 50-fold, 100- fold, 200-fold, 500-fold, or more. Further still, the delivery component optionally minimizes off- target effect by about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 200%, 500%, or more.
- the delivery component serves as a first vehicle that transports an Arc-based capsid to a general target region (e.g., a tumor microenvironment) and the Arc-based or endo-Gag-based capsid’s second polypeptide serves as a second delivery molecule that drives the Arc-based capsid or endo-Gag-based capsid to the specific target site and optionally facilitates intracellular uptake.
- the delivery component minimizes off-target effect by about 2- fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, lO-fold, 20-fold, 30-fold, 50-fold, 100- fold, 200-fold, 500-fold, or more.
- the delivery component minimizes off-target effect by about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 200%, 500%, or more.
- the delivery component serves as a first vehicle that transports an Arc-based capsid to a target site of interest and the Arc-based or endo-Gag-based capsid’s second polypeptide serves as a second delivery molecule that facilitates intracellular uptake.
- the delivery component comprises an extracellular vesicle.
- the extracellular vesicle comprises a microvesicle, a liposome, or a micelle.
- the extracellular vesicle has a diameter of from about 10 nm to about 2000 nm, from about 10 nm to about 1000 nm, from about lOnm to about 800nm, from about 20nm to about 600nm, from about 30nm to about 500nm, from about 50nm to about 200nm, or from about 80nm to about lOOnm.
- the delivery component comprises a microvesicle.
- microvesicle Also known as circulating microvesicles or microparticles, microvesicles are membrane-bound vesicles that comprise phospholipids.
- the microvesicle has a diameter of from about 50nm to about lOOOnm, from about lOOnm to about 800nm, from about 200nm to about 500nm, or from about 50nm to about 400nm.
- the microvesicle is originated from cell membrane inversion, exocytosis, shedding, blebbing, or budding.
- the microvesicles are generated from differentiated cells.
- the microvesicles are generated from undifferentiated cells, e.g., by blast cells, progenitor cells, or stem cells.
- the delivery component comprises a liposome.
- the liposome comprises a plurality of lipopeptides, which are presented on the surface of the liposome, for targeted delivery to a site or region of interest.
- the liposomes fuse with the target cell, whereby the contents of the liposome are then emptied into the target cell.
- a liposome is endocytosed by cells that are phagocytic. Endocytosis is then followed by intralysosomal degradation of liposomal lipids and release of the encapsulated agents.
- Exemplary liposomes suitable for incorporation include, and are not limited to, multilamellar vesicles (MLV), oligolamellar vesicles (OLV), unilamellar vesicles (UV), small unilamellar vesicles (SETV), medium-sized unilamellar vesicles (METV), large unilamellar vesicles (LETV), giant unilamellar vesicles (GUV), multivesicular vesicles (MVV), single or oligolamellar vesicles made by reverse-phase evaporation method (REV), multilamellar vesicles made by the reverse-phase evaporation method (MLV-REV), stable plurilamellar vesicles (SPLV), frozen and thawed MLV (FATMLV), vesicles prepared by extrusion methods (VET), vesicles prepared by French press (FPV), vesicles prepared
- a liposome comprises Amphipol (A8-35).
- Techniques for preparing liposomes are described in, for example, COLLOIDAL DRUG DELIVERY SYSTEMS, vol. 66 (J. Kreuter ed., Marcel Dekker, Inc. (1994)).
- liposomes are unilamellar or multilamellar, and vary in size with diameters ranging from about 20nm to greater than about lOOOnm.
- liposomes provided herein also comprise carrier lipids.
- the carrier lipids are phospholipids.
- Carrier lipids capable of forming liposomes include, but are not limited to, dipalmitoylphosphatidylcholine (DPPC), phosphatidylcholine (PC; lecithin), phosphatidic acid (PA), phosphatidylglycerol (PG), phosphatidylethanolamine (PE), or phosphatidylserine (PS).
- DPPC dipalmitoylphosphatidylcholine
- PC phosphatidylcholine
- PG phosphatidylglycerol
- PE phosphatidylethanolamine
- PS phosphatidylserine
- Other suitable phospholipids further include
- DSPC distearoylphosphatidylcholine
- DMPC dimyristoylphosphatidylcholine
- DPPG dipalmitoylphosphatidyglycerol
- DSPG distearoylphosphatidyglycerol
- DMPG dimyristoylphosphatidylglycerol
- DPP A dipalmitoylphosphatidic acid
- DMPA dimyristoylphosphatidic acid
- DSP A distearoylphosphatidic acid
- DPPS dipalmitoylphosphatidylserine
- DMPS dimyristoylphosphatidylserine
- DSPS distearoylphosphatidylserine
- DPPE dipalmitoylphosphatidyethanolamine
- the liposomes further comprise a sterol (e.g., cholesterol) which modulates liposome formation.
- a sterol e.g., cholesterol
- the carrier lipids are optionally any non phosphate polar lipids.
- the delivery component comprises a micelle.
- the micelle has a diameter from about 2nm to about 250nm, from about 20nm to about 200nm, from about 20nm to about lOOnm, or from about 50 to about lOOnm.
- the micelle is a polymeric micelle, characterized by a core shell structure, in which the hydrophobic core is surrounded by a hydrophilic shell.
- the hydrophilic shell further comprises a hydrophilic polymer or copolymer and a pH sensitive component.
- hydrophilic polymers or copolymers include, but are not limited to, poly(N- substituted acrylamides), poly(N-acryloyl pyrrolidine), poly(N-acryloyl piperidine), poly(N-acryl- L-amino acid amides), poly(ethyl oxazoline), methylcellulose, hydroxypropyl acrylate,
- hydroxyalkyl cellulose derivatives and poly(vinyl alcohol), poly(N-isopropylacrylamide), poly(N- vinyl-2-pyrrolidone), polyethyleneglycol derivatives, and combinations thereof.
- the pH-sensitive moiety includes, but is not limited to, an alkylacrylic acid such as methacrylic acid, ethylacrylic acid, propyl acrylic acid and butyl acrylic acid, or an amino acid such as glutamic acid.
- the hydrophobic moiety constitutes the core of the micelle and includes, for example, a single alkyl chain, such as octadecyl acrylate or a double chain alkyl compound such as phosphatidylethanolamine or dioctadecylamine.
- the hydrophobic moiety is optionally a water insoluble polymer such as a poly(lactic acid) or a poly(e-caprolactone).
- Polymeric micelles exhibiting pH-sensitive properties are also contemplated and are formed, e.g., by using pH-sensitive polymers including, but not limited to, copolymers from methacrylic acid, methacrylic acid esters and acrylic acid esters, polyvinyl acetate phthalate, hydroxypropyl methyl cellulose phthalate, cellulose acetate phthalate, or cellulose acetate trimellitate.
- pH-sensitive polymers including, but not limited to, copolymers from methacrylic acid, methacrylic acid esters and acrylic acid esters, polyvinyl acetate phthalate, hydroxypropyl methyl cellulose phthalate, cellulose acetate phthalate, or cellulose acetate trimellitate.
- the delivery component comprises a viral envelope.
- Viral envelopes comprise glycoproteins, phospholipids, and additional proteins obtained from a host.
- the viral envelope is permissive to a wide range of target cells.
