WO2019227106A1 - Tumor-specific neoantigens and methods of using the same - Google Patents

Tumor-specific neoantigens and methods of using the same Download PDF

Info

Publication number
WO2019227106A1
WO2019227106A1 PCT/US2019/034229 US2019034229W WO2019227106A1 WO 2019227106 A1 WO2019227106 A1 WO 2019227106A1 US 2019034229 W US2019034229 W US 2019034229W WO 2019227106 A1 WO2019227106 A1 WO 2019227106A1
Authority
WO
WIPO (PCT)
Prior art keywords
nucleic acid
subject
cancer
tumor
acid molecule
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2019/034229
Other languages
English (en)
French (fr)
Other versions
WO2019227106A9 (en
Inventor
Elizabeth Kennedy DUPERRET
Alfredo Perales PUCHALT
David Weiner
Niranjan Y. Sardesai
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Wistar Institute of Anatomy and Biology
Inovio Pharmaceuticals Inc
Geneos Therapeutics Inc
Original Assignee
Wistar Institute of Anatomy and Biology
Inovio Pharmaceuticals Inc
Geneos Therapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to US17/058,999 priority Critical patent/US12528848B2/en
Priority to CN201980039164.6A priority patent/CN112261947A/zh
Priority to KR1020207037379A priority patent/KR20210018321A/ko
Priority to CA3100974A priority patent/CA3100974A1/en
Priority to JP2021516553A priority patent/JP2021525549A/ja
Priority to EP19808366.9A priority patent/EP3801597A4/en
Priority to MX2020012649A priority patent/MX2020012649A/es
Application filed by Wistar Institute of Anatomy and Biology, Inovio Pharmaceuticals Inc, Geneos Therapeutics Inc filed Critical Wistar Institute of Anatomy and Biology
Publication of WO2019227106A1 publication Critical patent/WO2019227106A1/en
Publication of WO2019227106A9 publication Critical patent/WO2019227106A9/en
Anticipated expiration legal-status Critical
Priority to JP2024073051A priority patent/JP2024091964A/ja
Priority to US19/208,273 priority patent/US20260085100A1/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/19Cytokines; Lymphokines; Interferons
    • A61K38/20Interleukins [IL]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4748Tumour specific antigens; Tumour rejection antigen precursors [TRAP], e.g. MAGE
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/177Receptors; Cell surface antigens; Cell surface determinants
    • A61K38/179Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/19Cytokines; Lymphokines; Interferons
    • A61K38/193Colony stimulating factors [CSF]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/00119Melanoma antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/11T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4201Neoantigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4271Melanoma antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4702Regulators; Modulating activity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4702Regulators; Modulating activity
    • C07K14/4703Inhibitors; Suppressors
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/62DNA sequences coding for fusion proteins
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/68Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
    • C12Q1/6876Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
    • C12Q1/6883Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material
    • C12Q1/6886Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material for cancer
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/53DNA (RNA) vaccination
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/57Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • C07K14/5434IL-12
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/71Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/50Fusion polypeptide containing protease site
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q2600/00Oligonucleotides characterized by their use
    • C12Q2600/156Polymorphic or mutational markers

Definitions

  • the disclosure relates to vaccines, nucleic acid sequence that are compeonents of vaccines and methods of manufacturing and using the same for inducing antigen-specific immune responses in a subject.
  • the immune system can be classified into two functional subsystems: the innate and the acquired immune system.
  • the innate immune system is the first line of defense against infections, and most potential pathogens are rapidly neutralized by this system before they can cause, for example, a noticeable infection.
  • the acquired immune system reacts to molecular structures, referred to as antigens, of the intruding organism.
  • humoral immune reaction antibodies secreted by B cells into bodily fluids bind to pathogen-derived antigens, leading to the elimination of the pathogen through a variety of mechanisms, e.g. complement-mediated lysis.
  • the cell-mediated immune reaction T-cells capable of destroying other cells are activated.
  • proteins associated with a disease are present in a cell, they are fragmented proteolytically to peptides within the cell. Specific cell proteins then attach themselves to the antigen or peptide formed in this manner and transport them to the surface of the cell, where they are presented to the molecular defense mechanisms, in particular T-cells, of the body. Cytotoxic T cells recognize these antigens and kill the cells that harbor the antigens.
  • MHC proteins The molecules that transport and present peptides on the cell surface are referred to as proteins of the major histocompatibility complex (MHC).
  • MHC proteins are classified into two types, referred to as MHC class I and MHC class II.
  • the structures of the proteins of the two MHC classes are very similar; however, they have very different functions.
  • Proteins of MHC class I are present on the surface of almost all cells of the body, including most tumor cells.
  • MHC class I proteins are loaded with antigens that usually originate from endogenous proteins or from pathogens present inside cells, and are then presented to naive or cytotoxic T-lymphocytes (CTLs).
  • CTLs cytotoxic T-lymphocytes
  • MHC class II proteins are present on dendritic cells, B- lymphocytes, macrophages and other antigen-presenting cells.
  • cytotoxic T- lymphocytes that recognize such self-peptide-presenting MHC molecules of class I are deleted in the thymus (central tolerance) or, after their release from the thymus, are deleted or inactivated, i.e. tolerized (peripheral tolerance).
  • CTLs cytotoxic T- lymphocytes
  • MHC molecules are capable of stimulating an immune reaction when they present peptides to non-tolerized T-lymphocytes.
  • Cytotoxic T- lymphocytes have both T-cell receptors (TCR) and cluster of differentiation (CD) molecules on their surface.
  • T-Cell receptors are capable of recognizing and binding peptides complexed with the molecules of MHC class I.
  • Each cytotoxic T-lymphocyte expresses a unique T-cell receptor which is capable of binding specific MHC/ peptide complexes.
  • the peptide antigens attach themselves to the molecules of MHC class I by competitive affinity binding within the endoplasmic reticulum, before they are presented on the cell surface.
  • affinity of an individual peptide antigen is directly linked to its amino acid sequence and the presence of specific binding motifs in defined positions within the amino acid sequence. If the sequence of such a peptide is known, it is possible to manipulate the immune system against diseased cells using, for example, peptide vaccines.
  • Cancer neoantigens epitopes derived from tumor-specific somatic mutations that are presented on MHCs, are emerging as promising targets for personalized immunotherapy. These epitopes are thought to be more robust immunotherapy targets compared to shared, overexpressed tumor-associated self-antigens due to i) their high frequency in human cancers (ranging from approximately 33-163 expressed, non-synonym ous mutations for common solid tumors in adults) (Vogelstein et al. Science (80- ).
  • cancer mortality is 171.2 per 100,000 men and women per year (based on 2008-2012 deaths), which makes cancer among the leading causes of death in the United States.
  • Existing cancer therapies include ablation techniques (e.g., surgical procedures, cryogenic/heat treatment, ultrasound, radiofrequency, and radiation) and chemical techniques (e.g., pharmaceutical agents, cytotoxic/chemotherapeutic agents, monoclonal antibodies, and various combinations thereof).
  • ablation techniques e.g., surgical procedures, cryogenic/heat treatment, ultrasound, radiofrequency, and radiation
  • chemical techniques e.g., pharmaceutical agents, cytotoxic/chemotherapeutic agents, monoclonal antibodies, and various combinations thereof.
  • Cancer vaccines are typically composed of tumor antigens and immunostimulatory molecules (e.g., cytokines or TLR ligands) that work together to induce antigen-specific cytotoxic T cells that target and destroy tumor cells.
  • Current cancer vaccines typically contain shared tumor antigens, which are native proteins (i.e. - proteins encoded by the DNA of ail the normal cells in the individual) that are selectively expressed or over-expressed in tumors found in many individuals. While such shared tumor antigens are useful in identifying particular types of tumors, they are not ideal as immunogens for targeting a T-cell response to a particular tumor type because they are subject to the immune dampening effects of self-tolerance.
  • Neoantigen targeted immunotherapies are based on the specific activation of certain well-defined tumor antigens that have been mapped to the patient’s specific tumor. These are antigens that have been shown to be expressed in the tumor and presented to the immune system of that patient, and thus are specifically targeted to the patient’s tumor without the risk of non specific/ bystander targeting from a broad activation of innate immunity.
  • the DNA vaccines described in the present disclosure surprisingly generate a much larger proportion of CD8 + T cell responses for the immunogenic epitopes.
  • the present disclosure describes for the first time that inclusion of only high affinity MHC class I epitopes selected for a larger proportion of immunogenic epitopes, and selected for 100% CD8 + or CD8 + /CD4 + T cell epitopes.
  • the present disclosure described for the first time that DNA vaccines encoding neo-antigens were able to control tumor growth in vivo in a therapeutic setting, and T cells expanded from immunized mice were able to kill tumor cells ex vivo.
  • the DNA vaccines targeting neoantigens described in the present disclosure can overcome many of the limitations of other vaccine platforms, and may be able to work synergistically with other platforms for effective immunotherapy approaches.
  • a nucleic acid molecule comprising a nucleic acid sequence comprising Formula I: [(AED n )-(linker)]TON - [AED n+1 ], wherein the AED is an antigen expression domain comprising an expressible nucleic acid sequence.
  • Each linker is
  • the antigen expression domain 1 is independently selectable from about 24 to about 250 nucleotides in length and encodes an epitope.
  • the antigen expression domain 2 is independently selectable from about 24 to about 250 nucleotides in length and encodes an epitope, and n is any positive integer from about 1 to about 500.
  • the antigen expression domain 1 and the antigen expression domain 2 are independently selectable from about 20 to about 2,000 nucleotides in length.
  • the antigen expression domain 1 or antigen expression domain 2 is independently selectable from about 50 to about 10,000 nucleotides in length and n is any positive integer from about 6 to about 26.
  • the antigen expression domain 1 and/or the antigen expression domain 2 are independently selectable from about 15 to about 150, about 15 to about 100, or about 15 to about 50 nucleotides in length.
  • n is a positive integer from about 5 to about 30, about 2 to about 100, about 2 to about 58, or about 2 to about 29.
  • At least one linker comprises from about 15 to about 300 nucleotides and encodes a cleavage site.
  • the at least one linker comprises a furin protease cleavage site or a porcine teschovirus-l 2 A (P2A) cleavage site.
  • at least one linker comprises from about 15 to about 300 nucleotides, encodes a cleavage site, and Formula I comprises at least a first linker and a second linker, wherein the first and second linker comprise a furin protease cleavage site.
  • At least one linker comprises from about 15 to about 300 nucleotides, encodes a cleavage site, n is a positive integer from about 5 to about 50, and each linker comprises a furin protease cleavage site.
  • the nucleic acid molecule of this embodiment may further comprise at least one regulatory sequence, and wherein at least one nucleic acid sequence of Formula I is operably linked to the regulatory sequence.
  • the antigen expression domain 1 is independently selectable from about 12 to about 15,000 nucleotides in length and encodes an epitope from one or a plurality of cancer cells from a subject.
  • the antigen expression domain 2 is independently selectable from about 12 to about 15,000 nucleotides in length and encodes an epitope from one or a plurality of cancer cells from the subject.
  • the nucleic acid molecule is in an amount sufficient to elicit a CD8+ T cell response and/or a CD4+ T cell response against any one or plurality of amino acid sequences encoded by one or plurality of antigen expression domains.
  • the nucleic acid molecule further comprises a leader sequence, such as an IgE leader sequence.
  • the nucleic acid molecule is a plasmid.
  • the nucleic acid sequence of Formula I is positioned with the multiple cloning site of a plasmid is (i) selected from the group consisting of: LLC, TC1, ID8, pGX450l, pGX4503, pGX4504, pGX4505, and pGX4506, or (ii) a plasmid having at least 70% homology with a plasmid selected from the group consisting of: LLC, TC1, ID8, pGX450l, pGX4503, pGX4504, pGX4505, and pGX4506. It should be appreciated that host cells can be transformed with such plasmids.
  • a composition comprises one or a plurality of nucleic acid molecules as described herein.
  • a pharmaceutical composition comprises (i) one or a plurality of any of the nucleic acid molecules described herein, or a pharmaceutically acceptable salt thereof and (ii) a pharmaceutically acceptable carrier.
  • the pharmaceutical composition may further comprise one or more therapeutic agents, such as a biologic therapeutic or a small molecule.
  • one of the therapeutic agents is (i) a checkpoint inhibitor or functional fragment thereof, or (ii) a nucleic acid sequence that encodes a checkpoint inhibitor or functional fragment thereof.
  • the checkpoint inhibitor or functional fragment thereof associates or inhibits a checkpoint protein selected from the group consisting of CTLA-4, PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD 160, CGEN- 15049, CHK 1, CHK2, A2aR, and B-7 family ligands or a combination thereof.
  • the checkpoint inhibitor is an inhibitor of the programmed death- 1 (PD-l) pathway.
  • the checkpoint inhibitor is an anti -cytotoxic T- lymphocyte-associated antigen 4 (CTLA4) antibody.
  • a pharmaceutical composition comprises a pharmaceutically effective amount of: (i) one or a plurality of any of the nucleic acid molecules described herein or nucleic acid sequences that are about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% homologous to any nuclecui acid sequence listed herein, or a pharmaceutically acceptable salt thereof; and (ii) a pharmaceutically acceptable carrier.
  • the therapeutic agent is an adjuvant or functional fragment thereof.
  • the adjuvant or functional fragment thereof is (i) selected from the group consisting of: poly-ICLC, 1018 ISS, aluminum salts, Amplivax. AS15, BCG, CP- 870,893, CpG7909, CyaA, GM-CSF, IC30, IC31, Imiquimod, ImuFact 1MP321, IS Patch, ISS,
  • Montanide ISA 206 Montanide ISA 50V, Montanide ISA-51, OK-432, OM-174, OM-197-MP- EC, ONTAK, PEPTEL, vector system, PLGA microparticles, resiquimod, S L172, Virosomes and other Virus-like particles, YF-17D, VEGF trap, R848, beta-gluean, Pam3Cys, acrylic or methacrylic polymers, copolymers of maleic anhydride and Aquila's QS21 stimulon, and a functional fragment of any thereof; or (ii) a nucleic acid molecule encoding an adjuvant selected from the group consisting of: poly-ICLC, 1018 ISS, Amplivax AS15, BCG, CP- 870,893, CpG7909, CyaA, GM-CSF, IC30, IC31 , Imiquimod, ImuFact 1MP321 , IS Patch, ISS,
  • the therapeutic agent is: (i) an immunostimulatory agent or functional fragment thereof; or (ii) a nucleic acid sequence encoding an immunostimulatory agent or a functional fragment thereof.
  • the immunostimulatory agent is an interleukin or a functional fragment thereof.
  • the therapeutic agent is: (i) an chemotherapeutic agent or functional fragment thereof; or (ii) a nucleic acid sequence encoding an chemotherapeutic agent or a functional fragment thereof.
  • a method of treating and/or preventing cancer in a subject comprises administering to the subject in need thereof a pharmaceutically effective amount of any of the nucleic acid molecules, or any of the pharmaceutical compositions described in this disclosure.
  • treatment is determined by a clinical outcome, an increase, enhancement or prolongation of anti-tumor activity by T cells, an increase in the number of anti tumor T cells or activated T cells as compared with the number prior to treatment, or a combination thereof.
  • the clinical outcome is selected from the group consisting of tumor regression, tumor shrinkage, tumor necrosis, anti-tumor response by the immune system, tumor expansion, recurrence or spread, or a combination thereof.
  • the cancer has a high mutational load.
  • the cancer is selected from the group consisting of: non-small cell lung cancer, melanoma, ovarian cancer, cervical cancer, glioblastoma, urogenital cancer, gynecological cancer, lung cancer, gastrointestinal cancer, head and neck cancer, non-metastatic or metastatic breast cancer, malignant melanoma, Merkel Cell Carcinoma or bone and soft tissue sarcomas, haematologic neoplasias, multiple myeloma, acute myelogenous leukemia, chronic myelogenous leukemia, myelodysplastic syndrome and acute lymphoblastic leukemia, breast cancer, metastatic colorectal cancers, hormone sensitive or hormone refractory prostate cancer, colorectal cancer, ovarian cancer, hepatocellular cancer, renal cell cancer, pancreatic cancer, gastric cancer, oesophageal cancers, hepatocellular cancers, cholangiocellular cancers, head and neck squamous
  • a method of enhancing an immune response against a plurality of heterogeneous hyperproliferative cells in a subject comprises administering to the subject in need thereof a pharmaceutically effective amount of any of the nucleic acid molecules or any of the pharmaceutical composition of as described in this disclosure.
  • the immune response is of a sufficient magnitude or efficacy to inhibit or retard tumor growth, induce tumor cell death, induce tumor regression, prevent or delay tumor recurrence, prevent tumor growth, prevent tumor spread and/or induce tumor elimination.
  • the additional therapeutic agent is a biologic therapeutic or a small molecule.
  • the therapeutic agent is: (i) a checkpoint inhibitor or functional fragment thereof; or (ii) a nucleic acid molecule encoding a checkpoint inhibitor or a functional fragment thereof.
  • the checkpoint inhibitor associates with or inhibits a checkpoint protein selected from the group consisting of CTLA-4, PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD160, CGEN-15049, CHK 1, CHK2, A2aR, and B-7 family ligands, IDO inhibitors, or a combination thereof.
  • the checkpoint inhibitor is an inhibitor of the programmed death- 1 (PD-l) pathway.
  • the checkpoint inhibitor is an anti -cytotoxic T- lymphocyte-associated antigen 4 (CTLA4) antibody or functional fragment thereof.
  • the therapeutic agent is selected from the adjuvants as disclosed herein, or an immunostimulatory agent or functional fragment thereof.
  • the immunostimulatory agent is an interleukin or functional fragment thereof.
  • the therapeutic agent is a chemotherapeutic agent.
  • the subject has cancer. In some embodiments, the subject has not responded to checkpoint inhibitor therapy.
  • the nucleic acid molecule is administered to the subject by electroporation.
  • a method of inducing an immune response in a subject comprises administering to the subject in need thereof a pharmaceutically effective amount of any of the nucleic acid molecules or any of the pharmaceutical composition of the present disclosure.
  • the immune response is a CD8+ T cell immune response.
  • inducing the CD8+ T cell immune response comprises activating 0.01% to about 50% CD8+ T cells.
  • inducing the CD8+ T cell immune response comprises expanding CD8+ T cells.
  • a method of enhancing an immune response in a subject comprises administering to the subject in need thereof a pharmaceutically effective amount of any of the nucleic acid molecules or any of the pharmaceutical compositions disclosed herein.
  • the immune response is a CD8+ T cell immune response.
  • enhancing the CD8+ T cell immune response comprises activating 0.01% to about 50% CD8+ T cells.
  • enhancing the CD8+ T cell immune response comprises expanding CD8+ T cells.
  • a method of identifying one or more subject-specific DNA neoantigen mutations in a subject, wherein the subject has a cancer characterized by the presence or quantity of a plurality of neoantigen mutations comprises:
  • each subject-specific peptide is an expression product of subject-specific DNA neoantigen not present in the non-tumor sample
  • the step of measuring the binding characteristics of the of the subject-specific peptides is carried out by one or more of:
  • the subject-specific peptides bind to HLA proteins of the subject with an IC50 of less than about 500 nM. In some embodiments, the step of ranking the subject- specific peptides based on the binding characteristics. In some embodiments, the method further comprises the step of measuring the CD8+ T cell immune response generated by the subject- specific peptides. In some embodiments, the method further comprises formulating the subject- specific DNA neoantigens into a immunogenic composition for administration to the subject. In some embodiments, about 200 ranked neoantigen mutations are included in the immunogenic composition.
  • the method further comprises steps of providing a culture comprising dendritic cells obtained from the subject, and contacting the dendritic cells with the immunogenic composition. In some embodiments, the method further comprises steps of:
  • a method of making an individualized cancer vaccine for a subject suspected of having or diagnosed with a cancer comprises:
  • the step of identifying comprises sequencing the cancer.
  • the step of analyzing further comprises determining one or more binding characteristics associated with the neoantigen mutation, the binding characteristics selected from the group consisting of binding of the subject-specific peptides to T-cell receptor, binding of the subject-specific peptides to a HLA protein of the subject and binding of the subject-specific peptides to transporter associated with antigen processing (TAP), and ranking, based on the determined characteristics, each of the neo-antigenic mutations.
  • TAP antigen processing
  • the method comprises cloning nucleic acid sequences encoding the one or plurality of neoantigen mutations into a nucleic acid molecule, such as a plasmid.
  • the nucleic acid molecule comprises a nucleic acid sequence of Formula I that is positioned within the multiple cloning site of a plasmid selected from the group consisting of: pGX450l, pGX4503, pGX 4504, pGX4505, and pGX4506.
  • FIG. 1A-FIG. IE shows DNA vaccine neo-epitope dodecamers induce frequent immune responses.
  • FIG. 1A Experimental setup. C57B1/6 mice were implanted with LLC, TC1 or ID8 tumor cells subcutaneously (LLC and TC1) or in the peritoneum (ID8). Tumors and normal tail tissue were harvested 3 weeks after implantation for RNA and DNA isolation and sequencing. Mutations were identified through comparison with normal tissue.
  • FIG. 1B Number of mutations identified for each tumor type with the indicated MHC class I affinity (NetMHCons vl .1).
  • FIG. 1C Plasmid DNA design. The predicted 9mer epitopes were flanked by 12 amino acids on each side. Each epitope was separated by a furin cleavage site.
  • FIG. 1E Percentage of epitopes that generated immune responses (>50
  • FIG. 2A-FIG. 2F shows the amino acid sequence of LLC Plasmid #1 and FIG. 2B shows the amino acid sequence of LLC Plasmid #1.
  • FIG. 2C shows the nucleotide sequence of LLC Plasmid #2 and FIG. 2D shows the amino acid sequence of LLC Plasmid #2.
  • FIG. 2E shows the nucleotide sequence of LLC Plasmid #1 and FIG. 2F shows the amino acid sequence of LLC Plasmid #3.
  • FIG. 3A- FIG. 3D shows the nucleotide sequence of TC1 Plasmid #1 and FIG. 3B shows the amino acid sequence of TC1 Plasmid #1.
  • FIG. 3C shows the nucleotide sequence of TC1 Plasmid #2 and
  • FIG. 3D shows the amino acid sequence of TC1 Plasmid #2.
  • FIG. 4A- FIG. 4D show the nucleotide sequence of ID8 Plasmid #1 and FIG. 4B shows the amino acid sequence of ID8 Plasmid #1.
  • FIG. 4C shows the nucleotide sequence of ID8 Plasmid #2 and
  • FIG. 4D shows the amino acid sequence of ID8 Plasmid #2.
