WO2020056127A1 - Pneumococcal fusion protein vaccines - Google Patents

Pneumococcal fusion protein vaccines Download PDF

Info

Publication number
WO2020056127A1
WO2020056127A1 PCT/US2019/050800 US2019050800W WO2020056127A1 WO 2020056127 A1 WO2020056127 A1 WO 2020056127A1 US 2019050800 W US2019050800 W US 2019050800W WO 2020056127 A1 WO2020056127 A1 WO 2020056127A1
Authority
WO
WIPO (PCT)
Prior art keywords
fusion protein
polypeptide
seq
vaccine
subject
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2019/050800
Other languages
English (en)
French (fr)
Inventor
Richard Malley
Yingjie Lu
Fan Zhang
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Boston Childrens Hospital
Original Assignee
Boston Childrens Hospital
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to SG11202101973YA priority Critical patent/SG11202101973YA/en
Priority to CA3111436A priority patent/CA3111436A1/en
Priority to AU2019338448A priority patent/AU2019338448B2/en
Priority to JP2021513863A priority patent/JP7535791B2/ja
Priority to CN201980073553.0A priority patent/CN113164580B/zh
Priority to KR1020217010452A priority patent/KR102922338B1/ko
Priority to BR112021004185-0A priority patent/BR112021004185A2/pt
Priority to MX2021002909A priority patent/MX2021002909A/es
Application filed by Boston Childrens Hospital filed Critical Boston Childrens Hospital
Priority to EP19860907.5A priority patent/EP3849599A4/en
Publication of WO2020056127A1 publication Critical patent/WO2020056127A1/en
Priority to IL281203A priority patent/IL281203A/en
Anticipated expiration legal-status Critical
Priority to JP2024077967A priority patent/JP2024096456A/ja
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/62DNA sequences coding for fusion proteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/02Bacterial antigens
    • A61K39/09Lactobacillales, e.g. aerococcus, enterococcus, lactobacillus, lactococcus, streptococcus
    • A61K39/092Streptococcus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04Antibacterial agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/315Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Streptococcus (G), e.g. Enterococci
    • C07K14/3156Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Streptococcus (G), e.g. Enterococci from Streptococcus pneumoniae (Pneumococcus)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/60Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • A61K2039/6031Proteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/62Medicinal preparations containing antigens or antibodies characterised by the link between antigen and carrier
    • A61K2039/627Medicinal preparations containing antigens or antibodies characterised by the link between antigen and carrier characterised by the linker
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/70Multivalent vaccine
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/20Fusion polypeptide containing a tag with affinity for a non-protein ligand