- the viral envelope is non-permissive and is specific to a target cell of interest.
- the viral envelope comprises a cell-specific binding protein and optionally a fusogenic molecule that aids in the fusion of the cargo into a target cell.
- the viral envelope comprises an endogenous viral envelope.
- the viral envelope is a modified envelop, comprising one or more foreign proteins.
- the viral envelope is derived from a DNA virus.
- Exemplary enveloped DNA viruses include viruses from the family of Herpesviridae , Poxviridae , and
- the viral envelope is derived from an RNA virus.
- RNA viruses include viruses from the family of Bunyaviridae, Coronaviridae,
- the viral envelope is derived from a virus from the family of Retroviridae .
- the viral envelope is from an oncolytic virus, such as an oncolytic DNA virus from the family of Herpesviridae (for example, HSV1) or Poxviridae (for example, Vaccinia virus and yxo a virus); or an oncolytic RNA virus from the family of
- an oncolytic virus such as an oncolytic DNA virus from the family of Herpesviridae (for example, HSV1) or Poxviridae (for example, Vaccinia virus and yxo a virus); or an oncolytic RNA virus from the family of
- Rhabdoviridae for example, VSV
- Paramyxoviridae for example MV and NDV
- the viral envelope further comprises a foreign or engineered protein that binds to an antigen or a cell surface molecule.
- antigens and cell surface molecules for targeting include, but are not limited to, P-glycoprotein, Her2/Neu, erythropoietin (EPO), epidermal growth factor receptor (EGFR), vascular endothelial growth factor receptor (VEGF-R), cadherin, carcinoembryonic antigen (CEA), CD4.
- EPO erythropoietin
- EGFR epidermal growth factor receptor
- VEGF-R vascular endothelial growth factor receptor
- CEA carcinoembryonic antigen
- CD20, CD33, CD34, CD45, CD117 (c-kit) CD 133, HLA-A.
- Ki-67 Ki-67
- viral envelope proteins HIV gpl20, or transferrin receptor.
- the Arc-based capsid or endo-Gag-based capsid is for in vitro use.
- the Arc-based capsid or endo-Gag-based capsid is for ex vivo use.
- the Arc-based capsid or endo-Gag-based capsid is for in vivo use.
- kits and articles of manufacture for use with one or more methods described herein.
- Such kits include a carrier, package, or container that is compartmentalized to receive one or more containers such as vials, tubes, and the like, each of the container(s) comprising one of the separate elements to be used in a method described herein.
- Suitable containers include, for example, bottles, vials, syringes, and test tubes.
- the containers are formed from a variety of materials such as glass or plastic.
- the container(s) include a recombinant or engineered Arc or endo-Gag polypeptide described above.
- kits optionally include an identifying description or label or instructions relating to its use in the methods described herein.
- a kit typically includes labels listing contents and/or instructions for use, and package inserts with instructions for use. A set of instructions will also typically be included.
- ranges and amounts can be expressed as“about” a particular value or range. About also includes the exact amount. Hence“about 5 pL” means“about 5 pL” and also“5 pL.” Generally, the term“about” includes an amount that would be expected to be within experimental error.
- the sequence of a CA N-lobe described herein corresponds to the human CA N-lobe.
- the human CA N-lobe comprises residues 207-278 of SEQ ID NO: 1.
- a CA N-lobe described herein comprises about 30%, 40%, 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97% 98% or 99% sequence identity to residue 207- 278 of SEQ ID NO: 1.
- a CA N-lobe described herein shares a structural similarity with the human CA N-lobe.
- a CA N-lobe described herein shares about 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97% 98% or 99% structural similarity with the human CA N-lobe.
- the CA N-lobe shares a high structural similarity (e.g., 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97% 98% or 99% structural similarity) but does not share a high sequence identity (e.g., the sequence identity is lower than 80%, lower than 70%, lower than 60%, lower than 50%, lower than 40%, or lower than 30%).
- the CA N-lobe comprises residues 207-278 of SEQ ID NO: 1.
- sequence of a CA C-lobe described herein corresponds to the human CA C-lobe.
- the human CA C-lobe comprises residues 278-370 of SEQ ID NO:
- a CA C-lobe described herein comprises about 30%, 40%, 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97% 98% or 99% sequence identity to residue 278- 370 of SEQ ID NO: 1.
- a CA C-lobe described herein shares a structural similarity with the human CA C-lobe. For example, a CA C-lobe described herein shares about 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97% 98% or 99% structural similarity with the human CA C-lobe.
- the CA C-lobe shares a high structural similarity (e.g., 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97% 98% or 99% structural similarity) but does not share a high sequence identity (e.g., the sequence identity is lower than 80%, lower than 70%, lower than 60%, lower than 50%, lower than 40%, or lower than 30%).
- the CA C-lobe comprises residues 278-370 of SEQ ID NO: 1.
- the terms“individual(s)”,“subject(s)” and“patient(s)” mean any mammal.
- the mammal is a human.
- the mammal is a non-human. None of the terms require or are limited to situations characterized by the supervision (e.g. constant or intermittent) of a health care worker (e.g. a doctor, a registered nurse, a nurse practitioner, a physician’s assistant, an orderly or a hospice worker).
- a health care worker e.g. a doctor, a registered nurse, a nurse practitioner, a physician’s assistant, an orderly or a hospice worker.
- EXAMPLE 1 Construction of DNA vectors encoding recombinant Arc proteins and engineered Arc proteins
- Human Arc cDNA includes an annotated matrix domain (MA) and a capsid domain.
- the capsid domain has an N-terminal lobe (NTD) and a C-terminal lobe (CTD).
- Figure 1 illustrates the structure of the Human Arc protein and the predicted structure of Arc from Python, Platypus, and Orca.
- cDNAs encoding engineered Arc proteins are optionally generated by recombining Arc sequences from different species ( Figure 2), by inserting functional domains from other proteins into an Arc protein ( Figure 3 A), by modifying the sequence of an Arc protein ( Figure 3B), and/or by any combination of the approaches exemplified in Figures 2-3.
- cDNAs encoding engineered endo-Gag proteins are likewise generated by recombining endo-Gag sequences from different species, by inserting functional domains from other proteins into an endo-Gag protein, by modifying the sequence of an endo-Gag protein, and/or by any combination of these approaches.
- an engineered endo-Gag protein optionally contains Arc sequences
- an engineered Arc protein optionally contains endo-Gag sequences.
- Engineered Arc and endo-Gag protein monomers assemble into capsids.
- cDNAs encoding the Arc and endo-Gag proteins of Table 1 were inserted into an expression vector derived from pET-4l a(+) (EMD Millipore (Novagen) Cat # 70566). The entire cloning site of pET-4l a(+) was removed and replaced with the DNA having the nucleotide sequence of SEQ ID NO: 57, which encodes an alternative N-terminal tag having the amino acid sequence of SEQ ID NO: 58 and comprising a 6xHis tag (SEQ ID NO: 59), a 6 amino acid spacer (SEQ ID NO: 60), and an AcTEVTM cleavage site (SEQ ID NO: 61).
- Table 1 Sequences of Arc and endo-Gag polypeptides and nucleotides.