  • FIG. 5 shows allele frequency of neoantigen gene expression in tumor cell lines in vivo vs in vitro. Allele frequency of mutated genes in TC1, ID8 and LLC tumor cell lines growing in vivo (forming tumors in C57B1/6) or in vitro (growing in 2D in cell culture flasks).
  • FIG. 6A-F shows CD4 and CD8 T cell responses to neoantigens.
  • FIG. 6A-F shows intracellular cytokine staining of splenocytes isolated from control (pVax) or neoantigen immunized mice, stimulated with the corresponding neoantigen-specific peptides for 5 hours. Shown are the percentage of CD8+ T cells that are IFNy+ (FIG. 6A), TNFa+ (FIG. 6B) and IL- 2+ (FIG. 6C), and CD4+ T cells that are IFNy+ (FIG. 6D), TNFa+ (FIG. 6E) and IL-2+ (FIG. 6F).
  • N 5 mice per group. Significance was calculated using a two-tailed student’s t-test. Error bars indicate ⁇ SEM. *p ⁇ 0.05, **r ⁇ 0.01, ***p ⁇ 0.00l, ****p ⁇ 0.000l.
  • FIG. 7A- FIG. 7E shows DNA vaccines generate predominantly CD8 T cell responses to neoantigens.
  • FIG. 7A is a graph of IFNy ELISpot responses for each epitope that generated a significant immune response (>50SFU/million splenocytes, statistically significantly greater response compared to pVax immunized mice). Red bars indicate responses that are exclusively CD8 + T cells, blue bars indicate responses that are exclusively CD4+ T cells, and purple bars indicate responses that are both CD8 + and CD4 + T cells.
  • FIG. 7B and FIG. 7C show example flow cytometry data from mice immunized with a TC1 plasmid containing Sgsm2 (FIG. 7B) or Lta4h (FIG. 7C). Shown are IFNy and TNFa responses for CD4 and CD8 T cells.
  • FIG. 7D shows IFNy ELISpot responses from (FIG. 7A), displayed according to MHC class I affinity
  • FIG. 8A-FIG. 8F shows polyfunctional T cell responses to neoantigens.
  • FIG. 8A- FIG. 8F shows polyfunctional T cell responses to neoantigens.
  • FIG. 9A and FIG. 9B shows MHCII prediction of neoantigen responses. Percentage of epitopes that generate CD4 versus CD8 T cell responses, organized according to MHC class II affinity, predicted using the SMM align method (netMHCII-l.l, FIG. 9 A) or the NN align method (netMHCII-2.2, FIG. 9B).
  • FIG. 10A and FIG. 10B shows most neoantigen responses are specific to the mutant peptide rather than the wild-type peptide.
  • FIG. 10A shows a comparison of IFNy ELISpot responses against the mutated neoantigen epitope (MUT) to responses against the corresponding wild-type, non-mutated epitope (WT).
  • FIG. 10B The data from A, expressed in terms of fold change between responses to the MUT and WT epitopes (MUT/WT). Red bars indicate epitopes with >2 fold increase in response, orange bars indicate epitopes with >1.5 fold increase in response, blue bars indicate epitopes with ⁇ 1.5 fold change in response, and green bars indicate epitopes with >1.5 fold decrease in response.
  • N 5 mice per group. Error bars indicate ⁇ SEM.
  • FIG. 11A-FIG. 11F shows DNA vaccine primed T cells selectively kill mutated cells.
  • FIG. 11 A shows flow cytometry plots showing IFNg expressing CD4 and CD8 T cells that resulted from the expansion of Herpud2 and Lta4h reactive T cells. Cytotoxicity of T-cells derived from TC1 plasmids.
  • FIG. 11B Sgmsm2
  • FIG. 11C Herpud2 and FIG. 11C Lta4h expanded with their corresponding overlapping peptides (5pg/ml) four weeks co-cultured for 24 hours with either TC1 or ID8 tumor cells measured by luciferase expression after co-culture of 24 hours (triplicates, similar results with 5-hour incubation).
  • FIG. 11 A shows flow cytometry plots showing IFNg expressing CD4 and CD8 T cells that resulted from the expansion of Herpud2 and Lta4h reactive T cells. Cytotoxicity of T-cells derived from TC1 plasmids.
  • FIG. 11B Sgmsm2
  • FIG. 11C Herpud
  • FIG. 11D shows RNA expression levels of Sgmsm2, Herpud2 and Lta4h in TC1 tumors grown in vivo compared to TC1 cells grown in vitro.
  • FIG. 11E shows flow cytometry histograms showing surface expression of MHC class II on B 16 melanoma, TC1, ID8 and LLC tumor cells in normal conditions or after being exposed to 50ng/ml of interferon gamma.
  • FIG. 11F Histograms showing basal and IFNy-induced expression of MHC class II in the B 16 melanoma, TC1, LLC and ID8 measured by flow cytometry. Two-way ANOVA. Error bars indicate ⁇ SEM. ***p ⁇ 0.00l.
  • FIG. 12 Surface expression of MHC class II on tumor cells. Flow cytometric quantification of MHC class II surface expression in B16 melanoma, TC1, ID8 and LLC tumor cell lines upon exposure to different concentrations of interferon gamma (measured as mean fluorescent intensity, triplicates). Error bars indicate ⁇ SEM.
  • FIG. 13A and FIG. 13B shows deletion of immunodominant epitopes in TC1 plasmids does not result in improved immunogenicity of sub-dominant epitopes.
  • FIG. 14A- FIG. 14C shows DNA neoantigen vaccines delay tumor progression.
  • FIG 14A Schematic of tumor challenge experiments: we implanted 100,000 TC1 tumor cells subcutaneously and 7 days later started weekly immunizations with TC1 plasmid 1, 2, both or pVax empty vector.
  • FIG. 14B Tumor volume of mice bearing TC1 treated TC1 plasmid 1, 2, both or pVax.
  • FIG. 15 shows a schematic of the design of poly-neoepitope DNA vaccine against B 16 model.
  • pGX450l and pGX4503 plasmids were used.
  • F indicates a furin cleavage site, encoded by a linker region.
  • P2A indicates a porcine teschovirus-l celavge site, encoded by the linker.
  • FIG. 16 shows the strategy for assessment of immune responses induced by a DNA vaccine against B16.
  • Splenic lymphocytes were stimulated for 18 hours with peptides for the full neoeptiope sequence (MHC II) or l5-mer peptides overlapping by 11 amino acids (MHC I). Peptides were design to not include cleavage sites. ⁇ FNy ELISpot assay was carried out at week 5.
  • FIG. 17 shows a panel of graphs that show the results from the ELISpot assay, measuring the amount of ⁇ FNy SFU/l0e6 splenocytes, corresponding to T cell activation, for the tested full length peptide, pooled l5-mer peptides and individual neoepitopes.
  • the B 16 fusion neoantigen construct (top) and the B 16 furin/ P2A neoantigen construct (bottom) were tested.
  • FIG. 18 shows proof of concept neoantigen studies: B16 neoantigens.
  • pGX450l can induce an immune response in mice, particularly in the M33 region, which is a CD8 epitope.
  • FIG. 19 shows a schematic of the design of poly-neoepitope DNA vaccine against B 16 model.
  • pGX4504, pGX5405 and pGX4506 plasmids were used.
  • F indicates a furin cleavage site, encoded by the linker.
  • P2A indicates a porcine teschovirus-l cleavage site, encoded by the linker.
  • FIG. 20 shows the strategy for assessment of immune responses induced by a DNA vaccine against B16.
  • Splenic lymphocytes were stimulated for 18 hours with peptides for the full neoeptiope sequence (MHC II) or l5-mer peptides overlapping by 11 amino acids (MHC I). Peptides were design to not include cleavage sites. ⁇ FNy ELISpot assay was carried out at week 5.
  • FIG. 21 shows a panel of results from the ELISpot assay, measuring the amount of ⁇ FNy SFU/l0e6 splenocytes, corresponding to T cell activation, for the tested full length peptide, pooled l5-mer peptides and individual neoepitopes.
  • the CT26 fusion neoantigen construct (top), the CT26 furin neoantigen (middle) and the CT26 furin/ P2A neoantigen construct (bottom) were tested.
  • FIG. 22 shows proof of concept neoantigen studies: CT26 neoantigens.
  • FIG. 23A and FIG. 23B show the pGX450l Full Length DNA Sequence.
  • FIG. 23B shows the pGX450l plasmid map.
  • FIG. 24A and FIG. 24B show the pGX4503 Full Length DNA Sequence.
  • FIG. 24B shows the pGX4503 plasmid map.
  • FIG. 25A and FIG. 25B show the pGX4504 Full Length DNA Sequence.
  • FIG. 25B shows the pGX4504 plasmid map.
  • FIG. 26A and FIG. 26B show the pGX4505 Full Length DNA Sequence.
  • FIG. 25B shows the pGX4505 plasmid map.
  • FIG. 27A and FIG. 27B show the pGX4505 Full Length DNA Sequence.
  • FIG. 25B shows the pGX4505 plasmid map.
  • FIG. 28 is a map of the 2999 basepair backbone vector plasmid pVAXl (Invitrogen, Carlsbad Calif.).
  • the CMV promoter is located at bases 137-724.
  • the T7 promoter/priming site is at bases 664-683. Multiple cloning sites are at bases 696-811.
  • Bovine GH polyadenylation signal is at bases 829-1053.
  • the Kanamycin resistance gene is at bases 1226-2020.
  • the pUC origin is at bases 2320-2993.
  • FIG. 29 depicts how the DNA neoantigen vaccine affects tumor growth.
  • C57B1/6 Mice were immunized three time at 3 week intervals with about 25 micrograms of ID8 plasmids 1 and 2 or pVAX without an insert and challenged with 2 xl06 ID8 tumor cells injected
  • FIG. 29 depicts survival analysis for mice bearing ID8 tumors treated with ID8 plasmid cocktail (25 micrograms of ID8 plasmid 1 and 25 micrograms id ID 8 plasmid 2 formulated together) or 50 microrams of pVax control plasmid.
  • mice were euthanized upon development of ascites.
  • N l0 mice/group.
  • FIG. 30 is a restriction map of the pVAX plasmid.
  • FIG. 31 depicts a both a vaccination protocol of an experiment performed with plasmids and the structure of plasmids in graphic form.
  • FIG.32 depicts results of the experiment of Example 11 using the plasmids identified in
  • FIG.31 Detailed Description
  • the present disclosure relates to personalized strategies for the treatment of cancer, by administering a therapeutically effective amount of a pharmaceutical composition (e.g., a cancer vaccine) comprising a plurality of tumor specific neo-antigens to a subject (e.g., a mammal such as a human).
  • a pharmaceutical composition e.g., a cancer vaccine
  • a subject e.g., a mammal such as a human.
  • a reference to "A and/or B,” when used in conjunction with open-ended language such as “comprising” can refer, In some embodiments, to A without B (optionally including elements other than B); in another embodiment, to B without A (optionally including elements other than A); in yet another embodiment, to both A and B (optionally including other elements); etc.
  • Activate refers to a primary response induced by ligation of a cell surface moiety.
  • such stimulation entails the ligation of a receptor and a subsequent signal transduction event. Further, the stimulation event may activate a cell and upregulate or downregulate expression or secretion of a molecule.
  • ligation of cell surface moieties may result in the reorganization of cytoskeletal structures, or in the coalescing of cell surface moieties, each of which could serve to enhance, modify, or alter subsequent cellular responses.
  • the terms“activating CD8+ T cells” or“CD8+ T cell activation” refer to a process (e.g ., a signaling event) causing or resulting in one or more cellular responses of a CD8+ T cell (CTL), selected from: proliferation, differentiation, cytokine secretion, cytotoxic effector molecule release, cytotoxic activity, and expression of activation markers.
  • CTL CD8+ T cell
  • an“activated CD8+ T cell” refers to a CD8+ T cell that has received an activating signal, and thus demonstrates one or more cellular responses, selected from proliferation, differentiation, cytokine secretion, cytotoxic effector molecule release, cytotoxic activity, and expression of activation markers. Suitable assays to measure CD8+ T cell activation are known in the art and are described herein.
  • the term“adjuvant” is meant to refer to any molecule added to the DNA plasmid vaccines described herein to enhance the immunogenicity of the antigens encoded by the DNA plasmids and the encoding nucleic acid sequences described hereinafter.
  • an“antigen” is meant to refer to any substance that will elicit an immune response.
  • anti-tumor response refers to an immune system response including but not limited to activating T-cells to attack an antigen or an antigen presenting cell.
  • cancer as used herein is meant to refer to any disease that is caused by, or results in, inappropriately high levels of cell division, inappropriately low levels of apoptosis, or both.
  • Specific examples of cancer include, but are not limited to, Acute Lymphoblastic
  • Bone Cancer Osteosarcoma/Malignant Fibrous Histiocytoma; Brain Stem Glioma, Childhood; Brain Tumor, Adult; Brain Tumor, Brain Stem Glioma, Childhood; Brain Tumor, Cerebellar Astrocytoma, Childhood; Brain Tumor, Cerebral Astrocytoma/Malignant Glioma, Childhood; Brain Tumor, Ependymoma, Childhood; Brain Tumor, Medulloblastoma, Childhood; Brain Tumor, Supratentorial Primitive Neuroectodermal Tumors, Childhood; Brain Tumor, Visual Pathway and Hypothalamic Glioma, Childhood; Brain Tumor, Childhood (Other); Breast Cancer; Breast Cancer and Pregnancy; Breast Cancer, Childhood; Breast Cancer, Male;
  • Glioma Childhood Brain Stem; Glioma. Childhood Visual Pathway and Hypothalamic; Hairy Cell Leukemia; Head and Neck Cancer; Hepatocellular (Liver) Cancer, Adult (Primary);
  • Laryngeal Cancer Childhood; Leukemia, Acute Lymphoblastic, Adult; Leukemia, Acute Lymphoblastic, Childhood; Leukemia, Acute Myeloid, Adult; Leukemia, Acute Myeloid, Childhood; Leukemia, Chronic Lymphocytic; Leukemia, Chronic Myelogenous; Leukemia, Hairy Cell; Lip and Oral Cavity Cancer; Liver Cancer, Adult (Primary); Liver Cancer,
  • Lung Cancer Non-Small Cell
  • Lung Cancer Small Cell
  • Lymphoblastic Leukemia Adult Acute
  • Lymphoblastic Leukemia Childhood Acute
  • Lymphocytic Leukemia Chronic
  • Lymphoma AIDS— Related
  • Lymphoma Central Nervous System
  • Lymphoma Cutaneous T-Cell; Lymphoma, Hodgkin's, Adult; Lymphoma, Hodgkin's;
  • Lymphoma Hodgkin's During Pregnancy; Lymphoma, Non-Hodgkin's, Adult;
  • Lymphoma Non-Hodgkin's, Childhood; Lymphoma, Non-Hodgkin's During Pregnancy;
  • Lymphoma Primary Central Nervous System; Macroglobulinemia, Waldenstrom's; Male Breast Cancer; Malignant Mesothelioma, Adult; Malignant Mesothelioma, Childhood; Malignant Thymoma; Medulloblastoma, Childhood; Melanoma; Melanoma, Intraocular; Merkel Cell Carcinoma; Mesothelioma, Malignant; Metastatic Squamous Neck Cancer with Occult Primary; Multiple Endocrine Neoplasia Syndrome, Childhood; Multiple Myeloma/Plasma Cell Neoplasm; Mycosis Fungoides; Myelodysplasia Syndromes; Myelogenous Leukemia, Chronic; Myeloid Leukemia, Childhood Acute; Myeloma, Multiple; Myeloproliferative Disorders, Chronic; Nasal Cavity and Paranasal Sinus Cancer; Nasopharyngeal Cancer; Nasopharyngeal Cancer,
  • Pancreatic Cancer Pancreatic Cancer; Pancreatic Cancer, Childhood', Pancreatic Cancer, Islet Cell; Paranasal Sinus and Nasal Cavity Cancer; Parathyroid Cancer; Penile Cancer; Pheochromocytoma; Pineal and Supratentorial Primitive Neuroectodermal Tumors, Childhood; Pituitary Tumor; Plasma Cell Neoplasm/Multiple Myeloma; Pleuropulmonary Blastoma; Pregnancy and Breast Cancer;
  • Pregnancy and Hodgkin's Lymphoma Pregnancy and Non-Hodgkin's Lymphoma; Primary Central Nervous System Lymphoma; Primary Liver Cancer, Adult; Primary Liver Cancer, Childhood; Prostate Cancer; Rectal Cancer; Renal Cell (Kidney) Cancer; Renal Cell Cancer, Childhood; Renal Pelvis and Ureter, Transitional Cell Cancer; Retinoblastoma;
  • Thyroid Cancer Thyroid Cancer
  • Thyroid Cancer Childhood
  • Transitional Cell Cancer of the Renal Pelvis and Ureter Trophoblastic Tumor, Gestational; Unknown Primary Site, Cancer of, Childhood;
  • the cancer is selected from the group consisting of non small cell lung cancer, melanoma, ovarian cancer, cervical cancer, glioblastoma, urogenital cancer, gynecological cancer, lung cancer, gastrointestinal cancer, head and neck cancer, non-metastatic or metastatic breast cancer, malignant melanoma, Merkel Cell Carcinoma or bone and soft tissue sarcomas, haematologic neoplasias, multiple myeloma, acute myelogenous leukemia, chronic myelogenous leukemia, myelodysplastic syndrome and acute lymphoblastic leukemia, breast cancer, metastatic colorectal cancers, hormone sensitive or hormone refractory prostate cancer, colorectal cancer, ovarian cancer, hepatocellular cancer, renal cell cancer, pancreatic cancer, gastric cancer, oesophageal cancers, hepatocellular cancers, cholangiocellular cancers, head and neck squamous cell cancer
  • checkpoint inhibitor as used herein is meant to refer to any small molecule chemical compound, antibody, nucleic acid molecule, or polypeptide, or fragments thereof, that inhibits the inhibitory pathways, allowing more extensive immune activity.
  • the checkpoint inhibitor is an inhibitor of the programmed death- 1 (PD-l ) pathway, for example an anti-PDl antibody, such as, but not limited to Nivoiumab.
  • the checkpoint inhibitor is an anti- cytotoxic T-lymphocyte-associated antigen (CTLA-4) antibody.
  • CTLA-4 cytotoxic T-lymphocyte-associated antigen
  • the checkpoint inhibitor is targeted at a member of the TNF superfamily such as CD40, 0X40, CD 137, GITR, CD27 or TIM-3. In some cases targeting a checkpoint inhibitor is accomplished with an inhibitory antibody or similar molecule. In other cases, it is accomplished with an agonist for the target; examples of this class include the stimulatory targets 0X40 and GITR.
  • “combination therapy” as used herein is meant to refer to administration of one or more therapeutic agents in a sequential manner, that is, wherein each therapeutic agent is administered at a different time, as well as administration of these therapeutic agents, or at least two of the therapeutic agents, in a substantially simultaneous manner.
  • Substantially simultaneous administration can be accomplished, for example, by administering to the subject a single capsule having a fixed ratio of each therapeutic agent or in multiple, single capsules for each of the therapeutic agents.
  • one combination of the present invention may comprise a pooled sample of tumor specific neoantigens and a checkpoint inhibitor administered at the same or different times, or the)' can be formulated as a single, co-formulated pharmaceutical composition comprising the two compounds.
  • a combination of the present invention may be formulated as separate pharmaceutical compositions that can be administered at the same or different time.
  • the term "simultaneously” is meant to refer to administration of one or more agents at the same time.
  • a cancer vaccine or immunogenic composition and a checkpoint inhibitor are administered simultaneously).
  • Simultaneously includes administration contemporaneously, that is during the same period of time.
  • the one or more agents are administered simultaneously in the same hour, or simultaneously in the same day.
  • Sequential or substantially simultaneous administration of each therapeutic agent can be effected by any appropriate route including, but not limited to, oral routes, intravenous routes, sub-cutaneous routes, intramuscular routes, direct absorption through mucous membrane tissues (e.g., nasal, mouth, vaginal, and rectal), and ocular routes (e.g., intravitreal, intraocular, etc.).
  • the therapeutic agents can be administered by the same route or by different routes. For example, one component of a particular combination may be administered by intravenous injection while the other component(s) of the combination may be administered orally. The components may be administered in any therapeutically effective sequence.
  • a “combination” embraces groups of compounds or non -drug therapies useful as part of a combination therapy.
  • EP electro-kinetic enhancement
  • transmembrane electric field pulse to induce microscopic pathways (pores) in a bio-membrane; their presence allows biomolecules such as plasmids, oligonucleotides, siRNA, drugs, ions, and/or water to pass from one side of the cellular membrane to the other.
  • fragment is meant a portion of a polypeptide or nucleic acid molecule. This portion contains, preferably, at least 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% of the entire length of the reference nucleic acid molecule or polypeptide. A fragment may contain 5,
  • nucleotides or amino acids 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000 or more nucleotides or amino acids.
  • the term“genetic construct” is meant to refer to the DNA or RNA molecules that comprise a nucleotide sequence which encodes protein.
  • the coding sequence includes initiation and termination signals operably linked to regulatory elements including a promoter and polyadenylation signal capable of directing expression in the cells of the individual to whom the nucleic acid molecule is administered.
  • a nucleic acid of the disclosure can be, but is not limited to, a eukaryotic cell, a bacterial cell, an insect cell, or a human cell.
  • Suitable eukaryotic cells include, but are not limited to, Vero cells, HeLa cells, COS cells, CHO cells, HEK293 cells, BHK cells and MDCKII cells.
  • Suitable insect cells include, but are not limited to, Sf9 cells.
  • the phrase "recombinant host cell” can be used to denote a host cell that has been transformed or transfected with a nucleic acid to be expressed.
  • a host cell also can be a cell that comprises the nucleic acid but does not express it at a desired level unless a regulatory sequence is introduced into the host cell such that it becomes operably linked with the nucleic acid. It is understood that the term host cell refers not only to the particular subject cell but also to the progeny or potential progeny of such a cell. Because certain modifications may occur in succeeding generations due to, e.g., mutation or environmental influence, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term as used herein.
  • hybridize as used herein is meant pair to form a double-stranded molecule between complementary polynucleotide sequences (e.g., a gene described herein), or portions thereof, under various conditions of stringency.
  • complementary polynucleotide sequences e.g., a gene described herein
  • stringency See, e.g., Wahl, G. M. and S. L. Berger (1987) Methods Enzymol. 152:399; Kimmel, A. R. (1987) Methods Enzymol. 152:507).
  • immune checkpoint as used herein is meant to refer to inhibitory pathways that slow down or stop immune reactions and prevent excessive tissue damage from uncontrolled activity of immune cells.
  • immune response is meant to refer to the activation of a host's immune system, e.g., that of a mammal, in response to the introduction of nucleic acid molecules comprising a nucleotide sequence encoding neoantigens a described herein.