Definitions

  • Streptococcus pneumoniae remains a leading cause of serious illness, including bacteremia, sepsis, meningitis and pneumonia, among children and adults worldwide. Morbidity and mortality among infants, young children, the elderly and subjects who have certain underlying medical conditions is high.
  • S. pneumoniae is a Gram-positive encapsulated coccus that colonizes the nasopharynx in about 5-10% of healthy adults and 20-40% of healthy children. Normal colonization becomes infectious when S. pneumoniae is carried into the Eustachian tubes, nasal sinuses, lungs, bloodstream, meninges, joint spaces, bones and peritoneal cavity. S. pneumoniae infection is the most frequent cause of bacteremia, pneumonia, meningitis, sinusitis and acute otitis media [CDC, 2010]
  • IPD Invasive pneumococcal disease
  • S. pneumoniae has several virulence factors that enable the organism to evade the immune system. Examples include a polysaccharide capsule that prevents phagocytosis by host immune cells, proteases that inhibit complement-mediated
  • PPSV23 Polysaccharide Vaccine (PPSV23 or Pneumovax®). PC VI 3 cannot confer protection against most of the known serotypes of S. pneumoniae. While PPSV23 includes
  • the present disclosure addresses the lack of suitable technologies for the prevention and/or treatment of pneumococcal infection.
  • the present disclosure addresses challenges in providing vaccines with sufficient immunogenicity to protect against invasive pneumococcal disease and pneumonia.
  • Technologies described herein can induce a T- and B-cell response and/or provide immunity against a broad range of S. pneumoniae serotypes, including one or more serotypes not included in commercially- available vaccines, e.g ., PCV13 or PPSV23.
  • a fusion protein described herein when administered to a subject, can induce a higher Thl7 response by at least 25% or more including, e.g., at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98%, or more, as compared to that induced by individual antigenic components of the fusion protein.
  • a fusion protein described herein, when administered to a subject can induce a higher Thl7 response by at least l.
  • l-fold or more including, e.g., at least 1.2-fold, at least 1.3-fold, at least 1.4-fold, at least 1.5-fold, at least 2-fold, at least 3-fold, at least 4-fold, at least 5-fold, at least lO-fold, or higher, as compared to that induced by individual antigenic components of the fusion protein.
  • a fusion protein described herein when administered to a subject, can induce an immune response to one or more representative non-vaccine pneumococcal serotype(s) that is/are not included in a commercially-available vaccine, e.g., PC VI 3 or PPSV23.
  • a fusion protein described herein when administered to a subject, can induce an immune response to one or more non-vaccine pneumococcal serotypes selected from the group consisting of 6B, 16F, 15A, and 35B.
  • FIG. 1 is a schematic of an exemplary CP1 fusion protein.
  • a biotin-binding protein such as, e.g., a truncated rhizavidin protein (e.g., amino acids 45-179 of a wild-type rhizavidin protein (denoted Rhavi)), a first linker (e.g., a GGGGSSS linker), a SP1500 polypeptide (e.g., amino acids 27-278 of S. pneumoniae protein SP1500), a second linker (e.g., the amino acid sequence or linker AAA), and a SP0785 polypeptide (e.g., amino acids 33-399 of S.
  • a biotin-binding protein such as, e.g., a truncated rhizavidin protein (e.g., amino acids 45-179 of a wild-type rhizavidin protein (denoted Rhavi)), a first linker (e.g.,
  • a CP1 fusion protein may further comprise a His tag.
  • the SSS amino acid sequence can be from the Sac I site on a PET2l/24b plasmid, with the GGGG amino acid sequence added to create a flexible linker with minimal steric hindrance.
  • the GGGGSSS linker can be synthesized.
  • the AAA amino acid sequence can be from the Not I site on a PET2l/24b plasmid, or synthesized.
  • FIG. 2 illustrates immune responses to SP1500 and SP0785 polypeptide components of an exemplary fusion protein CP1.
  • the left panel shows Thl7 response to a SP1500 polypeptide and a SP0785 polypeptide of an exemplary fusion protein CP1.
  • Thl7 responses are shown as geometric mean concentration of IL-17A secreted in media after stimulation of peripheral blood samples of mice immunized with cholera toxin alone, or with a SP1500 or SP0785 polypeptide adjuvanted with cholera toxin.
  • Each point on the graph represents secreted IL-17A for one mouse.
  • the right panel shows protection from colonization by S.
  • FIG. 3 illustrates immune responses to an exemplary fusion protein CP1.
  • the left panel shows Thl7 response to an exemplary fusion protein CP1.
  • Thl7 responses are shown as geometric mean concentration of IL-17 secreted in media after stimulation of peripheral blood samples of mice immunized with a truncated rhizavidin protein (Rhavi) or with CP1, both adjuvanted with cholera toxin.
  • Rhavi truncated rhizavidin protein
  • CP1 truncated rhizavidin protein
  • Each point on the graph represents secreted IL-17A for one mouse.
  • the right panel shows protection from colonization by S.
  • CT cholera toxin
  • CFU colony forming unit
  • IL-17A interleukin 17 A
  • rhavi truncated rhizavidin protein
  • Figure 4 illustrates the presence of functional antibodies against a
  • S. pneumoniae serotype e.g., serotype 6B
  • S. pneumoniae serotype 6B representative S. pneumoniae serotype in CP1 immune sera.
  • pneumoniae serotype 6B was incubated in a modified concentrated opsonophagocytic assay (COP A) with heat inactivated pre-immune (P0) and immune (P3) serum, at various dilutions, from each of two rabbits (87 and 88) immunized with CP1 adjuvanted with aluminum phosphate.
  • COP A modified concentrated opsonophagocytic assay
  • P0 pre-immune
  • P3 immune
  • the colony forming units (CFU) for each dilution and sera combination were enumerated on blood agar plates after overnight incubation.
  • the presence of functional antibodies is shown by killing of S. pneumoniae , i.e., reduction of CFUs following incubation with immune sera.
  • Each vertical bar on the graph represents CFU/ml for each sample of the indicated CP1 serum and dilution, at the indicated timepoint (bottom of graph).
  • Figure 5 illustrates the presence of functional antibodies against a
  • S. pneumoniae serotype 15A was incubated in a modified concentrated opsonophagocytic assay (COP A) with heat inactivated pre-immune (P0) and immune (P3) serum, at 1/2 dilution , from each of two rabbits (87 and 88) immunized with CP1 adjuvanted with aluminum phosphate.
  • COP A modified concentrated opsonophagocytic assay
  • P0 pre-immune
  • P3 immune
  • the colony forming units (CFU) for each serum were enumerated on blood agar plates after overnight incubation.
  • the presence of functional antibodies is shown by killing of S. pneumoniae , i.e., reduction of CFUs following incubation with immune sera.
  • Each vertical bar on the graph represents CFU/ml for each sample of the indicated CP1 serum at the indicated timepoint (bottom of graph).
  • Figure 6 illustrates the presence of functional antibodies against a
  • S. pneumoniae serotype e.g ., serotype 35B
  • S. pneumoniae serotype 35B representative S. pneumoniae serotype in CP1 immune sera.
  • pneumoniae serotype 35B was incubated in a modified concentrated opsonophagocytic assay (COP A) with heat inactivated pre-immune (P0) and immune (P3) serum, at 1/2 dilution, from each of two rabbits (87 and 88) immunized with CP1 adjuvanted with aluminum phosphate.
  • COP A modified concentrated opsonophagocytic assay
  • P0 pre-immune
  • P3 immune
  • the colony forming units (CFU) for each serum were enumerated on blood agar plates after overnight incubation.
  • the presence of functional antibodies is shown by killing of S. pneumoniae , i.e., reduction of CFUs following incubation with immune sera.
  • Each vertical bar on the graph represents CFU/ml for each sample of the indicated CP1 serum at the indicated timepoint (bottom of graph).
  • S. pneumoniae serotypes S. pneumoniae serotypes 6B (Panel A), 16F (Panel D), 15A (Panel B), and 35B (Panel C) were separately incubated in a modified concentrated opsonophagocytic assay (COP A) with heat-inactivated pre-immune (P0) and immune (P3) sera, at various dilutions, from rabbits (87, 88, and 1762) immunized with CP1 adjuvanted with aluminum phosphate. The presence of functional antibodies is shown by killing of S. pneumoniae. Results are expressed as percent killing activity, i.e., the percent reduction in S.
  • COP A modified concentrated opsonophagocytic assay
  • Each vertical bar of Panels A-D represents the percent killing activity observed with the indicated dilution of the indicated CP1 serum (bottom of each graph), against the indicated S. pneumoniae serotype (top of each graph),
  • FIG 8 illustrates immune responses (e.g., Thl7 responses) to an exemplary fusion protein CP1 compared to a SP1500 or SP0785 polypeptide.
  • Mice were immunized with CP1, SP1500, or SP0785 polypeptides, adjuvanted with cholera toxin, or were immunized with Rhavi protein adjuvanted with cholera toxin (control).
  • Thl7 responses are shown as geometric mean concentration of IL-17A secreted in media after stimulation of peripheral blood samples of immunized mice with purified SP0785 polypeptide (Panel A), purified SP1500 polypeptide (Panel B), or killed (inactivated) pneumococcal whole cells (WCV; Panel C). Each point on the graphs represents secreted IL-17A for one mouse. Horizontal bars represent the geometric mean of secreted IL-17A for each group.
  • CT cholera toxin.
  • Figure 9 illustrates immune responses (e.g ., Thl7 responses) to an exemplary fusion protein CP1 compared to a fusion protein SP0785-linker (SSSGG)-SPl500-linker (SSVDKL)-PdT.
  • Mice were immunized with CP1 or SP0785-linker (SSSGG)-SPl500- linker (SSVDKL)-PdT, adjuvanted with cholera toxin, or were immunized with Rhavi protein adjuvanted with cholera toxin (control).
  • Thl7 responses are shown as geometric mean concentration of IL-17A secreted in media after stimulation of peripheral blood samples of immunized mice with purified SP0785 polypeptide (Panel A), or purified SP1500 polypeptide (Panel B). Each point on the graphs represents secreted IL-17A for one mouse. Horizontal bars represent the geometric mean of secreted IL-17A for each group.
  • CT cholera toxin.
  • Figure 10 illustrates immune responses (e.g., Thl7 responses) to an exemplary fusion protein CP1 compared to a mixture (unconjugated) of SP0785, SP1500, and Rhavi polypeptides.
  • Mice were immunized with CP1 or a mixture (unconjugated) of SP0785, SP1500, and Rhavi polypeptides, adjuvanted with cholera toxin, or were immunized with Rhavi protein adjuvanted with cholera toxin (control).
  • Thl7 responses are shown as geometric mean concentration of IL-17A secreted in media after stimulation of peripheral blood samples of immunized mice with purified SP0785 polypeptide (Panel A), purified SP1500 polypeptide (Panel B), or killed (inactivated) pneumococcal whole cells (WCV; Panel C).
  • Each point on the graphs represents secreted IL-17A for one mouse.
  • Horizontal bars represent the geometric mean of secreted IL-17A for each group.
  • CT cholera toxin
  • mixture mixture (unconjugated) of SP0785, SP1500, and Rhavi
  • Figure 11 illustrates hemolytic activity of an exemplary fusion protein CP1 and fusion protein SP0785-linker (SSSGG)-SP 1500-linker (SSVDKL)-PdT (PdT fusion) against sheep red blood cells.
  • Sheep red blood cells were incubated with positive control protein pneumolysin (Ply), pneumolysoid PdT, CP1, or fusion protein SP0785-linker (SSSGG)-SPl500-linker (SSVDKL)-PdT at the concentrations indicated on the x axis.
  • Hemolytic activity as measured by OD42 0 of the supernatants is plotted on the y axis.
  • the term“a” may be understood to mean“at least one”;
  • the term“or” may be understood to mean “and/or”;
  • the terms“comprising” and“including” may be understood to encompass itemized components or steps whether presented by themselves or together with one or more additional components or steps; and
  • the terms“about” and“approximately” may be understood to permit standard variation as would be understood by those of ordinary skill in the art; and (v) where ranges are provided, endpoints are included.
  • Administration typically refers to the administration of a composition to a subject or system to achieve delivery of an agent that is, or is included in, the composition.
  • a composition typically refers to the administration of a composition to a subject or system to achieve delivery of an agent that is, or is included in, the composition.
  • routes may, in appropriate circumstances, be utilized for administration to a subject, for example a human.
  • administration may be ocular, oral, parenteral, topical, etc.
  • administration may be bronchial ( e.g ., by bronchial instillation), buccal, dermal (which may be or comprise, for example, one or more of topical to the dermis, intradermal, interdermal, transdermal, etc.), enteral, intra-arterial, intradermal, intragastrical, intramedullary, intramuscular, intranasal, intraperitoneal, intrathecal, intravenous, intraventricular, within a specific organ (e.g., intrahepatic), mucosal, nasal, oral, rectal, subcutaneous, sublingual, topical, tracheal (e.g, by intratracheal instillation), vaginal, vitreal, etc.
  • bronchial e.g ., by bronchial instillation
  • buccal which may be or comprise, for example, one or more of topical to the dermis, intradermal, interdermal, transdermal, etc.
  • enteral intra-arterial, intradermal
  • administration may involve only a single dose. In some embodiments, administration may involve application of a fixed number of doses. In some embodiments, administration may involve dosing that is intermittent (e.g, a plurality of doses separated in time) and/or periodic (e.g, individual doses separated by a common period of time) dosing. In some embodiments, administration may involve continuous dosing ( e.g ., perfusion) for at least a selected period of time.
  • agent in general, the term“agent”, as used herein, may be used to refer to a compound or entity of any chemical class including, for example, a polypeptide, nucleic acid, saccharide, lipid, small molecule, metal, or combination or complex thereof.
  • the term may be utilized to refer to an entity that is or comprises a cell or organism, or a fraction, extract, or component thereof.
  • the term may be used to refer to a natural product in that it is found in and/or is obtained from nature.
  • the term may be used to refer to one or more entities that is man-made in that it is designed, engineered, and/or produced through action of the hand of man and/or is not found in nature.
  • an agent may be utilized in isolated or pure form; in some embodiments, an agent may be utilized in crude form.
  • potential agents may be provided as collections or libraries, for example that may be screened to identify or characterize active agents within them.
  • the term“agent” may refer to a compound or entity that is or comprises a polymer; in some cases, the term may refer to a compound or entity that comprises one or more polymeric moieties.
  • the term“agent” may refer to a compound or entity that is not a polymer and/or is substantially free of any polymer and/or of one or more particular polymeric moieties. In some embodiments, the term may refer to a compound or entity that lacks or is substantially free of any polymeric moiety.
  • amino acid in its broadest sense, refers to any compound and/or substance that can be incorporated into a polypeptide chain, e.g., through formation of one or more peptide bonds.
  • an amino acid has the general structure H 2 N-C(H)(R)-COOH.
  • an amino acid is a naturally-occurring amino acid.
  • an amino acid is a non-natural amino acid; in some embodiments, an amino acid is a D-amino acid; in some embodiments, an amino acid is an L-amino acid.
  • Standard amino acid refers to any of the twenty standard L-amino acids commonly found in naturally occurring peptides.“Non-standard amino acid” refers to any amino acid, other than the standard amino acids, regardless of whether it is prepared synthetically or obtained from a natural source.
  • an amino acid, including a carboxy- and/or amino-terminal amino acid in a polypeptide can contain a structural modification as compared with the general structure above.
  • an amino acid may be modified by methylation, amidation, acetylation, pegylation, glycosylation, phosphorylation, and/or substitution (e.g ., of the amino group, the carboxylic acid group, one or more protons, and/or the hydroxyl group) as compared with the general structure.
  • such modification may, for example, alter the circulating half-life of a polypeptide containing the modified amino acid as compared with one containing an otherwise identical unmodified amino acid.
  • such modification does not significantly alter a relevant activity of a polypeptide containing the modified amino acid, as compared with one containing an otherwise identical unmodified amino acid.
  • the term“amino acid” may be used to refer to a free amino acid; in some embodiments it may be used to refer to an amino acid residue of a polypeptide.
  • Antibody refers to a polypeptide that includes canonical immunoglobulin sequence elements sufficient to confer specific binding to a particular target antigen.
  • intact antibodies as produced in nature are approximately 150 kDa tetrameric agents comprised of two identical heavy chain polypeptides (about 50 kDa each) and two identical light chain polypeptides (about 25 kDa each) that associate with each other into what is commonly referred to as a“Y-shaped” structure.
  • Each heavy chain is comprised of at least four domains (each about 110 amino acids long)- an amino-terminal variable (VH) domain (located at the tips of the Y structure), followed by three constant domains: CH1, CH2, and the carboxy-terminal CH3 (located at the base of the Y’s stem).
  • VH amino-terminal variable
  • CH1, CH2 amino-terminal variable
  • CH3 carboxy-terminal CH3
  • Each light chain is comprised of two domains - an amino-terminal variable (VL) domain, followed by a carboxy-terminal constant (CL) domain, separated from one another by another“switch”.
  • VL amino-terminal variable
  • CL carboxy-terminal constant
  • Intact antibody tetramers are comprised of two heavy chain-light chain dimers in which the heavy and light chains are linked to one another by a single disulfide bond; two other disulfide bonds connect the heavy chain hinge regions to one another, so that the dimers are connected to one another and the tetramer is formed.
  • Naturally-produced antibodies are also
  • Each domain in a natural antibody has a structure characterized by an“immunoglobulin fold” formed from two beta sheets (e.g., 3-, 4-, or 5-stranded sheets) packed against each other in a compressed antiparallel beta barrel.
  • Each variable domain contains three hypervariable loops known as“complement
  • FR regions form the beta sheets that provide the structural framework for the domains, and the CDR loop regions from both the heavy and light chains are brought together in three-dimensional space so that they create a single hypervariable antigen binding site located at the tip of the Y structure.
  • the Fc region of naturally-occurring antibodies binds to elements of the complement system, and also to receptors on effector cells, including for example effector cells that mediate cytotoxicity.
  • affinity and/or other binding attributes of Fc regions for Fc receptors can be modulated through glycosylation or other modification.
  • antibodies produced and/or utilized in accordance with the present invention include glycosylated Fc domains, including Fc domains with modified or engineered such glycosylation.
  • in some embodimentsylated Fc domains include glycosylated Fc domains, including Fc domains with modified or engineered such glycosylation.
  • any polypeptide or complex of polypeptides that includes sufficient immunoglobulin domain sequences as found in natural antibodies can be referred to and/or used as an“antibody”, whether such polypeptide is naturally produced ( e.g ., generated by an organism reacting to an antigen), or produced by recombinant engineering, chemical synthesis, or other artificial system or methodology.
  • an antibody is polyclonal; in some embodiments, an antibody is monoclonal.
  • an antibody has constant region sequences that are characteristic of mouse, rabbit, primate, or human antibodies.
  • antibody sequence elements are humanized, primatized, chimeric, etc., as is known in the art.
  • an antibody utilized in accordance with the present invention is in a format selected from, but not limited to, intact IgA, IgG, IgE or IgM antibodies; bi- or multi- specific antibodies (e.g., Zybodies ® , etc.); antibody fragments such as Fab fragments, Fab’ fragments, F(ab’)2 fragments, Fd’ fragments, Fd fragments, and isolated CDRs or sets thereof; single chain Fvs; polypeptide-Fc fusions; single domain antibodies (e.g, shark single domain antibodies such as IgNAR or fragments thereof); cameloid antibodies; masked antibodies (e.g, Probodies ® ); Small Modular ImmunoPharmaceuticals (“SMIPsTM ); single chain or Tandem di
  • an antibody may lack a covalent modification (e.g, attachment of a glycan) that it would have if produced naturally.
  • an antibody may contain a covalent modification (e.g, attachment of a glycan, a payload [e.g, a detectable moiety, a therapeutic moiety, a catalytic moiety, etc.], or other pendant group [e.g, poly-ethylene glycol, etc.]).
  • Antigen refers to (i) an agent that induces an immune response; and/or (ii) an agent that binds to a T cell receptor (e.g, when presented by an MHC molecule) or to an antibody.
  • an antigen induces a humoral response (e.g, including production of antigen-specific antibodies); in some embodiments, an antigen induces a cellular response (e.g., involving T cells whose receptors specifically interact with the antigen).
  • an antigen induces a humoral response and a cellular response.
  • an antigen binds to an antibody and may or may not induce a particular physiological response in an organism.
  • an antigen may be or include any chemical entity such as, for example, a small molecule, a nucleic acid, a polypeptide, a carbohydrate, a lipid, a polymer (in some embodiments other than a biologic polymer (e.g, other than a nucleic acid or amino acid polymer)), etc.
  • an antigen is or comprises a polypeptide.
  • an antigen is or comprises a polysaccharide.
  • an antigen may be provided in isolated or pure form, or alternatively may be provided in crude form (e.g, together with other materials, for example in an extract such as a cellular extract or other relatively crude preparation of an antigen- containing source).
  • antigens utilized in accordance with the present invention are provided in a crude form.
  • an antigen is a recombinant antigen.
  • an antigen is a polypeptide or a polysaccharide that, upon administration to a subject, induces a specific and/or clinically relevant immune response to such polypeptide or polysaccharide.
  • an antigen is selected to induce a specific and/or clinically relevant immune response to such polypeptide or polysaccharide.
  • Two entities are“associated” with one another, as that term is used herein, if the presence, level and/or form of one is correlated with that of the other.
  • two or more entities are physically“associated” with one another if they interact, directly or indirectly, so that they are and/or remain in physical proximity with one another.
  • two or more entities that are physically associated with one another are covalently linked to one another.
  • two or more entities that are physically associated with one another are not covalently linked to one another but are non-covalently associated, for example by means of affinity interactions, electrostatic interactions, hydrogen bonds, van der Waals interaction, hydrophobic interactions, magnetism, and combinations thereof.
  • Binding typically refers to a non-covalent association between or among two or more entities.
  • Direct binding involves physical contact between entities or moieties; indirect binding involves physical interaction by way of physical contact with one or more intermediate entities. Binding between two or more entities can typically be assessed in any of a variety of contexts - including where interacting entities or moieties are studied in isolation or in the context of more complex systems (e.g ., while covalently or otherwise associated with a carrier entity and/or in a biological system or cell).
  • Carrier protein refers to a protein or peptide that is coupled, complexed, or otherwise associated with a hapten (e.g., a small peptide or lipid) or less immunogenic antigen (e.g, a polysaccharide) and that induces or improves an immune response to such a coupled, or complexed, or otherwise associated hapten (e.g, a small peptide or lipid) or less immunogenic antigen (e.g, a polysaccharide).
  • a hapten e.g., a small peptide or lipid
  • immunogenic antigen e.g, a polysaccharide
  • such an immune response is or comprises a response to a hapten or less immunogenic antigen that is coupled, complexed, or otherwise associated with such a carrier protein. In some embodiments, such an immune response is or comprises a response to both a carrier protein and a hapten or less immunogenic antigen that is coupled, complexed, or otherwise associated with such a carrier protein. In some embodiments, no significant immune response to a carrier protein itself occurs. In some embodiments, immune response to a carrier protein may be detected; in some such embodiments, immune response to such a carrier protein is strong. In some embodiments, a carrier protein is coupled, complexed, or otherwise associated with one or more other molecules.
  • colonization generally refers to the ability of a microbe to grow at a target site or surface.
  • colonization refers to the ability of a microbe (e.g., a bacterium) to grow at an anatomical site (e.g., a mucosal membrane, gastrointestinal tract, injury site, organ, etc.) of a host.
  • anatomical site e.g., a mucosal membrane, gastrointestinal tract, injury site, organ, etc.
  • Combination therapy refers to those situations in which a subject is exposed to two or more therapeutic regimens (e.g ., two or more therapeutic agents).
  • the two or more regimens may be administered simultaneously; in some embodiments, such regimens may be administered sequentially (e.g., all“doses” of a first regimen are administered prior to administration of any doses of a second regimen); in some embodiments, such agents are administered in overlapping dosing regimens.
  • “administration” of combination therapy may involve administration of one or more agent(s) or modality(ies) to a subject receiving the other agent(s) or modality(ies) in the combination.
  • combination therapy does not require that individual agents be administered together in a single composition (or even necessarily at the same time), although in some embodiments, two or more agents, or active moieties thereof, may be administered together in a combination composition, or even in a combination compound (e.g, as part of a single chemical complex or covalent entity).
  • Derivative As used herein, the term“derivative”, or grammatical equivalents thereof, refers to a structural analogue of a reference substance. That is, a “derivative” is a substance that shows significant structural similarity with the reference substance, for example sharing a core or consensus structure, but also differs in certain discrete ways. Such a substance would be said to be“derived from” said reference substance.
  • a derivative is a substance that can be generated from the reference substance by chemical manipulation.
  • a derivative is a substance that can be generated through performance of a synthetic process substantially similar to (e.g, sharing a plurality of steps with) one that generates the reference substance.
  • Domain refers to a section or portion of an entity.
  • a“domain” is associated with a particular structural and/or functional feature of the entity so that, when the domain is physically separated from the rest of its parent entity, it substantially or entirely retains the particular structural and/or functional feature.
  • a domain may be or include a portion of an entity that, when separated from that (parent) entity and linked with a different (recipient) entity, substantially retains and/or imparts on the recipient entity one or more structural and/or functional features that characterized it in the parent entity.
  • a domain is a section or portion of a molecule (e.g, a small molecule, carbohydrate, lipid, nucleic acid, or polypeptide).
  • a domain is a section of a polypeptide; in some such embodiments, a domain is characterized by a particular structural element (e.g ., a particular amino acid sequence or sequence motif, a-helix character, b-sheet character, coiled-coil character, random coil character, etc.), and/or by a particular functional feature (e.g., binding activity, enzymatic activity, folding activity, signaling activity, etc.).
  • Dosage form or unit dosage form may be used to refer to a physically discrete unit of an active agent (e.g, a therapeutic or diagnostic agent) for administration to a subject.
  • each such unit contains a predetermined quantity of active agent.
  • such quantity is a unit dosage amount (or a whole fraction thereof) appropriate for administration in accordance with a dosing regimen that has been determined to correlate with a desired or beneficial outcome when administered to a relevant population (i.e., with a therapeutic dosing regimen).
  • the total amount of a therapeutic composition or agent administered to a particular subject is determined by one or more attending physicians and may involve administration of multiple dosage forms.
  • Dosing regimen may be used to refer to a set of unit doses (typically more than one) that are administered individually to a subject, typically separated by periods of time.
  • a given therapeutic agent has a recommended dosing regimen, which may involve one or more doses.
  • a dosing regimen comprises a plurality of doses each of which is separated in time from other doses.
  • individual doses are separated from one another by a time period of the same length; in some embodiments, a dosing regimen comprises a plurality of doses and at least two different time periods separating individual doses.
  • all doses within a dosing regimen are of the same unit dose amount. In some embodiments, different doses within a dosing regimen are of different amounts. In some embodiments, a dosing regimen comprises a first dose in a first dose amount, followed by one or more additional doses in a second dose amount different from the first dose amount. In some embodiments, a dosing regimen comprises a first dose in a first dose amount, followed by one or more additional doses in a second dose amount same as the first dose amount. In some embodiments, a dosing regimen is correlated with a desired or beneficial outcome when administered across a relevant population (i.e., is a therapeutic dosing regimen).
  • Fragment A“fragment” of a material or entity as described herein has a structure that includes a discrete portion of the whole, but lacks one or more moieties found in the whole. In some embodiments, a fragment consists of such a discrete portion. In some embodiments, a fragment includes a discrete portion of the whole which discrete portion shares one or more functional characteristics found in the whole. In some embodiments, a fragment consists of such a discrete portion. In some embodiments, a fragment consists of or comprises a characteristic structural element or moiety found in the whole.
  • a fragment of a polymer comprises or consists of at least 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500 or more monomeric units (e.g, residues) as found in the whole polymer.
  • a polymer fragment comprises or consists of at least about 5%, 10%, 15%, 20%, 25%, 30%,
  • the whole material or entity may in some embodiments be referred to as the“parent” of the whole.
  • homology refers to the overall relatedness between polymeric molecules, e.g, between nucleic acid molecules (e.g, DNA molecules and/or RNA molecules) and/or between polypeptide molecules.
  • polymeric molecules are considered to be“homologous” to one another if their sequences are at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical.
  • polymeric molecules are considered to be“homologous” to one another if their sequences are at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% similar (e.g, containing residues with related chemical properties at corresponding positions).
  • certain amino acids are typically classified as similar to one another as“hydrophobic” or “hydrophilic” amino acids, and/or as having“polar” or“non-polar” side chains. Substitution of one amino acid for another of the same type may often be considered a“homologous” substitution.
  • Identity refers to the overall relatedness between polymeric molecules, e.g., between nucleic acid molecules (e.g, DNA molecules and/or RNA molecules) and/or between polypeptide molecules.
  • polymeric molecules are considered to be“substantially identical” to one another if their sequences are at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical.
  • Calculation of the percent identity of two nucleic acid or polypeptide sequences can be performed by aligning the two sequences for optimal comparison purposes (e.g ., gaps can be introduced in one or both of a first and a second sequence for optimal alignment and non-identical sequences can be disregarded for comparison purposes).
  • the length of a sequence aligned for comparison purposes is at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5%, or substantially 100% of the length of a reference sequence.
  • the nucleotides at corresponding positions are then compared. When a position in the first sequence is occupied by the same residue (e.g., nucleotide or amino acid) as the corresponding position in the second sequence, then the molecules are identical at that position.