- Expression vectors constructs comprising Arc and endo-Gag open reading frames were transformed into the Rosetta 2 (DE3)pLysS E. coli strain (Millipore Sigma, Cat# 71403). Arc or endo-Gag expression was induced with 0.1 mM IPTG followed by a l6-hour incubation at l6°C. Cell pellets were lysed by sonication in 20 mM sodium phosphate pH 7.4, 0.1M NaCl, 40 mM imidazole, 1 mM DTT, and 10% glycerol.
- the lysate was treated with excess TETRBO DNase (Thermo Fisher Scientific, Cat# AM2238), RNase Cocktail (Thermo Fisher Scientific, Cat# AM2286), and Benzonase Nuclease (Millipore Sigma, Cat# 71205) to eliminate nucleic acids.
- NaCl was added to lysate in order to adjust the NaCl concentration to 0.5 M followed by
- 6xHis-tagged recombinant protein was loaded onto a HisTrap HP column (GE Healthcare, Cat# 17-5247-01), washed with buffer A (20 mM sodium phosphate pH 7.4, 0.5M NaCl, 40 mM imidazole, and 10 % glycerol), and eluted with a linear gradient of buffer B (20 mM sodium phosphate pH 7.4, 0.5M NaCl, 500 mM imidazole, and 10 % glycerol). Collection tubes were supplemented in advance with 10 m ⁇ of 0.5 M EDTA pH 8.0 per 1 ml eluate. The resulting Arc or endo-Gag protein is generally more than 95% pure as revealed by SDS-PAGE analysis, with a yield of up to 50 mg per 1 L of bacterial culture.
- Figure 4A The resulting Arc or endo-Gag protein is generally more than 95% pure as revealed by SDS-PAGE analysis, with a yield of up to 50 mg per 1 L of
- Residual nucleic acid was removed by anion exchange chromatography on a mono Q 5/50 GL column (GE Healthcare, Cat# 17516601). Before loading to the column, recombinant protein was buffer exchanged to buffer C (20 mM Tris-HCl pH 8.0, 100 mM NaCl, and 10% glycerol) using“Pierce Protein Concentrator PES, 10K MWCO, 5-20 ml” (Thermo Scientific, Cat# 88528) according to the manufacturer’s protocol. After loading, the mono Q resin was washed with 2 ml of buffer C.
- Cleaved Arc protein (1 mg/mL) was loaded into a 20kDa MWCO dialysis cassette and dialyzed overnight in 1M sodium phosophate (pH 7.5) at room temperature. The following day, the solution was removed from the cassette, transferred to microcentrifuge tubes, and spun at max speed for 5 minutes in a tabletop centrifuge. The supernatant was transferred to a lOOkDa MWCO Regenerated Cellulose Amicon ETltrafiltration Centrifugal concentrator. The buffer was exchanged to PBS pH 7.5 and the volume was reduced 20-fold.
- Capsid assembly was assayed by transmission electron microscopy.
- EM grids Carbon Support Film, Square Grid, 400 mesh, 5-6nm, Copper, CF400-Cu-UL
- a 5 pL sample of purified Arc was applied to the grid for 20 seconds and then wicked away using filter paper. The grid was then washed with MilliQ H 2 0, stained with 5pL of 1% ETranyl Acetate in H 2 0 for 30 seconds, and air dried for 1 minute.
- Images of Arc capsids were acquired using a FEI Talos L120C TEM equipped with a Gatan 4k x 4k One View camera.
- Figure 5 shows concentrated human Arc capsids.
- Figure 6 shows capsids formed from recombinantly expressed Arc orthologs from other vertebrate species.
- Figure 7 shows capsids formed from recombinantly expressed endo-Gag genes from other vertebrate species.
- Capsids assembled from isolated recombinant human Arc protein were fluorescently labeled by reacting with a 50-molar excess of NHS ester Alexa FluorTM 594-NHS dye (InvitrogenTM #A20004) (dissolved in DMSO) in PBS (pH 8.5). Reactions were allowed to proceed for 2-hours in the dark. Alexa594 -labeled capsids were then dialyzed with PBS (pH 7.5) overnight at room temperature in the dark with at least two buffer exchanges to remove any unlabeled dye.
- NHS ester Alexa FluorTM 594-NHS dye InvitrogenTM #A20004
- HeLa cells (ATCC® CCL-2TM) were seeded 24-hours prior to the experiment in 96-well plates at counts such that they reach -80% confluency for treatment. Labeled-capsids were then spiked into complete tissue culture media to a final capsid concentration of 0.05mg/ml. Treatments proceed for 4-hours at 37°C, and then cells are washed 3-times with imaging media (DMEM, no phenol red, with 10% FBS and 20mM HEPES) containing lOug/ml Hoechst nuclear stain prior to imaging. Fluorescence microscopy revealed a punctate staining pattern, suggesting that the Arc capsids were internalized by the HeLa cells ( Figure 8). Little or no intracellular staining was observed after administration of Alexa FluorTM 594-labeled bovine serum albumin (BSA) (final concentration of 0.05 mg/ml) or 45.6 mM Alexa FluorTM 594 under identical conditions.
- BSA Alexa FluorTM 5
- RNA Purified cell-associated RNA was quantified by qPCR in technical triplicate, normalizing values to cellular GAPDH-levels, and comparing to Escherichia coli rrsA mRNA and Arc RNA that could have carried over from protein purification.
- Table 2 shows primers used for the PCR reaction. The amount of cell-associated Cre RNA detected was > 27-fold higher when Arc capsid were loaded with Cre RNA compared to control capsids not loaded with Cre RNA ( Figure 9).
- Figure 10 illustrates an alternative method of demonstrating the delivery of a
- RNA heterologous RNA by an Arc or endo-Gag capsid.
- 6xHis-tagged Arc or endo-Gag genes are expressed in a host cell.
- the resulting Arc monomers are mixed with translatable Cre mRNA under capsid forming conditions to form Cre mRNA loaded capsids.
- Cre-loaded capsids are then administered to LoxP-luciferase reporter mice.
- Cre mRNA Upon successful delivery of Cre mRNA into mouse cells and subsequent translation of Cre recombinase protein, LoxP sites of the reporter are recombined, leading to luciferase expression, which is optionally detected by bioluminescence imaging upon administration of luciferin.
- This method is used to test the transmission potential of candidate Arc and endo-Gag genes.
- a positive luciferase signal indicates that the candidate Arc or endo-Gag gene encodes an Arc or endo-Gag protein capable of assembling into capsids that incorporate a heterologous cargo and deliver that cargo to a target cell.