  • isolated means that the polynucleotide or polypeptide or fragment, variant, or derivative thereof has been essentially removed from other biological materials with which it is naturally associated, or essentially free from other biological materials derived, e.g., from a recombinant host cell that has been genetically engineered to express the polypeptide of the invention.
  • ligand as used herein is meant to refer to a molecule which has a structure complementary to that of a receptor and is capable of forming a complex with this receptor.
  • a ligand is to be understood as meaning in particular a peptide or peptide fragment which has a suitable length and suitable binding motives in its amino acid sequence, so that the peptide or peptide fragment is capable of forming a complex with proteins of MHC class I or MHC class II.
  • MHC molecules capable of binding peptides resulting from the proteolytic cleavage of protein antigens and representing potential T-cell epitopes, transporting them to the cell surface and presenting them there to specific cells, in particular cytotoxic T-lymphocytes or T-helper cells.
  • the major histocompatibility complex in the genome comprises the genetic region whose gene products expressed on the cell surface are important for binding and presenting endogenous and/or foreign antigens and thus for regulating immunological processes. The major
  • MHC class I histocompatibility complex
  • MHC class II histocompatibility complex
  • the molecules of the two MHC classes are specialized for different antigen sources.
  • the molecules of MHC class I present endogenously synthesized antigens, for example viral proteins and tumor antigens.
  • the molecules of MHC class II present protein antigens originating from exogenous sources, for example bacterial products.
  • the cellular biology and the expression patterns of the two MHC classes are adapted to these different roles.
  • MHC molecules of class I consist of a heavy chain and a light chain and are capable of binding a peptide of about 8 to 11 amino acids, but usually 9 or 10 amino acids, if this peptide has suitable binding motifs, and presenting it to cytotoxic T-lymphocytes.
  • the peptide bound by the MHC molecules of class I originates from an endogenous protein antigen.
  • the heavy chain of the MHC molecules of class I is preferably an HLA-A, HLA-B or HLA-C monomer, and the light chain is b-2-microglobulin.
  • MHC molecules of class II consist of an a-chain and a b-chain and are capable of binding a peptide of about 15 to 24 amino acids if this peptide has suitable binding motifs, and presenting it to T-helper cells.
  • the peptide bound by the MHC molecules of class II usually originates from an extracellular of exogenous protein antigen.
  • the a-chain and the b-chain are in particular HLA-DR, HLA-DQ and HLA-DP monomers.
  • neoantigen as used herein is meant to refer to a class of tumor antigens which arises from tumor-specific mutations in expressed protein of a subject.
  • the neoantigen is derived directly from a tumor of a subject. This is as opposed to a known tumor associated antigen which may be a consensus sequence known to elicit an immune response against a cell expressing the tumor antigen but not necessarily expressed by a tumor derived the subject.
  • the term“neoantigen mutation” as used herein refers to a mutation that is predicted to encode a neoantigenic peptide.
  • pharmaceutically acceptable refers to approved or approvable by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, including humans.
  • pharmaceutically acceptable excipient, carrier or diluent as used herein is meant to refer to an excipient, carrier or diluent that can be administered to a subject, together with an agent, and which does not destroy the pharmacological activity thereof and is nontoxic when administered in doses sufficient to deliver a therapeutic amount of the agent.
  • pharmaceutically acceptable salt of tumor specific neoantigens as used herein may be an acid or base salt that is generally considered in the art to be suitable for use in contact with the tissues of human beings or animals without excessive toxicity, irritation, allergic response, or other problem or complication.
  • Such salts include mineral and organic acid salts of basic residues such as amines, as well as alkali or organic salts of acidic residues such as carboxylic acids.
  • Specific pharmaceutical salts include, but are not limited to, salts of acids such as hydrochloric, phosphoric, hydrobromic, malic, glycolic, fumaric, sulfuric, sulfamic, suifanilic, formic, toluenesulfonie, methanesulfonic, benzene sulfonic, ethane disulfonic, 2- hydroxyethyl sulfonic, nitric, benzoic, 2-acetoxybenzoic, citric, tartaric, lactic, stearic, salicylic, glutamic, ascorbic, pamoic, succinic, fumaric, maleic, propionic, hydroxymaleic, hydroiodic, phenyiacetic, a!kanoic such as acetic, HOOC-(CH2)n-COOH where n is 0-4, and the like.
  • acids such as hydrochloric, phosphoric, hydrobromic, malic, glycolic, fumaric, sulfur
  • pharmaceutically acceptable cations include, but are not limited to sodium, potassium, calcium, aluminum, lithium and ammonium.
  • pharmaceutically acceptable salts for the pooled tumor specific neoantigens provided herein, including those listed by Remington's Pharmaceutical Sciences, l7th ed., Mack Publishing Company, Easton, PA, p. 1418 ( 1985).
  • a pharmaceutically acceptable acid or base salt can be synthesized from a parent compound that contains a basic or acidic moiety by any conventional chemical method. Briefly, such salts can be prepared by reacting the free acid or base forms of these compounds with a stoichiometric amount of the appropriate base or acid in an appropriate solvent.
  • the terms “prevent,” “preventing,” “prevention,” “prophylactic treatment,” and the like are meant to refer to reducing the probability of developing a disease or condition in a subject, who does not have, but is at risk of or susceptible to developing a disease or condition.
  • a purified polypeptide of the present invention is a polypeptide that is at least from about 70 to about 100% pure, i.e., the polypeptide is present in a composition wherein the polypeptide constitutes from about 70 to about 100% by weight of the total composition.
  • the purified polypeptide of the present invention is from about 75% to about 99% by weight pure, from about 80% to about 99% by weight pure, from about 90 to about 99% by weight pure, or from about 95% to about 99% by weight pure.
  • a receptor may serve, to transmit information in a cell, a cell formation or an organism.
  • the receptor comprises at least one receptor unit and preferably two receptor units, where each receptor unit may consist of a protein molecule, in particular a glycoprotein molecule.
  • the receptor has a structure which complements that of a ligand and may complex the ligand as a binding partner.
  • the information is transmitted in particular by conformational changes of the receptor following complexation of the ligand on the surface of a cell.
  • a receptor is to be understood as meaning in particular proteins of MHC classes I and II capable of forming a receptor/ligand complex with a ligand, in particular a peptide or peptide fragment of suitable length.
  • small molecule refers to a low molecular weight ( ⁇ 900 daltons) organic compound that may help regulate a biological process, with a size on the order of 10 9 m. Most drugs are small molecules.
  • the terms“subject,”“individual,”“host,” and“patient,” are used interchangeably herein and refer to any mammalian subject for whom diagnosis, treatment, or therapy is desired, particularly humans. The methods described herein are applicable to both human therapy and veterinary applications. In some embodiments, the subject is a mammal, and in other embodiments the subject is a human.
  • “patient in need thereof’ or“subject in need thereof’ refers to a living organism suffering from or prone to a disease or condition that can be treated by administration of a vaccine (or pharmaceutical composition comprising a neoantigen DNA vaccine) according to the described invention.
  • A“patient in need thereof’ or“subject in need” may also refer to a living organism that is receiving a neoantigen DNA vaccine (or pharmaceutical composition comprising a neoantigen DNA vaccine) according to the described invention, or has received a neoantigen DNA vaccine (or pharmaceutical composition comprising a neoantigen DNA vaccine) according to the described invention; or has a tumor or
  • Non-limiting examples include humans, other mammals, bovines, rats, mice, dogs, monkeys, goat, sheep, cows, deer, and other non-mammalian animals.
  • a patient or subject is human.
  • T-cell epitope as used herein is meant to refer to a peptide sequence which can be bound by the MHC molecules of class I or II in the form of a peptide-presenting MHC molecule or MHC complex and then, in this form, be recognized and bound by cytotoxic T- lymphocytes or T-helper cells, respectively.
  • therapeutic effect as used herein is meant to refer to some extent of relief of one or more of the symptoms of a disorder (e.g., a neoplasia or tumor) or its associated pathology.
  • A“therapeutically effective amount” as used herein is meant to refer to an amount of an agent which is effective, upon single or multiple dose administration to the cell or subject, in prolonging the survivability of the patient with such a disorder, reducing one or more signs or symptoms of the disorder, preventing or delaying, and the like beyond that expected in the absence of such treatment.
  • A“therapeutically effective amount” is intended to qualify the amount required to achieve a therapeutic effect.
  • a physician or veterinarian having ordinary skill in the art can readily determine and prescribe the "therapeutically effective amount" (e.g., ED50) of the pharmaceutical composition required.
  • the physician or veterinarian could start doses of the compounds of the invention employed in a pharmaceutical composition at levels lower than that required in order to achieve the desired therapeutic effect and gradually increase the dosage until the desired effect is achieved.
  • the therapeutically effective amount is an amount effective to shrink a solid tumor by about 2% in total mass as compared to its mass or estimated mass before treatment, by about 4% in total mass, by about 6% in total mass, by about 8% in total mass, by about 10% in total mass, by about 15% in total mass, by about 20% in total mass, by about 25% in total mass, by about 30% in total mass, by about 35% in total mass, by about 40% in total mass, by about 45% in total mass, or by about 50% in total mass as compared to the total mass of the solid tumor before the treatment.
  • “treat,”“treated,”“treating,”“treatment,” and the like as used herein are meant to refer to reducing or ameliorating a disorder and/or symptoms associated therewith (e.g., a cancer or tumor).
  • “Treating” may refer to administration of the neoantigen vaccines described herein to a subject after the onset, or suspected onset, of a cancer.
  • “Treating” includes the concepts of “alleviating”, which refers to lessening the frequency of occurrence or recurrence, or the severity, of any symptoms or other ill effects related to a cancer and/or the side effects associated with cancer therapy.
  • treating also encompasses the concept of“managing” which refers to reducing the severity of a particular disease or disorder in a patient or delaying its recurrence, e.g., lengthening the period of remission in a patient who had suffered from the disease. It is appreciated that, although not precluded, treating a disorder or condition does not require that the disorder, condition, or symptoms associated therewith be completely eliminated.
  • compositions and methods of the invention seek to reduce the size of a tumor or number of cancer cells, cause a cancer to go into remission, or prevent growth in size or cell number of cancer cells. In some circumstances, treatment with the leads to an improved prognosis.
  • therapeutic effect as used herein is meant to refer to some extent of relief of one or more of the symptoms of a disorder (e.g., a neoplasia or tumor) or its associated pathology.
  • A“therapeutically effective amount” as used herein is meant to refer to an amount of an agent which is effective, upon single or multiple dose administration to the cell or subject, in prolonging the survivability of the patient with such a disorder, reducing one or more signs or symptoms of the disorder, preventing or delaying, and the like beyond that expected in the absence of such treatment.
  • A“therapeutically effective amount” is intended to qualify the amount required to achieve a therapeutic effect.
  • a physician or veterinarian having ordinary skill in the art can readily determine and prescribe the "therapeutically effective amount" (e.g., ED50) of the pharmaceutical composition required.
  • the physician or veterinarian could start doses of the compounds of the invention employed in a pharmaceutical composition at levels lower than that required in order to achieve the desired therapeutic effect and gradually increase the dosage until the desired effect is achieved.
  • the therapeutically effective amount may be initially determined from preliminary in vitro studies and/or animal models.
  • a therapeutically effective dose may also be determined from human data.
  • the applied dose may be adjusted based on the relative bioavailability and potency of the administered agent Adjusting the dose to achieve maximal efficacy based on the methods described above and other well-known methods is within the capabilities of the ordinarily skilled artisan.
  • General principles for determining therapeutic effectiveness which may be found in Chapter 1 of Goodman and Gilman's The Pharmacological Basis of Therapeutics, lOth Edition, McGraw-Hill (New York) (2001), incorporated herein by reference, are summarized below.
  • Pharmacokinetic principles provide a basis for modifying a dosage regimen to obtain a desired degree of therapeutic efficacy with a minimum of unacceptable adverse effects. In situations where the drug's plasma concentration can be measured and related to the therapeutic window, additional guidance for dosage modification can be obtained.
  • Drug products are considered to be pharmaceutical equivalents if they contain the same active ingredients and are identical in strength or concentration, dosage form, and route of
  • Two pharmaceutically equivalent drug products are considered to be bioequivalent when the rates and extents of bioavailability of the active ingredient in the two products are not significantly different under suitable test conditions.
  • nucleic acid molecules e.g ., cDNA or genomic DNA
  • RNA molecules e.g., mRNA
  • nucleotide analogs e.g., peptide nucleic acids and non-naturally occurring nucleotide analogs
  • hybrids thereof The nucleic acid molecule can be single-stranded or double-stranded.
  • the nucleic acid molecules of the disclosure comprise a contiguous open reading frame encoding an antibody, or a fragment thereof, as described herein.“Nucleic acid” or“oligonucleotide” or “polynucleotide” as used herein may mean at least two nucleotides covalently linked together.
  • a nucleic acid also encompasses the complementary strand of a depicted single strand.
  • Many variants of a nucleic acid may be used for the same purpose as a given nucleic acid.
  • a nucleic acid also encompasses substantially identical nucleic acids and complements thereof.
  • a single strand provides a probe that may hybridize to a target sequence under stringent hybridization conditions.
  • a nucleic acid also encompasses a probe that hybridizes under stringent hybridization conditions.
  • Nucleic acids may be single stranded or double stranded, or may contain portions of both double stranded and single stranded sequence.
  • the nucleic acid may be DNA, both genomic and cDNA, RNA, or a hybrid, where the nucleic acid may contain combinations of deoxyribo- and ribo-nucleotides, and combinations of bases including uracil, adenine, thymine, cytosine, guanine, inosine, xanthine hypoxanthine, isocytosine and isoguanine Nucleic acids may be obtained by chemical synthesis methods or by recombinant methods.
  • a nucleic acid will generally contain phosphodiester bonds, although nucleic acid analogs may be included that may have at least one different linkage, e.g., phosphoramidate,
  • nucleic acids containing one or more non-naturally occurring or modified nucleotides are also included within one definition of nucleic acids.
  • the modified nucleotide analog may be located for example at the 5'-end and/or the 3'-end of the nucleic acid molecule.
  • nucleotide analogs may be selected from sugar- or backbone-modified ribonucleotides. It should be noted, however, that also nucleobase-modified ribonucleotides, i.e. ribonucleotides, containing a non-naturally occurring nucleobase instead of a naturally occurring nucleobase such as uridines or cytidines modified at the 5-position, e.g. 5-(2-amino)propyl uridine, 5-bromo uridine; adenosines and guanosines modified at the 8-position, e.g. 8-bromo guanosine; deaza nucleotides, e.g.
  • O- and N-alkylated nucleotides e.g. N6-methyl adenosine are suitable.
  • the 2'-OH-group may be replaced by a group selected from H, OR, R, halo, SH,
  • Modified nucleotides also include nucleotides conjugated with cholesterol through, e.g., a hydroxyprolinol linkage as described in Krutzfeldt et ah, Nature (Oct. 30, 2005), Soutschek et ah, Nature 432: 173-178 (2004), and U.S. Patent Publication No. 20050107325, which are incorporated herein by reference in their entireties.
  • Modified nucleotides and nucleic acids may also include locked nucleic acids (LNA), as described in U.S. Patent No.
  • nucleic acid molecule comprises one or more nucleotide sequences that encode one or more proteins.
  • a nucleic acid molecule comprises initiation and termination signals operably linked to regulatory elements including a promoter and polyadenylation signal capable of directing expression in the cells of the individual to whom the nucleic acid molecule is administered.
  • the nucleic acid molecule also includes a plasmid containing one or more nucleotide sequences that encode one or a plurality of neoantigens.
  • the disclosure relates to a pharmaceutical composition
  • a pharmaceutical composition comprising a first, second, third or more nucleic acid molecule, each of which encoding one or a plurality of neoantigens and at elast one of each plasmid comprising one or more of the Formulae disclosed herein.
  • polypeptide “peptide” and“protein” are used interchangeably herein to refer to polymers of amino acids of any length.
  • the polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non-natural amino acids or chemical groups that are not amino acids.
  • the terms also encompass an amino acid polymer that has been modified; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation, such as conjugation with a labeling component.
  • amino acid includes natural and/or unnatural or synthetic amino acids, including glycine and both the D or L optical isomers, and amino acid analogs and
  • The“percent identity” or “percent homology” of two polynucleotide or two polypeptide sequences is determined by comparing the sequences using the GAP computer program (a part of the GCG Wisconsin Package, version 10.3 (Accelrys, San Diego, Calif.)) using its default parameters.
  • “Identical” or “identity” as used herein in the context of two or more nucleic acids or amino acid sequences may mean that the sequences have a specified percentage of residues that are the same over a specified region.
  • the percentage may be calculated by optimally aligning the two sequences, comparing the two sequences over the specified region, determining the number of positions at which the identical residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the specified region, and multiplying the result by 100 to yield the percentage of sequence identity.
  • the residues of single sequence are included in the denominator but not the numerator of the calculation.
  • Alignment Search Tool is suitable for determining sequence similarity.
  • Software for performing BLAST analyses is publicly available through the National Center for Biotechnology
  • HSPs high scoring sequence pair
  • T is referred to as the neighborhood word score threshold (Altschul et al., supra).
  • HSPs high scoring sequence pair
  • These initial neighborhood word hits act as seeds for initiating searches to find HSPs containing them.
  • the word hits are extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Extension for the word hits in each direction are halted when: 1) the cumulative alignment score falls off by the quantity X from its maximum achieved value; 2) the cumulative score goes to zero or below, due to the
  • the Blast algorithm parameters W, T and X determine the sensitivity and speed of the alignment.
  • the Blast program uses as defaults a word length (W) of 11, the
  • Gapped BLAST performs a statistical analysis of the similarity between two sequences.
  • One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide sequences would occur by chance.
  • P(N) the smallest sum probability
  • a nucleic acid is considered similar to another if the smallest sum probability in comparison of the test nucleic acid to the other nucleic acid is less than about 1, less than about 0.1, less than about 0.01, and less than about 0.001.
  • Two single-stranded polynucleotides are“the complement” of each other if their sequences can be aligned in an anti-parallel orientation such that every nucleotide in one polynucleotide is opposite its complementary nucleotide in the other polynucleotide, without the introduction of gaps, and without unpaired nucleotides at the 5' or the 3' end of either sequence.
  • a polynucleotide is "complementary" to another polynucleotide if the two polynucleotides can hybridize to one another under moderately stringent conditions.
  • a polynucleotide can be complementary to another polynucleotide without being its complement.
  • stringent hybridization conditions or“stringent conditions” as used herein is meant to refer to conditions under which a nucleic acid molecule will hybridize another nucleic acid molecule, but to no other sequences. Stringent conditions are sequence-dependent and will be different in different circumstances. Longer sequences hybridize specifically at higher temperatures. Generally, stringent conditions are selected to be about 5°C lower than the thermal melting point (Tm) for the specific sequence at a defined ionic strength and pH. The Tm is the temperature (under defined ionic strength, pH and nucleic acid concentration) at which 50% of the probes complementary to the target sequence hybridize to the target sequence at equilibrium. Since the target sequences are generally present in excess, at Tm, 50% of the probes are occupied at equilibrium.
  • Tm thermal melting point
  • stringent conditions will be those in which the salt concentration is less than about 1.0 M sodium ion, typically about 0.01 to 1.0 M sodium ion (or other salts) at pH 7.0 to 8.3 and the temperature is at least about 30° C for short probes, primers or oligonucleotides (e.g. 10 to 50 nucleotides) and at least about 600C for longer probes, primers or oligonucleotides.
  • Stringent conditions may also be achieved with the addition of destabilizing agents, such as formamide.
  • nucleic acid molecule or polypeptide exhibiting at least 50% identity to a reference amino acid sequence (for example, any one of the amino acid sequences described herein) or nucleic acid sequence (for example, any one of the nucleic acid sequences described herein).
  • a reference amino acid sequence for example, any one of the amino acid sequences described herein
  • nucleic acid sequence for example, any one of the nucleic acid sequences described herein.
  • such a sequence is at least 60%, more preferably 80% or 85%, and more preferably 90%, 95% or even 99% identical at the amino acid level or nucleic acid to the sequence used for comparison.
  • a nucleotide sequence is "operably linked" to a regulatory sequence if the regulatory sequence affects the expression (e.g ., the level, timing, or location of expression) of the nucleotide sequence.
  • a "regulatory sequence” is a nucleic acid that affects the expression (e.g., the level, timing, or location of expression) of a nucleic acid to which it is operably linked.
  • the regulatory sequence can, for example, exert its effects directly on the regulated nucleic acid, or through the action of one or more other molecules (e.g., polypeptides that bind to the regulatory sequence and/or the nucleic acid).
  • Examples of regulatory sequences include promoters, enhancers and other expression control elements (e.g., polyadenylation signals). Further examples of regulatory sequences are described in, for example, Goeddel, 1990, Gene
  • sample refers generally to a limited quantity of something which is intended to be similar to and represent a larger amount of that something.
  • a sample is a collection, swab, brushing, scraping, biopsy, removed tissue, or surgical resection that is to be testing for the absence, presence or grading of a hyperproliferative tissue, which, in some cases is cancerous tissue or one or a plurality of cells.
  • samples are taken from a patient or subject that is believed to have a cancer, hyperplasia, pre- cancerous or comprise one or more tumor cells.
  • a sample believed to contain one or more hyperproliferative cells is compared to a“control sample” that is known not to contain one or more hyperproliferative cells.
  • This disclosure contemplates using any one or a plurality of disclosed samples herein to identify, detect, sequence and/or quantify the amount of neoantigens (highly or minimally immunogenic) within a particular sample.
  • the methods relate to the step of exposing a swab, brushing or other sample from an environment to a set of reagents sufficient to isolate and/or sequence the DNA and RNA of one or a plurality of cells in the sample.
  • A“vector” is a nucleic acid that can be used to introduce another nucleic acid linked to it into a cell.
  • a vector refers to a linear or circular double stranded DNA molecule into which additional nucleic acid segments can be ligated.
  • a viral vector e.g ., replication defective retroviruses, adenoviruses and adeno- associated viruses
  • certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors comprising a bacterial origin of replication and episomal mammalian vectors).
  • vectors e.g., non-episomal mammalian vectors
  • An "expression vector” is a type of vector that can direct the expression of a chosen polynucleotide.
  • the disclosure relates to any one or plurality of vectors that comprise nucleic acid sequences encoding any one or plurality of amino acid sequence disclosed herein.
  • vaccine as used herein is meant to refer to a composition for generating immunity for the prophylaxis and/or treatment of diseases (e.g., cancer). Accordingly, vaccines are medicaments which comprise antigens and are intended to be used in humans or animals for generating specific defense and protective substance by vaccination.