  • the percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which needs to be introduced for optimal alignment of the two sequences.
  • the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm. For example, the percent identity between two nucleotide sequences can be determined using the algorithm of Meyers and Miller, 1989, which has been incorporated into the ALIGN program (version 2.0).
  • nucleic acid sequence comparisons made with the ALIGN program use a PAM 120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
  • the percent identity between two nucleotide sequences can, alternatively, be determined using the GAP program in the GCG software package using an
  • an appropriate reference measurement may be or comprise a measurement in a particular system (e.g, in a single subject) under otherwise comparable conditions absent presence of (e.g, prior to and/or after) a particular agent or treatment, or in presence of an appropriate comparable reference agent.
  • an appropriate reference measurement may be or comprise a measurement in comparable system known or expected to respond in a particular way, in presence of the relevant agent or treatment.
  • Immunologically effective amount or immunologically effective dose refers to an amount of an antigenic or immunogenic substance, e.g ., an antigen, immunogen, immunogenic complex, immunogenic composition, vaccine, or pharmaceutical composition, which when administered to a subject, either in a single dose or as part of a series of doses, that is sufficient to enhance a subject’s own immune response against a subsequent exposure to a pathogen.
  • the pathogen is S. pneumoniae.
  • the immune response is against one or more different serotypes of S.
  • the immune response is against two or more different serotypes of S. pneumoniae. In some embodiments, the immune response is against nine or more different serotypes of S. pneumoniae. In some embodiments, the immune response is against thirteen or more different serotypes of S. pneumoniae. In some embodiments, the immune response is against fifteen or more different serotypes of S. pneumoniae. In some embodiments, the immune response is against twenty-three or more different serotypes of S. pneumoniae. In some embodiments, the immune response is against twenty-four or more different serotypes of S. pneumoniae.
  • An immunologically effective amount may vary based on the subject to be treated, the species of the subject, the degree of immune response desired to induce, etc.
  • an immunologically effective amount is sufficient for treatment or protection of a subject having or at risk of having disease.
  • an immunologically effective amount refers to a non-toxic but sufficient amount that can be an amount to treat, attenuate, or prevent infection and/or disease (e.g, bacterial infection, pneumococcal infection, bacterial colonization, pneumococcal colonization, complications associated with bacterial infection, complications associated with pneumococcal infection, etc.) in any subject.
  • infectious disease e.g, bacterial infection, pneumococcal infection, bacterial colonization, pneumococcal colonization, complications associated with bacterial infection, complications associated with pneumococcal infection, etc.
  • immunologically effective amount is sufficient to induce an immunoprotective response upon administration to a subject.
  • Immunoprotective response or protective response refers to an immune response that mediates antigen or immunogen-induced immunological memory.
  • an immunoprotective response is induced by the administration of a substance, e.g, an antigen, immunogen, immunogenic complex, immunogenic composition, vaccine, or pharmaceutical composition to a subject.
  • immunoprotection involves one or more of active immune surveillance, a more rapid and effective response upon immune activation as compared to a response observed in a naive subject, efficient clearance of the activating agent or pathogen, followed by rapid resolution of inflammation.
  • an immunoprotective response is an adaptive immune response.
  • an immunoprotective response is sufficient to protect an immunized subject from productive infection by a particular pathogen or pathogens to which a vaccine is directed ( e.g ., S. pneumoniae infection).
  • Immunization refers to a process of inducing an immune response to an infectious organism or agent in a subject (“active immunization”), or alternatively, providing immune system components against an infectious organism or agent to a subject (“passive immunization”).
  • immunization involves the administration of one or more antigens, immunogens, immunogenic complexes, vaccines, immune molecules such as antibodies, immune sera, immune cells such as T cells or B cells, or pharmaceutical compositions to a subject. In some embodiments, immunization is performed by administering an
  • immunologically effective amount of a substance e.g., an antigen, immunogen,
  • immunogenic complex results in an immunogenic composition
  • immunogenic composition e.g., an antibody, immune serum, immune cell such as a T cell or B cell, or pharmaceutical composition to a subject.
  • immune molecule such as an antibody, immune serum, immune cell such as a T cell or B cell, or pharmaceutical composition to a subject.
  • immunization results in an immunogenic composition
  • active immunization is performed by administering to a subject an antigenic or immunogenic substance, e.g, an antigen, immunogen, immunogenic complex, vaccine, or pharmaceutical composition.
  • passive immunization is performed by administering to a subject an immune system component, e.g, an immune molecule such as an antibody, immune serum, or immune cell such as a T cell or B cell.
  • Isolated refers to a substance and/or entity that has been (1) separated from at least some of the components with which it was associated when initially produced (whether in nature and/or in an experimental setting), and/or (2) designed, produced, prepared, and/or manufactured by the hand of man. Isolated substances and/or entities may be separated from about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or more than about 99% of the other components with which they were initially associated.
  • isolated agents are about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or more than about 99% pure.
  • a substance is "pure” if it is substantially free of other components.
  • a substance may still be considered “isolated” or even “pure”, after having been combined with certain other components such as, for example, one or more carriers or excipients (e.g ., buffer, solvent, water, etc.); in such embodiments, percent isolation or purity of the substance is calculated without including such carriers or excipients.
  • carriers or excipients e.g ., buffer, solvent, water, etc.
  • a biological polymer such as a polypeptide or polysaccharide that occurs in nature is considered to be "isolated” when, a) by virtue of its origin or source of derivation is not associated with some or all of the components that accompany it in its native state in nature; b) it is substantially free of other polypeptides or nucleic acids of the same species from the species that produces it in nature; c) is expressed by or is otherwise in association with components from a cell or other expression system that is not of the species that produces it in nature.
  • a polypeptide or polysaccharide that is chemically synthesized or is synthesized in a cellular system different from that which produces it in nature is considered to be an "isolated” polypeptide or polysaccharide.
  • a polypeptide or polysaccharide that has been subjected to one or more purification techniques may be considered to be an "isolated" polypeptide or polysaccharide to the extent that it has been separated from other components a) with which it is associated in nature; and/or b) with which it was associated when initially produced.
  • Linker As used herein, the term“linker” is used to refer to an entity that connects two or more elements to form a multi-element agent. For example, those of ordinary skill in the art appreciate that a polypeptide whose structure includes two or more functional or organizational domains often includes a stretch of amino acids between such domains that links them to one another.
  • a polypeptide comprising a linker element has an overall structure of the general form S1-L-S2, wherein Sl and S2 may be the same or different and represent two domains associated with one another by the linker (L).
  • a polypeptide linker is at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13,
  • a linker is characterized in that it tends not to adopt a rigid three-dimensional structure, but rather provides flexibility to the polypeptide.
  • linker elements that can appropriately be used when engineering polypeptides (e.g ., fusion polypeptides) are known in the art (Holliger et al, 1993; Poljak, 1994).
  • composition refers to a composition in which an active agent is formulated together with one or more pharmaceutically acceptable carriers.
  • the active agent is present in unit dose amount appropriate for administration in a therapeutic regimen that shows a statistically significant probability of achieving a predetermined therapeutic effect when administered to a relevant population.
  • a pharmaceutical composition may be specially formulated for administration in solid or liquid form, including those adapted for the following: oral administration, for example, drenches (aqueous or non-aqueous solutions or suspensions), tablets, e.g., those targeted for buccal, sublingual, and systemic absorption, boluses, powders, granules, pastes for application to the tongue; parenteral administration, for example, by subcutaneous, intramuscular, intravenous or epidural injection as, for example, a sterile solution or suspension, or sustained-release formulation; topical application, for example, as a cream, ointment, or a controlled-release patch or spray applied to the skin, lungs, or oral cavity; intravaginally or intrarectally, for example, as a pessary, cream, or foam; sublingually; ocularly; transdermally; or nasally, pulmonary, and to other mucosal surfaces.
  • oral administration for example, drenches (aqueous or non-aqueous solutions
  • composition as disclosed herein, the term "pharmaceutically acceptable" applied to the carrier, diluent, or excipient used to formulate a composition as disclosed herein means that the carrier, diluent, or excipient must be compatible with the other ingredients of the composition and not deleterious to the recipient thereof.
  • Polysaccharide refers to a polymeric carbohydrate molecule composed of long chains of monosaccharide units bound together by glycosidic, phosphodiester, or other linkages, and on hydrolysis give the constituent monosaccharides or oligosaccharides. Polysaccharides range in structure from linear to highly branched. Examples include storage polysaccharides such as starch and glycogen, structural polysaccharides such as cellulose and chitin and microbial
  • polysaccharides and antigenic polysaccharides found in microorganisms including, but not limited to, capsular polysaccharides (CPS), O polysaccharides (OPS), core O
  • Polypeptide generally has its art- recognized meaning of a polymer of at least three amino acids, e.g., linked to each other by peptide bonds.
  • polypeptide bonds e.g., linked to each other by peptide bonds.
  • polypeptides are intended to be sufficiently general as to encompass not only polypeptides having a complete sequence recited herein, but also to encompass polypeptides that represent functional fragments (i.e., fragments retaining at least one activity) of such complete polypeptides.
  • protein sequences generally tolerate some substitution without destroying activity.
  • Polypeptides may contain L-amino acids, D-amino acids, or both and may contain any of a variety of amino acid modifications or analogs known in the art. Useful modifications include, e.g. , terminal acetylation, amidation, methylation, etc.
  • proteins may comprise natural amino acids, non natural amino acids, synthetic amino acids, and combinations thereof.
  • prevention refers to reducing the risk of developing the disease, disorder and/or condition, and/or a delay of onset, and/or reduction in frequency and/or severity of one or more characteristics or symptoms of a particular disease, disorder or condition.
  • prevention is assessed on a population basis such that an agent is considered to“prevent” a particular disease, disorder or condition if a statistically significant decrease in the development, frequency, and/or intensity of one or more symptoms of the disease, disorder or condition is observed in a population susceptible to the disease, disorder, or condition.
  • prevention may be considered complete when onset of a disease, disorder or condition has been delayed for a predefined period of time.
  • Protein encompasses a polypeptide. Proteins may include moieties other than amino acids (e.g, may be glycoproteins, proteoglycans, etc.) and/or may be otherwise processed or modified. Those of ordinary skill in the art will appreciate that a“protein” can be a complete polypeptide chain as produced by a cell (with or without a signal sequence), or can be a characteristic portion thereof.
  • proteins can sometimes include more than one polypeptide chain, for example linked by one or more disulfide bonds or associated by other means.
  • Polypeptides may contain l-amino acids, d-amino acids, or both and may contain any of a variety of amino acid modifications or analogs known in the art. Useful modifications include, e.g ., terminal acetylation, amidation, methylation, etc.
  • proteins may comprise natural amino acids, non-natural amino acids, synthetic amino acids, and combinations thereof.
  • the term“peptide” is generally used to refer to a polypeptide having a length of less than about 100 amino acids, less than about 50 amino acids, less than 20 amino acids, or less than 10 amino acids.
  • proteins are antibodies, antibody fragments, biologically active portions thereof, and/or characteristic portions thereof.
  • Recombinant is intended to refer to polypeptides that are designed, engineered, prepared, expressed, created, manufactured, and/or isolated by recombinant means, such as polypeptides expressed using a recombinant expression vector transfected into a host cell; polypeptides isolated from a recombinant, combinatorial human polypeptide library; polypeptides isolated from an animal (e.g, a mouse, rabbit, sheep, fish, etc.) that is transgenic for or otherwise has been manipulated to express a gene or genes, or gene components that encode and/or direct expression of the polypeptide or one or more component(s), portion(s), element(s), or domain(s) thereof; and/or polypeptides prepared, expressed, created or isolated by any other means that involves splicing or ligating selected nucleic acid sequence elements to one another, chemically synthesizing selected sequence elements, and/or otherwise generating a nucleic acid that encodes and
  • one or more of such selected sequence elements is found in nature. In some embodiments, one or more of such selected sequence elements is designed in silico. In some embodiments, one or more such selected sequence elements results from mutagenesis (e.g, in vivo or in vitro ) of a known sequence element, e.g, from a natural or synthetic source such as, for example, in the germline of a source organism of interest (e.g., of a human, a mouse, etc.).
  • reference describes a standard or control relative to which a comparison is performed.
  • an agent, animal, subject, population, sample, sequence or value of interest is compared with a reference or control agent, animal, subject, population, sample, sequence or value.
  • a reference or control is tested and/or determined substantially simultaneously with the testing or determination of interest.
  • a reference or control is a historical reference or control, optionally embodied in a tangible medium.
  • a reference or control is determined or characterized under comparable conditions or circumstances to those under assessment.
  • a“response” to treatment may refer to any beneficial alteration in a subject’s condition that occurs as a result of or correlates with treatment. Such alteration may include stabilization of the condition (e.g ., prevention of deterioration that would have taken place in the absence of the treatment), amelioration of symptoms of the condition, and/or improvement in the prospects for cure of the condition, etc. It may refer to a subject’s response or to a tumor’s response. Subject or tumor response may be measured according to a wide variety of criteria, including clinical criteria and objective criteria.
  • Techniques for assessing response include, but are not limited to, clinical examination, positron emission tomography, chest X-ray CT scan, MRI, ultrasound, endoscopy, laparoscopy, presence or level of biomarkers in a sample obtained from a subject, cytology, and/or histology.
  • the exact response criteria can be selected in any appropriate manner, provided that when comparing groups of subjects and/or tumors, the groups to be compared are assessed based on the same or comparable criteria for determining response rate.
  • One of ordinary skill in the art will be able to select appropriate criteria.
  • risk refers to a likelihood that a particular subject will develop the disease, disorder, and/or condition.
  • risk is expressed as a percentage.
  • risk is from 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 40, 50, 60, 70, 80, 90 up to 100%.
  • risk is expressed as a risk relative to a risk associated with a reference sample or group of reference samples.
  • a reference sample or group of reference samples have a known risk of a disease, disorder, condition and/or event.
  • a reference sample or group of reference samples are from subjects comparable to a particular subject.
  • relative risk is 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more.
  • Serotype As used herein, the term“serotype”, also referred to as a serovar, refers to a distinct variation within a species of bacteria or virus or among immune cells of different subjects. These microorganisms, viruses, or cells are classified together based on their cell surface antigens, allowing the epidemiologic classification of organisms to the sub- species level. A group of serovars with common antigens may be referred to as a serogroup or sometimes serocomplex.
  • Subject refers an organism, typically a mammal (e.g ., a human, in some embodiments including prenatal human forms).
  • a subject is suffering from a relevant disease, disorder or condition.
  • a subject is susceptible to a disease, disorder, or condition.
  • a subject displays one or more symptoms or characteristics of a disease, disorder or condition.
  • a subject does not display any symptom or characteristic of a disease, disorder, or condition.
  • a subject is someone with one or more features characteristic of susceptibility to or risk of a disease, disorder, or condition.
  • a subject is a patient.
  • a subject is a subject to whom diagnosis and/or therapy is and/or has been administered.
  • a subject who is“susceptible to” a disease, disorder, or condition is at risk for developing the disease, disorder, or condition.
  • a subject who is susceptible to a disease, disorder, or condition does not display any symptoms of the disease, disorder, or condition.
  • a subject who is susceptible to a disease, disorder, or condition has not been diagnosed with the disease, disorder, and/or condition.
  • a subject who is susceptible to a disease, disorder, or condition is a subject who has been exposed to conditions associated with development of the disease, disorder, or condition.
  • a risk of developing a disease, disorder, and/or condition is a population-based risk (e.g., family members of subjects suffering from the disease, disorder, or condition).
  • Symptoms are reduced: As used herein,“symptoms are reduced” when one or more symptoms of a particular disease, disorder or condition is reduced in magnitude (e.g, intensity, severity, etc.) and/or frequency, e.g, to a stastistically and/or clinically significant or relevant level. For purposes of clarity, a delay in the onset of a particular symptom is considered one form of reducing the frequency of that symptom.
  • treatment refers to any administration of a therapy that partially or completely alleviates, ameliorates, relieves, inhibits, delays onset of, reduces severity of, and/or reduces incidence of one or more symptoms, features, and/or causes of a particular disease, disorder, and/or condition.
  • such treatment may be of a subject who does not exhibit signs of the relevant disease, disorder and/or condition and/or of a subject who exhibits only early signs of the disease, disorder, and/or condition. Alternatively or additionally, such treatment may be of a subject who exhibits one or more established signs of the relevant disease, disorder and/or condition. In some embodiments, treatment may be of a subject who has been diagnosed as suffering from the relevant disease, disorder, and/or condition. In some embodiments, treatment may be of a subject known to have one or more susceptibility factors that are statistically correlated with increased risk of development of the relevant disease, disorder, and/or condition.
  • Vaccination refers to the administration of a composition intended to generate an immune response, for example to a disease-causing agent.
  • vaccination can be administered before, during, and/or after exposure to a disease-causing agent, and in some embodiments, before, during, and/or shortly after exposure to the agent.
  • vaccination includes multiple administrations, appropriately spaced in time, of a vaccinating composition.
  • vaccination initiates immunization.
  • the present disclosure relates, generally, to novel immunogenic fusion proteins of S. pneumoniae that can be used, e.g ., to induce and/or increase an
  • IPD pneumococcal disease
  • the 13 serotypes contained in the vaccine in children and for the prevention of pneumonia and IPD in adults.
  • covalent conjugation of saccharides of the 13 pneumococcal serotypes to the CRM197 protein creates saccharide-protein conjugates, which are capable of inducing a T cell-dependent immune response against one or more of the 13 pneumococcal serotypes represented by the saccharides.
  • the second vaccine, PPSV23 is a 23-valent polysaccharide vaccine and is indicated for the prevention of pneumococcal disease in adults greater than 50 years of age, or in persons greater than 2 years of age at increased risk of pneumococcal disease. It is composed of purified capsular polysaccharides from 23 pneumococcal serotypes. While this vaccine has the potential to protect against more serotypes when compared to PCV13, it does not provide protection against the emerging serotypes 35B, 23A and 23B. In addition, PPSV23 elicits a T cell-independent polysaccharide immune response that stimulates mature B-lymphocytes, but not T-lymphocytes.
  • PPSV23 is not effective against colonization.
  • polysaccharide-type vaccines are not used in infants and children less than 2 years of age, because these children respond poorly to T cell- independent antigens [PNEUMOVAX 23 prescribing information, 2017; CDC, 2010]
  • PNEUMOVAX 23 prescribing information, 2017; CDC, 2010 Data suggest that PPSV23 may protect adults and the elderly against IPD; however, no consistent effect has been observed in the prevention of pneumonia [Gruber et al, 2008]
  • the presently disclosed novel immunogenic proteins represent a substantial advance over the currently available options for immunizing patients against pneumococcal infection.
  • Such immunogenic proteins can be used, e.g., to induce and/or increase an immunoprotective response or to reduce pneumococcal colonization in subjects, such as those at risk of or suffering from pneumococcal infection.
  • the present disclosure describes novel immunogenic fusion proteins of S. pneumoniae.
  • the inventors demonstrated that the pneumococcal antigens SP0785 and SP1500 individually elicited a strong IL-17 recall response in re- stimulated human PBMCs and splenocytes of mice that have been exposed to pneumococcus. Immunization of mice with SP0785 plus cholera toxin adjuvant, or with SP1500 plus cholera toxin adjuvant, resulted in significant reduction of pneumococcal colonization (on the order of lOO-fold).
  • Immunization with a fusion of SP0785 to the pneumolysoid PdT, or a fusion of SP0785 to the pneumolysoid PdT further conjugated to a polysaccharide of Salmonella typhi protected 80% of mice from sepsis in a lethal challenge with live S. pneumoniae.
  • Immunization with a fusion of SP0785, SP1500 and the pneumolysoid PdT further conjugated to a polysaccharide of Salmonella typhi also resulted in significant reduction of pneumococcal colonization (on the order of lO-fold).
  • a fusion protein includes one, two, or more polypeptides that elicit ( e.g ., primarily elicit) a T cell response, or that elicit both a T cell and a B cell response.
  • the fusion protein comprises one or more of the polypeptides listed in Table 1.
  • the fusion protein comprises two of the polypeptides listed in Table 1.
  • the fusion protein comprises three of the polypeptides listed in Table 1.
  • the fusion protein comprises one or more of polypeptides encoded by one or more of the genes listed in Table 1.
  • the fusion protein comprises two of polypeptides encoded by two or more of the genes listed in Table 1.
  • the fusion protein comprises three polypeptides encoded by three of the genes listed in Table 1.
  • a fusion protein comprises one or more antigenic polypeptides of S. pneumoniae having an amino acid sequence comprising any of SEQ ID NOs: 3-8, or antigenic fragments thereof. In some embodiments, a fusion protein comprises two antigenic polypeptides having an amino acid sequence comprising any of SEQ ID NOs:3-8, or antigenic fragments thereof. In some embodiments, a fusion protein comprises (i) two antigenic polypeptides having an amino acid sequence comprising any of SEQ ID NOs:3-8, or antigenic fragments thereof, and (i) a biotin-binding moiety comprising SEQ ID NO: 1 or 2, or biotin-binding fragments thereof.
  • At least one antigenic polypeptide is or comprises an SP0785 polypeptide (e.g ., SEQ ID NOs:3-5). In some such embodiments, at least one antigenic polypeptide is or comprises an SP1500 polypeptide (e.g., SEQ ID NOs:6-8).
  • a fusion protein comprises one or more polypeptides homologous to the S. pneumoniae polypeptides listed in Table 1, e.g, an SP0785
  • polypeptide or an SP1500 polypeptide isolated from different serotypes of S. pneumoniae Individual serotypes of S. pneumoniae contain numerous mutations relative to each other, and some of these result in different protein sequences between the different serotypes.
  • One of skill in the art may readily substitute an amino acid sequence, or a portion thereof, with the homologous amino acid sequence from a different S. pneumoniae serotype.
  • antigenic polypeptides have at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identity to the polypeptides listed in Table 1, or antigenic fragments thereof. Serotypic variation may be used to design such variants of the polypeptides listed in Table 1.
  • fusion proteins described herein comprise one or more fragments of polypeptides listed in Table 1, e.g, biotin-binding fragments of rhizavidin, antigenic fragments of a SP0785 polypeptide with or without a signal sequence, or antigenic fragments of a SP1500 polypeptide with or without a signal sequence.
  • polypeptides listed in Table 1 e.g, biotin-binding fragments of rhizavidin, antigenic fragments of a SP0785 polypeptide with or without a signal sequence, or antigenic fragments of a SP1500 polypeptide with or without a signal sequence.
  • fusion proteins described herein comprise truncation mutants that are close in size to the polypeptides listed in Table 1. For example, they may lack at most one, two, three, four, five, ten, or twenty amino acids from one or both termini (referring to
  • a fragment is a truncated fragment of any of SEQ ID NOs: l-8 lacking 1-5, 1-10, or 1-20 amino acid residues from the N-terminus, C-terminus, or both, of any one of SEQ ID NOs: 1-8. In some embodiments, a fragment is a truncated fragment of any of SEQ ID NOs: 1-8 lacking 1-10 amino acid residues from the N-terminus, C-terminus, or both, of any one of SEQ ID Nos: 1- 8.
  • a fragment may lack 10 amino acid residues at both the N-terminus and C- terminus of any one of SEQ ID NOs:l-8, resulting in a protein lacking 20 amino acid residues.
  • Internal deletions e.g ., of 1-10, 11-20, 21-30, or 31-40 amino acids, are also contemplated.
  • a fusion protein comprises an N-terminal polypeptide and a C-terminal polypeptide.
  • one or both of the N-terminal polypeptide and the C-terminal polypeptide is an antigenic polypeptide, for example, a polypeptide having an amino acid sequence comprising one or more of SEQ ID NOs:3-8, or an antigenic fragment or variant thereof.
  • one or both of the N- terminal polypeptide and the C-terminal polypeptide is a biotin-binding moiety, for example a polypeptide having an amino acid sequence comprising SEQ ID NO: 1 or 2, or a biotin binding fragment thereof.
  • one of the N-terminal polypeptide or the C-terminal polypeptide is a biotin-binding moiety, for example a polypeptide having an amino acid sequence comprising SEQ ID NO: 1 or 2, or a biotin-binding fragment thereof, and the other terminal polypeptide is an antigenic polypeptide, for example, a polypeptide having an amino acid sequence comprising one or more of SEQ ID NOs:3-8, or an antigenic fragment or variant thereof.
  • the N-terminal polypeptide and the C-terminal polypeptide are directly bound to each other.
  • the N-terminal polypeptide and the C-terminal polypeptide are linked via a linker peptide.
  • the length and/or amino acids of a linker when present, can be adjusted to obtain a more flexible, semi-rigid, or rigid linker.
  • Exemplary flexible peptide linkers are shown as SEQ ID NOs:37-40.
  • a linker can generally be from 1-40, such as 3-10 or 10-30 and specifically 3, 4, 5, 6, 7, 8, 9,
  • the fusion protein comprises one linker. In some embodiments, the fusion protein comprises two linkers. In some embodiments, the one or two linkers are selected from SEQ ID NO:37 (GGGGSSS) and SEQ ID NO:38 (AAA). In some embodiments, the fusion protein comprises SEQ ID NO:37 (GGGGSSS) and SEQ ID NO:38 (AAA). In some embodiments, the fusion protein comprises an amino acid sequence AAA residual from a Not I restriction site. In some embodiments, the fusion protein comprises a linker of SEQ ID NO:37 (GGGGSSS) and an amino acid sequence AAA residual from a Not I restriction site.
  • the present disclosure provides fusion proteins with at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% sequence identity to a fusion protein listed in Table 2.
  • a fusion protein is or includes an amino acid sequence having at least 80%, 85%, 90%, 95%, 97%, 98%, 99%, 99.5%, or 100% identity to any one of SEQ ID NOs: 17-26.
  • a fusion protein is or includes an amino acid sequence having at least 80%, 85%, 90%, 95%, 97%, 98%, 99%, 99.5%, or 100% identity to SEQ ID NO:23.
  • a fusion protein is or includes an amino acid sequence having at least 80%, 85%, 90%, 95%, 97%, 98%, 99%, 99.5%, or 100% identity to CP1.
  • a fusion protein described herein comprises an antigenic fragment of a fusion protein shown in Table 2.
  • a fusion protein is or includes an antigenic fragment of any of SEQ ID NOs: 17-26.
  • a fusion protein may lack at most one, two three, four, five, ten, or twenty amino acids from the N-terminus, C-terminus, or both, of any one of SEQ ID NOs: 17-26.
  • a fusion protein is or includes an antigenic fragment of SEQ ID NO:23. In some embodiments, a fusion protein is or includes an antigenic fragment of CP1.
  • a fusion protein described herein comprises a biotin binding moiety.
  • the fusion protein comprises a biotin-binding moiety, and one or more polypeptide antigens.
  • the fusion protein comprises a biotin-binding moiety and two or more polypeptide antigens.
  • a “biotin-binding moiety” refers to a biotin-binding polypeptide or protein, a biotin-binding fragment thereof, or a biotin-binding domain thereof.
  • the biotin binding moiety of the fusion protein comprises rhizavidin or a biotin-binding fragment thereof, as further described in WO 2012/155053, the contents of which are herein incorporated by reference in their entirety.
  • a fusion protein described herein comprises a biotin binding moiety that is or comprises a polypeptide having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to the sequence of SEQ ID NO: l (rhizavidin), or biotin-binding fragment thereof.
  • the fusion protein comprises a biotin-binding moiety that is or comprises a polypeptide having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to the sequence of SEQ ID NO:2 (amino acids 45-179 of rhizavidin, denoted Rhavi), or biotin-binding fragment thereof.
  • the fusion protein comprises a polypeptide comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to the sequence of SEQ ID NO:4 (amino acids 33-399 of S. pneumoniae SP0785 polypeptide), or an antigenic fragment thereof.
  • the fusion protein comprises a polypeptide comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to the sequence of SEQ ID NO:7 (amino acids 27-278 of S. pneumoniae SP1500 polypeptide), or an antigenic fragment thereof.
  • a fusion protein described herein comprises each of: (a) a biotin-binding moiety that is or comprises a polypeptide having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to the sequence of SEQ ID NO:l (rhizavidin), or biotin-binding fragment thereof; (b) a polypeptide comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to the sequence of SEQ ID NO:4 (amino acids 33-399 of S.
  • the fusion protein further comprises one or more linkers.
  • the one or more linkers are selected from SEQ ID NO:37 (GGGGSSS) and SEQ ID NO:38 (AAA).
  • the fusion protein comprises an amino acid sequence AAA residual from a Not I restriction site.