- VSVGVGGPEI RPSEGEIYDYALDMSQMYALTPPPGEMPSI PQAHDSYQWVSVSEDAPASPVETQVFEDPREFLS
- VSVGVGGPEI RPSEGEIYDYALDMSQMYALTPPPGEVPSI PQAHDSYQWVSVSEDAPASPVETQVFEDPREFLS
- VSVGVGGPEI RPSEGEIYDYALDMSQMYALTPPPGEVPSI PQAHDSYQWVSTSEDAPASPVETQVFEDPREFLS
- VSVGVGGPEI RPSEGEIYDYALDMSQMYALTPGPGEVPSI PQAHDSYQWVSVSEDAPASPVETQIFEDPHEFLS
- VSVGVGGPEI RPSEGEIYDYALDMSQMYALTPSPGELPSVPQPHDSYQWVTSPEDAPASPVETQVFEDPREFLC
- PEEAAPTPVPRLSESAN PPAQRPDPAHPGGPKPQKTEEEVLETEGDQEVSLGTPQEVVEAPETPGEPPLSPGF
- VN EN RFCNDAMKVAFLISLLTGEAEEWVVPYI EMDSPILGDYRAFLDEMKQCFGWDDDEDDDDEEEEDDY
- AAAT A AT CTT GAAGACCACGTTCCTACCGAT A AT CAACGGTGG A A A AGT C AAT CAAGGCGTG CTT AG C;
- AGT CGC AAAAT GTTTTCCCAG AT G G AAC AAATG AAT AG CAAG C AAACG G AT CT G CTTTT AG AACAT CAAAA
- AAACCG AG CGTAATTCTTC AG ATTG GTAAGTGCCG CG CTG AG ATG CTGGAACACGTCCGCCG CACGCATCG
- CTTT ACC ACCT AGTACCAC AACCAG CCCG AAT G CGTC AT CT GGTACCC AACCTG AAG CGCCTT CCCC ACCT G
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Molecular Biology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Health & Medical Sciences (AREA)
- Zoology (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- Biochemistry (AREA)
- Medicinal Chemistry (AREA)
- Biophysics (AREA)
- Wood Science & Technology (AREA)
- General Engineering & Computer Science (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Physics & Mathematics (AREA)
- Microbiology (AREA)
- Gastroenterology & Hepatology (AREA)
- Plant Pathology (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Epidemiology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Toxicology (AREA)
- Virology (AREA)
- Immunology (AREA)
- Optics & Photonics (AREA)
- Nanotechnology (AREA)
- Cell Biology (AREA)
- Mycology (AREA)
- Botany (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicinal Preparation (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (15)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2021539499A JP7344300B2 (ja) | 2018-09-18 | 2019-09-18 | Arcベースのカプシドおよびその使用 |
| CA3113095A CA3113095A1 (en) | 2018-09-18 | 2019-09-18 | Arc-based capsids and uses thereof |
| EP19862077.5A EP3852813A4 (en) | 2018-09-18 | 2019-09-18 | ARC-BASED CAPSIDS AND THEIR USES |
| KR1020217011429A KR20210070305A (ko) | 2018-09-18 | 2019-09-18 | Arc 기반 캡시드 및 이의 용도 |
| US17/277,119 US20220088224A1 (en) | 2018-09-18 | 2019-09-18 | Arc-based capsids and uses thereof |
| CN201980075900.3A CN113164623A (zh) | 2018-09-18 | 2019-09-18 | 基于arc的衣壳及其用途 |
| AU2019343045A AU2019343045A1 (en) | 2018-09-18 | 2019-09-18 | ARC-based capsids and uses thereof |
| KR1020247017429A KR20240093924A (ko) | 2018-09-18 | 2019-09-18 | Arc 기반 캡시드 및 이의 용도 |
| US17/382,092 US11447527B2 (en) | 2018-09-18 | 2021-07-21 | Endogenous Gag-based capsids and uses thereof |
| US17/382,102 US11505578B2 (en) | 2018-09-18 | 2021-07-21 | Endogenous Gag-based capsids and uses thereof |
| US17/473,209 US20210403907A1 (en) | 2018-09-18 | 2021-09-13 | Arc-based capsids and uses thereof |
| US17/497,174 US20220016032A1 (en) | 2018-09-18 | 2021-10-08 | Arc-based capsids and uses thereof |
| US17/818,318 US20230057793A1 (en) | 2018-09-18 | 2022-08-08 | Arc-based capsids and uses thereof |
| US18/046,354 US12617822B2 (en) | 2022-10-13 | Arc-based capsids and uses thereof | |
| JP2023141593A JP2024007554A (ja) | 2018-09-18 | 2023-08-31 | Arcベースのカプシドおよびその使用 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201862733015P | 2018-09-18 | 2018-09-18 | |
| US62/733,015 | 2018-09-18 |
Related Child Applications (5)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US17/277,119 A-371-Of-International US20220088224A1 (en) | 2018-09-18 | 2019-09-18 | Arc-based capsids and uses thereof |
| US17/382,092 Continuation US11447527B2 (en) | 2018-09-18 | 2021-07-21 | Endogenous Gag-based capsids and uses thereof |
| US17/382,102 Continuation US11505578B2 (en) | 2018-09-18 | 2021-07-21 | Endogenous Gag-based capsids and uses thereof |
| US17/473,209 Continuation US20210403907A1 (en) | 2018-09-18 | 2021-09-13 | Arc-based capsids and uses thereof |
| US17/497,174 Continuation US20220016032A1 (en) | 2018-09-18 | 2021-10-08 | Arc-based capsids and uses thereof |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2020061229A2 true WO2020061229A2 (en) | 2020-03-26 |
| WO2020061229A3 WO2020061229A3 (en) | 2020-04-30 |
Family
ID=69888834
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2019/051786 Ceased WO2020061229A2 (en) | 2018-09-18 | 2019-09-18 | Arc-based capsids and uses thereof |
Country Status (8)
| Country | Link |
|---|---|
| US (3) | US20220088224A1 (https=) |
| EP (1) | EP3852813A4 (https=) |
| JP (2) | JP7344300B2 (https=) |
| KR (2) | KR20240093924A (https=) |
| CN (1) | CN113164623A (https=) |
| AU (1) | AU2019343045A1 (https=) |
| CA (1) | CA3113095A1 (https=) |
| WO (1) | WO2020061229A2 (https=) |
Cited By (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11129892B1 (en) | 2020-05-18 | 2021-09-28 | Vnv Newco Inc. | Vaccine compositions comprising endogenous Gag polypeptides |
| WO2022164942A1 (en) * | 2021-01-27 | 2022-08-04 | Vnv Newco Inc. | Pnma2-based capsids and uses thereof |
| US11447527B2 (en) | 2018-09-18 | 2022-09-20 | Vnv Newco Inc. | Endogenous Gag-based capsids and uses thereof |
| WO2022235723A1 (en) * | 2021-05-04 | 2022-11-10 | Cornell University | Engineered extracellular vesicles |
| WO2024026295A1 (en) * | 2022-07-27 | 2024-02-01 | Aera Therapeutics, Inc. | Endogenous gag-based and pnma family capsids and uses thereof |
| WO2024006988A3 (en) * | 2022-06-30 | 2024-02-15 | The Broad Institute, Inc. | Engineered delivery vesicles and uses thereof |
| WO2025129158A1 (en) * | 2023-12-15 | 2025-06-19 | The Broad Institute, Inc. | Engineered arc delivery vesicles and uses thereof |
| US12617822B2 (en) | 2022-10-13 | 2026-05-05 | Aera Therapeutics, Inc. | Arc-based capsids and uses thereof |
Families Citing this family (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20210403907A1 (en) * | 2018-09-18 | 2021-12-30 | Vnv Newco Inc. | Arc-based capsids and uses thereof |