  • A“vaccine composition” or a“neoantigen vaccine composition” can include a pharmaceutically acceptable excipient, earner or diluent.
  • the present disclosure is based, at least in part, on the ability to identify all, or substantially all, of the mutations within a cancer/tumor (e.g., translocations, inversions, large and small deletions and insertions, missense mutations, splice site mutations, etc.).
  • these mutations are present in the genome of cancer/tumor cells of a subject, but not in normal tissue from the subject.
  • the disclosure relates to the innovative discovery that administering pharmaceutical compositions comprising the nucleic acid sequences that encode from about 1 to about 100 different amino acid sequences that represent a milleu of mutations in several different cancer cells Such mutations are of particular interest if they lead to changes that result in a protein with an altered amino acid sequence that is unique to the patient's cancer/tumor (e.g., a neo-antigen).
  • the present disclosure features a nucleic acid molecule comprising a nucleic acid sequence comprising Formula I:
  • the AED is an independently selectable antigen expression domain comprising an expressible nucleic acid sequence, wherein AED n is referred to as antigen expression domain and wherein AEDn+l is referred to as antigen expression domain 2; wherein the each linker is independently selectable from about 0 to about 300 natural or non-natural nucleic acids in length, wherein the antigen expression domain 1 is independently selectable from about 12 to about 15,000 nucleotides in length and encodes an epitope; wherein the antigen expression domain 2 is independently selectable from about 12 to about 15,000 nucleotides in length and encodes an epitope; and wherein n is any positive integer from about 1 to about 500.
  • each linker is independently selectable from about 0 to about 25, about 1 to about 25, about 2 to about 25, about 3 to about 25, about 4 to about 25, about 5 to about 25, about 6 to about 25, about 7 to about 25, about 8 to about 25, about 9 to about 25, about 10 to about 25, about 11 to about 25, about 12 to about 25, about 13 to about 25, about 14 to about 25, about 15 to about 25, about 16 to about 25, about 17 to about 25, about 18 to about
  • each linker is about 0, about 1, about 2, about 3, about 4, about 5, about 6, about 7, about 8, about 9, about 10, about 11, about 12, about 13, about 14, about 15, about 16, about 17, about 18, about 19, about 20, about 21, about 22, about 23, about 24, about 25 natural or non natural nucleic acids in length.
  • each linker is independently selectable from a linker that is about 0, about 1, about 2, about 3, about 4, about 5, about 6, about 7, about 8, about 9, about 10, about 11, about 12, about 13, about 14, about 15, about 16, about 17, about 18, about 19, about 20, about 21, about 22, about 23, about 24, about 25 natural or non-natural nucleic acids in length.
  • each linker is about 21 natural or non-natural nucleic acids in length.
  • the length of each linker according to Formula I is different.
  • the length of a first linker is about 0, about 1, about 2, about 3, about 4, about 5, about 6, about 7, about 8, about 9, about 10, about 11, about 12, about 13, about 14, about 15, about 16, about 17, about 18, about 19, about 20, about 21, about 22, about 23, about 24, about 25 natural or non-natural nucleic acids in length
  • the length of a second linker is about 0, about 1, about 2, about 3, about 4, about 5, about 6, about 7, about 8, about 9, about 10, about 11, about 12, about 13, about 14, about 15, about 16, about 17, about 18, about 19, about 20, about 21, about 22, about 23, about 24, about 25 natural or non-natural nucleic acids in length, where the length of the first linker is different from the length of the second linker.
  • Formula I comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more linkers wherein the linkers are of similar or
  • two linkers can be used together, in a nucleotide sequence that encodes a fusion peptide.
  • the first linker is independently selectable from about 0 to about 25 natural or non-natural nucleic acids in length, about 0 to about 25, about 1 to about 25, about 2 to about 25, about 3 to about 25, about 4 to about 25, about 5 to about 25, about 6 to about 25, about 7 to about 25, about 8 to about 25, about 9 to about 25, about 10 to about 25, about 11 to about 25, about 12 to about 25, about 13 to about 25, about 14 to about 25, about 15 to about 25, about 16 to about 25, about 17 to about 25, about 18 to about 25, about 19 to about 25, about 20 to about 25, about 21 to about 25, about 22 to about 25, about 23 to about 25, about 24 to about 25 natural or non-natural nucleic acids in length.
  • the second linker is independently selectable from about 0 to about 25, about 1 to about 25, about 2 to about 25, about 3 to about 25, about 4 to about 25, about 5 to about 25, about 6 to about 25, about 7 to about 25, about 8 to about 25, about 9 to about 25, about 10 to about 25, about 11 to about 25, about 12 to about 25, about 13 to about 25, about 14 to about 25, about 15 to about 25, about 16 to about 25, about 17 to about 25, about 18 to about 25, about 19 to about 25, about 20 to about 25, about 21 to about 25, about 22 to about 25, about 23 to about 25, about 24 to about 25 natural or non-natural nucleic acids in length.
  • the first linker is independently selectable from a linker that is about 0, about 1, about 2, about 3, about 4, about 5, about 6, about 7, about 8, about 9, about 10, about 11, about 12, about 13, about 14, about 15, about 16, about 17, about 18, about 19, about 20, about 21, about 22, about 23, about 24, about 25 natural or non-natural nucleic acids in length.
  • the second linker is independently selectable from a linker that is about 0, about 1, about 2, about 3, about 4, about 5, about 6, about 7, about 8, about 9, about 10, about 11, about 12, about 13, about 14, about 15, about 16, about 17, about 18, about 19, about 20, about 21, about 22, about 23, about 24, about 25 natural or non-natural nucleic acids in length.
  • antigen expression domain 1 and antigen expression domain 2 comprise a nucleic acid sequence that encodes a particular tumor neoantigen.
  • antigen expression domain 1 encodes a CD4 neoepitope.
  • antigen expression domain 1 encodes a CD8 neoepitope.
  • antigen expression domain 2 encodes a CD4 neoepitope.
  • antigen expression domain 2 encodes a CD8 neoepitope.
  • antigen domain 1 encodes a CD8 neoepitope and antigen expression domain 2 encodes a CD8 neoepitope.
  • a CD4 neoepitope is an epitope that is recognized by CD4+ T cells.
  • a CD8 neoepitope is an epitope that is recognized by CD8+ T cells.
  • the disclosures relates to a nucleic acid sequence comprising a plurality of antigen expression domains encoding at least two neoantigens separated by one or a plurality of linkers.
  • the antigen expression domain encodes an amino acid sequence from about 3 to about 100 amino acids in length.
  • the linker sequence separate each antigen expression domain.
  • the nucleic acid sequence comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more linkers.
  • the nucleic acid sequence comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more linkers, at least one or more are comprise furin linkers.
  • the nucleic acid sequence comprises at least 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more linker domains and the nucleic acid sequence comprises Formula 1(a): (AED 1 )-(linker)-(AED 2 ) -(linker)]schreib
  • each AED is independently selectable from any one or plurality of tumor associated antigens from a subject and wherein n is any positive integer from about 1 to about 50 and wherein each“linker” is a nucleic acid sequence encoding one or a plurality of amino acid cleavage sites.
  • Each linker may be the same or independently selectable to comprise one or a plurality of the linkers disclosed herein.
  • the linker is a furin cleavage site from about 9 to about 105 nucleotides in length and encodes an amino acid sequence that is an amino acid cleavage site.
  • the nucleic acid sequence is a component of a nucleic acid molecule.
  • the composition comprises 1, 2, 3, 4, 5, or more nucleic acid molecules each of which expressing any of the patterns or formulae of AEDs disclosed herein.
  • the disclosures also relates to a nucleic acid sequence comprising a coding region and a non-coding region, the coding region consisting of the Formula 1(b):
  • n is a positive integer from about 1 to about 20, wherein each“linker” encode one or a plurality of amino acid cleavages sequences, and wherein the non-coding region comprises at least one regulatory sequence operably linked to one or more AEDs; and wherein, in the 5’ ot 3’ orientation, AED 3 is the terminal antigen expression domain in a sequence of AEDs.
  • the regulatory is any of the regulatory sequences depicted in the Figures or a functional fragment that comprises at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96% 97%, 98% or 99% homologous to the regulatory sequence depicted in the Figures.
  • the nucleic acid molecule or sequence of the disclosure comprises a plurality of antigen expression domains encoding at least two neoantigens separated by one or a plurality of linkers.
  • the antigen expression domain encodes an amino acid sequence from about 3 to about 100 amino acids in length.
  • the linker sequence separate each antigen expression domain.
  • the nucleic acid sequence comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more linkers. In some embodiments, the nucleic acid sequence comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more linkers, at least one or more are comprise furin linkers. In some embodiments, the nucleic acid sequence comprises at least 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more linker domains and the nucleic acid sequence comprises
  • each AED is independently selectable from any one or plurality of tumor associated antigens from a subject and wherein n is any positive integer from about 1 to about 50 and wherein each“linker” is a nucleic acid sequence encoding one or a plurality of amino acid cleavage sites.
  • Each linker may be the same or independently selectable to comprise one or a plurality of the linkers disclosed herein.
  • the antigen expression domain 1 and/or 2 is independently selectable from about 12 to about 15,000 nucleotides in length, about 50 to about 15,000 nucleotides in length, about 100 to about 15,000 nucleotides in length, about 500 to about 15,000 nucleotides in length, about 1,000 to about 15,000 nucleotides in length, about 5,000 to about 15,000 nucleotides in length, about 10,000 to about 15,000 nucleotides in length.
  • the antigen expression domain 1 is about 12, about 25, about 50, about 75, about 100, about 200, about 300, about 400, about 500, about 600, about 700, about 800, about 900, about 1,000, about 2,000, about 3,000, about 4,000, about 5,000, about 6,000, about 7,000, about 8,000, about 9,000, about 10,000, about 11,000, about 12,000, about 13,000, about 14,000, about 15,000 nucleotides in length.
  • the antigen expression domain 2 is independently selectable from about 12 to about 15,000 nucleotides in length, about 50 to about 15,000 nucleotides in length, about 100 to about 15,000 nucleotides in length, about 500 to about 15,000 nucleotides in length, about 1,000 to about 15,000 nucleotides in length, about 5,000 to about 15,000 nucleotides in length, about 10,000 to about 15,000 nucleotides in length.
  • the antigen expression domain 2 is about 12, about 25, about 50, about 75, about 100, about 200, about 300, about 400, about 500, about 600, about 700, about 800, about 900, about 1,000, about 2,000, about 3,000, about 4,000, about 5,000, about 6,000, about 7,000, about 8,000, about 9,000, about 10,000, about 11,000, about 12,000, about 13,000, about 14,000 about 15,000 nucleotides in length.
  • the antigen expression domain 1 or the antigen expression domain 2 are independently selectable from about 20 to about 2,000 nucleotides in length. In some embodiments, the antigen expression domain 1 is about 20 to about 2,000 nucleotides in length, about 50 to about 2,000 nucleotides in length, about 100 to about 2,000 nucleotides in length, about 500 to about 2,000 nucleotides in length, about 1500 to about 2,000 nucleotides in length.
  • the antigen expression domain 1 is about 20, about 30, about 40, about 50, about 60, about 70, about 80, about 90, about 100, about 200, about 300, about 400, about 500, about 600, about 700, about 800, about 900, about 1000, about 1,100, about 1,200, about 1,300, about 1,400, about 1,500, about 1,600, about 1,700, about 1,800, about 1900, about 2000 nucleotides in length.
  • the antigen expression domain 2 is about 20 to about 2,000 nucleotides in length, about 50 to about 2,000 nucleotides in length, about 100 to about 2,000 nucleotides in length, about 500 to about 2,000 nucleotides in length, about 1500 to about 2,000 nucleotides in length.
  • the antigen expression domain 2 is about 20, about 30, about 40, about 50, about 60, about 70, about 80, about 90, about 100, about 200, about 300, about 400, about 500, about 600, about 700, about 800, about 900, about 1000, about 1,100, about 1,200, about 1,300, about 1,400, about 1,500, about 1,600, about 1,700, about 1,800, about 1900, about 2000 nucleotides in length.
  • the antigen expression domain 1 and/or the antigen expression domain 2 are independently selectable from about 15 to about 150 nucleotides in length, for example about 15 to about 150 nucleotides in length, about 15 to about 125 nucleotides in length, about 15 to about 100, about 15 to about 90 nucleotides in length, about 15 to about 90 nucleotides in length, about 15 to about 80 nucleotides in length, about 15 to about 70
  • nucleotides in length about 15 to about 60 nucleotides in length, about 15 to about 50
  • nucleotides in length about 15 to about 40 nucleotides in length, about 15 to about 30
  • the antigen expression domain 1 and/or antigen expression domain 2 is independently selectable from about 15 to about 100 nucleotides in length, for example about 3 to about 120 nucleotides in length, from about 15 to about 100, from about 15 to about 90 nucleotides in length, about 15 to about 90 nucleotides in length, about 15 to about 80 nucleotides in length, about 15 to about 70 nucleotides in length, about 15 to about 60 nucleotides in length, about 15 to about 50 nucleotides in length, about 15 to about 40
  • nucleotides in length about 15 to about 30 nucleotides in length, about 15 to about 20
  • the antigen expression domain 1 and/or antigen expression domain 2 is independently selectable from about 15 to about 50 nucleotides in length, for example about 15 to about 50 nucleotides in length, about 15 to about 40 nucleotides in length, about 15 to about 30 nucleotides in length, about 15 to about 20 nucleotides in length.
  • n is any positive integer from about 1 to about 500. In some embodiments, n is any positive integer from about 1 to about 500, from about 10 to about 500, from about 50 to about 500, from about 100 to about 500, from about 200 to about 500, from about 300 to about 500, from about 400 to about 500.
  • n is any positive integer of about 1, about 5, about 10, about 15, about 20, about 25, about 30, about 35, about 40, about 45, about 50, about 55, about 60, about 65, about 70, about 75, about 80, about 85, about 90, about 95, about 100, about 105, about 110, about 115, about 120, about 125, about 130, about 135, about 140, about 145, about 150, about 155, about 160, about 165, about 170, about 175, about 180, about 185, about 190, about 195, about 200, about 205, about 210, about 215, about 220, about 225, about 230, about 235, about 240, about 245, about 250, about 255, about 260, about 265, about 270, about 275, about 280, about 285, about 290, about 295, about 300, about 305, about 310, about 315, about 120, about 325, about 330, about 335, about 340, about 345, about 350, about 355, about 360
  • n is a positive integer from about 5 to about 30, from about 5 to about 25, from about 5 to about 20, from about 5 to about 15, from about 5 to about 10.
  • n is a positive integer from about 2 to about 100, from about 2 to about 90, from about 2 to about 80, from about 2 to about 70, from about 2 to about 60, from about 2 to about 50, from about 2 to about 40, from about 2 to about 30, from about 2 to about 20, from about 2 to about 10.
  • n is a positive integer from about 2 to about 58, from about 3 to about 58, from about 4 to about 58, from about 5 to about 58, from about 6 to about 58, from about 7 to about 58, from about 8 to about 58, from about 9 to about 58, from about 10 to about 58, from about 11 to about 58, from about 12 to about 58, from about 13 to about 58, from about
  • n is a positive integer from about 2 to about 29, from about 3 to about 29, from about 4 to about 29, from about 5 to about 29, from about 6 to about 58, from about 7 to about 29, from about 8 to about 29, from about 9 to about 29, from about 10 to about 29, from about 11 to about 29, from about 12 to about 29, from about 13 to about 29, from about 14 to about 29, from about 15 to about 29, from about 16 to about 29, from about 17 to about 29, from about 18 to about 29, from about 19 to about 29, from about 20 to about 29, from about 21 to about 29, from about 22 to about 29, from about 23 to about 29, from about 24 to about 29, from about 25 to about 29, from about 26 to about 29, from about 27 to about 29, from about 28 to about 29.
  • the antigen expression domain 1 or antigen expression domain 2 is independently selectable from about 50 to about 10,000 nucleotides in length, for example about 50 to about 15,000 nucleotides in length, about 100 to about 15,000 nucleotides in length, about 500 to about 15,000 nucleotides in length, about 1,000 to about 15,000 nucleotides in length, about 5,000 to about 15,000 nucleotides in length, about 10,000 to about 15,000 nucleotides in length, and n is any positive integer from about 6 to about 26, for example about 6, about 7, about 8, about 9, about 10, about 11, about 12, about 13, about 14, about 15, about 16, about 17, about 18, about 19, about 20, about 21, about 22, about 23, about 24, about 25, or about 26.
  • a nucleic acid molecule comprises a nucleic acid sequence comprising Formula I ([(AED n )-(linker)] register - [AED n+1 ]), wherein the each linker is independently selectable from about 0 to about 25 natural or non-natural nucleic acids in length.
  • a nucleic acid molecule comprises a nucleic acid sequence comprising Formula I ([(AED n )-(linker)]TON - [AED n+1 ]), wherein the each linker is independently selectable from about 0 to about 25 natural or non-natural nucleic acids in length, about 0 to about 25, about 1 to about 25, about 2 to about 25, about 3 to about 25, about 4 to about 25, about 5 to about 25, about 6 to about 25, about 7 to about 25, about 8 to about 25, about 9 to about 25, about 10 to about 25, about 11 to about 25, about 12 to about 25, about 13 to about 25, about 14 to about 25, about 15 to about 25, about 16 to about 25, about 17 to about 25, about 18 to about 25, about 19 to about 25, about 20 to about 25, about 21 to about 25, about 22 to about 25, about 23 to about 25, about 24 to about 25.
  • each linker is about 0, about 1, about 2, about 3, about 4, about 5, about 6, about 7, about 8, about 9, about 10, about 11, about 12, about 13, about 14, about 15, about 16, about 17, about 18, about 19, about 20, about 21, about 22, about 23, about 24, about 25 natural or non-natural nucleic acids in length. In some embodiments, each linker is about 21 natural or non-natural nucleic acids in length. In certain embodiments, two linkers can be used together, in a fusion.
  • the first linker is independently selectable from about 0 to about 25 natural or non-natural nucleic acids in length, about 0 to about 25, about 1 to about 25, about 2 to about 25, about 3 to about 25, about 4 to about 25, about 5 to about 25, about 6 to about 25, about 7 to about 25, about 8 to about 25, about 9 to about 25, about 10 to about 25, about 11 to about 25, about 12 to about 25, about 13 to about 25, about 14 to about 25, about 15 to about 25, about 16 to about 25, about 17 to about 25, about 18 to about 25, about 19 to about 25, about 20 to about 25, about 21 to about 25, about 22 to about 25, about 23 to about 25, about 24 to about 25 natural or non-natural nucleic acids in length.
  • the second linker is independently selectable from about 0 to about 25, about 1 to about 25, about 2 to about 25, about 3 to about 25, about 4 to about 25, about 5 to about 25, about 6 to about 25, about 7 to about 25, about 8 to about 25, about 9 to about 25, about 10 to about 25, about 11 to about 25, about 12 to about 25, about 13 to about 25, about 14 to about 25, about 15 to about 25, about 16 to about 25, about 17 to about 25, about 18 to about 25, about 19 to about 25, about 20 to about 25, about 21 to about 25, about 22 to about 25, about 23 to about 25, about 24 to about 25 natural or non-natural nucleic acids in length.
  • the first linker is independently selectable from a linker that is about 0, about 1, about 2, about 3, about 4, about 5, about 6, about 7, about 8, about 9, about 10, about 11, about 12, about 13, about 14, about 15, about 16, about 17, about 18, about 19, about 20, about 21, about 22, about 23, about 24, about 25 natural or non-natural nucleic acids in length.
  • the second linker is independently selectable from a linker that is about 0, about 1, about 2, about 3, about 4, about 5, about 6, about 7, about 8, about 9, about 10, about 11, about 12, about 13, about 14, about 15, about 16, about 17, about 18, about 19, about 20, about 21, about 22, about 23, about 24, about 25 natural or non-natural nucleic acids in length.
  • the at least one linker comprises from about 15 to about 300 nucleotides and encodes a n amino acid cleavage site.
  • each linker positioned between each AED is the same nucleotide sequence comprising from about 15 to about 120 nucleotides and encodes an amino acid cleavage site.
  • the formula e.g . [(AED n )-(linker)] register - [AED n+1 ]) comprises at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more linkers.
  • the formula comprises at least a first linker and a second linker.
  • the formula comprises at least a first linker, a second linker, and a third linker.
  • the formula comprises at least a first linker, a second linker, a third linker, and a fourth linker.
  • the formula comprises at least a first linker, a second linker, a third linker, a fourth linker, and a fifth linker.
  • the at least one linker comprises a furin protease cleavage site.
  • Furin is a protease which resides in the trans-Golgi network of eukaryotic cells. Its function is to cleave proteins at a step just prior to their delivery to their final cellular destination. Furin recognizes a consensus amino acid sequence, RXRR, RXRK or KXKR (where X is any amino acid, Moehring et ak, 1993, incorporated by reference in its entirety herein) and cuts proteins which contain these sequences when they reach the trans-Golgi network. Furin is a consensus amino acid sequence, RXRR, RXRK or KXKR (where X is any amino acid, Moehring et ak, 1993, incorporated by reference in its entirety herein) and cuts proteins which contain these sequences when they reach the trans-Golgi network. Furin is a consensus amino acid sequence, RXRR, RXRK or KXKR (where X is any amino acid, Moehring et ak, 1993, incorporated by reference in its entirety herein
  • the one or plurality of nucleic acid molecules encode a furin- sensitive cleavage site selected from the sequence R-X- [R/K] -R, where R denotes arginine, X is any amino acid, and K is lysine.
  • R/K indicates that this amino acid may be either arginine or lysine.
  • a furin cleavage site is introduced after the antigen domain 1 and/or the antigen domain 2 (e.g. [(AED n )-(linker)] register - [AED n+1 ]).
  • the at least one linker comprises from about 15 to about 300 nucleotides and encodes a cleavage site, wherein the at least one linker comprises a 2A cleavage site. In some embodiments, the at least one linker comprises from about 15 to about 300 nucleotides and encodes a cleavage site, wherein the at least one linker comprises a porcine teschovirus-l 2 A (P2A) cleavage site.
  • P2A porcine teschovirus-l 2 A
  • a 2A peptide is a“self-cleaving” small peptide.
  • the average length of 2A peptides is 18-22 amino acids.
  • the designation“2A” refers to a specific region of picornavirus polyproteins.
  • FMDV 2A abbreviated herein as F2A
  • E2A equine rhinitis A virus
  • P2A porcine teschovirus-l 2A
  • T2A Thoseaasigna virus 2A
  • the former three viruses belong to picornaviruses and the latter is an insect virus.
  • DNA and corresponding amino acid sequences of various 2A peptides are shown below in Table 2.
  • P2A indicates porcine teschovirus-l 2 A; T2A, Thoseaasigna virus 2A; E2A, equine rhinitis A virus (ERAV) 2A; F2A, FMDV 2A.