  • the fusion protein comprises a linker of SEQ ID NO:37 (GGGGSSS) and an amino acid sequence AAA residual from a Not I restriction site.
  • a fusion protein described herein comprises each of:
  • biotin-binding moiety that is or comprises a polypeptide having at least 80%, 85%,
  • SEQ ID NO:2 amino acids 45-179 of rhizavidin, denoted Rhavi
  • a polypeptide comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to the sequence of SEQ ID NO:4 (amino acids 33-399 of S.
  • pneumoniae SP0785 polypeptide or an antigenic fragment thereof; and (c) a polypeptide comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to the sequence of SEQ ID NO:5 (amino acids 27-278 of S.
  • the fusion protein further comprises one or more linkers.
  • the one or more linkers are selected from SEQ ID NO:37 (GGGGSSS) and SEQ ID NO:38 (AAA).
  • the fusion protein comprises an amino acid sequence AAA residual from a Not I restriction site.
  • the fusion protein comprises a linker of SEQ ID NO:37 (GGGGSSS) and an amino acid sequence AAA residual from a Not I restriction site.
  • a fusion protein described herein comprises an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%,
  • a fusion protein described herein includes a variant or fragment of a polypeptide listed in Table 1. In some embodiments, a fusion protein described herein includes a polypeptide encoded by a variant or fragment of a gene listed in Table 1. In some embodiments, a fragment included in a fusion protein described herein is close in size to a full-length polypeptide or a polypeptide listed in Table 1.
  • the fragment may lack at most one, two, three, four, five, ten, twenty, or thirty amino acids from one or both termini.
  • the fragment is 25-50 amino acids in length, or 50- 100, or 100-150, or 150-200, or 200-250, or 250-300, or 300-350 amino acids in length.
  • the fragments result from processing, or partial processing, of signal sequences by an expression host, e.g. E. coli, an insect cell line (e.g, the baculovirus expression system), or a mammalian (e.g, human or Chinese Hamster Ovary) cell line.
  • fragments described above or sub-fragments thereof e.g, fragments of 8-50, 8-30, or 8-20 amino acid residues
  • each gene and polypeptide may be identified by searching for the Locus Tag in a publicly available database, e.g., Entrez Gene (on the NCBI NIH web site on the World Wide Web, at www.ncbi.nlm.nih.
  • SP0785 Polypeptides e.g., SEQ ID NOs:3-5
  • Variants Thereof e.g., SEQ ID NOs:3-5
  • SP0785 is a conserved hypothetical S. pneumoniae protein described in WO
  • a SP0785 polypeptide is an efflux transporter protein conserved across S. pneumoniae strains.
  • a SP0785 polypeptide is or comprises a full-length SP0785 polypeptide.
  • a full- length SP0785 polypeptide has 399 amino acids (38 kDa) and is represented by the amino acid sequence as set forth in SEQ ID NO: 3.
  • Amino acids 1-32 of SEQ ID NO:3 are predicted to be a signal sequence and transmembrane domain of a SP0785 polypeptide (amino acids 1-32 of the full-length protein).
  • a fusion protein comprises a SP0785 polypeptide of S. pneumoniae.
  • a fusion protein comprises at least 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 45, 50, 60, 65, 70, 75, 80, 85, 90, 95, 100, 150, 200, 250, 300, 350, 367, or 399 consecutive amino acids of a SP0785 polypeptide.
  • a SP0785 polypeptide of the fusion protein comprises at least 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 45, 50, 60, 65, 70, 75, 80, 85, 90, 95, 100, 150, 200, 250, 300, 350, 367, or 399 consecutive amino acids of the sequence shown in SEQ ID NO:3 [full-length].
  • a SP0785 polypeptide of the fusion protein comprises at least 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 45, 50, 60, 65, 70, 75, 80, 85, 90, 95, 100, 150, 200, 250, 300, 350, 367, or 399 consecutive amino acids of the sequence shown in SEQ ID NO:3 [full-length].
  • a SP0785 comprises at least 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 45, 50, 60, 65, 70, 75, 80, 85, 90, 95, 100, 150, 200, 250, 300, 350, 367, or 399 consecutive amino
  • polypeptide of the fusion protein comprises an amino acid sequence that is at least 60% or more (including, e.g., at least 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to at least 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 45, 50, 60, 65, 70, 75, 80, 85, 90, 95, 100, 150, 200, 250, 300, 350, 367, or 399 consecutive amino acids of the sequence shown in SEQ ID NO: 3 [full-length].
  • a SP0785 polypeptide of the fusion protein comprises at least 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 45, 50, 60, 65, 70, 75,
  • a SP0785 polypeptide of the fusion protein comprises an amino acid sequence that is at least 60% or more (including, e.g., at least 65%, 70%, 75%, 80%, 85%, 90%, 95%,
  • SEQ ID NO:5 a consensus sequence illustrating combinations of SP785 sequences from different S. pneumoniae serotypes.
  • the fusion protein includes a polypeptide having an amino acid sequence comprising, or consisting of, SEQ ID NO:5, or an antigenic fragment thereof (e.g, in place of a polypeptide having an amino acid sequence comprising one of SEQ ID NO:3 or 4).
  • a SP0785 polypeptide of the fusion protein comprises at least 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 45, 50, 60, 65, 70, 75, 80, 85, 90, 95, 100, 150, 200, 250, 300, 350, or 367 consecutive amino acids of the sequence shown in SEQ ID NO:5 [consensus].
  • a SP0785 comprises at least 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 45, 50, 60, 65, 70, 75, 80, 85, 90, 95, 100, 150, 200, 250, 300, 350, or 367 consecutive amino acids of the sequence shown in SEQ ID NO:5 [consensus].
  • a SP0785 comprises at least 7, 8, 9, 10,
  • polypeptide of the fusion protein comprises an amino acid sequence that is at least 60% or more (including, e.g., at least 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to at least 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19,20, 25, 30, 35, 45, 50, 60, 65, 70, 75, 80, 85, 90, 95, 100, 150, 200, 250, 300, 350, or 367 consecutive amino acids of the sequence shown in SEQ ID NO:5 [consensus]
  • SEQ ID NO: 11 An exemplary nucleotide sequence encoding a SP0785 polypeptide is provided herein as SEQ ID NO: 11.
  • SP1500 Polypeptides e.g., SEQ ID NOs:6-8 and Variants Thereof
  • a SP1500 polypeptide is an Amino Acid ABC Transporter, amino acid-binding polypeptide conserved across S. pneumoniae strains.
  • a SP1500 polypeptide is or comprises a full-length SP1500 polypeptide.
  • a full-length SP1500 polypeptide has 278 amino acids (28 kDa) and is represented by the amino acid sequence as set forth in SEQ ID NO: 6.
  • Amino acids 1-26 of SEQ ID NO:6 are predicted to be a signal sequence of a SP1500 polypeptide (amino acids 1-26 of the full-length protein).
  • a fusion protein comprises a SP1500 polypeptide of S. pneumoniae.
  • a fusion protein comprises at least 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18,
  • a SP1500 polypeptide of the fusion protein comprises at least 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 45, 50, 60, 65, 70, 75,
  • a SP1500 polypeptide of the fusion protein comprises an amino acid sequence that is at least 60% or more (including, e.g., at least 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to at least 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 45, 50, 60, 65, 70, 75, 80, 85, 90, 95, 100, 150, 200, 252, or 278 consecutive amino acids of the sequence shown in SEQ ID NO: 6 [full-length]
  • a SP1500 polypeptide of the fusion protein comprises at least 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 45, 50, 60, 65, 70, 75, 80, 85, 90, 95, 100, 150, 200, or 252 consecutive amino acids of the sequence shown in SEQ ID NO:7 [minus signal sequence].
  • a SP1500 polypeptide of the fusion protein comprises an amino acid sequence that is at least 60% or more (including, e.g., at least 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to at least 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19,20, 25, 30, 35, 45, 50, 60,
  • the fusion protein includes a polypeptide having an amino acid sequence comprising, or consisting of, SEQ ID NO:8, or an antigenic fragment thereof (e.g, in place of a polypeptide having an amino acid sequence comprising one of SEQ ID NO:6 or 7).
  • a SP1500 polypeptide of the fusion protein comprises at least 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 45, 50, 60, 65, 70, 75, 80, 85, 90, 95,
  • a SP1500 polypeptide of the fusion protein comprises an amino acid sequence that is at least 60% or more (including, e.g., at least 65%, 70%,
  • SEQ ID NO: 14 An exemplary nucleotide sequence encoding a SP1500 polypeptide is provided herein as SEQ ID NO: 14.
  • a fusion protein described herein is a component of non-covalent Multiple Antigen Presenting System (MAPS) immunogenic complexes.
  • MAPS complexes utilize the high affinity (dissociation constant [KD] ⁇ 10 15 M) noncovalent binding between biotin, or biotin derivatives, and rhizavidin, a biotin binding protein that has no significant predicted homology with human proteins.
  • Rhizavidin is a naturally occurring dimeric protein in the avidin protein family, was first discovered in Rhizobium etli , a symbiotic bacterium of the common bean.
  • Rhizavidin has only a 22% amino acid identity with chicken avidin, a protein commonly found in eggs, but with high conservation of amino acid residues involved in biotin binding [Helppolainen et al, 2007]
  • the nucleotide sequence of rhizavidin is set forth in SEQ ID NO:9.
  • the amino acid sequence of rhizavidin is set forth in SEQ ID NO: 1.
  • Amino acids 1-44 of SEQ ID NO: 1 are predicted to be a signal sequence(s) of rhizavidin (amino acids 1-44 of the full-length protein).
  • a fusion protein comprises rhizavidin.
  • a fusion protein comprises at least 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 45, 50, 60, 65, 70, 75, 80, 85, 90, 95, 100, 150, or 179 consecutive amino acids of a rhizavidin polypeptide.
  • a rhizavidin polypeptide of the fusion protein comprises at least 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 45, 50, 60, 65, 70, 75, 80, 85, 90, 95, 100, 150, or 179 consecutive amino acids of the sequence shown in SEQ ID NO: 1 [full-length].
  • a rhizavidin polypeptide of the fusion protein comprises an amino acid sequence that is at least 60% or more (including, e.g., at least 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to at least 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 45, 50, 60, 65, 70, 75, 80, 85, 90, 95, 100, 150, or 179 consecutive amino acids of the sequence shown in SEQ ID NO: l [full-length].
  • a rhizavidin polypeptide of the fusion protein comprises at least 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 45, 50, 60, 65, 70, 75, 80, 85, 90, 95, 100, or 135 consecutive amino acids of the sequence shown in SEQ ID NO:2 [minus signal sequence].
  • a rhizavidin polypeptide of the fusion protein comprises an amino acid sequence that is at least 60% or more (including, e.g., at least 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to at least 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19,20, 25, 30, 35, 45, 50, 60,
  • a rhizavidin polypeptide of the fusion protein is or comprises amino acids 50-179 of SEQ ID NO:l. In some embodiments, a rhizavidin polypeptide of the fusion protein is or comprises amino acids 55-179 of SEQ ID NO: l. In some embodiments, a rhizavidin polypeptide of the fusion protein is or comprises amino acids 60-179 of SEQ ID NO: l. In some embodiments, a rhizavidin polypeptide of the fusion protein is or comprises amino acids 65-179 of SEQ ID NO: l.
  • a rhizavidin polypeptide of the fusion protein is or comprises amino acids 45-175 of SEQ ID NO:l. In some embodiments, a rhizavidin polypeptide of the fusion protein is or comprises amino acids 45-171 of SEQ ID NO: l. In some embodiments, a rhizavidin polypeptide of the fusion protein is or comprises amino acids 45-167 of SEQ ID NO: l. In some embodiments, a rhizavidin polypeptide of the fusion protein is or comprises amino acids 45-163 of SEQ ID NO: l.
  • a fusion protein comprises one or more linkers.
  • a linker is or comprises one or more amino acids.
  • a fusion protein comprises an antigenic polypeptide joined to a biotin-binding moiety by a linker.
  • a fusion protein comprises a first antigenic polypeptide, a second antigenic polypeptide, a biotin-binding moiety, and at least one linker.
  • the first antigenic polypeptide and the second antigenic polypeptide are joined by a linker.
  • the first antigenic polypeptide or the second antigenic polypeptide are joined to the biotin-binding moiety by a linker.
  • first antigenic polypeptide and the second antigenic polypeptide are joined by a first linker; and the first antigenic polypeptide or the second antigenic polypeptide are joined to the biotin-binding moiety by a second linker.
  • a linker interposes a structure between two protein moieties.
  • the structure is or comprises an a-helix.
  • the structure is or comprises a b-strand.
  • the structure is or comprises a coil/bend.
  • the structure is or comprises a turn.
  • a linker decreases steric hindrance between two protein moieties joined by the linker.
  • a linker decreases unfavorable interactions between two protein moieties joined by the linker.
  • a linker comprises a mixture of glycine and serine residues.
  • the linker may additionally comprise threonine, proline, and/or alanine residues.
  • a linker is hydrophilic.
  • a linker is hydrophobic.
  • a linker increases the stability of the fusion protein containing the linker.
  • a linker does not interfere with the folding of an antigenic polypeptide to which it is joined. In some embodiments, a linker does not interfere with the antigenicity of an antigenic polypeptide to which it is joined. In some
  • a linker does not reduce the antigenicity of an antigenic polypeptide to which it is joined. In some embodiments, a linker does not eliminate the antigenicity of an antigenic polypeptide to which it is joined. In some embodiments the effect of the linker is determined by comparing the polypeptide with the polypeptide joined to the linker.
  • a linker does not interfere with the folding of a biotin binding moiety to which it is joined. In some embodiments, a linker does not interfere with the biotin-binding ability of a biotin-binding moiety to which it is joined. In some embodiments, a linker does not reduce the biotin-binding ability of a biotin-binding moiety to which it is joined. In some embodiments, a linker does not eliminate the biotin-binding ability of a biotin-binding moiety to which it is joined. In some embodiments the effect of the linker is determined by comparing the biotin-binding moiety with the biotin-binding moiety joined to the linker.
  • a linker is not antigenic. In some embodiments, a linker does not elicit a T cell response. In some embodiments, a linker does not elicit a B cell response. In some embodiments, a linker does not induce a T cell or a B cell response.
  • a linker comprises two or more amino acids.
  • a linker may be 3-100, 5-100, 10-100, 20-100 30-100, 40-100, 50-100, 60- 100, 70-100, 80-100, 90-100, 5-55, 10-50, 10-45, 10-40, 10-35, 10-30, 10-25, 10-20, 10-15,
  • a linker comprises between 10-100, 10-90, 10-80, 10-70, 10-60, 10-50, 10-40, 10-30, 10-20, 10-15 amino acids. In some embodiments, the linker comprises at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, or 95 amino acids. In some embodiments, a linker is or comprises 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70,
  • a linker is a flexible linker.
  • Flexible linkers may be useful for joining domains that require a certain degree of movement or interaction and may include small, non-polar (e.g . Gly) or polar (e.g. Ser or Thr) amino acids. Incorporation of Ser or Thr can also maintain the stability of the linker in aqueous solutions by forming hydrogen bonds with the water molecules, and therefore reduce unfavorable interactions between the linker and the protein moieties.
  • a linker comprises small non-polar (e.g . Gly) or polar (e.g. Ser or Thr) amino acids.
  • a linker is a Gly-Ser linker.
  • a linker is or comprises an amino acid sequence of GGGGSSS (SEQ ID NO:37).
  • a linker is or comprises a sequence of (GGGGS)n (SEQ ID NO: 39), where n represents the number of repeating GGGGS units and is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30 or more.
  • a polypeptide linker may have an amino acid sequence that is or comprises GGGGSGGGGSGGGGS (SEQ ID NO:4l) (i.e., (GGGGS) 3 ) or
  • a linker comprises one or more of Gly, Ser, Thr, Ala, Lys, and Glu.
  • a linker is or comprises KESGSVSSEQLAQFRSLD (SEQ ID NO:43).
  • a linker is or comprises EGKSSGSGSESKST (SEQ ID NO:44).
  • a linker is or comprises (Gly)n (SEQ ID NO:45) where n represents the number of repeating Gly residues and is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30 or more.
  • a linker is or comprises GGG.
  • a linker is or comprises (Gly) 6 (SEQ ID NO:40).
  • a linker is or comprises (Gly)s (SEQ ID NO:46).
  • a linker is or comprises GSAGSAAGSGEF (SEQ ID NO:47).
  • a linker is or comprises an amino acid sequence of AAA (SEQ ID NO:38).
  • a linker is a rigid linker. Rigid linkers are useful to keep a fixed distance between domains and to maintain their independent functions. Rigid linkers may also be useful when a spatial separation of the domains is critical to preserve the stability or bioactivity of one or more components in the fusion.
  • a linker is or comprises (EAAAK)n (SEQ ID NO:48) where n represents the number of repeating EAAAK units and is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30 or more.
  • a linker is or comprises A(EAAAK) n A, (SEQ ID NO:49) where n represents the number of repeating EAAAK units and is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30 or more.
  • a linker is or comprises A(EAAAK) n A, where n represents the number of repeating EAAAK units and is 2, 3, 4, or 5.
  • a linker is or comprises
  • a linker is or comprises [A(EAAAK) n A]m, (SEQ ID NO:51) wherein n is 2, 3, or 4 and m is 1 or 2.
  • a linker is or comprises AEAAAKEAAAKA (SEQ ID NO:52).
  • a linker is or comprises (X-Pro)n (SEQ ID NO:53) , with X designating any amino acid, where n represents the number of repeating X-Pro units and is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30 or more.
  • a linker is or comprises (Ala-Pro)n (SEQ ID NO:54), where n represents the number of repeating Ala-Pro units and is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15,
  • a linker is or comprises (Ala-Pro)n, where n represents the number of repeating Ala-Pro units and is 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, or 17.
  • a linker is or comprises (Lys-Pro)n (SEQ ID NO:55), where n represents the number of repeating Lys-Pro units and is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10,
  • a linker is or comprises (Glu-Pro)n (SEQ ID NO:56), where n represents the number of repeating Glu-Pro units and is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30 or more.
  • a linker is or comprises (Ala-Pro)7 (SEQ ID NO:57).
  • a linker is or comprises
  • a linker is or comprises
  • a linker is or comprises
  • GAPGGGGGAAAAAGGGGGGAPGGGGGAAAAAGGGGGGAPGGGGGAAAAAGGG GGGAP (GAG3 linker, SEQ ID NO: 60).
  • Suitable linkers or spacers also include those having an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more homologous or identical to the above exemplary linkers.
  • a fusion protein described herein may comprise a tag.
  • a tag may be N-terminal or C-terminal.
  • tags may be added to a polypeptide (via additions or modifications on the encoding DNA sequence) to facilitate purification, detection, solubility, or confer other desirable characteristics on the protein.
  • a tag may be a peptide, oligopeptide, or polypeptide that may be used in affinity purification.
  • a tag is, comprises, or is derived from one or more of polyhistidine (His), Glutathione S-transferase (GST), tandem affinity purification (TAP), FLAG, myc, human influenza hemagglutinin (HA), maltose binding protein (MBP), vesicular Stomatitis viral glycoprotein (VSV-G), thioredoxin, V5, avidin, streptavidin, biotin carboxyl carrier protein (BCCP), Calmodulin, Nus, S tags, lipoprotein D, and galactosidase.
  • a His tag is or comprises an amino acid sequence of H n , wherein n is an integer between 2 and 10.
  • Exemplary His tags include HHHHHH (SEQ ID NO: 15) and MSYYHHHHHH (SEQ ID NO: 16).
  • the fusion protein is free of tags such as protein purification tags, and is purified by a method not relying on affinity for a purification tag.
  • the fusion protein comprises no more than 1, 2, 3, 4, 5, 10, or 20 additional amino acids on one or both termini of a polypeptide of Table 1 or fusion protein of Table 2.
  • a fusion protein described herein may contain a membrane translocating sequence (MTS), to facilitate introduction of the fusion protein into a mammalian cell and subsequent stimulation of the cell-mediated immune response.
  • MTS membrane translocating sequence
  • Exemplary membrane translocating sequences include the hydrophobic region in the signal sequence of Kaposi fibroblast growth factor, the MTS of a synuclein, the third helix of the Antennapedia homeodomain, SN50, integrin 3 h-region, HIV Tat, pAntp, PR-39, abaecin, apidaecin, Bac5, Bac7, P. berghei CS protein, and those MTSs described in U.S. Pat. Nos. 6,248, 558, 6,432,680 and 6,248,558.
  • the present disclosure provides nucleic acids, e.g ., DNA, RNA, or analogs thereof, encoding one or more of the polypeptides and/or fusion proteins described herein.
  • An underlying DNA sequence for the polypeptides described herein may be modified in ways that do not affect the sequence of the protein product, and such sequences are included in the invention.
  • a DNA sequence may be codon-optimized to improve expression in a host such as a bacterial cell line, e.g. , E. coli , an insect cell line (e.g, using the baculovirus expression system), or a mammalian (e.g, human or Chinese Hamster Ovary) cell line.
  • the present disclosure provides nucleic acids, e.g, DNA, RNA, or analogs thereof, that are at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 99.5%, or 100% identical to a nucleic acid sequence provide in Table 1, Table 2, or a variant or portion thereof.
  • the nucleic acid is 600-2000, 800-1800, 1000-1600, 1200-1400 nucleotides in length.
  • the nucleic acid is 600- 1600, 800-1800, 1000-2000, 2000-3000, or 3000-4000 nucleotides in length.
  • a nucleic acid may be used for recombinant production of a polypeptide or fusion protein of Table 1 or Table 2, or antigenic fragments thereof.
  • a nucleic acid may be used as a vaccine.
  • Nucleic acid sequences encoding variants of SP0785 are provided as SEQ ID NOs: 11 and 12.
  • Nucleic acid sequences encoding variants of SP1500 are provided as SEQ ID NOs: 6 and 7.
  • Nucleic acid sequences encoding different fusion proteins are provided as SEQ ID NOs:27-36.
  • other DNA sequences including multiple codon-optimized sequences could be contemplated by those of ordinary skill to encode such polypeptides and fusion proteins.
  • Nucleic acids encoding polypeptides or fusion proteins of Table 1 or Table 2, or fragments thereof, can be cloned into any of a variety of expression vectors, under the control of a variety of regulatory elements, and fusions can be created with other sequences of interest.
  • Methods of cloning nucleic acids are routine and conventional in the art.
  • isolating, cloning, modifying, labeling, manipulating, sequencing and otherwise treating or analyzing nucleic acids and/or proteins see, e.g. , Sambrook et al,l989; Ausubel et al,l995; Davis et al, 1986; Hames et al, 1985; Dracopoli et al, 2018; and Coligan et al, 2018.
  • a fusion protein described herein does not have, or has minimal, hemolytic activity.
  • the hemolytic activity of a fusion protein described herein can be established by turbidimetry (OD420) after incubation of the fusion protein at different dilutions with red blood cells (e.g., sheep erythrocytes), to determine the protein concentration at which 50% of the red blood cells are lysed.
  • the hemolytic activity of a fusion protein described herein can be characterized by an OD420 of less than 0.4 or lower, including, e.g., less than 0.3, less than 0.25, less than 0.2, or lower, for a given protein concentration.
  • polypeptides of S. pneumoniae and fusion proteins described herein, and fragments and variants thereof are immunogenic. These polypeptides and fusion proteins may be immunogenic in mammals, for example mice, rats, guinea pigs, or humans.
  • An antigenic polypeptide or fusion protein is typically one capable of raising a significant immune response in an assay or in a subject.
  • the immune response may be innate, humoral, cell-mediated, or mucosal (combining elements of innate, humoral and cell-mediated immunity).
  • an antigenic polypeptide or fusion protein may increase the amount of IL-17 produced by T cells.
  • an antigenic polypeptide or fusion protein may (i) induce production of antibodies, e.g ., neutralizing antibodies, that bind to the polypeptide and/or the whole bacteria, (ii) induce Thl7 immunity, (iii) activate the CD4+ T cell response, for example by increasing the number of CD4+ T cells and/or increasing localization of CD4+ T cells to the site of infection or reinfection, (iv) activate the CD8+ T cell response, for example by increasing the number of CD8+ T cells and/or increasing localization of CD8+ T cells to the site of infection or reinfection, (v) activate both the CD4+ and the CD8+ response, (vi) activate CD4-/CD8- immunity, (vii) induce Thl immunity, (viii) induce anti -microbial peptides, (ix) activate innate immunity, or any combination of the foregoing.
  • an antigenic polypeptide or fusion protein elicits production of a detectable amount of antibody specific to that antigen
  • a fusion protein described herein is an antigen or has antigenic properties. In some embodiments, a fusion protein described herein is a carrier protein or has carrier properties. In some embodiments, a fusion protein described herein is both an antigen and a carrier protein. In some embodiments, a fusion protein described herein has both carrier properties and antigenic properties.
  • a fusion protein described herein is an antigen of an immunogenic complex (e.g., a Multiple Antigen Presenting System (MAPS) complex as described in WO 2012/155007, the entire contents of which are incorporated herein by reference for the purposes indicated herein).
  • a fusion protein described herein is a carrier protein of an immunogenic complex.
  • a fusion protein described herein is both a carrier protein and an antigen of an immunogenic complex.
  • polypeptides of the fusion proteins described herein have less than 20%, 30%, 40%, 50%, 60% or 70% identity to human auto-antigens and/or gut commensal bacteria (e.g., certain Bacteroides, Clostridium , Fusobacterium,
  • Escherichia Escherichia , and Lactobacillus species.
  • human autoantigens include insulin, proliferating cell nuclear antigen, cytochrome P450, and myelin basic protein.
  • a polypeptide included in a fusion protein described herein may comprise one or more immunogenic portions and one or more non-immunogenic portions.
  • the immunogenic portions may be identified by various methods, including protein microarrays, ELISPOT/ELISA techniques, and/or specific assays on different deletion mutants (e.g, fragments) of the polypeptide in question.
  • Immunogenic portions may also be identified by computer algorithms. Some such algorithms, like EpiMatrix (produced by EpiVax), use a computational matrix approach.
  • An antigenic fragment of a polypeptide described herein comprises at least one immunogenic portion, as measured experimentally or identified by algorithm (for example, the SYFPEITHI algorithm found at
  • the present disclosure also provides immunogenic compositions (e.g ., vaccine compositions) of, or comprising, one or more fusion proteins described herein.
  • the immunogenic composition comprises one or more fusion proteins with at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% sequence identity to a fusion protein listed in Table 2.
  • the immunogenic composition comprises a fusion protein that is or includes an amino acid sequence having at least 80%, 85%, 90%, 95%, 97%, 98%, 99%, 99.5%, or 100% identity to any one of SEQ ID NOs: 17-26.
  • the immunogenic composition comprises a fusion protein that is or includes an amino acid sequence having at least 80%, 85%, 90%, 95%, 97%, 98%, 99%, 99.5%, or 100% identity to SEQ ID NO:23. In some embodiments, the immunogenic composition comprises a fusion protein that is or includes an amino acid sequence having at least 80%, 85%, 90%, 95%, 97%, 98%, 99%, 99.5%, or 100% identity to CP1 (e.g., as described in Figure 1).
  • an immunogenic composition may also comprise portions of fusion proteins described herein, for example internal deletion mutants, truncation mutants, and fragments.
  • the portions of said fusion proteins are immunogenic.
  • the immunogenicity of a portion of a fusion protein is readily determined using the same assays that are used to determine immunogenicity of the full- length fusion protein.
  • the portion of the fusion protein has substantially the same immunogenicity as the full-length fusion protein.
  • the immunogenicity is no less than 10%, 20%, 30%, 40%, or 50% that of the fusion proteins of Table 2.
  • an immunogenic composition described herein includes a fusion protein described herein and additionally one or more, or two or more, known S. pneumoniae antigens.
  • the known S. pneumoniae antigens are predominantly antibody targets.
  • the known S. pneumoniae antigens are polysaccharides.
  • the known S. pneumoniae antigens protect from S. pneumoniae colonization, or from S. pneumoniae -induced sepsis, pneumonia, meningitis, otitis media, sinusitis, or infection of other sites or organs by S. pneumoniae.
  • One appropriate art-recognized class of S. pneumoniae antigens is
  • PspA Pneumococcal surface protein A
  • derivatives of PspA include proline-rich segments with the non-proline block (PR+NPB, also referred to as PRN and further described in Daniels et al, 2010), and related constructs comprising all or a fragment of the proline-rich region of PspA (e.g ., regions containing one or more of the sequences PAPAP, PKP, PKEPEQ and PEKP and optionally including a non-proline block).
  • fragments or variants of PspA comprise proline-rich segments with the non-proline block and 10, 20 30, 40 or more additional amino acids of PspA sequence.
  • Peptides containing the NPB are particularly immunogenic, suggesting that the NPB may be an important epitope.
  • Pneumolysoids have homology to the S. pneumoniae protein pneumolysin (PLY or Ply), but have reduced toxicity compared to pneumolysin. Pneumolysoids can be naturally occurring or engineered derivatives of pneumolysin. In some embodiments, a pneumolysoid has at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to pneumolysin.
  • the pneumolysoid demonstrates less than one half, l/lOth, l/20th, 1/50th, l/lOOth, l/200th, l/500th, or l/lOOOth the toxicity of pneumolysin in an assay for one or both of hemolytic activity towards erythrocytes and inhibition of polymorphonuclear leukocytes. Both assays are described in Saunders et al, 1989.
  • Exemplary pneumolysoids include PdT, a triple mutant further described in Berry et al,
  • the pneumolysin has a mutation in the catalytic center, such as at amino acid 428 or 433 or its vicinity.
  • S. pneumoniae antigens include choline-binding protein A (CbpA) and derivatives thereof (Ogunniyi et al, 2001); pneumococcal surface adhesin A (PsaA); caseinolytic protease; sortase A (SrtA); pilus 1 RrgA adhesin; PpmA; PrtA; PavA; LytA; Stk-PR; PcsB; RrgB and derivatives thereof.
  • CpbA derivatives include constructs described in WO 2012/134975.
  • an immunogenic composition e.g ., a vaccine composition
  • the mixture contains both full-length polypeptides and fragments resulting from processing, or partial processing, of signal sequences by an expression host, e.g. E. coli , an insect cell line (e.g, the baculovirus expression system), or a mammalian cell line (e.g, human or Chinese Hamster Ovary).
  • an immunogenic composition contains one or more fusion proteins of any of SEQ ID NOs: 17-26 in the absence of any other antigens. In some embodiments, an immunogenic composition contains a fusion protein of SEQ ID NO:23 in the absence of any other antigens. In some embodiments, an immunogenic composition contains one or more fusion proteins of any of SEQ ID NOs: 17-26 in combination with one or more additional proteins of any of SEQ ID NOs: 1-8, in the absence of other antigens. In some embodiments, an immunogenic composition contains a fusion protein of SEQ ID NO:23 in combination with one or more additional proteins of any of SEQ ID NOs: 1-8, in the absence of any other antigens.
  • fusion proteins described herein may be conjugated to S. pneumoniae polysaccharides.
  • fusion proteins described herein may be non-covalently complexed to S. pneumoniae polysaccharides.
  • the S. pneumoniae polysaccharides may be, for example, as described in U.S. Pat. No. 5,623,057, U.S. Pat. No. 5,371,197, or PCT/US2011/023526.
  • the non-covalent complexes may be, for example, those of the Multiple Antigen Presenting System (MAPS), as described in
  • a fusion protein described herein is covalently bound to another molecule. This may, for example, increase the half-life, solubility,
  • Molecules that may be covalently bound to the fusion protein include a carbohydrate, biotin, polyethylene glycol) (PEG), polysialic acid, N-propionylated polysialic acid, nucleic acids, polysaccharides, and PLGA.
  • PEG polyethylene glycol
  • PEG chains can be linear, branched, or with comb or star geometries.
  • the fusion protein is covalently bound to a moeity that stimulates the immune system.
  • An example of such a moeity is a lipid moeity.
  • lipid moieties are recognized by a Toll-like receptor (TLR) such as TLR-2 or TLR-4, and activate the innate immune system.
  • TLR Toll-like receptor
  • a fusion protein and one or more additional components described herein are mixed together using known methods to form a multi- component immunogenic composition.