| US12351837B2 (en) | 2019-01-23 | 2025-07-08 | The Broad Institute, Inc. | Supernegatively charged proteins and uses thereof |
| US20200347100A1 (en) * | 2019-03-15 | 2020-11-05 | The Broad Institute, Inc. | Non-naturally occurring capsids for delivery of nucleic acids and/or proteins |
| WO2020191233A1 (en) | 2019-03-19 | 2020-09-24 | The Broad Institute, Inc. | Methods and compositions for editing nucleotide sequences |
| US12473543B2 (en) | 2019-04-17 | 2025-11-18 | The Broad Institute, Inc. | Adenine base editors with reduced off-target effects |
| WO2020252455A1 (en) | 2019-06-13 | 2020-12-17 | The General Hospital Corporation | Engineered human-endogenous virus-like particles and methods of use thereof for delivery to cells |
| CA3189601A1 (en) | 2020-07-24 | 2022-01-27 | The General Hospital Corporation | Enhanced virus-like particles and methods of use thereof for delivery to cells |
| CN120248078B (zh) * | 2025-05-28 | 2025-11-28 | 中国人民解放军军事科学院军事医学研究院 | 一种基于arc蛋白的修饰多肽及其作为核酸递送载体的应用 |
Family Cites Families (121)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4510245A (en) | 1982-11-18 | 1985-04-09 | Chiron Corporation | Adenovirus promoter system |
| US4897355A (en) | 1985-01-07 | 1990-01-30 | Syntex (U.S.A.) Inc. | N[ω,(ω-1)-dialkyloxy]- and N-[ω,(ω-1)-dialkenyloxy]-alk-1-yl-N,N,N-tetrasubstituted ammonium lipids and uses therefor |
| US5168062A (en) | 1985-01-30 | 1992-12-01 | University Of Iowa Research Foundation | Transfer vectors and microorganisms containing human cytomegalovirus immediate-early promoter-regulatory DNA sequence |
| US4968615A (en) | 1985-12-18 | 1990-11-06 | Ciba-Geigy Corporation | Deoxyribonucleic acid segment from a virus |
| US4737323A (en) | 1986-02-13 | 1988-04-12 | Liposome Technology, Inc. | Liposome extrusion method |
| US4837028A (en) | 1986-12-24 | 1989-06-06 | Liposome Technology, Inc. | Liposomes with enhanced circulation time |
| US5000960A (en) | 1987-03-13 | 1991-03-19 | Micro-Pak, Inc. | Protein coupling to lipid vesicles |
| US5989886A (en) | 1991-01-02 | 1999-11-23 | The Johns Hopkins University | Method for the inhibition and prevention of viral replication using fusions of a virus protein and a destructive enzyme |
| US5260065A (en) | 1991-09-17 | 1993-11-09 | Micro Vesicular Systems, Inc. | Blended lipid vesicles |
| US5543158A (en) | 1993-07-23 | 1996-08-06 | Massachusetts Institute Of Technology | Biodegradable injectable nanoparticles |
| US6007845A (en) | 1994-07-22 | 1999-12-28 | Massachusetts Institute Of Technology | Nanoparticles and microparticles of non-linear hydrophilic-hydrophobic multiblock copolymers |
| US5855913A (en) | 1997-01-16 | 1999-01-05 | Massachusetts Instite Of Technology | Particles incorporating surfactants for pulmonary drug delivery |
| US5985309A (en) | 1996-05-24 | 1999-11-16 | Massachusetts Institute Of Technology | Preparation of particles for inhalation |
| US5944710A (en) | 1996-06-24 | 1999-08-31 | Genetronics, Inc. | Electroporation-mediated intravascular delivery |
| US5869326A (en) | 1996-09-09 | 1999-02-09 | Genetronics, Inc. | Electroporation employing user-configured pulsing scheme |
| GB9710049D0 (en) | 1997-05-19 | 1997-07-09 | Nycomed Imaging As | Method |
| GB9710809D0 (en) | 1997-05-23 | 1997-07-23 | Medical Res Council | Nucleic acid binding proteins |
| EP1025217B1 (en) | 1997-10-24 | 2006-10-04 | Invitrogen Corporation | Recombinational cloning using nucleic acids having recombination sites |
| ES2341926T3 (es) | 1998-03-02 | 2010-06-29 | Massachusetts Institute Of Technology | Poliproteinas con dedos de cinc que tienen enlazadores mejorados. |
| FR2780069B1 (fr) | 1998-06-23 | 2002-06-28 | Inst Nat Sante Rech Med | Famille de sequences nucleiques et de sequences proteiques deduites presentant des motifs retroviraux endogenes humains et leurs applications |
| US7013219B2 (en) | 1999-01-12 | 2006-03-14 | Sangamo Biosciences, Inc. | Regulation of endogenous gene expression in cells using zinc finger proteins |
| US6534261B1 (en) | 1999-01-12 | 2003-03-18 | Sangamo Biosciences, Inc. | Regulation of endogenous gene expression in cells using zinc finger proteins |
| US6794136B1 (en) | 2000-11-20 | 2004-09-21 | Sangamo Biosciences, Inc. | Iterative optimization in the design of binding proteins |
| US20030104526A1 (en) | 1999-03-24 | 2003-06-05 | Qiang Liu | Position dependent recognition of GNN nucleotide triplets by zinc fingers |
| US7030215B2 (en) | 1999-03-24 | 2006-04-18 | Sangamo Biosciences, Inc. | Position dependent recognition of GNN nucleotide triplets by zinc fingers |
| FR2797889A1 (fr) | 1999-09-01 | 2001-03-02 | Bio Merieux | Procede de detection de l'expression d'une proteine d'enveloppe d'un retrovirus endogene humain et utilisations d'un gene codant pour cette proteine |
| EP1385538B1 (en) | 2001-04-05 | 2013-01-30 | The Johns Hopkins University | Chimeric Vaccines comprising the lumenal domain of LAMP-1 or LAMP-2 |
| US7776321B2 (en) | 2001-09-26 | 2010-08-17 | Mayo Foundation For Medical Education And Research | Mutable vaccines |
| US8518694B2 (en) | 2002-06-13 | 2013-08-27 | Novartis Vaccines And Diagnostics, Inc. | Nucleic acid vector comprising a promoter and a sequence encoding a polypeptide from the endogenous retrovirus PCAV |
| EP1651667B1 (en) | 2003-04-04 | 2012-03-28 | Centre National De La Recherche Scientifique | Protein with fusogenic activity, nucleic acid sequences encoding said protein and pharmaceutical compositions comprising the same |
| JP5060284B2 (ja) | 2004-03-30 | 2012-10-31 | アンスティテュ・グスターブ・ルシ | ウイルスタンパク質の免疫抑制作用のモデュレーションに関与するポリペプチド配列 |
| GB0418651D0 (en) | 2004-08-20 | 2004-09-22 | Medical Res Council | Method |
| ES2582091T3 (es) | 2005-10-18 | 2016-09-09 | Precision Biosciences | Meganucleasas diseñadas racionalmente con especificidad de secuencia y afinidad de unión a ADN alteradas |
| GB0526210D0 (en) * | 2005-12-22 | 2006-02-01 | Oxford Biomedica Ltd | Vectors |