  • the formula comprises at least a first linker and a second linker, wherein the first and second linker comprise a furin protease cleavage site.
  • the formula comprises at least a first linker, a second linker, and a third linker, wherein the first, second and third linker comprise a furin protease cleavage site.
  • the formula comprises at least a first linker, a second linker, a third linker, and a fourth linker, wherein the first, second, third and fourth linker comprise a furin protease cleavage site.
  • the formula comprises at least a first linker, a second linker, a third linker, a fourth linker, and a fifth linker, wherein the first, second, third, fourth and fifth linker comprise a furin protease cleavage site.
  • the formula comprises at least a first linker, a second linker, a third linker, a fourth linker, and a fifth linker, wherein the first, second, third, fourth and fifth linker comprise a furin protease cleavage site.
  • the formula comprises at least a first linker and a second linker, wherein the first and second linker comprise a P2A protease cleavage site. In some embodiments, the formula comprises at least a first linker, a second linker, and a third linker, wherein the first, second and third linker comprise a P2A cleavage site.
  • the formula comprises at least a first linker, a second linker, a third linker, and a fourth linker, wherein the first, second, third and fourth linker comprise a P2A cleavage site.
  • the formula comprises at least a first linker, a second linker, a third linker, a fourth linker, and a fifth linker, wherein the first, second, third, fourth and fifth linker comprise a P2A cleavage site.
  • the formula comprises at least a first linker, a second linker, a third linker, a fourth linker, a fifth linker, or more wherein the first, second, third, fourth, fifth linker, or more linkers comprise a P2A protease cleavage site.
  • the formula comprises at least a first linker and a second linker, wherein at least one of the first or second linkers comprise a furin protease cleavage site.
  • the formula comprises at least a first linker, a second linker, and a third linker, wherein at least one of the first, second or third linkers comprise a furin protease cleavage site.
  • the formula comprises at least a first linker, a second linker, a third linker, and a fourth linker, at least one of the first, second, third or fourth linkers comprise a furin protease cleavage site.
  • the formula comprises at least a first linker, a second linker, a third linker, a fourth linker, and a fifth linker, at least one of the first, second, third, fourth or fifth linkers comprise a furin protease cleavage site.
  • the formula comprises at least a first linker and a second linker, wherein at least one of the first or second linkers comprise a P2A protease cleavage site.
  • the formula comprises at least a first linker, a second linker, and a third linker, wherein at least one of the first, second or third linkers comprise a P2A protease cleavage site. In some embodiments, the formula comprises at least a first linker, a second linker, a third linker, and a fourth linker, at least one of the first, second, third or fourth linkers comprise a P2A protease cleavage site.
  • the formula comprises at least a first linker, a second linker, a third linker, a fourth linker, and a fifth linker, at least one of the first, second, third, fourth or fifth linkers comprise a P2A protease cleavage site.
  • Nucleic acid molecules useful in the methods of the invention include any nucleic acid molecule that encodes a neoantigen, or a fragment thereof; any nucleic acid that encodes a linker, any nucleic acid that encodes a regulatory sequence, any nucleic acid that encodes a leader sequence. Such nucleic acid molecules need not be 100% identical with an endogenous nucleic acid sequence, but will typically exhibit substantial identity. Polynucleotides having“substantial identity” to an endogenous sequence are typically capable of hybridizing with at least one strand of a double-stranded nucleic acid molecule.
  • nucleic acid seqeunce or molecules of the disclosure relate to nucleic acid sequences comprising a nucleic acid sequence at least about 70%, 80%, 85%, 90% ,95%, 96%, 97%, 98% 99% or
  • nucleic acid seqeunce or molecules of the disclosure relate to nucleic acid sequences comprising a nucleic acid sequence with at least about 70%, 80%, 85%, 90% ,95%, 96%, 97%, 98% 99% or 100% sequence identity to SEQ ID NO:68, the seqeunce of FIG. 2A, 2C, 2E, 3 A, 3C, 4A or FIG 4C, and comprise Formula 1, 1(a), or 11(a) within their multiple cloning site.
  • the nucleic acid seqeunce or molecules of the disclosure relate to nucleic acid sequences comprising a nucleic acid sequence encoding an amino acid sequence encoded by a nucleic acid sequence with at least about 70%, 80%, 85%, 90% ,95%, 96%, 97%, 98% 99% or 100% sequence identity to SEQ ID NO:68, the seqeunce of FIG. 2A, 2C, 2E, 3 A, 3C, 4A or FIG 4C.
  • the diclsoure relates to a nucleic acid molecule that is pVax or with at least about 70%, 80%, 85%, 90% ,95%, 96%, 97%, 98% 99% or 100% sequence identity to SEQ ID NO:68.
  • the diclsoure relates to a nucleic acid molecule that is pVax or with at least about 70%, 80%, 85%, 90% ,95%, 96%, 97%, 98% 99% or 100% sequence identity to SEQ ID NO:68 comprising a coding seqeunce comprising any one or plurality of nucleic acid sequences with at least about 70%, 80%, 85%, 90% ,95%, 96%, 97%, 98% 99% or 100% sequence identity to SEQ ID Nos: 1-40.
  • the diclsoure relates to a nucleic acid molecule that is pVax or with at least about 70%, 80%, 85%, 90% ,95%, 96%, 97%, 98% 99% or 100% sequence identity to SEQ ID NO:68 comprising a coding seqeunce comprising any one or plurality of nucliecacid sequences with at least about 70%, 80%, 85%, 90% ,95%, 96%, 97%, 98% 99% or 100% sequence identity to SEQ ID Nos: 1-40, and, optionally, one or plurality of nucleic acid sequences encoding one or a plurality of amino acid sequences with at least about 70%, 80%, 85%, 90% ,95%, 96%, 97%, 98% 99% or 100% sequence identity to SEQ ID NO:6l - 66.
  • an exemplary leader sequence is an IgE leader amino acid sequence as set forth in the sequence below and described in US20160175427, incorporated by reference in its entirety herein.
  • the nucleic acid comprises a coding region consisting of any of
  • the leader sequence is an IgE leader sequence: Met Asp Trp Thr Trp He Leu Phe Leu Val Ala Ala Ala Thr Arg Val (SEQ ID NO:69) or a leader sequence that is a functional fragment thereof comprising at least about 70%, 80%, 85%, 90% , 95%, 96%, 97%, 98% or 99% homologous to the IgE leader sequence identified in the aforementioned sentence.
  • nucleic acid seqeunce or molecules of the disclosure relate to nucleic acid sequences comprising a leader with at least about 70%, 80%, 85%, 90% ,95%, 96%, 97%, 98% 99% or 100% sequence identity to SEQ ID NO:69.
  • stringent salt concentration will ordinarily be less than about 750 mM NaCl and 75 mM trisodium citrate, preferably less than about 500 mM NaCl and 50 mM trisodium citrate, and more preferably less than about 250 mM NaCl and 25 mM trisodium citrate.
  • Low stringency hybridization can be obtained in the absence of organic solvent, e.g., formamide, while high stringency hybridization can be obtained in the presence of at least about 35% formamide, and more preferably at least about 50% formamide.
  • Stringent temperature conditions will ordinarily include temperatures of at least about 30° C., more preferably of at least about 37° C., and most preferably of at least about 42° C.
  • Varying additional parameters, such as hybridization time, the concentration of detergent, e.g., sodium dodecyl sulfate (SDS), and the inclusion or exclusion of carrier DNA, are well known to those skilled in the art.
  • concentration of detergent e.g., sodium dodecyl sulfate (SDS)
  • SDS sodium dodecyl sulfate
  • Various levels of stringency are accomplished by combining these various conditions as needed.
  • hybridization will occur at 30° C. in 750 mM NaCl, 75 mM trisodium citrate, and 1% SDS.
  • hybridization will occur at 37° C. in 500 mM NaCl, 50 mM trisodium citrate, 1% SDS, 35% formamide, and 100 pg/ml denatured salmon sperm DNA (ssDNA).
  • hybridization will occur at 42° C. in 250 mM NaCl, 25 mM trisodium citrate, 1% SDS, 50% formamide, and 200 pg/ml ssDNA. Useful variations on these conditions will be readily apparent to those skilled in the art.
  • wash stringency conditions can be defined by salt concentration and by temperature. As above, wash stringency can be increased by decreasing salt concentration or by increasing temperature.
  • stringent salt concentration for the wash steps will preferably be less than about 30 mM NaCl and 3 mM trisodium citrate, and most preferably less than about 15 mM NaCl and 1.5 mM trisodium citrate.
  • Stringent temperature conditions for the wash steps will ordinarily include a temperature of at least about 25° C., more preferably of at least about 42° C., and even more preferably of at least about 68° C. In a preferred embodiment, wash steps will occur at 25° C.
  • wash steps will occur at 42° C. in 15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS. In a more preferred embodiment, wash steps will occur at 68° C. in 15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS. Additional variations on these conditions will be readily apparent to those skilled in the art. Hybridization techniques are well known to those skilled in the art and are described, for example, in Benton and Davis (Science 196: 180, 1977); Grunstein and Hogness (Proc. Natl. Acad.
  • nucleic acid sequences may be used in association with other polynucleotide sequences coding for regulatory proteins that control the expression of the neo antigen sequence.
  • nucleic acid molecule according to the invention may additionally contain recognition, regulatory, leader and and promoter sequences.
  • the nucleic acid molecule further comprises at least one regulatory sequence, wherein at least one nucleic acid sequence of Formula I is operably linked to the regulatory sequence.
  • the nucleic acid molecule further comprises a leader sequence.
  • an exemplary leader sequence is an IgE leader amino acid sequence as described in US20160175427, incorporated by reference in its entirety herein.
  • the nucleic acid molecule comprises a nucleic acid sequence comprising Formula I ([(AED n )-(linker)]TON - [AED n+1 ]), wherein the antigen expression domain 1 is independently selectable from about 12 to about 15,000 nucleotides in length and encodes an epitope from one or a plurality of cancer cells from a subject; and the antigen expression domain 2 is independently selectable from about 12 to about 15,000 nucleotides in length and encodes an epitope from one or a plurality of cancer cells from the subject.
  • the nucleic acid molecule comprising a nucleic acid sequence comprising Formula I is in an amount sufficient to elicit a cellular immune response.
  • a "cellular immune response” is meant to include a cellular response directed to cells characterized by presentation of an antigen with class I or class II MHC. The cellular response relates to cells called T cells or T-lymphocytes which act as either“helpers” or “killers”.
  • the helper T cells (also termed CD4 + T cells) play a central role by regulating the immune response and the killer cells (also termed cytotoxic T cells, cytolytic T cells, CD8 + T cells or CTLs) kill diseased cells such as cancer cells, preventing the production of more diseased cells.
  • the present invention involves the stimulation of an anti-tumor CTL response against tumor cells expressing one or more tumor expressed antigens and preferably presenting such tumor expressed antigens with class I MHC.
  • the nucleic acid molecule comprising a nucleic acid sequence comprising Formula I ([(AED n )-(linker)] canal - [AED n+1 ]) is in an amount sufficient to elicit a CD8+ T cell response against any one or plurality of amino acid sequences encoded by one or plurality of antigen expression domains. In some embodiments, the nucleic acid molecule comprising a nucleic acid sequence comprising Formula I ([(AED n ) - [AED n+1 ]) is in an amount sufficient to elicit a CD8+ T and/or CD4+ T cell response against any one or plurality of amino acid sequences encoded by one or plurality of antigen expression domains.
  • the nucleic acid molecule comprising a nucleic acid sequence comprising Formula I is in an amount sufficient to elicit a CD4+ T cell response against any one or plurality of amino acid sequences encoded by one or plurality of antigen expression domains.
  • the nucleic acid molecule comprising a nucleic acid sequence comprising Formula I is in an amount sufficient to elicit a subpopulation of T cells that are greater than at least about 40% CD4+ T cells in response against any one or plurality of amino acid sequences encoded by one or plurality of antigen expression domains as compared to the response generated without the nucleic acid sequences disclosed herein.
  • the nucleic acid molecule comprising a nucleic acid sequence comprising Formula I is in an amount sufficient to elicit a subpopulation of T cells that are greater than at least about 40% CD8+ T cells in response against any one or plurality of amino acid sequences encoded by one or plurality of antigen expression domains as compared to the response generated without the nucleic acid sequences disclosed herein.
  • the nucleic acid molecule comprising a nucleic acid sequence comprising Formula I is in an amount sufficient to elicit a subpopulation of T cells that comprise greater than at least about 40% CD4+ T cells and that comprise greater than 40% CD8+ T cells in response against any one or plurality of amino acid sequences encoded by one or plurality of antigen expression domains as compared to the response generated without the nucleic acid sequences disclosed herein.
  • the nucleic acid molecule described in any of the aspects and embodiments herein is a plasmid.
  • an expression vector comprises the nucleic acid molecule described in any of the aspects and embodiments .
  • the nucleic acid expression vector is a plasmid.
  • the vector can be capable of expressing one or a plurality of consensus neoantigen sequences in the cell of a mammal in a quantity effective to elicit an immune response in the mammal.
  • the vector can be recombinant.
  • the vector can comprise heterologous nucleic acid encoding the neoantigen.
  • the vector can be a plasmid.
  • the vector can be useful for transfecting cells with nucleic acid encoding a neoantigen, which the transformed host cell is cultured and maintained under conditions wherein expression of the neoantigen takes place.
  • the vector is capable of expressing one or a plurality of neoantigen sequences in the cell of a mammal in a quantity effective to elicit an immune response in the mammal.
  • a cell comprising the nucleic acid molecule is capable of expressing one or a plurality of consensus neoantigen sequences in the cell of a mammal in a quantity effective to elicit an immune response in the mammal that shrinks a tumor by more than about 5, 10, 15, 20, 30, 40, 50, 60, 70 or more percent.
  • a cell comprising the nucleic acid molecule is capable of expressing one or a plurality of neoantigen amino acid sequences in the cell of a mammal in a quantity effective to elicit an clonal expansion of CD8+ T cells from about 0.1 to about 50% of the total T cell stimulation against the one or plurality of neoantigens.
  • the vector can comprise heterologous nucleic acid encoding a neoantigen and can further comprise an initiation codon, which can be upstream of the neoantigen coding sequence, and a stop codon, which can be downstream of the neoantigen coding sequence.
  • the initiation and termination codon can be in frame with the neoantigen coding sequence.
  • the vector can also comprise a promoter that is operably linked to the neoantigen coding sequence.
  • the promoter operably linked to the neoantigen coding sequence can be a promoter from simian virus 40
  • SV40 mouse mammary tumor virus
  • MMTV mouse mammary tumor virus
  • HAV human immunodeficiency virus
  • BIV bovine immunodeficiency virus
  • LTR long terminal repeat
  • Moloney virus promoter an avian leukosis virus (ALV) promoter
  • AMV avian leukosis virus
  • CMV cytomegalovirus
  • ESV Epstein Ban- virus
  • RSV Rous sarcoma virus
  • the promoter can also be a promoter from a human gene such as human actin, human myosin, human hemoglobin, human muscle creatine, or human metalothionein.
  • the promoter can also be a tissue specific promoter, such as a muscle or skin specific promoter, natural or synthetic. Examples of such promoters are described in ETS patent application publication no. ETS20040175727, the contents of which are incorporated herein in its entirety.
  • the vector can also comprise a polyadenylation signal, which can be downstream of the HA coding sequence.
  • the polyadenylation signal can be a SV40 polyadenylation signal, LTR polyadenylation signal, bovine growth hormone (bGH) polyadenylation signal, human growth hormone (hGH) polyadenylation signal, or human .beta.-globin polyadenylation signal.
  • the SV40 polyadenylation signal can be a polyadenylation signal from a pCEP4 vector (Invitrogen, San Diego, Calif.).
  • the vector can also comprise an enhancer upstream of the neoantigen coding.
  • the enhancer can be necessary for DNA expression.
  • the enhancer can be human actin, human myosin, human hemoglobin, human muscle creatine or a viral enhancer such as one from CMV, HA, RSV or EBV.
  • Polynucleotide function enhances are described in ET.S. Pat. Nos. 5,593,972, 5,962,428, and WO94/016737, the contents of each are fully incorporated by reference.
  • the vector can also comprise a mammalian origin of replication in order to maintain the vector extrachromosomally and produce multiple copies of the vector in a cell.
  • the vector can be LLC, TC1, ID8, pGX450l, pGX4503, pGX 4504, pGX4505, and/or pGX4506 or any one or more regulatory or non-coding sequences of LLC, TC1, ID8, pGX450l, pGX4503, pGX 4504, pGX4505, and/or pGX4506.
  • the vector comprises the sequence that is pVAXl.
  • the backbone of the vector can be pAV0242.
  • the vector can be a replication defective adenovirus type 5 (Ad5) vector.
  • the vector can also comprise a regulatory sequence, which can be well suited for gene expression in a mammalian or human cell into which the vector is administered.
  • the neoantigen coding sequence can comprise a codon, which can allow more efficient transcription of the coding sequence in the host cell.
  • the vector can be pSE420 (Invitrogen, San Diego, Calif.), which can be used for protein production in Escherichia coli (E. coli).
  • the vector can also be pYES2 (Invitrogen, San Diego, Calif.), which can be used for protein production in Saccharomyces cerevisiae strains of yeast.
  • the vector can also be of the MAXBAC.TM. complete baculovirus expression system
  • the vector can also be pcDNA I or pcDNA3 (Invitrogen, San Diego, Calif.), which can be used for protein production in mammalian cells such as Chinese hamster ovary (CHO) cells.
  • the vector can be expression vectors or systems to produce protein by routine techniques and readily available starting materials including Sambrook et al., Molecular Cloning: A Laboratory Manual, Second Ed., Cold Spring Harbor (1989), which is incorporated fully by reference.
  • Expression vectors for different cell types are well known in the art and can be selected without undue experimentation.
  • the DNA is inserted into an expression vector, such as a plasmid, in proper orientation and correct reading frame for expression.
  • the DNA may be linked to the appropriate transcriptional and translational regulatory control nucleotide sequences recognized by the desired host (e.g., bacteria), although such controls are generally available in the expression vector.
  • the vector is then introduced into the host bacteria for cloning using standard techniques (see, e.g., Sambrook et al. (1989) Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory, Cold Spring Harbor, N. Y.).
  • the nucleic acid sequence of Formula I is positioned with the multiple cloning site of a plasmid selected from the group consisting of LLC, TC1, ID8, pGX450l, pGX4503, pGX4504, pGX4505, and pGX4506. In some embodiments, the nucleic acid sequence of Formula I is positioned with the multiple cloning site of LLC. In some embodiments, the nucleic acid sequence of Formula I is positioned with the multiple cloning site of TC1. In some embodiments, the nucleic acid sequence of Formula I is positioned with the multiple cloning site of ID8.
  • the nucleic acid sequence of Formula I is positioned with the multiple cloning site of pGX450l. In some embodiments, the nucleic acid sequence of Formula I is positioned with the multiple cloning site of pGX4503. In some embodiments, the nucleic acid sequence of Formula I is positioned with the multiple cloning site of pGX4504. In some embodiments, the nucleic acid sequence of Formula I is positioned within the multiple cloning site of pGX4505. In some embodiments, the nucleic acid sequence of Formula I is positioned with the multiple cloning site of pGX4506. In preferred embodiments, the plasmid is pGX4505 or a sequence that is 70%, 80% , 90%, 91%, 92%, 93%, 94%, 95%,
  • a host cell is transformed with the plasmids described herein.
  • the invention also provides that the one or more neo-antigenic peptides of the invention may be encoded by a single expression vector.
  • the invention also provides that the one or more neo-antigenic peptides of the invention may be encoded and expressed in vivo using a viral based system (e.g., an adenovirus system).
  • polynucleotide encoding a polypeptide encompasses a polynucleotide which includes only coding sequences for the polypeptide as well as a polynucleotide which includes additional coding and/or non-coding sequences.
  • the polynucleotides of the invention can be in the form of RNA or in the form of DNA.
  • DNA includes cDNA, genomic DNA, and synthetic DNA; and can be double-stranded or single-stranded, and if single stranded can be the coding strand or non-coding (anti-sense) strand.
  • the polynucleotides may comprise the coding sequence for the tumor specific neo-antigenic peptide fused in the same reading frame to a polynucleotide which aids, for example, in expression and/or secretion of a polypeptide from a host cell (e.g., a leader sequence which functions as a secretory sequence for controlling transport of a polypeptide from the cell).
  • a polypeptide having a leader sequence is a preprotein and can have the leader sequence cleaved by the host cell to form the mature form of the polypeptide.
  • the polynucleotides can comprise the coding sequence for the tumor specific neo-antigenic peptide fused in the same reading frame to a marker sequence that allows, for example, for purification of the encoded polypeptide, which may then be incorporated into the personalized neoplasia vaccine.
  • the marker sequence can be a hexa- histidine tag supplied by a pQE-9 vector to provide for purification of the mature polypeptide fused to the marker in the case of a bacterial host, or the marker sequence can be a hemagglutinin (HA) tag derived from the influenza hemagglutinin protein when a mammalian host (e.g., COS-7 cells) is used.
  • Additional tags include, but are not limited to, Calmodulin tags, FLAG tags, Myc tags, S tags, SBP tags, Softag 1, Softag 3, V5 tag, Xpress tag, Isopeptag, SpyTag, Biotin
  • BCCP Carboxyl Carrier Protein
  • GST tags GST tags
  • fluorescent protein tags e.g., green fluorescent protein tags
  • maltose binding protein tags Nus tags, Strep-tag, thioredoxin tag, TC tag, Ty tag, and the like.
  • the polynucleotides may comprise the coding sequence for one or more of the tumor specific neo-antigenic peptides fused in the same reading frame to create a single concatamerized neo-antigenic peptide construct capable of producing multiple neo-antigenic peptides.
  • the present invention provides isolated nucleic acid molecules having a nucleotide sequence at least 60% identical, at least 65% identical, at least 70% identical, at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, or at least 96%, 97%, 98% or 99% identical to a polynucleotide encoding a tumor specific neo-antigenic peptide of the present invention.
  • polynucleotide having a nucleotide sequence at least, for example, 95%“identical” to a reference nucleotide sequence is intended that the nucleotide sequence of the polynucleotide is identical to the reference sequence except that the polynucleotide sequence can include up to five point mutations per each 100 nucleotides of the reference nucleotide sequence.
  • a polynucleotide having a nucleotide sequence at least 95% identical to a reference nucleotide sequence up to 5% of the nucleotides in the reference sequence can be deleted or substituted with another nucleotide, or a number of nucleotides up to 5% of the total nucleotides in the reference sequence can be inserted into the reference sequence.