  • a fusion protein and one or more additional components described herein are nano-encapsulated using known methods.
  • a fusion protein and one or more additional components described herein are molded into nano- or micro- particles using known methods.
  • a fusion protein and one or more additional components described herein are conjugated through a covalent bond using known methods to form a multi-component immunogenic composition.
  • a fusion protein and one or more additional components described herein are joined non-covalently using known methods to form a multi- component immunogenic composition. Additional methods of combining a fusion protein and one or more additional components are described in, e.g .,
  • the present disclosure also provides immunogenic compositions (e.g, vaccine compositions) of, or comprising, one or more nucleic acids encoding fusion proteins described herein.
  • the immunogenic composition comprises one or more nucleic acids encoding fusion proteins with at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% sequence identity to a fusion protein listed in Table 2.
  • the immunogenic composition comprises a nucleic acid encoding a fusion protein that is or includes an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identity to any one of SEQ ID NOs: 17-26.
  • the immunogenic composition comprises a nucleic acid encoding a fusion protein that is or includes an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identity to SEQ ID NO:23. In some embodiments, the immunogenic composition comprises a nucleic acid encoding a fusion protein that is or includes an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identity to CP1.
  • the immunogenic composition comprises one or more nucleic acids having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identity to any one of SEQ ID NOs:27-36. In some embodiments, the immunogenic composition comprises a nucleic acid having at least 80%, 85%, 90%, 95%, 96%, 97%,
  • these nucleic acids are expressed in the immunized individual, resulting in production of the encoded S. pneumoniae fusion proteins, and the S. pneumoniae fusion proteins so produced have an immunostimulatory or immunoprotective effect in the immunized individual.
  • Such a nucleic acid-containing immunostimulatory composition may comprise, for example, an origin of replication, and/or a promoter that drives expression of one or more nucleic acids encoding one or more fusion proteins of SEQ ID NOs:27-36.
  • Such a composition may also comprise a bacterial plasmid vector into which is inserted a promoter (sometimes a strong viral promoter), one or more nucleic acids encoding one or more fusion proteins of SEQ ID NOs: 17-26, and a polyadenylation/transcriptional termination sequence.
  • a promoter sometimes a strong viral promoter
  • nucleic acids encoding one or more fusion proteins of SEQ ID NOs: 17-26
  • a polyadenylation/transcriptional termination sequence may also comprise a bacterial plasmid vector into which is inserted a promoter (sometimes a strong viral promoter), one or more nucleic acids encoding one or more fusion proteins of SEQ ID NOs: 17-26, and a polyadenylation/transcriptional termination sequence.
  • the nucleic acid is DNA.
  • nucleic acid is RNA.
  • an immunogenic composition or vaccine that includes one or more fusion proteins described herein is characterized in that one or more of the opsonization potential or immune responses to one or more fusion proteins is increased relative to a pre-determined level, as measured by ELISA and/or by a functional antibody assay.
  • one or more of the opsonization potential or immune response to the one or more fusion proteins is increased by at least 30% or more, including, e.g., at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90% or more, relative to a predetermined level, as measured by ELISA and/or by a functional antibody assay.
  • one or more of the opsonization potential or immune responses to the one or more fusion proteins is increased at least l-fold, 2-fold, 3-fold, 4- fold, or 5-fold relative to a pre-determined level, as measured by ELISA and/or by a functional antibody assay.
  • the pre-determined level is a pre-immune level (e.g., a level observed when a subject is not immunized, or is immunized in the absence of one or more fusion proteins described herein).
  • an immunogenic composition or vaccine that includes one or more fusion proteins described herein, upon administration to a subject, induces an immune response against S. pneumoniae.
  • the immunogenic composition or vaccine upon administration to a subject, induces an immune response against one or more serotypes of S. pneumoniae. In some embodiments, the immunogenic composition or vaccine, upon administration to a subject, induces a protective immune response against one or more serotypes of S. pneumoniae.
  • the immune response is an antibody or B cell response. In some embodiments, the immune response is a T cell response. In some embodiments, the immune response is an innate immune response.
  • the immune response is a CD4+ T cell response, including Thl, Th2, or Thl7 response, or a CD8+ T cell response, or a CD4+ and a CD8+ T cell response, or a CD4-/CD8- T cell response.
  • the immune response is an antibody or B cell response and a T cell response.
  • the immune response is an antibody or B cell response, a T cell response, and an innate immune response.
  • an immunogenic composition or vaccine that includes one or more fusion proteins described herein may be used for prophylactic and/or therapeutic treatment of S. pneumoniae.
  • the present disclosure provides a method for immunizing a subject suffering from or susceptible to S. pneumoniae infection, comprising administering an immunologically effective amount of any immunogenic composition or vaccine that includes one or more fusion proteins described herein.
  • the subject receiving the immunization may be a male or a female, and may be an infant, child, adolescent, or adult.
  • the subject being treated is a human.
  • the subject is a non-human animal.
  • an immunogenic composition or vaccine comprising a fusion protein described herein treats or prevents infection by S. pneumoniae.
  • the immunogenic composition or vaccine treats or prevents Invasive Pneumococcal Disease (IPD) due to infection by S. pneumoniae.
  • IPD Invasive Pneumococcal Disease
  • the immunogenic composition or vaccine treats or prevents bacteremia due to infection by S. pneumoniae.
  • the immunogenic composition or vaccine treats or prevents sepsis due to infection by S.
  • the immunogenic composition or vaccine upon administration to a subject, treats or prevents organ damage due to infection by S. pneumoniae. In some embodiments, upon administration to a subject, the immunogenic composition or vaccine treats or prevents meningitis due to infection by S. pneumoniae. In some embodiments, upon administration to a subject, the immunogenic composition or vaccine treats or prevents pneumonia due to infection by S. pneumoniae. In some embodiments, upon administration to a subject, the immunogenic composition or vaccine treats or prevents otitis media due to infection by S. pneumoniae. In some embodiments, upon administration to a subject, treats or prevents sinusitis due to infection by S. pneumoniae.
  • an immunogenic composition or vaccine comprising a fusion protein described herein inhibits or reduces the rate of occurrence of infection by S. pneumoniae. In some embodiments, upon administration to a subject, an immunogenic composition or vaccine comprising a fusion protein described herein inhibits or reduces the rate of occurrence of infection by S. pneumoniae. In some embodiments, upon administration to a subject, an immunogenic composition or vaccine comprising a fusion protein described herein inhibits or reduces the rate of occurrence of infection by S. pneumoniae. In some embodiments, upon administration to a subject, an immunogenic composition or vaccine comprising a fusion protein described herein inhibits or reduces the rate of occurrence of infection by S. pneumoniae. In some embodiments, upon administration to a subject, an immunogenic composition or vaccine comprising a fusion protein described herein inhibits or reduces the rate of occurrence of infection by S. pneumoniae. In some embodiments, upon administration to a subject, an immunogenic composition or vaccine comprising a fusion protein described herein inhibits or reduces the rate of
  • the immunogenic composition or vaccine inhibits or reduces the rate of occurrence of Invasive Pneumococcal Disease (IPD) due to infection by S.
  • IPD Invasive Pneumococcal Disease
  • the immunogenic composition or vaccine upon administration to a subject, inhibits or reduces the rate of occurrence of bacteremia due to infection by S. pneumoniae. In some embodiments, upon administration to a subject, the immunogenic composition or vaccine inhibits or reduces the rate of occurrence of sepsis due to infection by S. pneumoniae. In some embodiments, upon administration to a subject, the immunogenic composition or vaccine inhibits or reduces the rate of occurrence of organ damage due to infection by S. pneumoniae. In some embodiments, upon administration to a subject, the immunogenic composition or vaccine inhibits or reduces the rate of occurrence of meningitis due to infection by S. pneumoniae. In some embodiments, upon administration to a subject, the immunogenic composition or vaccine inhibits or reduces the rate of occurrence of bacteremia due to infection by S. pneumoniae. In some embodiments, upon administration to a subject, the immunogenic composition or vaccine inhibits or reduces the rate of occurrence of sepsis due to infection by S. pneumoniae. In some embodiments, upon administration to a subject
  • the immunogenic composition or vaccine inhibits or reduces the rate of occurrence of pneumonia due to infection by S. pneumoniae. In some embodiments, upon administration to a subject, the immunogenic composition or vaccine inhibits or reduces the rate of occurrence of otitis media due to infection by S. pneumoniae. In some embodiments, upon administration to a subject, the immunogenic composition or vaccine inhibits or reduces the rate of occurrence of sinusitis due to infection by S. pneumoniae.
  • an immunogenic composition or vaccine comprising a fusion protein described herein reduces the severity of infection by S. pneumoniae.
  • the immunogenic composition or vaccine upon administration to a subject, reduces the severity of Invasive Pneumococcal Disease (IPD) due to infection by S. pneumoniae.
  • IPD Invasive Pneumococcal Disease
  • the immunogenic composition or vaccine upon administration to a subject, reduces the severity of bacteremia due to infection by S. pneumoniae.
  • the immunogenic composition or vaccine upon administration to a subject, reduces the severity of sepsis due to infection by S. pneumoniae.
  • the immunogenic composition or vaccine upon administration to a subject, reduces the severity of organ damage due to infection by S. pneumoniae.
  • the immunogenic composition or vaccine upon administration to a subject, reduces the severity of organ damage due to infection by S. pneumoniae upon administration to a subject, upon administration to a subject, the
  • the immunogenic composition or vaccine reduces the severity of meningitis due to infection by S. pneumoniae. In some embodiments, upon administration to a subject, the immunogenic composition or vaccine reduces the severity of pneumonia due to infection by S.
  • the immunogenic composition or vaccine upon administration to a subject, reduces the severity of otitis media due to infection by S.
  • the immunogenic composition or vaccine upon administration to a subject, reduces the severity of sinusitis due to infection by S. pneumoniae.
  • an immunogenic composition or vaccine comprising a fusion protein described herein inhibits transmission of S. pneumoniae from the subject to another subject. In some embodiments, upon administration to a subject, an immunogenic composition or vaccine comprising a fusion protein described herein inhibits transmission of S. pneumoniae from the subject to another subject. In some embodiments, upon administration to a subject, an immunogenic composition or vaccine comprising a fusion protein described herein inhibits transmission of S. pneumoniae from the subject to another subject. In some embodiments, upon administration to a subject, an immunogenic composition or vaccine comprising a fusion protein described herein inhibits transmission of S. pneumoniae from the subject to another subject. In some embodiments, upon administration to a subject, an immunogenic composition or vaccine comprising a fusion protein described herein inhibits transmission of S. pneumoniae from the subject to another subject. In some embodiments, upon administration to a subject, an immunogenic composition or vaccine comprising a fusion protein described herein inhibits transmission of S. pneumoniae from the subject to another subject. In some embodiments, upon administration to
  • the immunogenic composition or vaccine inhibits colonization by S. pneumoniae in the subject. In some embodiments, upon administration to a subject, the immunogenic composition or vaccine inhibits colonization by S. pneumoniae in the nasopharynx of the subject.
  • an immunogenic composition or vaccine comprising a fusion protein described herein, upon administration to a subject, induces an immune response against S. pneumoniae in the subject at a level greater than a control composition.
  • the immunogenic composition or vaccine upon administration to a subject, induces an immune response against one or more serotypes of S. pneumoniae at a level greater than a control composition.
  • the level greater is about 1%, about 2%, about 3%, about 4%, about 5%, about 6%, about 7%, about 8%, about 9%, about 10%, about 11%, about 12%, about 13%, about 14%, about 15%, about 16%, about 17%, about 18%, about 19%, about 20%, about 21%, about 22%, about 23%, about 24%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, or about 95% of the control composition.
  • an immunogenic composition or vaccine comprising a fusion protein described herein, upon administration to a subject, induces an immune response that can help protect against the establishment of S. pneumoniae at a level greater than a control composition.
  • the immunogenic composition or vaccine protects against colonization at a level greater than a control composition.
  • the immunogenic composition or vaccine inhibits infection by S. pneumoniae in a non-col onized or uninfected subject at a level greater than a control composition.
  • the immunogenic composition or vaccine reduces the duration of colonization by S. pneumoniae in a subject who is already colonized at a level greater than a control composition.
  • the level greater is about 1%, about 2%, about 3%, about 4%, about 5%, about 6%, about 7%, about 8%, about 9%, about 10%, about 11%, about 12%, about 13%, about 14%, about 15%, about 16%, about 17%, about 18%, about 19%, about 20%, about 21%, about 22%, about 23%, about 24%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, or about 95% of the control composition.
  • an antibody composition comprising antibodies raised in a mammal immunized with an immunogenic composition or vaccine comprising a fusion protein described herein.
  • an antibody comprises at least one antibody selected from the group consisting of monoclonal Abs (mAbs) and anti-idiotype antibodies.
  • mAbs monoclonal Abs
  • an antibody composition comprises an isolated gamma globulin fraction.
  • an antibody composition comprises polyclonal antibodies.
  • the antibody composition is administered to a subject.
  • Optimal amounts of components for a particular vaccine comprising a fusion protein described herein can be ascertained by standard studies involving observation of appropriate immune responses in subjects. Following an initial immunization, subjects can receive one or several booster immunizations adequately spaced in time.
  • the immunogenic composition or vaccine comprising a fusion protein described herein, and/or preparations thereof may be formulated in a unit dosage form for ease of administration and uniformity of dosage.
  • the specific therapeutically effective dose level for any particular subject or organism may depend upon a variety of factors including the severity or degree of risk of infection; the activity of the specific vaccine or vaccine composition employed; other characteristics of the specific vaccine or vaccine composition employed; the age, body weight, general health, sex of the subject, diet of the subject, pharmacokinetic condition of the subject, the time of administration ( e.g ., with regard to other activities of the subject such as eating, sleeping, receiving other medicines including other vaccine doses, etc.), route of administration, rate of excretion of the specific vaccine or vaccine composition employed; vaccines used in combination or coincidental with the vaccine composition employed; and like factors well known in the medical arts.
  • compositions e.g., pharmaceutical compositions
  • Vaccine preparation is generally described in Vaccine Design (Powell and Newman, 1995).
  • an immunologically amount of a vaccine product can be formulated together with one or more organic or inorganic, liquid or solid, pharmaceutically suitable carrier materials.
  • pharmaceutically acceptable carrier(s) include solvents, dispersion media, and the like, which are compatible with pharmaceutical administration.
  • materials that can serve as pharmaceutically acceptable carriers include, but are not limited to sugars such as lactose, glucose, dextrose, and sucrose; starches such as com starch and potato starch; cellulose and its derivatives such as sodium carboxymethyl cellulose, ethyl cellulose and cellulose acetate; powdered tragacanth; malt; gelatin; talc; excipients such as cocoa butter and suppository waxes; oils such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, com oil and soybean oil; polyols such as glycerol, propylene glycol, and liquid polyethylene glycol; esters such as ethyl oleate and ethyl laurate; agar; buffering agents such as magnesium hydroxide; alginic acid; pyr
  • Vaccines may be formulated by combining one or more fusion proteins described herein with carriers and/or other optional components by any available means including, for example, conventional mixing, granulating, dissolving, lyophilizing, or similar processes.
  • Vaccines comprising one or more fusion proteins described herein may be lyophilized up until they are about to be used, at which point they are extemporaneously reconstituted with diluent.
  • vaccine components or compositions are lyophilized in the presence of one or more other components (e.g ., adjuvants), and are extemporaneously reconstituted with saline solution.
  • individual components, or sets of components may be separately lyophilized and/or stored (e.g., in a vaccination kit), the components being reconstituted and either mixed prior to use or administered separately to the subject.
  • Lyophilization can produce a more stable composition (for instance by preventing or reducing breakdown of polysaccharide antigens). Lyophilizing of vaccines or vaccine components is well known in the art. Typically, a liquid vaccine or vaccine component is freeze dried, often in the presence of an anti-caking agent (such as, for example, sugars such as sucrose or lactose). In some embodiments, the anti-caking agent is present, for example, at an initial concentration of 10-200 mg/ml.
  • an anti-caking agent such as, for example, sugars such as sucrose or lactose.
  • the anti-caking agent is present, for example, at an initial concentration of 10-200 mg/ml.
  • Lyophilization typically occurs over a series of steps, for instance a cycle starting at -69° C, gradually adjusting to -24°C over 3 h, then retaining this temperature for 18 h, then gradually adjusting to -l6°C over 1 h, then retaining this temperature for 6 h, then gradually adjusting to +34°C over 3 h, and finally retaining this temperature over 9 h.
  • a vaccine comprising a fusion protein described herein is a liquid.
  • the liquid is a reconstituted lyophylate.
  • a vaccine has a pH of about 5, about 6, about 7, or about 8.
  • a vaccine has a pH between about 5 and about 7.5.
  • a vaccine has a pH between 5 and 7.5.
  • a vaccine has a pH between about 5.3 and about 6.3.
  • a vaccine has a pH between 5.3 and 6.3.
  • a vaccine has a pH of about 5.0, about 5.1, about 5.2, about 5.3, about 5.4, about 5.5, about 5.6, about 5.7, about 5.8, about 5.9, about 6.0, about 6.1, about 6.2, about 6.3, about 6.4, about 6.5, about 6.6, about 6.7, about 6.8, about 6.9, about 7.0, about 7.1, about 7.2, about 7.3, about 7.4, or about 7.5.
  • Vaccines or vaccine components for use in accordance with the present disclosure may be incorporated into liposomes, cochleates, biodegradable polymers such as poly-lactide, poly-glycolide and poly-lactide-co-glycolides, or immune-stimulating complexes (ISCOMS).
  • biodegradable polymers such as poly-lactide, poly-glycolide and poly-lactide-co-glycolides, or immune-stimulating complexes (ISCOMS).
  • a vaccine for use in accordance with the present invention, for example, by slowing the absorption of one or more vaccine components.
  • delay of absorption may be accomplished, for example, by the use of a liquid suspension of crystalline or amorphous material with poor water solubility.
  • the rate of absorption of the product then depends upon its rate of dissolution, which in turn, may depend upon size and form.
  • delayed absorption may be accomplished by dissolving or suspending one or more vaccine components in an oil vehicle.
  • injectable depot forms can also be employed to delay absorption.
  • Such depot forms can be prepared by forming microcapsule matrices of one or more vaccine components a biodegradable polymer network. Depending upon the ratio of polymer to vaccine component, and the nature of the particular polymer(s) employed, the rate of release can be controlled.
  • biodegradable polymers examples include, for example, poly(orthoesters) and poly(anhydrides).
  • One particular exemplary polymer is polylactide-polyglycolide.
  • Depot injectable formulations may also be prepared by entrapping the product in liposomes or microemulsions, which are compatible with body tissues.
  • Polymeric delivery systems can also be employed in non-depot formulations including, for example, oral formulations.
  • biodegradable, biocompatible polymers such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, poly orthoesters, and polylactic acid, etc.
  • Polysaccharide antigens or conjugates may be formulated with such polymers, for example to prepare particles, microparticles, extrudates, solid dispersions, admixtures, or other combinations in order to facilitate preparation of useful formulations ( e.g ., oral).
  • Vaccines comprising one or more fusion proteins described herein for use in accordance with the present disclosure include immunogenic compositions, and may additionally include one or more additional active agents (i.e., agents that exert a biological effect - not inert ingredients).
  • additional active agents i.e., agents that exert a biological effect - not inert ingredients
  • adjuvants it is common in vaccine preparation to include one or more adjuvants.
  • additional agents may be formulated together with one or more other vaccine components, or may be maintained separately and combined at or near the time of administration.
  • such additional components may be administered separately from some or all of the other vaccine components, within an appropriate time window for the relevant effect to be achieved.
  • the vaccine formulations and immunogenic compositions comprising a fusion protein described herein may include an adjuvant.
  • Adjuvants generally, are agents that enhance the immune response to an antigen. Adjuvants can be broadly separated into two classes, based on their principal mechanisms of action: vaccine delivery systems and immunostimulatory adjuvants (see, e.g. , Singh et al, 2003). In most vaccine formulations, the adjuvant provides a signal to the immune system so that it generates a response to the antigen, and the antigen is required for driving the specificity of the response to the pathogen.
  • Vaccine delivery systems are often particulate formulations, e.g., emulsions, microparticles, immune-stimulating complexes (ISCOMs), nanoparticles, which may be, for example, particles and/or matrices, and liposomes.
  • immunostimulatory adjuvants are sometimes from or derived from pathogens and can represent pathogen associated molecular patterns (PAMP), e.g, lipopolysaccharides (LPS), monophosphoryl lipid A (MPL), or CpG-containing DNA, which activate cells of the innate immune system.
  • PAMP pathogen associated molecular patterns
  • LPS lipopolysaccharides
  • MPL monophosphoryl lipid A
  • CpG-containing DNA which activate cells of the innate immune system.
  • adjuvants may be classified as organic and inorganic.
  • Inorganic adjuvants include alum salts such as aluminum phosphate, amorphous aluminum hydroxyphosphate sulfate, and aluminum hydroxide, which are commonly used in human vaccines.
  • Organic adjuvants comprise organic molecules including macromolecules.
  • Non limiting examples of organic adjuvants include cholera toxin/toxoids, other
  • enterotoxins/toxoids or labile toxins/toxoids of Gram-negative bacteria enterotoxins/toxoids or labile toxins/toxoids of Gram-negative bacteria, interleukins (e.g, IL-l, IL-2, IL-4, IL-5, IL-6, IL-7, IL-12, IL-15, IL-18, etc.), interferons (e.g, gamma interferon), granulocyte macrophage colony stimulating factor (GM-CSF), macrophage colony stimulating factor (M-CSF), and tumor necrosis factor (TNF).
  • interleukins e.g, IL-l, IL-2, IL-4, IL-5, IL-6, IL-7, IL-12, IL-15, IL-18, etc.
  • interferons e.g, gamma interferon
  • GM-CSF granulocyte macrophage colony stimulating factor
  • M-CSF macrophage colony stimulating factor
  • TNF
  • Adjuvants may also be classified by the response they induce.
  • the adjuvant induces the generation, proliferation, or activation of Thl cells or Th2 cells.
  • the adjuvant induces the generation, proliferation, or activation of B cells.
  • the adjuvant induces the activation of antigen-presenting cells. These categories are not mutually exclusive; in some cases, an adjuvant activates more than one type of cell.
  • the adjuvant induces the generation, proliferation, or activation of Thl7 cells.
  • the adjuvant may promote the CD4+ or CD8+ T cells to secrete IL-17.
  • an adjuvant that induces the generation, proliferation, or activation of Thl7 cells is one that produces at least a 2-fold, and in some cases a lO-fold, experimental sample to control ratio in the following assay.
  • an experimenter compares the IL-17 levels secreted by two populations of cells: (1) cells from animals immunized with the adjuvant and a polypeptide known to induce Thl7 generation, proliferation, or activation, and (2) cells from animals treated with the adjuvant and an irrelevant (control) polypeptide.
  • An adjuvant that induces the generation, proliferation, or activation of Thl7 cells may cause the cells of population (1) to produce more than 2-fold, or more than lO-fold more IL-17 than the cells of population (2).
  • IL-17 may be measured, for example, by ELISA or ELISPOT.
  • Certain toxins such as cholera toxin and labile toxin (produced by enterotoxigenic E. coli , or ETEC), activate a Thl7 response.
  • the adjuvant is a toxin or toxoid.
  • Cholera toxin was successfully used in a mouse model to induce protective immunity in conjunction with certain polypeptides from Table 1.
  • One form of labile toxin is produced by Intercell. Mutant derivates of labile toxin (toxoids) that are active as adjuvants but significantly less toxic can be used as well.
  • Exemplary detoxified mutant derivatives of labile toxin include mutants lacking ADP- ribosyltransferase activity.
  • Particular detoxified mutant derivatives of labile toxin include LTK7 (Douce et al, 1995) and LTK63 (Williams et al, 2004), LT-G192 (Douce et al, 1999), and LTR72 (Giuliani et al, 1998).
  • the adjuvant comprises a VLP (virus-like particle).
  • VLP virus-like particle
  • Alphavirus replicons induces the activation of Thl7 cells using alphavirus and is produced by Alphavax.
  • alphavirus may be engineered to express an antigen of interest, a cytokine of interest (for example, IL-17 or a cytokine that stimulates IL-17 production), or both, and may be produced in a helper cell line. More detailed information may be found in ET.S. Patent Nos. 5,643,576 and 6,783,939.
  • a vaccine formulation is administered to a subject in combination with a nucleic acid encoding a cytokine.
  • TLRs toll-like receptors
  • MPL Monophosphoryl Lipid A
  • MPL has been produced as a detoxified lipopolysaccharide (LPS) endotoxin obtained from Gram-negative bacteria, such as S. minnesota.
  • LPS lipopolysaccharide
  • TLR agonists include TLR-4 agonists
  • TLR-4 agonists have been produced and/or sold by, for example, the Infectious Disease Research Institute (IRDI), Corixa, Esai, Avanti Polar Lipids, Inc., and Sigma Aldrich.
  • Another exemplary adjuvant that activates TLRs comprises a mixture of MPL, Trehalose Dicoynomycolate (TDM), and dioctadecyldimethylammonium bromide (DDA).
  • TDM Trehalose Dicoynomycolate
  • DDA dioctadecyldimethylammonium bromide
  • R848 resiquimod
  • the adjuvant is or comprises a saponin.
  • the saponin is a triterpene glycoside, such as those isolated from the bark of the Quillaja saponaria tree.
  • a saponin extract from a biological source can be further fractionated (e.g, by chromatography) to isolate the portions of the extract with the best adjuvant activity and with acceptable toxicity.
  • Typical fractions of extract from Quillaja saponaria tree used as adjuvants are known as fractions A and C.
  • combinations of adjuvants are used.
  • Three exemplary combinations of adjuvants are MPL and alum, E6020 and alum, and MPL and an ISCOM.
  • Adjuvants may be covalently or non-covalently bound to antigens.
  • the adjuvant may comprise a protein which induces inflammatory responses through activation of antigen-presenting cells (APCs).
  • APCs antigen-presenting cells
  • one or more of these proteins can be recombinantly fused with an antigen of choice, such that the resultant fusion molecule promotes dendritic cell maturation, activates dendritic cells to produce cytokines and chemokines, and ultimately, enhances presentation of the antigen to T cells and initiation of T cell responses (e.g, see Wu et al, 2005).
  • an immunogenic composition or vaccine comprising a fusion protein described herein is formulated and/or administered in combination with an adjuvant.
  • the adjuvant is selected from the group consisting of aluminum phosphate, aluminum hydroxide, and phosphate aluminum hydroxide.
  • the adjuvant comprises aluminum phosphate.
  • the adjuvant is aluminum phosphate.
  • the same adjuvant or mixture of adjuvants is present in each dose of a vaccine.
  • an adjuvant may be administered with the first dose of vaccine and not with subsequent doses (i.e., booster shots).
  • a strong adjuvant may be administered with the first dose of vaccine and a weaker adjuvant or lower dose of the strong adjuvant may be administered with subsequent doses.
  • the adjuvant can be administered before the administration of the antigen, concurrent with the administration of the antigen or after the administration of the antigen to a subject (sometimes within 1, 2, 6, or 12 hours, and sometimes within 1, 2, or 5 days). Certain adjuvants are appropriate for human subjects, non-human animals, or both.
  • Vaccines for use in accordance with the present disclosure may include, or be administered concurrently with, antimicrobial therapy.
  • such vaccines may include or be administered with one or more agents that kills or retards growth of a pathogen.
  • agents include, for example, penicillin, vancomycin, erythromycin, azithromycin, and clarithromycin, cefotaxime, ceftriaxone, levoflaxin, gatifloxacin.
  • vaccines for use in accordance with the present invention may include, or be administered with, one or more other vaccines or therapies.
  • one or more non-pneumococcal antigens may be included in or administered with the vaccines.
  • a vaccine formulation or immunogenic composition may include one or more additional components.
  • the vaccine formulation or immunogenic composition may include one or more stabilizers such as sugars (such as sucrose, glucose, or fructose), phosphate (such as sodium phosphate dibasic, potassium phosphate monobasic, dibasic potassium phosphate, or monosodium phosphate), glutamate (such as monosodium L- glutamate), gelatin (such as processed gelatin, hydrolyzed gelatin, or porcine gelatin), amino acids (such as arginine, asparagine, histidine, L-histidine, alanine, valine, leucine, isoleucine, serine, threonine, lysine, phenylalanine, tyrosine, and the alkyl esters thereof), inosine, or sodium borate.
  • stabilizers such as sugars (such as sucrose, glucose, or fructose), phosphate (such as sodium phosphate dibasic, potassium phosphate monobasic, dibasic potassium phosphate, or mono
  • the vaccine formulation or immunogenic composition includes one or more buffers such as a mixture of sodium bicarbonate and ascorbic acid.
  • the vaccine formulation may be administered in saline, such as phosphate buffered saline (PBS), or distilled water.
  • PBS phosphate buffered saline
  • the vaccine formulation or immunogenic composition includes one or more surfactants, for example, but not limited to, polysorbate 80
  • TWEEN 80 polysorbate 20 (TWEEN 20), Polyethylene glycol p-(l, 1,3,3- tetramethylbutyl)-phenyl ether (TRITON X-100), and 4-(l,l,3,3-Tetramethylbutyl)phenol polymer with formaldehyde and oxirane (TYLOXAPOL).
  • a surfactant can be ionic or nonionic.
  • the vaccine formulation or immunogenic composition includes one or more salts such as sodium chloride, ammonium chloride, calcium chloride, or potassium chloride.