| JP2008078613A (ja) | 2006-08-24 | 2008-04-03 | Rohm Co Ltd | 窒化物半導体の製造方法及び窒化物半導体素子 |
| WO2008149176A1 (en) | 2007-06-06 | 2008-12-11 | Cellectis | Meganuclease variants cleaving a dna target sequence from the mouse rosa26 locus and uses thereof |
| WO2009042727A1 (en) | 2007-09-24 | 2009-04-02 | The Johns Hopkins University | Immediate early gene arc interacts with endocytic machinery and regulates the trafficking and function of presenilin |
| WO2009088256A2 (ko) | 2008-01-09 | 2009-07-16 | Konkuk University Industrial Cooperation Corp | 배큘로바이러스-기반 백신 |
| EP3269395A1 (en) | 2008-11-07 | 2018-01-17 | Massachusetts Institute Of Technology | Aminoalcohol lipidoids and uses thereof |
| US20110027239A1 (en) | 2009-07-29 | 2011-02-03 | Tissue Genesis, Inc. | Adipose-derived stromal cells (asc) as delivery tool for treatment of cancer |
| US8927807B2 (en) | 2009-09-03 | 2015-01-06 | The Regents Of The University Of California | Nitrate-responsive promoter |
| WO2011072246A2 (en) | 2009-12-10 | 2011-06-16 | Regents Of The University Of Minnesota | Tal effector-mediated dna modification |
| US9567573B2 (en) | 2010-04-26 | 2017-02-14 | Sangamo Biosciences, Inc. | Genome editing of a Rosa locus using nucleases |
| US9193827B2 (en) | 2010-08-26 | 2015-11-24 | Massachusetts Institute Of Technology | Poly(beta-amino alcohols), their preparation, and uses thereof |
| EP2691443B1 (en) | 2011-03-28 | 2021-02-17 | Massachusetts Institute of Technology | Conjugated lipomers and uses thereof |
| WO2013059922A1 (en) | 2011-10-25 | 2013-05-02 | The University Of British Columbia | Limit size lipid nanoparticles and related methods |
| WO2013086373A1 (en) | 2011-12-07 | 2013-06-13 | Alnylam Pharmaceuticals, Inc. | Lipids for the delivery of active agents |
| US9254311B2 (en) | 2012-04-02 | 2016-02-09 | Moderna Therapeutics, Inc. | Modified polynucleotides for the production of proteins |
| WO2013151665A2 (en) | 2012-04-02 | 2013-10-10 | modeRNA Therapeutics | Modified polynucleotides for the production of proteins associated with human disease |
| CA2842041A1 (en) | 2012-04-18 | 2013-10-24 | Arrowhead Research Corporation | Poly(acrylate) polymers for in vivo nucleic acid delivery |
| AU2013293270B2 (en) | 2012-07-25 | 2018-08-16 | Massachusetts Institute Of Technology | Inducible DNA binding proteins and genome perturbation tools and applications thereof |
| EP2840140B2 (en) | 2012-12-12 | 2023-02-22 | The Broad Institute, Inc. | Crispr-Cas based method for mutation of prokaryotic cells |
| IL239344B2 (en) | 2012-12-12 | 2024-06-01 | Broad Inst Inc | Systems engineering, methods and optimal guiding components for sequence manipulation |
| US8697359B1 (en) | 2012-12-12 | 2014-04-15 | The Broad Institute, Inc. | CRISPR-Cas systems and methods for altering expression of gene products |
| US20140310830A1 (en) | 2012-12-12 | 2014-10-16 | Feng Zhang | CRISPR-Cas Nickase Systems, Methods And Compositions For Sequence Manipulation in Eukaryotes |
| CN113355357B (zh) | 2012-12-12 | 2024-12-03 | 布罗德研究所有限公司 | 对用于序列操纵的改进的系统、方法和酶组合物进行的工程化和优化 |
| US20140186843A1 (en) | 2012-12-12 | 2014-07-03 | Massachusetts Institute Of Technology | Methods, systems, and apparatus for identifying target sequences for cas enzymes or crispr-cas systems for target sequences and conveying results thereof |
| EP2931899A1 (en) | 2012-12-12 | 2015-10-21 | The Broad Institute, Inc. | Functional genomics using crispr-cas systems, compositions, methods, knock out libraries and applications thereof |
| WO2014093655A2 (en) | 2012-12-12 | 2014-06-19 | The Broad Institute, Inc. | Engineering and optimization of systems, methods and compositions for sequence manipulation with functional domains |
| WO2014093709A1 (en) | 2012-12-12 | 2014-06-19 | The Broad Institute, Inc. | Methods, models, systems, and apparatus for identifying target sequences for cas enzymes or crispr-cas systems for target sequences and conveying results thereof |
| EP3031921B1 (en) | 2012-12-12 | 2025-03-12 | The Broad Institute, Inc. | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
| WO2014118272A1 (en) | 2013-01-30 | 2014-08-07 | Santaris Pharma A/S | Antimir-122 oligonucleotide carbohydrate conjugates |
| US9481905B2 (en) | 2013-02-19 | 2016-11-01 | Orizhan Bioscience Limited | Method of using neutrilized DNA (N-DNA) as surface probe for high throughput detection platform |
| US9693958B2 (en) | 2013-03-15 | 2017-07-04 | Cureport, Inc. | Methods and devices for preparation of lipid nanoparticles |
| US11332719B2 (en) | 2013-03-15 | 2022-05-17 | The Broad Institute, Inc. | Recombinant virus and preparations thereof |
| MX374532B (es) | 2013-06-17 | 2025-03-06 | Broad Inst Inc | Suministro, uso y aplicaciones terapéuticas de los sistemas y composiciones crispr-cas, para actuar sobre trastornos y enfermedades utilizando componentes víricos. |
| EP3725885A1 (en) | 2013-06-17 | 2020-10-21 | The Broad Institute, Inc. | Functional genomics using crispr-cas systems, compositions methods, screens and applications thereof |
| CN105492611A (zh) | 2013-06-17 | 2016-04-13 | 布罗德研究所有限公司 | 用于序列操纵的优化的crispr-cas双切口酶系统、方法以及组合物 |
| CN105683379A (zh) | 2013-06-17 | 2016-06-15 | 布罗德研究所有限公司 | 用于对有丝分裂后细胞的疾病和障碍进行靶向和建模的系统、方法和组合物的递送、工程化和优化 |
| WO2014204723A1 (en) | 2013-06-17 | 2014-12-24 | The Broad Institute Inc. | Oncogenic models based on delivery and use of the crispr-cas systems, vectors and compositions |
| RU2716420C2 (ru) | 2013-06-17 | 2020-03-11 | Те Брод Инститьют Инк. | Доставка и применение систем crispr-cas, векторов и композиций для целенаправленного воздействия и терапии в печени |
| WO2014204724A1 (en) | 2013-06-17 | 2014-12-24 | The Broad Institute Inc. | Delivery, engineering and optimization of tandem guide systems, methods and compositions for sequence manipulation |
| EP3058091B1 (en) | 2013-10-18 | 2020-03-25 | The Broad Institute, Inc. | Spatial and cellular mapping of biomolecules in situ by high-throughput sequencing |