  • These mutations of the reference sequence can occur at the amino- or carboxy-terminal positions of the reference nucleotide sequence or anywhere between those terminal positions, interspersed either individually among nucleotides in the reference sequence or in one or more contiguous groups within the reference sequence.
  • nucleic acid molecule is at least 80% identical, at least 85% identical, at least 90% identical, and in some embodiments, at least 95%, 96%, 97%, 98%, or 99% identical to a reference sequence can be determined conventionally using known computer programs such as the Bestfit program (Wisconsin Sequence Analysis Package, Version 8 for Unix, Genetics Computer Group, University Research Park, 575 Science Drive, Madison, Wis. 53711). Bestfit uses the local homology algorithm of Smith and Waterman, Advances in Applied Mathematics 2:482-489 (1981), to find the best segment of homology between two sequences.
  • the parameters are set such that the percentage of identity is calculated over the full length of the reference nucleotide sequence and that gaps in homology of up to 5% of the total number of nucleotides in the reference sequence are allowed.
  • the present disclosure also includes a composition comprising one or a plurality of nucleic acid molecules described herein.
  • nucleic acid molecules as vehicles for delivering neo-antigens to the subject in vivo in the form of, e.g., DNA/RNA vaccines (see, e.g., WO2012/159643, and WO2012/159754, hereby incorporated by reference in their entirety).
  • the personalized neoplasia vaccine may include separate DNA plasmids encoding, for example, one or more neo-antigenic peptides/polypeptides as identified in according to the invention.
  • the exact choice of expression vectors will depend upon the peptide/polypeptides to be expressed, and is well within the skill of the ordinary artisan.
  • the expected persistence of the DNA constructs is expected to provide an increased duration of protection.
  • the composition comprises the a first, second or third nucleic acid molecule, wherein at least the first nucleic acid molecule encodes one or more neoantigens.
  • the second nucleic acid molecule comprises one or more neoantigens.
  • the second nucleic acid molecule comprising a nucleic acid sequence that encodes one or more adjuvants.
  • the personalized neoplasia vaccine may include separate RNA or cDNA molecules encoding neo-antigenic peptides/polypeptides of the invention.
  • the personalized neoplasia vaccine may include a viral based vector for use in a human patient such as, for example, and adenovirus system (see, e.g., Baden et al. First-in-human evaluation of the safety and immunogenicity of a recombinant adenovirus serotype 26 HIV-l Env vaccine (IPCAVD 001). J Infect Dis. 2013 Jan. 15; 207(2):240-7, hereby incorporated by reference in its entirety).
  • a viral based vector for use in a human patient
  • adenovirus system see, e.g., Baden et al. First-in-human evaluation of the safety and immunogenicity of a recombinant adenovirus serotype 26 HIV-l Env vaccine (IPCAVD 001). J Infect Dis. 2013 Jan. 15; 207(2):240-7, hereby incorporated by reference in its entirety).
  • a population of neoplasia/tumor specific neoantigens may be identified by sequencing the neoplasia/tumor and normal DNA of each patient to identify tumor-specific mutations, and determining the patient's HLA allotype.
  • the population of neoplasia/tumor specific neo-antigens and their cognate native antigens may be subject to bioinformatic analysis using validated algorithms to predict which tumor-specific mutations create epitopes that could bind to the patient's HLA allotype, and in particular which tumor- specific mutations create epitopes that could bind to the patient's HLA allotype more effectively than the cognate native antigen. Based on this analysis, identified nucleotide sequences corresponding to these mutations may be designed for each patient, and used together for use as a cancer vaccine in immunizing the subject.
  • the disclosure features a method of identifying one or more subject-specific neoantigen mutations in a subject, wherein the subject has been diagnosed with, suspected of having or comprises one or more hyperproliferative cells (e.g. such as a tumor). In some embodiments, the disclosure features a method of identifying one or more subject-specific neoantigen mutations in a subject, wherein the subject has been diagnosed with, suspected of having or comprises one or more hyperproliferative cells (e.g.
  • the method comprising sequencing a nucleic acid sample from a tumor of the subject and of a non-tumor sample of the subject; analyzing the sequence to determine coding and non-coding regions; identifying sequences comprising tumor- specific non-synonymous or non-silent mutations not present in the non-tumor sample;
  • each subject-specific peptide is an expression product of subject-specific DNA neoantigen not present in the non-tumor sample, thereby identifying one or more subject-specific DNA neoantigens in a subject.
  • measuring the binding characteristics of the of the subject-specific peptides is carried out by one or more of measuring the binding of the subject-specific peptides to T-cell receptor; measuring the binding of the subject-specific peptides to a HLA protein of the subject; or measuring the binding of the subject-specific peptides to transporter associated with antigen processing (TAP).
  • measuring the binding of the subject-specific peptides to T-cell receptor comprises measuring the binding of the subject-specific peptides to a HLA protein of the subject or sample.
  • the subject-specific peptides bind to HLA proteins of the subject with an IC50 of less than about 550 nM. In some embodiments, the subject-specific peptides bind to HLA proteins of the subject with an IC50 of less than about 500 nM. In some embodiments, the subject-specific peptides bind to HLA proteins of the subject with an IC50 of less than about 450 nM. In some embodiments, the subject-specific peptides bind to HLA proteins of the subject with an IC50 of less than about 400 nM. In some embodiments, the subject-specific peptides bind to HLA proteins of the subject with an IC50 of less than about 350 nM.
  • the subject-specific peptides bind to HLA proteins of the subject with an IC50 of less than about 300 nM.
  • the method of identifying one or more subject-specific DNA neoantigen mutations in a subject further comprises the step of ranking the subject-specific peptides based on the binding characteristics.
  • the method of identifying one or more subject-specific DNA neoantigen mutations in a subject further comprises the step of measuring the CD8+ T cell immune response generated by the subject-specific peptides.
  • Methods of measuring the CD8+ T cell response are known in the art and described herein.
  • the method of identifying one or more subject-specific DNA neoantigen mutations in a subject further comprises formulating the subject-specific DNA neoantigens into a immunogenic composition for administration to the subject.
  • the top 200 ranked neo-antigen mutations are included or subcloned into the immunogenic composition, which in some embodiments, is one or a plurality of plasmids.
  • the top 150 ranked neo-antigen mutations are included in the immunogenic composition.
  • the top 100 ranked neo-antigen mutations are included in the immunogenic composition.
  • the top 50 ranked neo-antigen mutations are included in the immunogenic composition.
  • the top 25 ranked neo-antigen mutations are included in the immunogenic composition.
  • the top 10 ranked neo-antigen mutations are included in the immunogenic composition.
  • the top 5 ranked neo-antigen mutations are included in the immunogenic composition.
  • the top 5-20 ranked noe-antigen mutations are included in the immunogenic composition.
  • the top 10-50 ranked neo-antigen mutations are included in the immunogenic composition.
  • the top 25-100 ranked neo-antigen mutations are included in the immunogenic composition.
  • the top 50-100 ranked neo-antigen mutations are included in the immunogenic composition.
  • the top 100-200 ranked neo-antigen mutations are included in the immunogenic composition.
  • the method of identifying one or more subject-specific DNA neoantigen mutations in a subject further comprises providing a culture comprising dendritic cells (DCs) obtained from the subject; and contacting the dendritic cells with the immunogenic composition.
  • DCs are potent antigen-presenting cells that initiate T cell immunity and can be used as cancer vaccines when loaded with one or more neoantigens of interest.
  • the method further comprises administering to the subject the dendritic cells;
  • CD8+ T cells from a peripheral blood sample from the subject, wherein the CD8+ cells recognize the at least one neoantigen; and expanding the population of CD8+ T cells that recognizes the neoantigen.
  • the expanded population of CD8+ T cells is administered to the subject.
  • any suitable sequencing-by-synthesis platform can be used to identify mutations.
  • sequencing-by-synthesis platforms are currently available: the Genome Sequencers from Roche/454 Life Sciences, the HiSeq Analyzer from Illumina/Solexa, the SOLiD system from Applied BioSystems, and the Heliscope system from Helicos Biosciences. Sequencing-by-synthesis platforms have also been described by Pacific Biosciences and VisiGen Biotechnologies. Each of these platforms can be used in the methods of the invention.
  • a plurality of nucleic acid molecules being sequenced is bound to a support (e.g., solid support).
  • a capture sequence/universal priming site can be added at the 3' and/or 5' end of the template.
  • the nucleic acids may be bound to the support by hybridizing the capture sequence to a complementary sequence covalently attached to the support.
  • the capture sequence (also referred to as a universal capture sequence) is a nucleic acid sequence complementary to a sequence attached to a support that may dually serve as a universal primer.
  • a member of a coupling pair (such as, e.g., antibody/antigen, receptor/ligand, or the avidin-biotin pair as described in, e.g., U.S. Patent Application No. 2006/0252077) may be linked to each fragment to be captured on a surface coated with a respective second member of that coupling pair.
  • the sequence may be analyzed, for example, by single molecule detection/sequencing, e.g., as described in the Examples and in LT.S. Pat. No. 7,283,337, including template-dependent sequencing-by-synthesis.
  • the surface-bound molecule is exposed to a plurality of labeled nucleotide triphosphates in the presence of polymerase.
  • the sequence of the template is determined by the order of labeled nucleotides incorporated into the 3' end of the growing chain. This can be done in real time or in a step-and-repeat mode. For real-time analysis, different optical labels to each nucleotide may be incorporated and multiple lasers may be utilized for stimulation of incorporated nucleotides.
  • the DNA or RNA sample is obtained from a neoplasia, a tumor or a bodily fluid, e.g., blood, obtained by known techniques (e.g. venipuncture) or saliva.
  • nucleic acid tests can be performed on dry samples
  • DASH dynamic allele-specific hybridization
  • MADGE microplate array diagonal gel electrophoresis
  • pyrosequencing oligonucleotide-specific ligation
  • TaqMan the TaqMan system
  • DNA“chip” technologies such as the Affymetrix SNP chips.
  • PCR based detection means may include multiplex amplification of a plurality of markers simultaneously. For example, it is well known in the art to select PCR primers to generate PCR products that do not overlap in size and can be analyzed simultaneously.
  • hybridization based detection means allow the differential detection of multiple PCR products in a sample.
  • Other techniques are known in the art to allow multiplex analyses of a plurality of markers.
  • the single base polymorphism can be detected by using a specialized exonuclease-resistant nucleotide, as disclosed, e.g., U.S. Pat. No. 4,656,127.
  • a primer complementary to the allelic sequence immediately 3' to the polymorphic site is permitted to hybridize to a target molecule obtained from a particular animal or human. If the polymorphic site on the target molecule contains a nucleotide that is complementary to the particular exonuclease-resistant nucleotide derivative present, then that derivative will be incorporated onto the end of the hybridized primer.
  • a solution-based method is used for determining the identity of the nucleotide of a polymorphic site.
  • Cohen et al. (French Patent No. 2,650,840; PCT Application No. W01991/02087).
  • a primer may be employed that is complementary to allelic sequences immediately 3' to a polymorphic site. The method determines the identity of the nucleotide of that site using labeled
  • dideoxynucleotide derivatives which, if complementary to the nucleotide of the polymorphic site, will become incorporated onto the terminus of the primer.
  • GBA Genetic Bit Analysis
  • PCT Application No. W01992/15712 An alternative method, known as Genetic Bit Analysis or GBA is described in PCT Application No. W01992/15712).
  • GBA uses mixtures of labeled terminators and a primer that is complementary to the sequence 3' to a polymorphic site.
  • the labeled terminator that is incorporated is thus determined by, and complementary to, the nucleotide present in the polymorphic site of the target molecule being evaluated.
  • the GBA method is preferably a heterogeneous phase assay, in which the primer or the target molecule is immobilized to a solid phase.
  • the disclosure generally relates to a method of identifying or selecting one or a plurality of neoantigens from a sample, the method comprising (a) sequencing the DNA/RNA from a sample, and (b) measuring the binding of the subject-specific peptides to T-cell receptor comprises measuring the binding of the subject-specific peptides to a HLA protein of the subject or sample, and (c) selecting or a plurality of neoantigens from a sample if the HLA protein from the subject binds to HLA proteins of the subject with an IC50 of less than about 500 nM, 400 nM, 300 nM, 200 nM, or IOOhM; and, optionally (d) ordering the neoantigens in order of lowest IC50 value to highest IC50 value.
  • the disclosure relates to generating a vaccine or manufacturing a pharmaceutical composition
  • the nucleic acid sequence encoding the neoantigens also comprises a linker.
  • the nucleic acid molecule is free of a nucleic acid sequence that encodes a P2A linker.
  • the nucleic acid molecule is free of a nucleic acid sequence that encodes two different linkers.
  • the nucleic acid molecule is free of a nucleic acid sequence that encodes a linker, such that at least two or a plurality of AED sequences, from the 5’ to 3’ orientation is encoded as a separate polypeptide or as a large contiguous fusion protein.
  • the method of identifying one or more subject-specific DNA neoantigen mutations in a subject further comprises providing a culture comprising dendritic cells (DCs) obtained from the subject; and contacting the dendritic cells with the immunogenic composition.
  • DCs are potent antigen-presenting cells that initiate T cell immunity and can be used as cancer vaccines when loaded with one or more neoantigens of interest.
  • the method further comprises administering to the subject the dendritic cells; obtaining a population of CD8+ T cells from a peripheral blood sample from the subject, wherein the CD8+ cells recognize the at least one neoantigen; and expanding the population of CD8+ T cells that recognizes the neoantigen.
  • the expanded population of CD8+ T cells is administered to the subject.
  • any suitable sequencing-by-synthesis platform can be used to identify mutations.
  • Four major sequencing-by-synthesis platforms are currently available: the Genome Sequencers from Roche/454 Life Sciences, the HiSeq Analyzer from Illumina/Solexa, the
  • a plurality of nucleic acid molecules being sequenced is bound to a support (e.g., solid support).
  • a capture sequence/universal priming site can be added at the 3' and/or 5' end of the template.
  • the nucleic acids may be bound to the support by hybridizing the capture sequence to a complementary sequence covalently attached to the support.
  • the capture sequence (also referred to as a universal capture sequence) is a nucleic acid sequence complementary to a sequence attached to a support that may dually serve as a universal primer.
  • a member of a coupling pair (such as, e.g., antibody/antigen, receptor/ligand, or the avidin-biotin pair as described in, e.g., U.S. Patent Application No. 2006/0252077) may be linked to each fragment to be captured on a surface coated with a respective second member of that coupling pair.
  • the sequence may be analyzed, for example, by single molecule detection/sequencing, e.g., as described in the Examples and in U.S. Pat. No. 7,283,337, including template-dependent sequencing-by-synthesis.
  • the surface-bound molecule is exposed to a plurality of labeled nucleotide triphosphates in the presence of polymerase.
  • the sequence of the template is determined by the order of labeled nucleotides incorporated into the 3' end of the growing chain. This can be done in real time or in a step-and-repeat mode. For real-time analysis, different optical labels to each nucleotide may be incorporated and multiple lasers may be utilized for stimulation of incorporated nucleotides.
  • the DNA or RNA sample is obtained from a neoplasia/tumor or a bodily fluid, e.g., blood, obtained by known techniques (e.g. venipuncture) or saliva.
  • nucleic acid tests can be performed on dry samples (e.g. hair or skin).
  • DASH dynamic allele-specific hybridization
  • MADGE microplate array diagonal gel electrophoresis
  • pyrosequencing oligonucleotide-specific ligation
  • TaqMan the TaqMan system
  • DNA“chip” technologies such as the Affymetrix SNP chips.
  • PCR based detection means may include multiplex amplification of a plurality of markers simultaneously. For example, it is well known in the art to select PCR primers to generate PCR products that do not overlap in size and can be analyzed simultaneously.
  • hybridization based detection means allow the differential detection of multiple PCR products in a sample.
  • Other techniques are known in the art to allow multiplex analyses of a plurality of markers.
  • the single base polymorphism can be detected by using a specialized exonuclease-resistant nucleotide, as disclosed, e.g., U.S. Pat. No. 4,656,127.
  • a primer complementary to the allelic sequence immediately 3 ' to the polymorphic site is permitted to hybridize to a target molecule obtained from a particular animal or human. If the polymorphic site on the target molecule contains a nucleotide that is complementary to the particular exonuclease-resistant nucleotide derivative present, then that derivative will be incorporated onto the end of the hybridized primer.
  • a solution-based method is used for determining the identity of the nucleotide of a polymorphic site.
  • Cohen et al. (French Patent No. 2,650,840; PCT Application No. W01991/02087).
  • a primer may be employed that is complementary to allelic sequences immediately 3' to a polymorphic site. The method determines the identity of the nucleotide of that site using labeled dideoxynucleotide derivatives, which, if complementary to the nucleotide of the polymorphic site, will become incorporated onto the terminus of the primer.
  • GBA Genetic Bit Analysis
  • PCT Application No. W01992/15712 An alternative method, known as Genetic Bit Analysis or GBA is described in PCT Application No. W01992/15712).
  • GBA uses mixtures of labeled terminators and a primer that is complementary to the sequence 3' to a polymorphic site.
  • the labeled terminator that is incorporated is thus determined by, and complementary to, the nucleotide present in the polymorphic site of the target molecule being evaluated.
  • the GBA method is preferably a heterogeneous phase assay, in which the primer or the target molecule is immobilized to a solid phase.
  • the disclosure further provides a method of inducing a neoplasia/tumor-specific immune response in a subject, vaccinating against a neoplasia/tumor, treating and/or alleviating a symptom of cancer in a subject by administering to the subject the nucleic acid sequences as described herein.
  • the disclosure provides a method of treating and/or preventing cancer in a subject, the method comprising administering to the subject in need thereof a pharmaceutically effective amount of any of the nucleic acid molecules as described herein (e.g. a nucleic acid molecule comprising a nucleic acid sequence comprising Formula I: [[(AED n )-(linker)] register - [AED n+1 ]) or any of the pharmaceutical compositions described herein.
  • the nucleic acid molecule is administered to the subject by electroporation.
  • treatment is determined by a clinical outcome, an increase, enhancement or prolongation of anti-tumor activity by T cells, an increase in the number of anti- tumor T cells or activated T cells as compared with the number prior to treatment, or a combination thereof.
  • clinical outcome is selected from the group consisting of tumor regression, tumor shrinkage, tumor necrosis, anti-tumor response by the immune system, tumor expansion, recurrence or spread, or a combination thereof.
  • cancers and cancer conditions that can be treated with the combination therapy of this document include, but are not limited to a patient in need thereof that has been diagnosed as having cancer, or at risk of developing cancer.
  • the subject has previously been treated, and not responded to checkpoint inhibitor therapy.
  • the therapy described herein is also applicable where the subject has no detectable neoplasia but is at high risk for disease recurrence.
  • nucleic acid molecules described herein may be used for a patient that has been diagnosed as having cancer, or at risk of developing cancer.
  • the cancer is a solid tumor.
  • the cancer has a high mutational load.
  • the cancer has a moderate mutational load.
  • the cancer has been shown to have a poor or low response to checkpoint inhibitor therapy.
  • the cancer is selected from, but not limited to, Acute Lymphoblastic Leukemia, Adult; Acute Lymphoblastic Leukemia, Childhood; Acute Myeloid Leukemia, Adult; Adrenocortical Carcinoma; Adrenocortical Carcinoma, Childhood; AIDS- Related Lymphoma; AIDS-Related Malignancies; Anal Cancer; Astrocytoma, Childhood Cerebellar; Astrocyto a, Childhood Cerebral; Bile Duct Cancer, Extrahepatic; Bladder Cancer; Bladder Cancer, Childhood; Bone Cancer, Osteosarcoma/Malignant Fibrous Histiocytoma; Brain Stem Glioma, Childhood; Brain Tumor, Adult; Brain Tumor, Brain Stem Glioma, Childhood; Brain Tumor, Cerebellar Astrocyto a, Childhood; Brain Tumor, Cerebral
  • Glioma Childhood Brain Stem; Glioma. Childhood Visual Pathway and Hypothalamic; Hairy Cell Leukemia; Head and Neck Cancer; Hepatocellular (Liver) Cancer, Adult (Primary);
  • Laryngeal Cancer Childhood; Leukemia, Acute Lymphoblastic, Adult; Leukemia, Acute Lymphoblastic, Childhood; Leukemia, Acute Myeloid, Adult; Leukemia, Acute Myeloid, Childhood; Leukemia, Chronic Lymphocytic; Leukemia, Chronic Myelogenous; Leukemia, Hairy Cell; Lip and Oral Cavity Cancer; Liver Cancer, Adult (Primary); Liver Cancer,
  • Lung Cancer Non-Small Cell
  • Lung Cancer Small Cell
  • Lymphoblastic Leukemia Adult Acute
  • Lymphoblastic Leukemia Childhood Acute
  • Lymphocytic Leukemia Chronic
  • Lymphoma AIDS— Related
  • Lymphoma Central Nervous System
  • Lymphoma Cutaneous T-Cell; Lymphoma, Hodgkin's, Adult; Lymphoma, Hodgkin's;
  • Lymphoma Hodgkin's During Pregnancy; Lymphoma, Non-Hodgkin's, Adult;
  • Lymphoma Non-Hodgkin's, Childhood; Lymphoma, Non-Hodgkin's During Pregnancy;
  • Lymphoma Primary Central Nervous System; Macroglobulinemia, Waldenstrom's; Male Breast Cancer; Malignant Mesothelioma, Adult; Malignant Mesothelioma, Childhood; Malignant Thymoma; Medulloblastoma, Childhood; Melanoma; Melanoma, Intraocular; Merkel Cell Carcinoma; Mesothelioma, Malignant; Metastatic Squamous Neck Cancer with Occult Primary; Multiple Endocrine Neoplasia Syndrome, Childhood; Multiple Myeloma/Plasma Cell Neoplasm; Mycosis Fungoides; Myelodysplasia Syndromes; Myelogenous Leukemia, Chronic; Myeloid Leukemia, Childhood Acute; Myeloma, Multiple; Myeloproliferative Disorders, Chronic; Nasal Cavity and Paranasal Sinus Cancer; Nasopharyngeal Cancer; Nasopharyngeal Cancer,
  • Pancreatic Cancer Pancreatic Cancer; Pancreatic Cancer, Childhood', Pancreatic Cancer, Islet Cell; Paranasal Sinus and Nasal Cavity Cancer; Parathyroid Cancer; Penile Cancer; Pheochromocytoma; Pineal and Supratentorial Primitive Neuroectodermal Tumors, Childhood; Pituitary Tumor; Plasma Cell Neoplasm/Multiple Myeloma; Pleuropulmonary Blastoma; Pregnancy and Breast Cancer;
  • Pregnancy and Hodgkin's Lymphoma Pregnancy and Non-Hodgkin's Lymphoma; Primary Central Nervous System Lymphoma; Primary Liver Cancer, Adult; Primary Liver Cancer, Childhood; Prostate Cancer; Rectal Cancer; Renal Cell (Kidney) Cancer; Renal Cell Cancer, Childhood; Renal Pelvis and Ureter, Transitional Cell Cancer; Retinoblastoma;
  • Thyroid Cancer Thyroid Cancer
  • Thyroid Cancer Childhood
  • Transitional Cell Cancer of the Renal Pelvis and Ureter Trophoblastic Tumor, Gestational; Unknown Primary Site, Cancer of, Childhood;
  • the cancer is selected from the group consisting of non small cell lung cancer, melanoma, ovarian cancer, cervical cancer, glioblastoma, urogenital cancer, gynecological cancer, lung cancer, gastrointestinal cancer, head and neck cancer, non-metastatic or metastatic breast cancer, malignant melanoma, Merkel Cell Carcinoma or bone and soft tissue sarcomas, haematologic neoplasias, multiple myeloma, acute myelogenous leukemia, chronic myelogenous leukemia, myelodysplastic syndrome and acute lymphoblastic leukemia, breast cancer, metastatic colorectal cancers, hormone sensitive or hormone refractory prostate cancer, colorectal cancer, ovarian cancer, hepatocellular cancer, renal cell cancer, pancreatic cancer, gastric cancer, oesophageal cancers, hepatocellular cancers, cholangiocellular cancers, head and neck squamous cell cancer
  • the cancer is non-small cell lung carcinoma or melanoma, both of which have been shown to have a high mutational load.