  • a preservative is included in the vaccine or immunogenic composition. In other embodiments, no preservative is used. A preservative is most often used in multi-dose vaccine vials, and is less often needed in single-dose vaccine vials. In some embodiments, the preservative is 2-phenoxyethanol, methyl and propyl parabens, benzyl alcohol, and/or sorbic acid.
  • an immunogenic composition or vaccine comprising a fusion protein described herein is administered to a subject at risk of developing
  • pneumococcal disease e.g. an infant, a toddler, a juvenile, or an older adult.
  • the immunogenic composition or vaccine is administered to a subject at elevated risk of developing pneumococcal disease, e.g. , immunocompromised subjects, subjects having sickle cell disease or other hemoglobinopathies, congenital or acquired asplenia, splenic dysfunction, chronic renal failure or nephrotic syndrome, diseases associated with treatment with immunosuppressive drugs or radiation therapy, including malignant neoplasm, leukemia, lymphomas, Hodgkin's disease, or solid organ
  • a subject can be considered at risk for developing a disease without having been diagnosed with any symptoms of the disease. For example, if the subject is known to have been, or to be intended to be, in situations with relatively high risk of infection, that subject will be considered at risk for developing the disease.
  • any effective route of administration may be utilized such as, for example, oral, nasal, enteral, parenteral, intramuscular or intravenous, subcutaneous, transdermal, intradermal, rectal, vaginal, topical, ocular, pulmonary, or by contact application.
  • the immunogenic composition or vaccine may be injected ( e.g ., via intramuscular, intraperitoneal, intradermal and/or subcutaneous routes); or delivered via the mucosa (e.g., to the oral/alimentary, respiratory, and/or genitourinary tracts).
  • Intranasal administration may be particularly useful in some contexts, for example for treatment of pneumonia or otitis media (as nasopharyngeal carriage of pneumococci can be more effectively prevented, thus attenuating infection at its earliest stage).
  • it may be desirable to administer different doses of the immunogenic composition or vaccine by different routes; in some embodiments, it may be desirable to administer different components of one dose via different routes.
  • compositions are administered intradermally.
  • Conventional technique of intradermal injection comprises steps of cleaning the skin, and then stretching with one hand, and with the bevel of a narrow gauge needle (26-31 gauge) facing upwards the needle is inserted at an angle of between 10-15°.
  • the barrel of the needle is lowered and further advanced while providing a slight pressure to elevate it under the skin.
  • the liquid is then injected very slowly thereby forming a bleb or bump on the skin surface, followed by slow withdrawal of the needle.
  • Other methods of intradermal administration of the immunogenic compositions or vaccines may include conventional syringes and needles, or devices designed for ballistic delivery of solid vaccines (WO 99/27961), or transdermal patches (WO 97/48440; WO 98/28037); or applied to the surface of the skin (transdermal or transcutaneous delivery WO 98/20734;
  • compositions may be administered as a single dose or as multiple doses.
  • an administration is a single“dose” so long as all relevant components are administered to a subject within a window of time; it is not necessary that every component be present in a single composition.
  • administration of two different immunogenic compositions or vaccines, within a period of less than 24 h, is considered a single dose.
  • immunogenic compositions or vaccines having different antigenic components may be administered in separate compositions, but as part of a single dose. As noted above, such separate compositions may be administered via different routes or via the same route.
  • the immunogenic composition or vaccine may be administered via one route, and a second active agent may be administered by the same route or by a different route.
  • compositions are administered in such amounts and for such time as is necessary to achieve a desired result.
  • the immunogenic composition or vaccine comprises an immunologically effective amount of at least immunogenic composition.
  • the exact amount required to achieve an immunologically effective amount may vary, depending on the immunogenic composition, and from subject to subject, depending on the species, age, and general condition of the subject, the stage of the disease, the particular pharmaceutical mixture, its mode of administration, and the like.
  • each pharmaceutical composition e.g, immunogenic composition or vaccine
  • each pharmaceutical composition e.g, immunogenic composition or vaccine
  • a pharmaceutical composition comprising a fusion protein described herein induces a Thl and/or Thl7 cell response upon administration to a subject.
  • the pharmaceutical composition induces an
  • the pharmaceutical composition comprising a fusion protein disclosed herein reduces rate of transmission and/or colonization of the mucosal surfaces by
  • the pharmaceutical composition reduces rate of transmission and/or colonization of the nasopharynx or the lungs by S. pneumoniae upon transmission.
  • Some embodiments provide for a method of immunizing a subject against S. pneumoniae infection comprising administering to the subject an immunologically effective amount of an immunogenic composition comprising a fusion protein described herein.
  • Some embodiments provide for a method of immunizing a subject against S. pneumoniae infection comprising administering to the subject an immunologically effective amount of a vaccine composition comprising a fusion protein described herein. Some embodiments provide for a method of immunizing a subject against S. pneumoniae infection comprising administering to the subject an immunologically effective amount of a pharmaceutical composition comprising a fusion protein described herein.
  • an immunogenic composition or vaccine comprising a fusion protein described herein may be administered in combination with another agent.
  • the agent is or comprises PCV13.
  • the agent is or comprises PPSV23.
  • the agent is or comprises an antibiotic.
  • administration of an immunogenic composition or vaccine comprising a fusion protein described herein may involve the delivery of a single dose.
  • administration may involve an initial dose followed by one or several additional immunization doses, adequately spaced.
  • An immunization schedule is a program for the administration of one or more specified doses of one or more specified pneumococcal vaccines, by one or more specified routes of administration, at one or more specified ages of a subject.
  • the present disclosure provides immunization methods that involve administering at least one dose of a vaccine to an infant subject.
  • the infant subject is 18 months old or younger.
  • the infant subject is 12 months old or younger.
  • the infant subject has previously received one or more doses of a conjugated pneumococcal polysaccharide vaccine; in other embodiments, the infant subject is naive to pneumococcal vaccines. In some embodiments, the infant subject has previously been infected with, or exposed to infection by S.
  • the present disclosure provides immunization methods that involve administering at least one dose of a vaccine to a toddler subject.
  • the toddler subject is 5 years old or younger. In some embodiments, the toddler subject is 4 years old or younger.
  • the toddler subject has previously received one or more doses of a conjugated pneumococcal polysaccharide vaccine; in other embodiments, the toddler subject is naive to pneumococcal vaccines. In some embodiments, the toddler subject has previously been infected with, or exposed to infection by S. pneumoniae.
  • the present disclosure provides immunization methods that involve administering at least one dose of a vaccine to a juvenile subject.
  • the juvenile subject is 18 years old or younger. In some embodiments, the juvenile subject is 15 years old or younger.
  • the juvenile subject has previously received one or more doses of a conjugated pneumococcal polysaccharide vaccine; in other embodiments, the juvenile subject is naive to pneumococcal vaccines.
  • the juvenile subject has previously been infected with, or exposed to infection by S. pneumoniae.
  • the present disclosure provides immunization methods that involve administering at least one dose of a vaccine to an adult subject.
  • the adult subject is older than about 50 years of age. In some embodiments, the adult subject is older than about 65 years of age.
  • the adult subject has previously received one or more doses of a conjugated pneumococcal polysaccharide vaccine; in other embodiments, the adult subject is naive to pneumococcal vaccines. In some embodiments, the adult subject has previously been infected with, or exposed to infection by S.
  • Immunization schedules of the present disclosure are provided to induce an immune response (e.g ., an immunoprotective response) in a subject sufficient to reduce at least one measure selected from the group consisting of incidence, prevalence, frequency, and/or severity of at least one infection, disease, or disorder, and/or at least one surrogate marker of the infection, disease, or disorder, in a population and/or subpopulation of the subject(s).
  • a supplemental immunization schedule is one which has this effect relative to the standard schedule which it supplements.
  • a supplemental schedule may call for additional administrations and/or supra-immunogenic doses of the immunogenic
  • compositions or vaccines disclosed herein found in the standard schedule, or for the administration of immunogenic compositions or vaccines not part of the standard schedule.
  • a full immunization schedule of the present invention may comprise both a standard schedule and a supplemental schedule.
  • Exemplary sample immunization schedules are provided for illustrative purposes. Detailed descriptions of methods to assess immunogenic response discussed herein allow one to develop alterations to the sample immunization schedules without undue experimentation.
  • a first administration of a pneumococcal vaccine usually occurs when a subject is more than about 2 weeks old, more than about 5 weeks old, more than about 1 year old, more than about 2 years old, more than about 15 years old, or more than about 18 years old.
  • a first administration of a pneumococcal vaccine usually occurs when a subject is more than about 50 years old, more than about 55 years old, more than about 60 years old, more than about 65 years old, or more than about 70 years old.
  • a single administration of vaccine is employed. It is possible that the purposes of the present invention can be served with a single administration, especially when one or more utilized vaccine polypeptides, polysaccharide(s) and/or conjugate(s) or combinations thereof is/are strong, and in such a situation a single dose schedule is sufficient to induce a lasting immune-protective response.
  • a number of doses is at least two, at least three or more doses. There is no set maximum number of doses, however it is good clinical practice not to immunize more often than necessary to achieve the desired effect.
  • a first dose of vaccine administered according to the disclosure may be considered a“priming” dose.
  • more than one dose is included in an immunization schedule.
  • a subsequent dose may be considered a“boosting” dose.
  • a priming dose may be administered to a naive subject (a subject who has never previously received a conjugated polysaccharide vaccine).
  • a priming dose may be administered to a subject who has previously received conjugated polysaccharide vaccine at least five or more years previous to administration of an initial vaccine dose according to the invention.
  • a priming dose may be administered to a subject who has previously received a conjugated polysaccharide vaccine at least twenty or more years previous to administration of a priming vaccine according to the invention.
  • an immunization schedule calls for two or more separate doses
  • the interval between doses is considered.
  • the interval between two successive doses may be the same throughout an immunization schedule, or it may change as the subject ages.
  • a first interval is generally at least about 2 weeks, 1 month, 6 weeks, 2 months, 3 months, 6 months, 9 months, 12 months, or longer.
  • second (or higher) intervals may be provided between such subsequent doses.
  • all intervals between subsequent doses are of the same length; in other embodiments, second intervals may vary in length.
  • the interval between subsequent doses may be at least about 12 months, at least about 15 months, at least about 18 months, at least about 21 months or at least about 2 years. In some embodiments, the interval between doses may be up to 3 years, up to about 4 years, or up to about 5 years or 10 years or more. In some embodiments, intervals between subsequent doses may decrease as the subject ages.
  • a method of assessing the immunogenicity of a pharmaceutical composition, immunogenic composition, or vaccine comprising a fusion protein described herein comprises evaluating, measuring, and/or comparing an immune response using one or more in vitro bioassays, including B cell and T cell responses such as antibody levels by ELISA, multiplex ELISA, MSD, Luminex, flow cytometry, Thl/Thl7 cell response, cytokine level measurement and functional antibody levels as measured by OPK, serum bactericidal killing (SBA), agglutination, motility, cytotoxicity, or adherence; and in vivo assays in animal models of pneumococcal disease (e.g.
  • B cell and T cell responses such as antibody levels by ELISA, multiplex ELISA, MSD, Luminex, flow cytometry, Thl/Thl7 cell response, cytokine level measurement and functional antibody levels as measured by OPK, serum bactericidal killing (SBA), agglutination, motility, cyto
  • the immune response is compared to a control composition.
  • a method of assessing the potency of a pharmaceutical composition, immunogenic composition, or vaccine comprising a fusion protein described herein comprises evaluating, measuring, and/or comparing an immune response using one or more in vitro bioassays, including B cell and T cell responses such as antibody levels by ELISA, multiplex ELISA, MSD, Luminex, flow cytometry, Thl/Thl7 cell response, cytokine level measurement and functional antibody levels as measured by OPK, serum bactericidal killing (SBA), internalization, activity neutralization, agglutination, motility, cytotoxicity, or adherence; and in vivo assays in animal models of pneumococcal disease (e.g.
  • the immune response is compared to a control composition.
  • antibody titers and/or types e.g ., total IgG, IgGl, IgG2, IgM, IgA, etc.
  • specific pathogen antigens e.g., polypeptides or polysaccharides, either serotype-specific or conserved across two or more serotypes
  • Cellular responses may be assessed by monitoring reactions such as delayed type hypersensitivity responses, etc. to the antigens.
  • PBMCs peripheral blood mononuclear cells
  • ELISpot enzyme-linked immunospot
  • the RIA method detects specific antibodies through incubation of sera with radio-labeled polysaccharides or polypeptides in suspension (e.g, Schiffiman et al, 1980). The antigen-antibody complexes are then precipitated with ammonium sulfate and the radiolabeled pellets assayed for counts per minute (cpm).
  • ELISA detection method specific antibodies from the sera of vaccinated subjects are quantitated by incubation with antigens (e.g, polypeptides or polysaccharides, either serotype-specific or conserved across two or more serotypes) which have been adsorbed to a solid support (e.g, Koskela and Leinonen (1981); Kojima et al, 1990; Concepcion and Frasch, 2001).
  • the bound antibody is detected using enzyme- conjugated secondary detection antibodies.
  • the ELISA also allows isotyping and subclassing of the immune response (i.e., IgM vs. IgG or IgGl vs.
  • IgG2 isotype- or subclass-specific secondary antibodies and can be adapted to evaluate the avidity of the antibodies (Anttila et al, 1998; Romero- Steiner et al, 2005).
  • Multiplex assays e.g,
  • Luminex facilitate simultaneous detection of antibodies to multiple antigens.
  • Antigens are conjugated to spectrally distinct microspheres that are mixed and incubated with serum.
  • the antibodies bound to the antigens on the coated microspheres are detected using a secondary antibody (e.g., R-Phycoerythrin-conjugated goat anti -human IgG).
  • opsonophagocytic assay which quantitates only the antibodies that can opsonize the bacteria, leading to ingestion and killing of the bacteria.
  • the standard assay utilizes a human phagocytic effector cell, a source of complement, bacteria, and diluted sera.
  • the assay readout is the serum endpoint titer at which there is >50% killing compared to bacteria incubated with complement and human cells alone (Romero- Steiner et al, 1997). This killing OPA can also be multiplexed by utilizing target strains of pathogen that carry different antibiotic resistance markers (Kim et al, 2003).
  • Another type of multiplex opsonic assay is a nonkilling assay in which the uptake by phagocytic effector cells of fluorescent stained encapsulated pathogen or fluorescent microspheres conjugated with antigens from a target pathogen in the presence of diluted sera plus a complement source is evaluated by FC (Martinez et al, 1999). Opsonic activity of serum antibody plus complement can also be evaluated by measuring the oxidative response of phagocytic human effector cells to ingested pathogen (Munro et al. 1985; Ojo-Amaize et al. 1995).
  • mice or rats are challenged with the pathogen plus diluted sera, and the endpoint titer of the sera which provides protection against pneumonia, bacteremia, colonization of organs or tissues, or mortality is determined (Stack et al. 1998; Saeland et al. 2000).
  • efficacy of immunization may be determined by assaying one or more cytokine levels by stimulating T cells from a subject after
  • the one or more cytokine levels may be compared to the one or more cytokine levels in the same subject before immunization. Increased levels of the one or more cytokine, such as a 1.5 fold, 2-fold, 5-fold, lO-fold, 20-fold, 50-fold or lOO-fold or more increase over pre-immunization cytokine levels, would indicate an increased response to the immunogenic composition or vaccine.
  • the one or more cytokines are selected from GM-CSP; IL-la; PMb; IL-2; IL-3; IL-4; IL-5; IL-6; IL-7; IL-8; IL-10; IL-12; IL-17A, IL-17F or other members of the IL-17 family; IL-22; IL-23; IFN-a; IFN-b; IFN-g; MIP-la; MIR-1b; TGF-b; TNFa, or TNF-b.
  • efficacy of immunization may be determined by assaying IL-17 levels (particularly IL-17A) by stimulating T cells from a subject after immunization.
  • the IL-17 levels may be compared to IL-17 levels in the same subject before immunization.
  • Increased IL-17 (e.g, IL-17A) levels such as a 1.5 fold, 2-fold, 5-fold, lO-fold, 20-fold, 50-fold or lOO-fold or more increase, would indicate an increased response to the immunogenic composition or vaccine.
  • one may assay neutrophils in the presence of T cells or antibodies from the patient for pneumococcal killing.
  • Increased pneumococcal killing such as a 1.5 fold, 2-fold, 5-fold, lO-fold, 20-fold, 50-fold or lOO-fold or more increase, would indicate an increased response to the immunogenic composition or vaccine.
  • Thl7 cell activation where increased Thl7 cell activation, such as a 1.5 fold, 2-fold, 5-fold, lO-fold, 20-fold, 50-fold or lOO-fold or more increase, correlates with an increased response to the immunogenic composition or vaccine.
  • Thl cell activation such as a 1.5 fold, 2-fold, 5-fold, lO-fold, 20-fold, 50-fold or lOO-fold or more increase, correlates with an increased response to the immunogenic composition or vaccine.
  • two or more of these assays are used. For example, one may measure IL-17 levels and the levels of immunogenic composition- or vaccine-specific antibody.
  • epidemiological markers such as incidence of, severity of, or duration of pneumococcal infection in vaccinated individuals compared to unvaccinated individuals.
  • Immunogenic composition or vaccine efficacy may also be assayed in various model systems such as the mouse challenge model. For instance, BALB/c or C57BL/6 strains of mice may be used. After administering the test immunogenic composition or vaccine to a subject (as a single dose or multiple doses), the experimenter administers a challenge dose of S. pneumoniae. In some cases, a challenge dose administered intranasally is sufficient to cause S. pneumoniae colonization (especially nasal colonization) in an unvaccinated animal, and in some cases a challenge dose administered via aspiration is sufficient to cause sepsis and a high rate of lethality in unvaccinated animals.
  • a challenge dose administered intranasally is sufficient to cause S. pneumoniae colonization (especially nasal colonization) in an unvaccinated animal
  • a challenge dose administered via aspiration is sufficient to cause sepsis and a high rate of lethality in unvaccinated animals.
  • a challenge dose administered via intraperitoneal injection is sufficient to cause sepsis and a high rate of lethality in unvaccinated animals. In some cases, a challenge dose administered via intravenous injection is sufficient to cause sepsis and a high rate of lethality in unvaccinated animals.
  • mice or rats are challenged with the pathogen plus diluted sera, and the endpoint titer of the sera which provides protection against bacteremia, colonization of organs or tissues, or mortality is determined (Stack et al. 1998; Saeland et al. 2000).
  • Example 1 Induction of Thl 7 response and protection from pneumococcal nasal colonization in mice mediated by SP0785 and SP1500 components of fusion protein CPI
  • This Example compares the ability of individual Streptococcus pneumoniae proteins SP0785 and SP1500 with an exemplary fusion protein CP1 to stimulate a Thl7 response and protect mice from nasal colonization with S. pneumoniae after nasal immunization with the adjuvant cholera toxin (CT).
  • An exemplary fusion protein CP1 is a fusion protein comprising a truncated rhizavidin (amino acids [45-179], denoted Rhavi), a SP0785 polypeptide, and a SP1500 polypeptide.
  • a fusion protein CP1 is or comprises Rhavi-linker (GGGGSSS)-SP 1500-linker (AAA)-SP0785.
  • S. pneumoniae proteins SP0785 and SP1500, and fusion protein CP1 can each generate a robust Thl 7 response in mice as demonstrated by secretion of interleukin 17A (IL-17A) after intranasal immunization with the adjuvant cholera toxin (CT).
  • IL-17A interleukin 17A
  • CT adjuvant cholera toxin
  • S. pneumoniae nasal colonization was significantly reduced by separate intranasal immunizations of mice with SP1500 or SP0785 and CT, or with CP1 and CT.
  • Histidine-tagged recombinant proteins were expressed in Escherichia coli and purified using Ni-nitrilotriacetic acid affinity chromatography. A second purification was executed with size-exclusion chromatography with a Superdex 200 column. Protein concentration was measured using a bicinchoninic acid (BCA) protein assay kit (Bio-Rad). Formulation
  • CT Cholera toxin
  • Rhavi truncated rhizavidin, amino acids [45-179]
  • WCC pneumococcal whole cell vaccine (chloroform inactivation)
  • CT cholera toxin
  • mice were intranasally challenged with 10 7 CFU of type 6B pneumococci (603 strain). Nasopharyngeal wash on euthanized mice was conducted 7 days post infection. The S. pneumoniae CFU per nasal wash were calculated after growth on blood agar plates.
  • S. pneumoniae strains 6B, 15 A, 16F, and 35B were inoculated into 10 mL cultures of Todd Hewitt Broth (THB) with yeast extract. Cultures were incubated at 37°C in 5% CO2 for 4 - 7 hours until the OD 6 oo reached 0.5 - 0.8 (mid-logarithmic phase). The bacteria were harvested by spinning for 7 minutes at 3,000 g at 4°C and the bacterial pellet was resuspended in 10 mL of THB with 10% glycerol with storage at -80°C.
  • THB Todd Hewitt Broth
  • Colony forming unit (CFU) estimations were determined by serially dilutions of frozen stocks on Trypticase soy agar with 5% sheep blood (Becton, Dickenson, and Company) with 37°C in 5% CO2 incubation for 18 to 24 hrs.
  • Frozen stocks of S. pneumoniae were thawed and resuspended at 2 x 10 5 CFU/ml in assay buffer (Hank’s buffered saline with 10% heat inactivated FBS).
  • assay buffer Hank’s buffered saline with 10% heat inactivated FBS.
  • 10 m ⁇ of bacteria suspension was added to each well followed by 20 m ⁇ of heat inactivated rabbit serum diluted in assay buffer to be tested in the assay.
  • the bacteria and rabbit serum were incubated at room temperature for 30 min with shaking.
  • 10 m ⁇ of baby rabbit complement Pel -Freeze Biologicals
  • HL60 cells (ATCC) were washed with assay buffer and resuspend to 1 x 10 7 cells/ml. To each well, 40 m ⁇ of HL60 suspension was added (200: 1 HL60 to bacteria ratio) followed by incubation with shaking at 37 °C with 5 % CO2 for 1 hour. The plate was transferred to ice and incubated for 20 minutes. Each sample (undiluted, 1/5 and 1/25 dilutions in water) was then plated on 5% blood agar plates. After overnight incubation at 37 °C with 5 % CO2, the CFU were counted for each sample and dilution.
  • a modified concentrated opsonophagocytic assay was established to investigate protein antibody-mediated killing of S. pneumoniae.
  • Sera from two rabbits immunized with CP1 P3 from rabbits 87 and 88 were assayed in comparison to the pre- immune sera (P0).
  • incubation with the P3 immune serum resulted in a reduction of the CFU ( Figure 4), or in alternative display of the same results, an increase in percent killing activity ( Figure 7, Panel A), compared to incubation with the pre-immune serum (P0) for S. pneumoniae serotype 6B, a type incorporated into the commercially available Prevnar 13 vaccine.
  • the killing activity of the immune serum was dependent on both HL60 cells and active complement (data not shown).
  • the same sera were assayed on two serotypes not incorporated into commercially available vaccines, S.
  • Example 3 Comparison of induction of Thl 7 response in mice following immunization with a mixture ( unconjusated ) of SPO 785, S PI 500, and a truncated rhizavidin protein
  • Histidine-tagged recombinant proteins were expressed in Escherichia coli and purified using Ni-nitrilotriacetic acid affinity chromatography. A second purification was executed with size-exclusion chromatography with a Superdex 200 column. Protein concentration was measured using a bicinchoninic acid (BCA) protein assay kit (Bio-Rad).
  • BCA bicinchoninic acid
  • CT Cholera toxin
  • CP1 fusion protein 1 (Rhavi-linker (GGGGSSS)-SP 1500-linker (AAA)- SP0785); Rhavi: truncated rhizavidin, amino acids [45-179]; CT: cholera toxin Note: all recombinant proteins were His-tagged.
  • intranasal immunization with CP1 adjuvanted with CT induced a stronger antigen-specific Thl7 response compared to immunization with SP0785 or SP1500 adjuvanted with CT, or with CT alone (control).
  • the Thl7 response is indicated by increased IL-17A production after ex vivo stimulation of peripheral blood of immunized mice with purified SP0785 (Panel A), purified SP1500 (Panel B), or killed (inactivated) pneumococcal whole cells (WCV; Panel C).
  • intranasal immunization with CP1 adjuvanted with CT also induced a stronger antigen-specific Thl7 response compared to immunization with fusion protein SP0785-linker (SSSGG)-SPl500-linker (SSVDKL)-PdT adjuvanted with CT, or with CT alone (control).
  • the Thl7 response is indicated by increased IL-17A production after ex vivo stimulation of peripheral blood of immunized mice with purified SP0785 (Panel A), or purified SP1500 (Panel B).
  • intranasal immunization with CP1 adjuvanted with CT induced a stronger antigen-specific Thl7 response compared to immunization with a combination (mixture) of SP0785, SP1500, and Rhavi adjuvanted with CT, or with CT alone (control).
  • the Thl7 response is indicated by increased IL-17A production after ex vivo stimulation of peripheral blood of immunized mice with purified SP0785 (Panel A), purified SP1500 (Panel B), or killed (inactivated) pneumococcal whole cells (WCV; Panel C).
  • Histidine-tagged recombinant fusion proteins CP1 and SP0785-linker (SSSGG)-SPl500-linker (SSVDKL)-PdT were expressed in Escherichia coli and purified using Ni-nitrilotriacetic acid affinity chromatography. A second purification was executed with size-exclusion chromatography with a Superdex 200 column. Protein concentration was measured using a bicinchoninic acid (BCA) protein assay kit (Bio-Rad).
  • BCA bicinchoninic acid
  • Assay was adapted from Benton et al, 1997.
  • Assay buffer contained 10 mM Dithiothreitol, 0.1% Bovine Serum Albumin in PBS pH 7.4, and 2% sheep red blood cells.
  • Sheep red blood cells were prepared as follows: add 200 m ⁇ sheep blood + 1 ml PBS pH 7.4, mix well, pellet, and wash 3x at 8,000 rpm for 30 sec each; finally resuspend blood cells in 10 ml chilled PBS and keep on ice until used. Assay was performed by diluting a
  • pneumolysin standard Ply
  • pneumolysoid PdT pneumolysoid PdT
  • fusion proteins to test CP1 and SP0785-linker (SSSGG)-SPl 500-linker (SSVDKL)-PdT
  • SSSGG SP0785-linker
  • SSVDKL SPl 500-linker
  • Plate was incubated for 30 min at 37°C. After incubation, plate was centrifuged for 5 min at 2,000 rpm at room temperature and 100 m ⁇ of supernatant was transferred to an empty 96 well plate to measure absorbance at OD42 0.
  • WP 050208881 241 SEYNLANLSVGQEVSFTSKVYPDKKWTGKLSYISDYPKNNGEAASPAAGNNTGSKYPYTIDVTGEVGDLKQGFSVNIEVK 320
  • WP 088793209 241 SEYNLANLSVGQEVSFTSKVYPDKKWTGKLSYI SDYPKNNGEAASPAAGNNTGSKYPYTIDVTGEVGDLKQGFSVNIEVK 320
  • WP 069123032 241 SEYNLANLSVGQEVSFTSKVYPDKKWTGKLSYI SDYPKNNGEAASPAAGNNTGSKYPYTIDVTGEVGDLKQGFSVNIEVK 320
  • WP 000728647 241 SEYNLANLSVGQEVSFTSKVYPDKKWTGKLSYI SDYPKNNGEAASPAAGNNTGSKYPYTIDVTGEVGDLKQGFSVNIEVK 320
  • SEQ ID NO:8 consensus SP1500 protein [amino acids 1-278]:
  • WP 061814735 1 MKKWMLVLVSLMTALFLVACGKNSSETSGDNWSKYQSNKSITIGFDSTFVPMGFAQKDGSYAGFDIDLATAV 72
  • WP 084843602 1 MKKWMHVLVSLMTALFLVACGKNSSETSGDNWSKYQSNKSITIGFDSTFVPMGFAQKDGSYAGFDIDLATAV 72
  • WP 050261378 1 MKKWMLVLVSLMTALFLVACGKNTSETSGDNWSKYESNKSITIGFDSTFVPMGFAQKDGSYAGFDIDIATAV 72
  • WP 088802838 1 MKKWMLVLVSLMTALFLVACGKNSSETSGDNWSKYQSNKSITIGFDSTFVPMGFAQKDGSYAGFDIDLATAV 72
  • WP 049512265 1 MKKWMLVLVSLMTALFLVACGKNSSETSGDNWSKYESNKSITIGFDSTFVPMGFAQKDGSYAGFDIDIATAV 72
  • WP 100128002 1 MKKWILVLVSLMTALFLVACGKNSSETSGDNWSKYESNKSITIGFDSTFVPMGFAQKDGSYAGFDIDIATAV 72
  • WP 101514844 1 MKKWILVLVSLMTALFLVACGKNSSETSGDNWSKYESNKSITIGFDSTFVPMGFAQKDGSYAGFDIDIATAV 72
  • WP 050242061 1 MKKWMLVLVSLMTALFLVACGKNASEISGDNWSKYQSNKSITIGFDSTFVPMGFAQKDGSYAGFDIDLATAV 72
  • WP 023941000 1 MKKWMFVLVSLMTALFLVACGKNASETSGDNWSKYESNKSITIGFDSTFVPMGFAQKDGSYAGFDIDIATAV 72
  • WP 088777969 1 MKKWMLVLVSLMTALFLVACGKNASETSGDNWSKYESNKSITIGFDSTFVPMGFAQKDGSYAGFDIDIATAV 72
  • WP 050223531 1 MKKWMLVLVSLMIALFLVACGKNTSETSGDNWSKYESNKSITIGFDSTFVPMGFAQKDGSYAGFDIDIATAV 72
  • CKJ33697 1 mkkwmkkwMKKWMLVLVSLMTALFLVACGKNASETSGDNWSKYESNKSITIGFDSTFVPMGFAQKDGSYAGFDIDLATAV 80
  • WP 061814735 153 GSSGYADFEANPELLKNIVANKEANQYQTFNEALIDLKNDRIDGLLIDRVYANYYLEAEGVLNDYNVFTVGLETEAFAVG 232
  • WP 084843602 153 GSSGYADFEANPELLKNIVANKEANQYQTFNEALIDLKNDRIDGLLIDRVYANYYLEAEGVLNDYNVFTVGLETEAFAVG 232
  • WP 100128002 153 GSSGYADFEANPAILKDIVANKEANQYQTFNEALIDLKNDRIDGLLIDRVYANYYLEAEGVLNDYNVFTVGLETEAFAVG 232
  • WP 101514844 153 GSSGYADFEANPAILKDIVANKEANQYQTFNEALIDLKNDRIDGLLIDRVYANYYLEAEGVLNDYNVFTVGLETEAFAVG 232
  • WP 050242061 153 GSSGYADFEANPAILKDIVANKEANQYQTFNEALIDLKNDRIDGLLIDRVYANYYLEAEGVLNDYNVFTVGLETEAFAVG
  • WP 023941000 153 GSSGYADFEANPAILKDIVANKEANQYQTFNEALIDLKNDRIDGLLIDRVYANYYLEAEGVLNDYNVFTVGLETEAFAVG 232
  • SEQ ID NO: 14 SP1500 gene encoding SP1500 protein lacking signal sequence [amino acids 27-278]:
  • SEQ ID NO:20 fusion protein Rhavi-SP0785-SPl500:
  • SEQ ID NO:23 fusion protein CP1, Rhavi-linker (GGGGSSS)-SP 1500- linker (AAA)-SP0785:
  • SEQ ID NO:29 codon-optimized nucleic acid sequence encoding fusion protein Rhavi-SPl500-SP0785:
  • SEQ ID NO:30 codon-optimized nucleic acid sequence encoding fusion protein Rhavi-SP0785-SPl500:
  • SEQ ID NO:31 codon-optimized nucleic acid sequence encoding fusion protein SPl500-SP0785-Rhavi:
  • SEQ ID NO:32 codon-optimized nucleic acid sequence encoding fusion protein SP0785-SPl500-Rhavi:
  • SEQ ID NO:33 codon-optimized nucleic acid sequence encoding fusion protein CP1 Rhavi-linker (GGGGSSS)-SPl500-linker (AAA)-SP0785:
  • SEQ ID NO:34 codon-optimized nucleic acid sequence encoding fusion protein Rhavi-linker (GGGGSSS)-SP0785 -linker (AAA)-SPl500:
  • SEQ ID NO:35 codon-optimized nucleic acid sequence encoding fusion protein SPl500-linker (GGGGSSS)-SP0785-linker (AAA)-Rhavi: AT GAC C AG C G G C GAC AAT T G G T C C AAAT AC C AGAG C AAC AAGAG CAT C AC GAT C G G C T T C GA
  • SEQ ID NO: 36 codon-optimized nucleic acid sequence encoding fusion protein SP0785-linker (GGGGSSS)-SPl500-linker (AAA)-Rhavi:
  • Anttila M Eskola J, Ahman H, Kayhty H. Avidity of IgG for Streptococcus pneumoniae type 6B and 23F polysaccharides in infants primed with pneumococcal conjugates and boosted with polysaccharide or conjugate vaccines. J Infect Dis. 1998 Jun; 177(6): 1614-21.
  • Rhizavidin from Rhizobium etli the first natural dimer in the avidin protein family. Biochem J. 2007;405:397- 405.
  • PNEUMOVAX® 23 Prescribing information.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Zoology (AREA)
  • Biomedical Technology (AREA)
  • Microbiology (AREA)
  • Pulmonology (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • General Engineering & Computer Science (AREA)
  • Biotechnology (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • Immunology (AREA)
  • Toxicology (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Oncology (AREA)
  • Communicable Diseases (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
PCT/US2019/050800 2018-09-12 2019-09-12 Pneumococcal fusion protein vaccines Ceased WO2020056127A1 (en)