| CN106459995B (zh) | 2013-11-07 | 2020-02-21 | 爱迪塔斯医药有限公司 | 使用统治型gRNA的CRISPR相关方法和组合物 |
| JP7103750B2 (ja) | 2013-12-12 | 2022-07-20 | ザ・ブロード・インスティテュート・インコーポレイテッド | ゲノム編集のためのCRISPR-Cas系及び組成物の送達、使用及び治療適用 |
| EP3470089A1 (en) | 2013-12-12 | 2019-04-17 | The Broad Institute Inc. | Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using particle delivery components |
| WO2015089427A1 (en) | 2013-12-12 | 2015-06-18 | The Broad Institute Inc. | Crispr-cas systems and methods for altering expression of gene products, structural information and inducible modular cas enzymes |
| JP6793547B2 (ja) | 2013-12-12 | 2020-12-02 | ザ・ブロード・インスティテュート・インコーポレイテッド | 最適化機能CRISPR−Cas系による配列操作のための系、方法および組成物 |
| JP6712948B2 (ja) | 2013-12-12 | 2020-06-24 | ザ・ブロード・インスティテュート・インコーポレイテッド | 組成物、及びヌクレオチドリピート障害におけるcrispr−cas系の使用方法 |
| US20150165054A1 (en) * | 2013-12-12 | 2015-06-18 | President And Fellows Of Harvard College | Methods for correcting caspase-9 point mutations |
| SG10201804975PA (en) | 2013-12-12 | 2018-07-30 | Broad Inst Inc | Delivery, Use and Therapeutic Applications of the Crispr-Cas Systems and Compositions for HBV and Viral Diseases and Disorders |
| WO2015089364A1 (en) | 2013-12-12 | 2015-06-18 | The Broad Institute Inc. | Crystal structure of a crispr-cas system, and uses thereof |
| EP3080259B1 (en) | 2013-12-12 | 2023-02-01 | The Broad Institute, Inc. | Engineering of systems, methods and optimized guide compositions with new architectures for sequence manipulation |
| WO2016049258A2 (en) | 2014-09-25 | 2016-03-31 | The Broad Institute Inc. | Functional screening with optimized functional crispr-cas systems |
| WO2016094872A1 (en) | 2014-12-12 | 2016-06-16 | The Broad Institute Inc. | Dead guides for crispr transcription factors |
| WO2016094874A1 (en) | 2014-12-12 | 2016-06-16 | The Broad Institute Inc. | Escorted and functionalized guides for crispr-cas systems |
| EP3889260A1 (en) | 2014-12-12 | 2021-10-06 | The Broad Institute, Inc. | Protected guide rnas (pgrnas) |
| WO2016106236A1 (en) | 2014-12-23 | 2016-06-30 | The Broad Institute Inc. | Rna-targeting system |
| CA2970370A1 (en) | 2014-12-24 | 2016-06-30 | Massachusetts Institute Of Technology | Crispr having or associated with destabilization domains |
| WO2016149426A1 (en) | 2015-03-16 | 2016-09-22 | The Broad Institute, Inc. | Constructs for continuous monitoring of live cells |
| CA2981716C (en) | 2015-04-10 | 2022-04-12 | Feldan Bio Inc. | Polypeptide-based shuttle agents for improving the transduction efficiency of polypeptide cargos to the cytosol of target eukaryotic cells, uses thereof, methods and kits relating to same |
| JP6895391B2 (ja) * | 2015-05-15 | 2021-06-30 | フラッシュ セラピューティクス | 少なくとも2つのカプシド形成された非ウイルス性rnaを含む、レトロウイルス粒子 |
| US10624849B2 (en) | 2015-09-28 | 2020-04-21 | Northwestern University | Targeted extracellular vesicles comprising membrane proteins with engineered glycosylation sites |
| WO2017068077A1 (en) | 2015-10-20 | 2017-04-27 | Institut National De La Sante Et De La Recherche Medicale (Inserm) | Methods and products for genetic engineering |
| EP3235828A1 (en) | 2016-04-21 | 2017-10-25 | Genethon | Stable pseudotyped lentiviral particles and uses thereof |
| WO2017191274A2 (en) | 2016-05-04 | 2017-11-09 | Curevac Ag | Rna encoding a therapeutic protein |
| WO2018209113A1 (en) | 2017-05-10 | 2018-11-15 | University Of Utah Research Foundation | Compositions and methods of use of arc capsids |
| WO2018213726A1 (en) | 2017-05-18 | 2018-11-22 | The Broad Institute, Inc. | Systems, methods, and compositions for targeted nucleic acid editing |
| US11866697B2 (en) | 2017-05-18 | 2024-01-09 | The Broad Institute, Inc. | Systems, methods, and compositions for targeted nucleic acid editing |
| JP2020530438A (ja) | 2017-06-22 | 2020-10-22 | アンスティテュ ギュスタフ ルッシーInstitut Gustave Roussy | ヒト内在性レトロウイルスタンパク質 |
| WO2019005886A1 (en) | 2017-06-26 | 2019-01-03 | The Broad Institute, Inc. | CRISPR / CAS-CYTIDINE DEAMINASE COMPOSITIONS, SYSTEMS AND METHODS FOR TARGETED EDITING OF NUCLEIC ACIDS |
| KR102761791B1 (ko) | 2017-06-26 | 2025-02-05 | 더 브로드 인스티튜트, 인코퍼레이티드 | 표적화된 핵산 편집을 위한 crispr/cas-아데닌 데아미나아제 기반 조성물, 시스템 및 방법 |
| EP3655530A4 (en) | 2017-07-17 | 2021-07-28 | The Broad Institute, Inc. | NEW TYPE VI CRISPR ORTHOLOGIST AND SYSTEMS |
| DK3676285T3 (da) | 2017-09-01 | 2026-01-19 | Inprother Aps | Vaccine til anvendelse i profylakse og/eller behandling af en sygdom |
| AU2018338318B2 (en) | 2017-09-21 | 2022-12-22 | Massachusetts Institute Of Technology | Systems, methods, and compositions for targeted nucleic acid editing |
| US20190096250A1 (en) | 2017-09-28 | 2019-03-28 | Uber Technologies, Inc. | Systems and Methods for Determining Whether an Autonomous Vehicle Can Provide a Requested Service for a Rider |
| WO2019071048A1 (en) | 2017-10-04 | 2019-04-11 | The Broad Institute, Inc. | SYSTEMS, METHODS AND COMPOSITIONS FOR TARGETED NUCLEIC ACID EDITION |
| CA3078096A1 (en) | 2017-10-20 | 2018-10-19 | Genethon | Use of syncytin for targeting drug and gene delivery to regenerating muscle tissue |
| IL273923B2 (en) | 2017-10-20 | 2024-08-01 | Genethon | Using syncytin for drug targeting and gene delivery to lung tissue |
| US20210163933A1 (en) | 2017-12-11 | 2021-06-03 | University Of Massachusetts | Arc protein extracellular vesicle nucleic acid delivery platform |
| WO2019126709A1 (en) | 2017-12-22 | 2019-06-27 | The Broad Institute, Inc. | Cas12b systems, methods, and compositions for targeted dna base editing |
| US20210079366A1 (en) | 2017-12-22 | 2021-03-18 | The Broad Institute, Inc. | Cas12a systems, methods, and compositions for targeted rna base editing |
| EP3788155A1 (en) | 2018-05-01 | 2021-03-10 | Wake Forest University Health Sciences | Lentiviral-based vectors and related systems and methods for eukaryotic gene editing |
| CA3105925A1 (en) | 2018-07-10 | 2020-01-16 | Alia Therapeutics S.R.L. | Vesicles for traceless delivery of guide rna molecules and/or guide rna molecule/rna-guided nuclease complex(es) and a production method thereof |