  • the cancer is ovarian cancer or glioblastoma multiforme, both of which show a moderate mutational load and have been shown to have a poor or low response to checkpoint inhibitor therapy.
  • the present disclosure features a method of inducing an immune response in a subject, the method comprising administering to the subject in need thereof a
  • the method comprises the steps of taking a sample from a subject, identifying one or more neoantigens expressed by hyperoliferative cells in a the sample, synthesizing one or more cDNA libraries based upon expression of neoantigens in the sample, cloning the one or more nucleic acid sequences that encode one or more epitopes of the neoantigens, into a nucleic acid molecule that comprises one or more components disclosed herein, and administering the nucleic acid molecule to the subject.
  • the present disclosure features a method of inducing a CD8+ T cell immune response in a subject, the method comprising administering to the subject in need thereof a pharmaceutically effective amount of any of the nucleic acid molecules of any one of the aspects or embodiments herein, or any one of the pharmaceutical compositions of any one of the aspects and embodiments herein.
  • the present disclosure features a method of enhancing an immune response in a subject, the method comprising administering to the subject in need thereof a
  • the present disclosure features a method of enhancing a CD8+ T cell immune response in a subject, the method comprising administering to the subject in need thereof a pharmaceutically effective amount of any of the nucleic acid molecules of any one of the aspects or embodiments herein, or any one of the pharmaceutical compositions of any one of the aspects and embodiments herein.
  • the subject has cancer. In another embodiment, the subject has previously been treated, and not responded to checkpoint inhibitor therapy.
  • the nucleic acid molecule is administered to the subject by electroporation.
  • enhancing the CD8+ T cell immune response comprises activating from about 0.01% to about 50% CD8+ T cells. In some embodiments, enhancing the CD8+ T cell immune response comprises activating from about 0.01% to about 50% that are IFN-T positive. In some embodiments, the activation of T cells is accomplished after no more than 1, 2, 3, 4, 5, 6, ,7 8, 9, 10 or more hours of contact with antigen preenting cells expressing or plasmids comprising the nucleotic acid squences disclosed herein or expressed by a hyperproliferative cell in a subject. CD8+ T cells. In some embodiments, enhancing the CD8+ T cell immune response comprises expanding CD8+ T cells. In some embodiments, enhancing the CD8+ T cell immune response comprises activating from about 0.05% to about 50% CD8+ T cellsln some
  • enhancing the CD8+ T cell immune response comprises activating from about 0.10% to about 50% CD8+ T cellsln some embodiments, enhancing the CD8+ T cell immune response comprises activating from about 0.2% to about 50% CD8+ T cellsln some
  • enhancing the CD8+ T cell immune response comprises activating from about 0.3% to about 50% CD8+ T cellsln some embodiments, enhancing the CD8+ T cell immune response comprises activating from about 0.4% to about 50% CD8+ T cellsln some
  • enhancing the CD8+ T cell immune response comprises activating from about 0.5% to about 50% CD8+ T cellsln some embodiments, enhancing the CD8+ T cell immune response comprises activating from about 0.6% to about 50% CD8+ T cellsln some embodiments, enhancing the CD8+ T cell immune response comprises activating from about 0.7% to about 50% CD8+ T cellsln some embodiments, enhancing the CD8+ T cell immune response comprises activating from about 0.8% to about 50% CD8+ T cellsln some embodiments, enhancing the CD8+ T cell immune response comprises activating from about 0.9% to about 50% CD8+ T cells In some embodiments, enhancing the CD8+ T cell immune response comprises activating from about 1.00% to about 50% CD8+ T cells.
  • enhancing the CD8+ T cell immune response comprises activating from about 2.0% to about 50% CD8+ T cells In some embodiments, enhancing the CD8+ T cell immune response comprises activating from about 3.0% to about 50% CD8+ T cells. In some embodiments, enhancing the CD8+ T cell immune response comprises activating from about 5.0% to about 50% CD8+ T cells. In some embodiments, enhancing the CD8+ T cell immune response comprises activating from about 6.0% to about 50% CD8+ T cells. In some embodiments, enhancing the CD8+ T cell immune response comprises activating from about 7.0% to about 50% CD8+ T cells. In some embodiments, enhancing the CD8+ T cell immune response comprises activating from about 8.0% to about 50% CD8+ T cells.
  • enhancing the CD8+ T cell immune response comprises activating from about 9.0% to about 50% CD8+ T cells. In some embodiments, enhancing the CD8+ T cell immune response comprises activating from about 10% to about 50% CD8+ T cells. In some embodiments, enhancing the CD8+ T cell immune response comprises activating from about 15% to about 50% CD8+ T cells. In some embodiments, enhancing the CD8+ T cell immune response comprises activating from about 20% to about 50% CD8+ T cells.
  • T cell activation can be measured by various assays as described herein.
  • T cell activities that may be measured include the induction of proliferation of T cells, the induction of signaling in T cells, the induction of expression of activation markers in T cells, such as interferon-gamma (IFN-v), the induction of cytokine secretion by T cells, and the cytotoxic activity of T cells.
  • IFN-v interferon-gamma
  • CD8+ T cell activation is measured by a proliferation assay.
  • the activation may be measured after stimulation of cells or cell sample by the encoded nucleic acid sequences.
  • the activation of CD8+ T-cells may be assessed or measured by determining secretion of cytokines, such as gamma interferon (IFN-g), tumor necrosis factor alpha (TNFa), interleukin- 12 (IL-12) or interleukin 2 (IL-2).
  • cytokines such as gamma interferon (IFN-g), tumor necrosis factor alpha (TNFa), interleukin- 12 (IL-12) or interleukin 2 (IL-2).
  • ELISA is used to determine cytokine secretion, for example secretion of gamma interferon (IFN-g), tumor necrosis factor alpha (TNFa), interleukin- 12 (IL-12) or interleukin 2 (IL-2).
  • the ELISPOT (enzyme-linked immunospot) technique may be used to detect T cells that secrete a given cytokine (e.g ., gamma interferon (IFN-g)) in response to stimulation with any of the nucleic acid molecules of any one of the aspects or embodiments herein, or any one of the pharmaceutical compositions of any one of the aspects and embodiments herein.
  • T cells are cultured with, e.g. any of the nucleic acid molecules of any one of the aspects or embodiments herein wells which have been coated with anti-IFN-g antibodies.
  • the secreted IFN-g is captured by the coated antibody and then revealed with a second antibody coupled to a chromogenic substrate.
  • cytokine molecules form spots, with each spot corresponding to one IFN-y-secreting cell.
  • the number of spots allows one to determine the frequency of rFN-y-secreting cells in the analyzed sample.
  • the ELISPOT assay has also been described for the detection of tumor necrosis factor alpha, interleukin-4 (IL-4), IL-5, IL-6, IL-10, IL-12, granulocyte-macrophage colony-stimulating factor , and granzyme B-secreting lymphocytes (Klinman D, Nutman T. Current protocols in immunology. New York, N.Y: John Wiley & Sons, Inc.; 1994. pp. 6.19.1-6.19.8, incorporated by reference in its entirety herein).
  • Flow cytometric analyses of intracellular cytokines may be used to measure the cytokine content in culture supernatants, but provides no information on the number of T cells that actually secrete the cytokine.
  • T cells When T cells are treated with inhibitors of secretion such as monensin or brefeldin A, they accumulate cytokines within their cytoplasm upon activation (e.g. with the nucleic acid molecules of the present invention). After fixation and permeabilization of the lymphocytes, intracellular cytokines can be quantified by cytometry. This technique allows the determination of the cytokines produced, the type of cells that produce these cytokines, and the quantity of cytokine produced per cell. Cytotoxicity
  • CD8+ T-cells by any of the nucleic acid molecules of any one of the aspects or embodiments herein, or any one of the pharmaceutical compositions of any one of the aspects and embodiments herein may be assessed by assaying the cytotoxic activity of the CD8+ T-cells.
  • the cytotoxic activity of T cells may be assessed by any suitable technique known to those of skill in the art.
  • a sample comprising T cells that have been exposed to the nucleic acid molecules according to the invention can be assayed for cytotoxic activity after an appropriate period of time, in a standard cytotoxic assay.
  • assays may include, but are not limited to, the chromium release CTL assay and the Alamar BlueTM fluorescence assay known in the art.
  • CFSE staining provides a much more quantitative endpoint and allows simultaneous phenotyping of the expanded cells. Every day after stimulation, an aliquot of cells is removed from each culture and analyzed by flow cytometry.
  • CFSE staining makes cells highly fluorescent. ETpon cell division, the fluorescence is halved and thus the more times a cell divides the less fluorescent it becomes.
  • the ability of any of the nucleic acid molecules of any one of the aspects or embodiments herein, or any one of the pharmaceutical compositions of any one of the aspects and embodiments herein to induce T cell proliferation is quantitated by measuring the number of cells that divided once, twice, three times and so on.
  • nucleic acid molecules that induce the greatest number of cell divisions at a particular time point is deemed as the most potent expander.
  • cell growth curves can be generated. These experiments are set up as the foregoing CFSE experiments, but no CFSE is used. Every 2-3 days of culture, T cells are removed from the respective cultures and counted using a Coulter counter which measures how many cells are present and the mean volume of the cells. The mean cell volume is the best predicator of when to restimulate the cells. In general, when T cells are properly stimulated they triple their cell volume.
  • the relative differences of each nucleic acid molecule to induce this level of T cell expansion is an important criteria on which the nucleic acid molecules of any one of the aspects or embodiments herein, or any one of the pharmaceutical compositions of any one of the aspects and embodiments herein are assessed.
  • T cells using the nucleic acid molecules of any one of the aspects or embodiments herein, or any one of the pharmaceutical compositions of any one of the aspects and embodiments herein enhances expression of certain key molecules in T cells that protect again apoptosis or otherwise prolong survival in vivo or in vitro. Apoptosis usually results from induction of a specific signal in the T cell.
  • T cell growth by protection from premature death or from absence or depletion of recognized T cell growth markers, such as Bcl-xL, growth factors, cytokines, or lymphokines normally necessary for T cell survival, as well as from Fas or Tumor Necrosis Factor Receptor (TNFR) cross-linking or by exposure to certain hormones or stress.
  • recognized T cell growth markers such as Bcl-xL, growth factors, cytokines, or lymphokines normally necessary for T cell survival, as well as from Fas or Tumor Necrosis Factor Receptor (TNFR) cross-linking or by exposure to certain hormones or stress.
  • TNFR Tumor Necrosis Factor Receptor
  • the disclosure features a method of enhancing an immune response against a plurality of heterogeneous hyperproliferative cells in a subject, the method comprising administering to the subject in need thereof a pharmaceutically effective amount of any of the nucleic acid molecules described herein (e.g. a nucleic acid molecule comprising a nucleic acid sequence comprising Formula I: [[(AED n )-(linker)] register - [AED n+1 ]), or any of the pharmaceutical compositions described herein.
  • a nucleic acid molecules described herein e.g. a nucleic acid molecule comprising a nucleic acid sequence comprising Formula I: [[(AED n )-(linker)] register - [AED n+1 ]
  • the subject has cancer. In another embodiment, the subject has previously been treated, and not responded to checkpoint inhibitor therapy.
  • the nucleic acid molecule is administered to the subject by electroporation.
  • the immune response is of a sufficient magnitude or efficacy to inhibit or retard tumor growth, induce tumor cell death, induce tumor regression, prevent or delay tumor recurrence, prevent tumor growth, prevent tumor spread and/or induce tumor elimination.
  • the method of enhancing an immune response against a plurality of heterogeneous hyperproliferative cells in a subject further comprises administration of one or more therapeutic agents.
  • the additional therapeutic agent is a biologic therapeutic or a small molecule.
  • the therapeutic agent is (i) a checkpoint inhibitor or functional fragment thereof; or (ii) a nucleic acid molecule encoding a checkpoint inhibitor or a functional fragment thereof.
  • the checkpoint inhibitor associates with or inhibits a checkpoint protein selected from the group consisting of CTLA-4, PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD160, CGEN-15049, CHK 1,
  • the checkpoint inhibitor is an inhibitor of the programmed death- 1 (PD-l) pathway.
  • the checkpoint inhibitor is an anti -cytotoxic T- lymphocyte-associated antigen 4 (CTLA4) antibody or functional fragment thereof.
  • the therapeutic agent is an adjuvant.
  • the ability of an adjuvant to increase the immune response to an antigen is typically manifested by a significant increase in immune-mediated reaction, or reduction in disease symptoms.
  • an increase in humoral immunity is typically manifested by a significant increase in the titer of antibodies raised to the antigen
  • an increase in T-cell activity is typically manifested in increased cell proliferation, or cellular cytotoxicity, or cytokine secretion.
  • An adjuvant may also alter an immune response, for example, by changing a primarily humoral or Th2 response into a primarily cellular, or Thl response.
  • the adjuvant can be other genes that are expressed in alternative plasmid or are delivered as proteins in combination with the plasmid above in the vaccine.
  • the adjuvant can be selected from the group consisting of: a- interferon (IFN-a), b-interferon (IFN-b), g-interferon, platelet derived growth factor (PDGF), TNFa, TNRb, GM-CSF, epidermal growth factor (EGF), cutaneous T cell -attracting chemokine (CTACK), epithelial thymus-expressed chemokine (TECK), mucosae-associated epithelial chemokine (MEC), IL-12, IL-15, MHC, CD80, CD86 including IL-15 having the signal sequence deleted and optionally including the signal peptide from IgE.
  • IFN-a interferon
  • IFN-b interferon
  • g-interferon g-interferon
  • PDGF platelet derived growth factor
  • TNFa TNFa
  • TNRb GM-CSF
  • EGF epidermal growth factor
  • CTL epidermal growth factor
  • CTACK epi
  • the adjuvant can be IL- 12, IL-15, IL-28, CTACK, TECK, platelet derived growth factor (PDGF), TNF. alpha., TNF.beta., GM-CSF, epidermal growth factor (EGF), IL-l, IL-2, IL-4, IL-5, IL-6, IL-10, IL-12, IL-18, or a combination thereof.
  • PDGF platelet derived growth factor
  • TNF. alpha. TNF.beta.
  • GM-CSF epidermal growth factor
  • EGF epidermal growth factor
  • IL-l IL-2
  • IL-4 epidermal growth factor
  • IL-5 IL-6
  • IL-10 IL-12
  • IL-18 or a combination thereof.
  • genes which can be useful adjuvants include those encoding: MCP-l, MIP-la, MPMr, IL-8, RANTES, L-selectin, P-selectin, E-selectin, CD34, GlyCAM-l, MadCAM-l, LFA-l, VLA-l, Mac-l, pl50.95, PECAM, ICAM-l, ICAM-2, ICAM-3, CD2, LFA-3, M-CSF, G-CSF, IL-4, mutant forms of IL-18, CD40, CD40L, vascular growth factor, fibroblast growth factor, IL-7, nerve growth factor, vascular endothelial growth factor, Fas, TNF receptor, Flt, Apo-l, p55, WSL-l, DR3, TRAMP, Apo-3, AIR, LARD, NGRF, DR4, DR5, KILLER, TRAIL- R2, TRICK2, DR6, Caspase ICE, Fos, c-jun, Sp-l
  • Human IL-12 alpha subunit is set forth in GenBank Accession Nos. NP 000873.2,
  • Human IL-12 beta subunit is set forth in GenBank Accession No. NP 002178.2, incorporated by reference in its entirety herein.
  • An exemplary human IL-12 beta subunit amino acid sequence is shown below:
  • Human IL-15 is set forth in GenBank Accession Nos. NP_000576. l, NR_751915.1, AAI00962.1 incorporated by reference in their entireties herein.
  • An exemplary human IL-15 amino acid sequence is shown below:
  • Human IL-17 is set forth in GenBank Accession Nos. NP_002l8l. l, NM_002190.2, incorporated by reference in their entireties herein.
  • An exemplary human IL-17 amino acid sequence is shown below:
  • Human IL-8 is set forth in GenBank Accession Nos. NP_000575. l, NM_000584.3, incorporated by reference in their entireties herein.
  • An exemplary human IL-8 amino acid sequence is shown below:
  • Human C-C motif chemokine 5 (processed form RANTES(3-68) ) is set forth in GenBank Accession Nos. NP_002976.2, NM_002985.2, incorporated by reference in their entireties herein.
  • An exemplary human C-C motif chemokine 5 amino acid sequence is shown below:
  • MKVSAAALAV ILIATALCAP ASASPYSSDT TPCCFAYIAR PLPRAHIKEY FYTSGKCSNP AVVFVTRKNR QVCANPEKKW VREYINSLEM S (SEQ ID NO:59)
  • Human Macrophage inflammatory protein 1 -alpha (MIP-la) is set forth in GenBank Accession Nos. NP_002974.l, NM_002983.2, incorporated by reference in their entireties herein.
  • An exemplary human C-C motif chemokine 5 amino acid sequence is shown below:
  • exemplary adjuvants include, but are not limited to, poly-ICLC (see Pharmacol Ther. 2015 Feb; 146: 120-31, incorporated by reference in its entirety herein), 1018 IS S (see Vaccine. 2003 Jun 2;2l(l9-20):246l-7, incorporated by reference in its entirety herein), aluminum salts, Amplivax AS 15, Bacillus Colmette-Guerin (BCG) (see Clin Immunol. 2000 Jan;94(l):64-72, incorporated by reference in its entirety herein) , CP- 870,893, CpG7909
  • 197-MP-EC ONTAK, PEPTEL, vector system, PLGA microparticles, resiquimod, S L172, Virosomes and other Virus-like particles, YF-17D, VEGF trap, R848, beta-glucan, Pam3Cys, acrylic or methacrylic polymers, copolymers of maleic anhydride and Aquila's QS21 stimulon, or functional fragment thereof.
  • the therapeutic agent is an immunostimulatory agent or functional fragment thereof.
  • the imunostimulatory agent is an interleukin or functional fragment thereof.
  • the therapeutic agent is a chemotherapeutic agent.
  • chemotherapeutic agents include, but are not limited to, aldesleukin, altretamine, amifostine, asparaginase, bleomycin, capecitabine, carboplatin, carmustine, cladribine, cisapride, cisplatin, cyclophosphamide, cytarabine, dacarbazine (DTIC), dactinomycin, docetaxel, doxorubicin, dronabinol, epoetin alpha, etoposide, filgrastim, fludarabine, fluorouracil, gemcitabine, granisetron, hydroxyurea, idarubicin, ifosfamide, interferon alpha, irinotecan, lansoprazole, levamisole, leucovorin, megestrol, mesna, methotrexate, me
  • the adjuvant can include a nucleic acid plasmid that encodes any cytokine or functional fragment thereof that is administered sequentially with a pharmaecuticla composition comprising a plasmid encoding a plurality of neoantigens, optionally with one or a plurality of tumor associated antigens not derived from a subject.
  • the cytokine is IL-12 or a subunit of IL-12.
  • adjuvant is a nucleic acid sequence that encodes an amino acid sequence that comprises at elast about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ NO: 54 or a functional fragment thereof. In some embodiments, adjuvant is a nucleic acid sequence that encodes an amino acid sequence that comprises at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ NO: 55 or a functional fragment thereof.
  • adjuvant is a first nucleic acid sequence that encodes an amino acid sequence that comprises at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ NO: 54 and a second amino acid sequence that comprises at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ NO: 55 or a functional fragment thereof.
  • nucleic acid molecule comprises a first nucleic acid sequence encoding the first subunit and a second nucleic acid encoding the second subunit, each of the first or second nucleic acid sequences operably linked to at least a first promoter, such as a CMV promoter.
  • nucleic acid molecule comprises a first nucleic acid sequence encoding the first subunit and a second nucleic acid encoding the second subunit, the first nucleic acid sequence is operably linked to at least a first promoter and the second nucleic acid sequence is operably linked to at least a second promoter.
  • the IL-12 seqeunces and nucleic acids sequences encoding the same can be found in ETS Pat. Nos. 9,981,036 and 9,272,024, each of which is incorporated by reference in its entirety.
  • compositions comprising an effective amount of one or more nucleic acid molecules according to the present invention (including a pharmaceutically acceptable salt, thereof), optionally in combination with a pharmaceutically acceptable carrier, excipient or additive.
  • the pharmaceutical compositions contain a pharmaceutically acceptable carrier, excipient, or diluent, which includes any pharmaceutical agent that does not itself induce the production of an immune response harmful to a subject receiving the composition, and which may be administered without undue toxicity.
  • a pharmaceutically acceptable carrier excipient, or diluent
  • pharmaceutical agent that does not itself induce the production of an immune response harmful to a subject receiving the composition, and which may be administered without undue toxicity.
  • pharmaceutically acceptable means being approved by a regulatory agency of the Federal or a state government or listed in the ET.S. Pharmacopia, European Pharmacopia or other generally recognized pharmacopia for use in mammals, and more particularly in humans. These compositions can be useful for treating and/or preventing viral infection and/or autoimmune disease.
  • the formulation of the pharmaceutical composition should suit the mode of administration.
  • the pharmaceutical composition is suitable for administration to humans, and can be sterile, non particulate and/or non-pyrogenic.