Priority Applications (11)

Application Number Priority Date Filing Date Title
BR112021004185-0A BR112021004185A2 (pt) 2018-09-12 2019-09-12 vacinas de proteína de fusão pneumocócica
AU2019338448A AU2019338448B2 (en) 2018-09-12 2019-09-12 Pneumococcal fusion protein vaccines
JP2021513863A JP7535791B2 (ja) 2018-09-12 2019-09-12 肺炎球菌融合タンパク質ワクチン
CN201980073553.0A CN113164580B (zh) 2018-09-12 2019-09-12 肺炎球菌融合蛋白疫苗
KR1020217010452A KR102922338B1 (ko) 2018-09-12 2019-09-12 폐렴구균 융합 단백질 백신
SG11202101973YA SG11202101973YA (en) 2018-09-12 2019-09-12 Pneumococcal fusion protein vaccines
CA3111436A CA3111436A1 (en) 2018-09-12 2019-09-12 Pneumococcal fusion protein vaccines
MX2021002909A MX2021002909A (es) 2018-09-12 2019-09-12 Vacunas de proteinas de fusion neumococicas.
EP19860907.5A EP3849599A4 (en) 2018-09-12 2019-09-12 Pneumococcal fusion protein vaccines
IL281203A IL281203A (en) 2018-09-12 2021-03-02 Pneumococcal fusion protein vaccines
JP2024077967A JP2024096456A (ja) 2018-09-12 2024-05-13 肺炎球菌融合タンパク質ワクチン