| AU2019343045A1 (en) | 2018-09-18 | 2021-05-13 | Vnv Newco Inc. | ARC-based capsids and uses thereof |
| US20210403907A1 (en) | 2018-09-18 | 2021-12-30 | Vnv Newco Inc. | Arc-based capsids and uses thereof |
| CN113544266A (zh) | 2018-12-17 | 2021-10-22 | 博德研究所 | Crispr相关转座酶系统和其使用方法 |
| US20200347100A1 (en) | 2019-03-15 | 2020-11-05 | The Broad Institute, Inc. | Non-naturally occurring capsids for delivery of nucleic acids and/or proteins |
| WO2020252455A1 (en) | 2019-06-13 | 2020-12-17 | The General Hospital Corporation | Engineered human-endogenous virus-like particles and methods of use thereof for delivery to cells |
| AU2020348872A1 (en) | 2019-09-20 | 2022-04-14 | Massachusetts Institute Of Technology | Compositions and methods for delivering cargo to a target cell |
| US11129892B1 (en) | 2020-05-18 | 2021-09-28 | Vnv Newco Inc. | Vaccine compositions comprising endogenous Gag polypeptides |
-
2019
- 2019-09-18 AU AU2019343045A patent/AU2019343045A1/en active Pending
- 2019-09-18 US US17/277,119 patent/US20220088224A1/en not_active Abandoned
- 2019-09-18 JP JP2021539499A patent/JP7344300B2/ja active Active
- 2019-09-18 EP EP19862077.5A patent/EP3852813A4/en active Pending
- 2019-09-18 WO PCT/US2019/051786 patent/WO2020061229A2/en not_active Ceased
- 2019-09-18 CA CA3113095A patent/CA3113095A1/en active Pending
- 2019-09-18 KR KR1020247017429A patent/KR20240093924A/ko active Pending
- 2019-09-18 KR KR1020217011429A patent/KR20210070305A/ko not_active Ceased
- 2019-09-18 CN CN201980075900.3A patent/CN113164623A/zh active Pending
-
2021
- 2021-07-21 US US17/382,092 patent/US11447527B2/en active Active
- 2021-07-21 US US17/382,102 patent/US11505578B2/en active Active
-
2023
- 2023-08-31 JP JP2023141593A patent/JP2024007554A/ja active Pending
Cited By (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11447527B2 (en) | 2018-09-18 | 2022-09-20 | Vnv Newco Inc. | Endogenous Gag-based capsids and uses thereof |
| US11505578B2 (en) | 2018-09-18 | 2022-11-22 | Vnv Newco Inc. | Endogenous Gag-based capsids and uses thereof |
| US11129892B1 (en) | 2020-05-18 | 2021-09-28 | Vnv Newco Inc. | Vaccine compositions comprising endogenous Gag polypeptides |
| WO2021236513A1 (en) * | 2020-05-18 | 2021-11-25 | Vnv Newco Inc. | Vaccine compositions comprising endogenous gag polypeptides |
| EP4153245A4 (en) * | 2020-05-18 | 2025-02-12 | Aera Therapeutics, Inc. | Vaccine compositions comprising endogenous gag polypeptides |
| WO2022164942A1 (en) * | 2021-01-27 | 2022-08-04 | Vnv Newco Inc. | Pnma2-based capsids and uses thereof |
| JP2024505060A (ja) * | 2021-01-27 | 2024-02-02 | エイラ・セラピューティクス・インコーポレイテッド | Pnma2ベースのキャプシド及びその使用 |
| WO2022235723A1 (en) * | 2021-05-04 | 2022-11-10 | Cornell University | Engineered extracellular vesicles |
| WO2024006988A3 (en) * | 2022-06-30 | 2024-02-15 | The Broad Institute, Inc. | Engineered delivery vesicles and uses thereof |
| WO2024026295A1 (en) * | 2022-07-27 | 2024-02-01 | Aera Therapeutics, Inc. | Endogenous gag-based and pnma family capsids and uses thereof |
| US12617822B2 (en) | 2022-10-13 | 2026-05-05 | Aera Therapeutics, Inc. | Arc-based capsids and uses thereof |
| WO2025129158A1 (en) * | 2023-12-15 | 2025-06-19 | The Broad Institute, Inc. | Engineered arc delivery vesicles and uses thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| JP7344300B2 (ja) | 2023-09-13 |
| US11447527B2 (en) | 2022-09-20 |
| US20220002358A1 (en) | 2022-01-06 |
| EP3852813A2 (en) | 2021-07-28 |
| KR20210070305A (ko) | 2021-06-14 |
| US20220088224A1 (en) | 2022-03-24 |
| WO2020061229A3 (en) | 2020-04-30 |
| US20210347829A1 (en) | 2021-11-11 |
| US11505578B2 (en) | 2022-11-22 |
| CN113164623A (zh) | 2021-07-23 |
| AU2019343045A1 (en) | 2021-05-13 |
| JP2024007554A (ja) | 2024-01-18 |
| KR20240093924A (ko) | 2024-06-24 |
| JP2022502077A (ja) | 2022-01-11 |
| EP3852813A4 (en) | 2022-06-22 |
| CA3113095A1 (en) | 2020-03-26 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11447527B2 (en) | Endogenous Gag-based capsids and uses thereof | |
| US20230057793A1 (en) | Arc-based capsids and uses thereof | |
| US20240102052A1 (en) | Pnma2-based capsids and uses thereof | |
| US10550188B2 (en) | Nucleic acid-polypeptide compositions and uses thereof | |
| US11110180B2 (en) | Nucleic acid-polypeptide compositions and uses thereof | |
| US20210095283A1 (en) | Heteroduplex nucleic acid molecules and uses thereof | |
| RS62863B1 (sr) | Konstruisane vanćelijske vezikule i njihove upotrebe | |
| WO2024026295A1 (en) | Endogenous gag-based and pnma family capsids and uses thereof | |
| US12617822B2 (en) | Arc-based capsids and uses thereof | |
| WO2025097132A1 (en) | Capsids with effector-polypeptide conjugates and uses thereof | |
| WO2025184534A2 (en) | Non-enveloped capsid delivery systems and uses thereof | |
| JP2024532486A (ja) | Dll3を標的とする抗原認識受容体及びその使用 | |
| JP2025535146A (ja) | 哺乳類細胞における外因性キャリアとしての細胞毒性壊死因子 | |
| WO2023215560A1 (en) | Tumor cell/immune cell multivalent receptor engager – bio-nanoparticle (timre-bnp) | |
| US11208468B2 (en) | Methods and compositions for treating melanoma | |
| JP2023542341A (ja) | 標的化された抗原送達システム及びその使用 | |
| JP2002512774A (ja) | 組換えオンコナーゼと、その化学的接合体および融合タンパク質 | |
| HK1253684B (en) | Conditionally active polypeptides |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 19862077 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 2021539499 Country of ref document: JP Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 3113095 Country of ref document: CA |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 20217011429 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2019862077 Country of ref document: EP Effective date: 20210419 |
|
| ENP | Entry into the national phase |
Ref document number: 2019343045 Country of ref document: AU Date of ref document: 20190918 Kind code of ref document: A |