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201862730199P 2018-09-12 2018-09-12
US62/730,199 2018-09-12

Publications (1)

Publication Number Publication Date
WO2020056127A1 true WO2020056127A1 (en) 2020-03-19

Family

ID=69772826

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2019/050800 Ceased WO2020056127A1 (en) 2018-09-12 2019-09-12 Pneumococcal fusion protein vaccines

Country Status (13)

Country Link
US (3) US20200087361A1 (cg-RX-API-DMAC7.html)
EP (1) EP3849599A4 (cg-RX-API-DMAC7.html)
JP (2) JP7535791B2 (cg-RX-API-DMAC7.html)
KR (1) KR102922338B1 (cg-RX-API-DMAC7.html)
CN (1) CN113164580B (cg-RX-API-DMAC7.html)
AU (1) AU2019338448B2 (cg-RX-API-DMAC7.html)
BR (1) BR112021004185A2 (cg-RX-API-DMAC7.html)
CA (1) CA3111436A1 (cg-RX-API-DMAC7.html)
IL (1) IL281203A (cg-RX-API-DMAC7.html)
MX (1) MX2021002909A (cg-RX-API-DMAC7.html)
SG (1) SG11202101973YA (cg-RX-API-DMAC7.html)
TW (1) TWI852943B (cg-RX-API-DMAC7.html)
WO (1) WO2020056127A1 (cg-RX-API-DMAC7.html)

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11013793B2 (en) 2018-09-12 2021-05-25 Affinivax, Inc. Multivalent pneumococcal vaccines
US11576958B2 (en) 2013-02-07 2023-02-14 Children's Medical Center Corporation Protein antigens that provide protection against pneumococcal colonization and/or disease
WO2023039223A1 (en) 2021-09-09 2023-03-16 Affinivax, Inc. Multivalent pneumococcal vaccines
WO2025193903A1 (en) 2024-03-15 2025-09-18 Affinivax, Inc. Pneumococcal polysaccharide compositions and uses thereof

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP4538370A1 (en) * 2022-06-07 2025-04-16 Peking University First Hospital Fusion protein containing truncated iga protease and use thereof
EP4637816A1 (en) * 2022-12-22 2025-10-29 The Medical College of Wisconsin, Inc. Compositions that target cd138 and cd3 and methods of making and using the same

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2014018904A1 (en) * 2012-07-26 2014-01-30 Genocea Biosciences, Inc. Fused antigen vaccines and compositions against streptococcus pneumoniae
US20150374811A1 (en) * 2013-02-07 2015-12-31 Children's Medical Center Corporation Protein antigens that provide protection against pneumococcal colonization and/or disease
US20160090404A1 (en) * 2011-05-11 2016-03-31 Children's Medical Center Corporation Modified biotin-binding protein, fusion proteins thereof and applications

Family Cites Families (49)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
IL112372A (en) 1994-02-07 2001-08-26 Res Dev Foundation Non-viral vector for the delivery of genetic information to cells
NZ304715A (en) 1995-03-22 1999-07-29 Jackson H M Found Military Med Production of immunogenic constructs using organic cyanylating reagents to activate carbohydrates and then coupling the carbohydrate to a protein, peptide or hapten
JP4469026B2 (ja) 1996-10-31 2010-05-26 ヒューマン ジノーム サイエンシーズ,インコーポレイテッド Streptococcus pneumoniaeの抗原およびワクチン
EP0977588B1 (en) 1997-04-24 2004-10-06 Henry M. Jackson Foundation For The Advancement Of Military Medicine Coupling of unmodified proteins to haloacyl or dihaloacyl derivatized polysaccharides for the preparation of protein-polysaccharide vaccines
US7060458B1 (en) 1997-08-14 2006-06-13 Wyeth Nucleic acid and amino acid sequences relating to Staphylococcus epidermidis for diagnostics and therapeutics
WO1999012416A1 (en) 1997-09-09 1999-03-18 The Trustees Of Columbia University In The City Of New York T-independent conjugate-vaccines
CN1318103A (zh) * 1998-07-27 2001-10-17 微生物技术有限公司 肺炎链球菌的核酸和蛋白质
US8246945B2 (en) 2000-04-06 2012-08-21 University Of Arkansas Methods and reagents for decreasing clinical reaction to allergy
GB0107658D0 (en) 2001-03-27 2001-05-16 Chiron Spa Streptococcus pneumoniae
NZ536859A (en) 2002-05-14 2007-11-30 Chiron Srl Mucosal combination vaccines for bacterial meningitis
US20060251675A1 (en) 2003-03-17 2006-11-09 Michael Hagen Mutant cholera holotoxin as an adjuvant and an antigen carrier protein
EP2311988A1 (en) 2003-04-15 2011-04-20 Intercell AG S. pneumoniae antigens
BRPI0410423A (pt) 2003-05-07 2006-06-06 Sanofi Pasteur Inc processo de imunogenicidade melhorada para vacinação meningocócica
CA2537900A1 (en) 2003-09-03 2005-04-28 Dendritherapeutics, Inc. Multiplex vaccines
US20050112139A1 (en) 2003-10-23 2005-05-26 Nmk Research, Llc Immunogenic composition and method of developing a vaccine based on factor H binding sites
US20070128183A1 (en) 2004-04-27 2007-06-07 Intercell Ag Td antigens
GB0410220D0 (en) 2004-05-07 2004-06-09 Kirkham Lea Ann Mutant pneumolysin proteins
EP1791961B1 (en) 2004-08-18 2011-06-08 The Governors of the University of Alberta Protein production method utilizing yebf
FI20041396A0 (fi) 2004-10-29 2004-10-29 Vesa Pekka Hytoenen Uudet mikrobiavidiinit
GB0428394D0 (en) 2004-12-24 2005-02-02 Chiron Srl Saccharide conjugate vaccines
WO2006084467A1 (en) 2005-02-11 2006-08-17 Ace Biosciences A/S Surface-located streptococcus pneumoniae polypeptides
US20090148894A1 (en) 2005-08-15 2009-06-11 Broedel Sheldon E Methods for optimizing the secretion of protein in prokaryotes
JP5135220B2 (ja) 2005-09-01 2013-02-06 ノバルティス ヴァクシンズ アンド ダイアグノスティクス ゲーエムベーハー アンド カンパニー カーゲー 血清群c髄膜炎菌を含む複数ワクチン接種
EP1957541A2 (en) * 2005-11-21 2008-08-20 Laboratoires Serono SA Compositions and methods of producing hybrid antigen binding molecules and uses thereof
MX2008007292A (es) 2005-12-08 2008-10-17 Univ Louisville Res Found Composiciones inmunoestimuladoras y metodos.
WO2007081583A2 (en) 2006-01-04 2007-07-19 Children's Medical Center Corporation Anti-pneumococcal preparations and methods of use
US7943133B2 (en) 2006-02-02 2011-05-17 Boston Biocom Llc Mesothelin antibody protein fusions and methods of use
US20080032340A1 (en) 2006-06-09 2008-02-07 University Of Arizona Peptide motifs for binding avidin or neutravidin
US8148084B2 (en) 2006-06-22 2012-04-03 Dana-Farber Cancer Institute, Inc. Diagnosis of autoimmune disease
CA2690973A1 (en) 2006-06-23 2007-12-27 Paul M. Simon Targeted immune conjugates
US7452985B2 (en) 2006-08-17 2008-11-18 Visgeneer, Inc. Human Ron-related gene variant associated with cancers
WO2008152448A2 (en) 2006-12-21 2008-12-18 Emergent Product Development Uk Limited Streptococcus proteins, and their use in vaccination
CN100579152C (zh) 2007-01-29 2010-01-06 华为技术有限公司 一种播放集团彩铃的方法、系统及装置
EP2468869B1 (en) 2007-01-31 2015-03-18 Pfenex Inc. Bacterial leader sequences for increased expression
AU2008287286B2 (en) 2007-04-13 2013-10-10 The Board Of Regents Of The University Of Oklahoma Mutants of cholesterol-dependent cytolysins and uses thereof
CA2690708A1 (en) 2007-06-26 2008-12-31 Glaxosmithkline Biologicals S.A. Vaccine
GB0714963D0 (en) 2007-08-01 2007-09-12 Novartis Ag Compositions comprising antigens
WO2009021548A1 (en) 2007-08-10 2009-02-19 Wacker Chemie Ag Expression of full length igg and secretion into the culture medium of prokaryotic cells
JP5658564B2 (ja) 2007-08-31 2015-01-28 ザ・ユニバーシティ・オブ・シカゴThe University Of Chicago ブドウ球菌肺疾患および状態に対する免疫に関連した方法および組成物
MX2011006922A (es) 2008-12-24 2012-06-12 Netherlands Vaccine Inst Polipeptidos de neumolisina (ply) modificada a partir de streptococcus pneumonia.
EP2208787A1 (en) 2009-01-19 2010-07-21 Université de Liège A recombinant alpha-hemolysin polypeptide of Staphylococcus aureus, having a deletion in the stem domain and heterologous sequences inserted
EP3263128A3 (en) 2009-04-14 2018-01-24 GlaxoSmithKline Biologicals S.A. Compositions for immunising against staphylococcus aureus
US8828953B2 (en) 2009-04-20 2014-09-09 NaZura BioHealth, Inc. Chemosensory receptor ligand-based therapies
RU2580299C2 (ru) 2009-06-29 2016-04-10 Дженосеа Биосайенсиз, Инк. Вакцины и композиции, направленные против streptococcus pneumoniae
CN101797381B (zh) 2010-01-29 2012-05-23 中国人民解放军第三军医大学 乙肝病毒抗原与路易斯寡糖的复合物及其制备方法和应用
EP2563396A2 (en) 2010-04-30 2013-03-06 Augmenta Biologicals LLC Delivery proteins
JP2019524639A (ja) * 2016-05-04 2019-09-05 ザ チルドレンズ メディカル センター コーポレーション アビジン様タンパク質およびそれらの融合タンパク質を精製する方法
AU2018243910B2 (en) 2017-03-28 2025-04-10 The Children's Medical Center Corporation A multiple antigen presenting system (MAPS)-based staphylococcus aureus vaccine, immunogenic composition, and uses thereof
CN112969474A (zh) * 2018-09-12 2021-06-15 艾芬尼维克斯公司 多价肺炎球菌疫苗

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20160090404A1 (en) * 2011-05-11 2016-03-31 Children's Medical Center Corporation Modified biotin-binding protein, fusion proteins thereof and applications
WO2014018904A1 (en) * 2012-07-26 2014-01-30 Genocea Biosciences, Inc. Fused antigen vaccines and compositions against streptococcus pneumoniae
US20150374811A1 (en) * 2013-02-07 2015-12-31 Children's Medical Center Corporation Protein antigens that provide protection against pneumococcal colonization and/or disease

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See also references of EP3849599A4 *

Cited By (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11576958B2 (en) 2013-02-07 2023-02-14 Children's Medical Center Corporation Protein antigens that provide protection against pneumococcal colonization and/or disease
US12083173B2 (en) 2013-02-07 2024-09-10 Children's Medical Center Corporation Protein antigens that provide protection against pneumococcal colonization and/or disease
US11013793B2 (en) 2018-09-12 2021-05-25 Affinivax, Inc. Multivalent pneumococcal vaccines
US11701416B2 (en) 2018-09-12 2023-07-18 Affinivax, Inc. Multivalent pneumococcal vaccines
US12370247B2 (en) 2018-09-12 2025-07-29 Affinivax, Inc. Multivalent pneumococcal vaccines
WO2023039223A1 (en) 2021-09-09 2023-03-16 Affinivax, Inc. Multivalent pneumococcal vaccines
US12036276B2 (en) 2021-09-09 2024-07-16 Affinivax, Inc. Multivalent pneumococcal vaccines
US12377140B2 (en) 2021-09-09 2025-08-05 Affinivax, Inc. Multivalent pneumococcal vaccines
WO2025193903A1 (en) 2024-03-15 2025-09-18 Affinivax, Inc. Pneumococcal polysaccharide compositions and uses thereof

Also Published As

Publication number Publication date
CN113164580A (zh) 2021-07-23
JP7535791B2 (ja) 2024-08-19
EP3849599A1 (en) 2021-07-21
BR112021004185A2 (pt) 2021-05-25
AU2019338448A1 (en) 2021-05-06
CN113164580B (zh) 2025-06-10
TWI852943B (zh) 2024-08-21
TW202035436A (zh) 2020-10-01
EP3849599A4 (en) 2022-06-29
KR102922338B1 (ko) 2026-02-05
IL281203A (en) 2021-04-29
CA3111436A1 (en) 2020-03-19
US20250019407A1 (en) 2025-01-16
KR20210088535A (ko) 2021-07-14
JP2024096456A (ja) 2024-07-12
AU2019338448B2 (en) 2026-02-26
US20230089151A1 (en) 2023-03-23
JP2022500409A (ja) 2022-01-04
MX2021002909A (es) 2021-09-08
US20200087361A1 (en) 2020-03-19
US12129283B2 (en) 2024-10-29
SG11202101973YA (en) 2021-03-30

Similar Documents

Publication Publication Date Title
US12370247B2 (en) Multivalent pneumococcal vaccines
US12129283B2 (en) Pneumococcal fusion protein vaccines
US12377140B2 (en) Multivalent pneumococcal vaccines
WO2024259229A2 (en) Fusion proteins generating protective antibodies and protective th17 responses for pseudomonas aeruginosa
WO2024192346A1 (en) Immunogenic compositions
EP4601683A1 (en) A maps vaccine targeting group b streptococcus (gbs)

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 19860907

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3111436

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2021513863

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112021004185

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 20217010452

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2019860907

Country of ref document: EP

Effective date: 20210412

ENP Entry into the national phase

Ref document number: 2019338448

Country of ref document: AU

Date of ref document: 20190912

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 112021004185

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20210305

WWG Wipo information: grant in national office

Ref document number: 201980073553.0

Country of ref document: CN