  • the disclosure provides a pharmaceutical composition
  • a pharmaceutical composition comprising (i) one or a plurality of nucleic acid molecules as described herein (e.g. a nucleic acid molecule comprising a nucleic acid sequence comprising Formula I: [([(AED n )-(linker)] register - [AED n+1 ]); and (ii) a pharmaceutically acceptable carrier.
  • the nucleic acid molecule or nucleic acid sequence is free of a linker segment and the resulting plasmid comprises one or more successive nucleic acid sequences that encodes neoantigens amino acid sequences or epitopes that are from about 3 to about 30 amino acids in length.
  • the nucleic acid molecule or nucleic acid sequence is free of a linker segment and the resulting plasmid comprises one or more successive nucleic acid sequences that encodes neoantigens amino acid sequences or epitopes that are from about 3 to about 30 amino acids in length.
  • composition comprises a pharmaceutically effective amount of: (i) one or a plurality of any of the nucleic acid molecules described herein comprising one or a combination of any component of a plasmid dsiclsoed herein or nucleic acid sequences that are about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% homologous to any nucleic acid sequence that is a component of the plasmid listed herein.
  • the nucleic acid molecule comprises a nucleic acid seqweunce that encodes one or more nucleic acids that encode neoantigens and one or more linkers.
  • the nucleica acid molecule encodes one or a plurality of furin cleavage sequences separating one or more of the AEDs.
  • the disclosure relates to a pharmaceutical composition comprising a nucleic acid molecule that is pGX4505 or a nucleic acid sequence that is at least 70% homolgous to the sequence of pGX4505, wherein its multiple cloning site is replaced by any of the Formulae disclosed herein.
  • the pharmaceutical composition further comprises one or more therapeutic agents.
  • the additional therapeutic agent is a biologic therapeutic or a small molecule.
  • the therapeutic agent is (i) a checkpoint inhibitor or functional fragment thereof; or (ii) a nucleic acid molecule encoding a checkpoint inhibitor or a functional fragment thereof.
  • the checkpoint inhibitor associates with or inhibits a checkpoint protein selected from the group consisting of CTLA-4, PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD160, CGEN-15049, CHK 1, CHK2, A2aR, and B-7 family ligands or a combination thereof.
  • the checkpoint inhibitor is an inhibitor of the programmed death- 1 (PD-l) pathway.
  • the checkpoint inhibitor is an anti -cytotoxic T- lymphocyte-associated antigen 4 (CTLA4) antibody or functional fragment thereof.
  • the therapeutic agent is an adjuvant.
  • the ability of an adjuvant to increase the immune response to an antigen is typically manifested by a significant increase in immune-mediated reaction, or reduction in disease symptoms.
  • an increase in humoral immunity is typically manifested by a significant increase in the titer of antibodies raised to the antigen
  • an increase in T-cell activity is typically manifested in increased cell proliferation, or cellular cytotoxicity, or cytokine secretion.
  • An adjuvant may also alter an immune response, for example, by changing a primarily humoral or Th2 response into a primarily cellular, or Thl response.
  • Exempary adjuvants include, but are not limited to, poly- ICLC, 1018 ISS, aluminum salts, Amplivax AS15, BCG, CP- 870,893, CpG7909, CyaA, GM- CSF, IC30, IC31 , Imiquimod, ImuFact 1MP321 , IS Patch, ISS, ISCOMATRIX, Juvlmmune, LipoVac, monophosphoryf lipid A, Montanide IMS 1312, Montanide ISA 206, Montanide ISA 50V, Montanide ISA-51, OK-432, OM-174, OM-197-MP-EC, ONTAK, PEPTEL, vector system,
  • the therapeutic agent is an immunostimulatory agent or functional fragment thereof.
  • the imunostimulatory agent is an interleukin or functional fragment thereof.
  • the therapeutic agent is a chemotherapeutic agent.
  • chemotherapeutic agents include, but are not limited to, aldesleukin, altretamine, amifostine, asparaginase, bleomycin, capecitabine, carboplatin, carmustine, cladribine, cisapride, cisplatin, cyclophosphamide, cytarabine, dacarbazine (DTIC), dactinomycin, docetaxel, doxorubicin, dronabinol, epoetin alpha, etoposide, filgrastim, fludarabine, fluorouracil, gemcitabine, granisetron, hydroxyurea, idarubicin, ifosfamide, interferon alpha, irinotecan, lansoprazole, levamisole, leucovorin, megestrol, mesna, methotrexate, me
  • One of skill in the art can determine which therapeutic regimen is appropriate on a subject by subject basis, depending, for example, on their cancer and their immune status (e.g ., T-cell, B cell or NK cell activity and/or numbers).
  • their cancer and their immune status e.g ., T-cell, B cell or NK cell activity and/or numbers.
  • a host cell can be transfected in vivo (i.e., in an animal) or ex vivo (i.e., outside of an animal).
  • Transfection of a nucleic acid molecule into a host cell can be accomplished by any method by which a nucleic acid molecule can be inserted into the cell. Transfection techniques include, but are not limited to, transfection, electroporation, microinjection, lipofection, adsorption, and protoplast fusion.
  • the disclosure relates to a composition comprising one, two, three or more nucleic acid molecules, each nucleic acid molecule comprising at least one coding sequence comprising Formula I.
  • the first second and/or third nucleic acid molecule comprises at least one AED that is a neoantigen and at least AED that is a tumor associated antigen that is not derived from a subject.
  • the first second and/or third nucleic acid molecule comprises at least one coding sequence comprising at least about 10 AEDs derived from a subject.
  • the first second and/or third nucleic acid molecule comprises at least one coding sequence comprising at least about 20 AEDs derived from a subject.
  • the first second and/or third nucleic acid molecule comprises at least one coding sequence comprising at least about 30 AEDs derived from a subject. In some embodiments, the first second and/or third nucleic acid molecule comprises at least one coding sequence comprising at least about 40 AEDs derived from a subject. In some embodiments, the first second and/or third nucleic acid molecule comprises at least one coding sequence comprising at least about 50 AEDs derived from a subject. In some embodiments, the first second and/or third nucleic acid molecule comprises at least one coding sequence comprising at least about 60 AEDs derived from a subject.
  • the first second and/or third nucleic acid molecule comprises at least one coding sequence comprising at least about 10 AEDs that are each independently a tumor associated antigen that is not derived from a subject. In some embodiments, the first second and/or third nucleic acid molecule comprises at least one coding sequence comprising at least about 20 AEDs that are each independently a tumor associated antigen that is not derived from a subject. In some embodiments, the first second and/or third nucleic acid molecule comprises at least one coding sequence comprising at least about 30 AEDs that are each independently a tumor associated antigen that is not derived from a subject.
  • the first second and/or third nucleic acid molecule comprises at least one coding sequence comprising at least about 40 AEDs that are each independently a tumor associated antigen that is not derived from a subject. In some embodiments, the first second and/or third nucleic acid molecule comprises at least one coding sequence comprising at least about 50 AEDs that are each independently a tumor associated antigen that is not derived from a subject. In some embodiments, the first second and/or third nucleic acid molecule comprises at least one coding sequence comprising at least about 60 AEDs that are each independently a tumor associated antigen that is not derived from a subject.
  • nucleic acid seqeunce encoding a neoantigenmucleic acid seqeunce encoding a tumor associated antigen not derived from the subject may be included in the embodiments, such as 1 : 1, 2: 1 :, 1 :2, 1 :4, 4: 1, 5: 1, 1 :5,
  • the nucleic acid sequence comprises at least 2, 3, 4, 5, 6, 7, 8, 9, or
  • each AED is independently selectable from any one or plurality of tumor associated antigens from a subject or one or a plurality of tumor antigens not derived from the subject and wherein n is any positive integer from about 1 to about 100 and wherein each“linker” is a nucleic acid sequence encoding one or a plurality of amino acid cleavage sites.
  • the nucleic acid sequence comprises at least one linker domain between each AED and the nucleic acid sequence comprises
  • each AED is independently selectable from any one or plurality of tumor associated antigens from a subject or one or a plurality of tumor antigens not derived from the subject and wherein n is any positive integer from about 25 to about 60 and wherein each“linker” is a nucleic acid sequence encoding one or a plurality of amino acid cleavage sites.
  • the nucleic acid sequence comprises at least one linker domain between each AED and the nucleic acid sequence comprises
  • each AED is independently selectable from any one or plurality of tumor associated antigens from a subject or one or a plurality of tumor antigens not derived from the subject and wherein n is any positive integer from about 35 to about 50 and wherein each“linker” is a nucleic acid sequence encoding one or a plurality of amino acid cleavage sites.
  • the nucleic acid sequence comprises at least one linker domain between each AED and the nucleic acid sequence comprises
  • each AED is independently selectable from any one or plurality of tumor associated antigens from a subject or one or a plurality of tumor antigens not derived from the subject and wherein n is any positive integer from about 40 to about 50 and wherein each“linker” is a nucleic acid sequence encoding one or a plurality of amino acid cleavage sites.
  • tumor associated antigens not derived from the subject comprise one or a combination of amino acids comprising at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% to Survivin, MAGE A10, gplOO,
  • the disclosure relates to a nucleic acid sequence comprising one or a plurality of nucleic acid sequence encoding one or a plurality of neoantigens and one or a plurality of nucleic acid sequences encoding one or a plurality of tumor associated antigens.
  • the turn ore associated antigens not derived from a subject are chosen from oneo r a combination of amino acid sequences comprising at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:6l, 62, 63, 64, 65, 66 or 67, or functional fragments thereof.
  • the disclosure relates to a nucleic acid sequence comprising one or a plurality of nucleic acid sequence encoding one or a plurality of neoantigens and one or a plurality of nucleic acid sequences encoding one or a plurality of tumor associated antigens, wherein the onr or plurality of neoantigens are chosen from one or a pluirality of amino acid sequences comprising at least about 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 1 - 20, or functional fragments thereof.
  • Routes of administration include, but are not limited to, intramuscular, intranasally, intradermally, intraperitoneal, intradermal, subcutaneous, intravenous, intraarterially, intraoccularly and oral as well as topically, transdermally, by inhalation or suppository or to mucosal tissue such as by lavage to vaginal, rectal, urethral, buccal and sublingual tissue.
  • Preferred routes of administration include intramuscular, intraperitoneal, intradermal and subcutaneous injection.
  • Genetic constructs may be administered by means including, but not limited to, traditional syringes, needleless injection devices, "microprojectile bombardment gone guns", or other physical methods such as electroporation ("EP”), "hydrodynamic method", or ultrasound.
  • EP electroporation
  • hydrodynamic method or ultrasound.
  • electroporation devices and electroporation methods preferred for facilitating delivery of the DNA vaccines of the present invention include those described in U.S. Patent No. 7,245,963 by Draghia-Akli, et al., U.S. Patent Application Publication No. 2005/0052630 submitted by Smith, et al., the contents of which are hereby incorporated by reference in their entirety.
  • electroporation devices and electroporation methods for facilitating delivery of the DNA vaccines provided in co-pending and co-owned U.S. Patent Application Serial No. 11/874072, filed October 17, 2007, which claims the benefit under 35 USC 1 19(e) to U.S. Provisional Applications Serial No. 60/852, 149, filed October 17, 2006, and U.S. Provisional Applications Serial No. 60/978,982, filed October 10, 2007, all of which are hereby incorporated in their entirety.
  • U.S. Patent No. 7,245,963 by Draghia-Akli, et al. describes modular electrode systems and their use for facilitating the introduction of a biomolecule into cells of a selected tissue in a body or plant.
  • the modular electrode systems comprise a plurality of needle electrodes; a hypodermic needle; an electrical connector that provides a conductive link from a programmable constant-current pulse controller to the plurality of needle electrodes; and a power source.
  • An operator can grasp the plurality of needle electrodes that are mounted on a support structure and firmly insert them into the selected tissue in a body or plant.
  • the biomolecules are then delivered via the hypodermic needle into the selected tissue.
  • the programmable constant-current pulse controller is activated and constant-current electrical pulse is applied to the plurality of needle electrodes.
  • the applied constant-current electrical pulse facilitates the introduction of the biomolecule into the cell between the plurality of electrodes.
  • U.S. Patent Application Publication No. 2005/0052630 incorporated by reference in its entirety herein, describes an electroporation device which may be used to effectively facilitate the introduction of a biomolecule into cells of a selected tissue in a body or plant.
  • the electroporation device comprises an electro-kinetic device ("EKD device") whose operation is specified by software or firmware.
  • EKD device produces a series of programmable constant- current pulse patterns between electrodes in an array based on user control and input of the pulse parameters, and allows the storage and acquisition of current waveform data.
  • the electroporation device also comprises a replaceable electrode disk having an array of needle electrodes, a central injection channel for an injection needle, and a removable guide disk.
  • 7,245,963 and U.S. Patent Application Publication No. 2005/0052630 are adapted for deep penetration into not only tissues such as muscle, but also other tissues or organs. Because of the configuration of the electrode array, the injection needle (to deliver the biomolecule of choice) is also inserted completely into the target organ, and the injection is administered perpendicular to the target issue, in the area that is pre-delineated by the electrodes.
  • the electrodes described in U.S. Patent No. 7,245,963 and U.S. Patent Application Publication No. 2005/005263 are preferably 20 mm long and 21 gauge.
  • electroporation devices can be configured to deliver to a desired tissue of a mammal a pulse of energy producing a constant current similar to a preset current input by a user.
  • the electroporation device comprises an electroporation component and an electrode assembly or handle assembly.
  • the electroporation component can include and incorporate one or more of the various elements of the electroporation devices, including:
  • the electroporation component can function as one element of the electroporation devices, and the other elements are separate elements (or components) in communication with the
  • the electroporation component can function as more than one element of the electroporation devices, which can be in communication with still other elements of the electroporation devices separate from the electroporation component.
  • the present invention is not limited by the elements of the electroporation devices existing as parts of one electromechanical or mechanical device, as the elements can function as one device or as separate elements in communication with one another.
  • the electroporation component is capable of delivering the pulse of energy that produces the constant current in the desired tissue, and includes a feedback mechanism.
  • the electrode assembly includes an electrode array having a plurality of electrodes in a spatial arrangement, wherein the electrode assembly receives the pulse of energy from the electroporation component and delivers same to the desired tissue through the electrodes.
  • At least one of the plurality of electrodes is neutral during delivery of the pulse of energy and measures impedance in the desired tissue and communicates the impedance to the electroporation component.
  • the feedback mechanism can receive the measured impedance and can adjust the pulse of energy delivered by the electroporation component to maintain the constant current.
  • the plurality of electrodes can deliver the pulse of energy in a decentralized pattern. In some embodiments, the plurality of electrodes can deliver the pulse of energy in the decentralized pattern through the control of the electrodes under a programmed sequence, and the programmed sequence is input by a user to the electroporation component. In some embodiments, the programmed sequence comprises a plurality of pulses delivered in sequence, wherein each pulse of the plurality of pulses is delivered by at least two active electrodes with one neutral electrode that measures impedance, and wherein a subsequent pulse of the plurality of pulses is delivered by a different one of at least two active electrodes with one neutral electrode that measures impedance.
  • the feedback mechanism is performed by either hardware or software.
  • the feedback mechanism is performed by an analog closed-loop circuit.
  • this feedback occurs every 50 ps, 20 ps, 10 ps or 1 ps, but is preferably a realtime feedback or instantaneous (i.e., substantially instantaneous as determined by available techniques for determining response time).
  • the neutral electrode measures the impedance in the desired tissue and communicates the impedance to the feedback
  • the feedback mechanism responds to the impedance and adjusts the pulse of energy to maintain the constant current at a value similar to the preset current.
  • the feedback mechanism maintains the constant current continuously and instantaneously during the delivery of the pulse of energy.
  • nucleic acid molecules of the invention can also be administered to the patient.
  • a number of methods are conveniently used to deliver the nucleic acids to the patient.
  • the nucleic acid can be delivered directly, as“naked DNA”. This approach is described, for instance, in Wolff et ak, Science 247: 1465-1468 (1990) as well as U.S. Pat. Nos. 5,580,859 and 5,589,466.
  • the nucleic acids can also be administered using ballistic delivery as described, for instance, in U.S. Pat. No. 5,204,253.
  • Particles comprised solely of DNA can be administered.
  • DNA can be adhered to particles, such as gold particles.
  • the nucleic acids can also be delivered complexed to cationic compounds, such as cationic lipids.
  • cationic compounds such as cationic lipids.
  • Lipid-mediated gene delivery methods are described, for instance, in
  • RNA encoding the peptide of interest can also be used for delivery (see, e.g., Kiken et al, 2011; Su et al, 2011).
  • a pharmaceutically acceptable carrier or excipient can include such functional molecules as vehicles, adjuvants, carriers or diluents, which are known and readily available to the public.
  • the pharmaceutically acceptable carrier is an adjuvant.
  • the pharmaceutically acceptable excipient is a transfection facilitating agent.
  • the transfection facilitating agent is a polyanion, polycation, or lipid, and more preferably poly-L-glutamate.
  • the nucleic acid molecule, or DNA plasmid is delivered to the cells in conjunction with administration of a polynucleotide function enhancer or a genetic vaccine facilitator agent (or transfection facilitating agent).
  • Polynucleotide function enhancers are described in U.S. Patent No. 5,593,972, U.S. Patent No. 5,962,428, and International Patent Application No. PCT/US94/00899 filed January 26, 1994, which are each incorporated herein by reference in their entireties.
  • Genetic vaccine facilitator agents are described in U.S. Patent Application Serial No. 021,579 filed April 1, 1994, which is
  • the transfection facilitating agent can be administered in conjunction with nucleic acid molecules as a mixture with the nucleic acid molecule or administered separately simultaneously, before or after administration of nucleic acid molecules.
  • transfection facilitating agents includes surface active agents such as immune-stimulating complexes (ISCOMS), Freunds incomplete adjuvant, LPS analog including monophosphoryl lipid A, muramyl peptides, quinone analogs and vesicles such as squalene and squalene, and hyaluronic acid may also be used administered in conjunction with the genetic construct.
  • ISCOMS immune-stimulating complexes
  • LPS analog including monophosphoryl lipid A
  • muramyl peptides muramyl peptides
  • quinone analogs and vesicles such as squalene and squalene
  • hyaluronic acid may also be used administered in conjunction with the genetic construct.
  • the DNA plasmid vaccines may also include a transfection facilitating agent such as lipids, liposomes, including lecithin liposomes or other liposomes known in the art, as a DNA-liposome mixture (see for example W09324640), calcium ions, viral proteins, polyanions, polycations, or nanoparticles, or other known transfection facilitating agents.
  • the transfection facilitating agent is a polyanion, polycation, including poly-L-glutamate (LGS), or lipid.
  • the DNA plasmids are delivered with genes for proteins which further enhance the immune response.
  • genes for proteins which further enhance the immune response are those which encode other cytokines and lymphokines such as alpha-interferon, gamma-interferon, platelet derived growth factor (PDGF), TNF a, TNFP, GM-CSF, epidermal growth factor (EGF), IL-l, IL-2, IL- 4, IL-5, IL-6, IL-10, IL-12, IL-18, MHC, CD80,CD86 and IL-15 including IL-15 having the signal sequence deleted and optionally including the signal peptide from IgE.
  • cytokines and lymphokines such as alpha-interferon, gamma-interferon, platelet derived growth factor (PDGF), TNF a, TNFP, GM-CSF, epidermal growth factor (EGF), IL-l, IL-2, IL- 4, IL-5, IL-6, IL-10, IL-12
  • genes which may be useful include those encoding: MCP-l, MIP-la, MIP-lp, IL-8, RANTES, L-selectin, P- selectin, E-selectin, CD34, GlyCAM-l, MadCAM-l, LFA-l, VLA-l, Mac-l, p 150.95, PEC AM, ICAM-l, ICAM-2, ICAM-3, CD2, LFA-3, M-CSF, G-CSF, IL-4, mutant forms of IL-18, CD40, CD40L, vascular growth factor, fibroblast growth factor, IL-7, nerve growth factor, vascular endothelial growth factor, Fas, TNF receptor, Fit, Apo-l, p55, WSL-l, DR3, TRAMP, Apo-3, AIR, LARD, NGRF, DR4, DR5, KILLER, TRAIL-R2, TRICK2, DR6, Caspase ICE, Fos, c-jun, Sp-l, Ap-
  • agents described herein When the agents described herein are administered as pharmaceuticals to humans or animals, they can be given per se or as a pharmaceutical composition containing active ingredient in combination with a pharmaceutically acceptable carrier, excipient, or diluent.
  • compositions of the invention can be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient.
  • agents or pharmaceutical compositions of the invention are administered in an amount sufficient to reduce or eliminate symptoms associated with viral infection and/or autoimmune disease.
  • composition comprising one or a plurality of nucleic acid molecules described herein preferably comprise DNA quantities of from about 1 nanogram to 10 milligrams; about 1 microgram to about 10 milligrams; or preferably about 0.1 microgram to about 10 milligrams; or more preferably about 100 microgram to about 1 milligram.
  • DNA plasmid vaccines according to the present invention comprise about 5 nanograms to about 1000 micrograms of DNA.
  • the DNA plasmid vaccines contain about 10 nanograms to about 800 micrograms of DNA.
  • the DNA plasmid vaccines contain about 0.1 to about 500 micrograms of DNA.
  • the DNA plasmid vaccines contain about 1 to about 350 micrograms of DNA. In some preferred embodiments, the DNA plasmid vaccines contain about 25 to about 250 micrograms of DNA. In some preferred embodiments, the DNA plasmid vaccines contain about 100 microgram to about 1 milligram DNA.
  • compositions according to the present invention are formulated according to the mode of administration to be used.
  • pharmaceutical compositions are injectable pharmaceutical compositions, they are sterile, pyrogen free and particulate free.
  • An isotonic formulation is preferably used.
  • additives for isotonicity can include sodium chloride, dextrose, mannitol, sorbitol and lactose.
  • isotonic solutions such as phosphate buffered saline are preferred.
  • Stabilizers include gelatin and albumin.
  • a vasoconstriction agent is added to the formulation.
  • the DNA formulations for use with a muscle or skin EP device described herein have high DNA concentrations, preferably concentrations that include microgram to tens of milligram quantities, and preferably milligram quantities, of DNA in small volumes that are optimal for delivery to the skin, preferably small injection volume, ideally 25-200 microliters (pL).
  • the DNA formulations have high DNA concentrations, such as 1 mg/mL or greater (mg DNA/volume of formulation). More preferably, the DNA formulation has a DNA concentration that provides for gram quantities of DNA in 200 pL of formula, and more preferably gram quantities of DNA in 100 pL of formula.
  • the DNA plasmids for use with the electroporation devices of the present invention can be formulated or manufactured using a combination of known devices and techniques, but preferably they are manufactured using an optimized plasmid manufacturing technique that is described in U.S. Patent Application Publication No. 20090004716, incorporated by reference in its entirety herein.
  • the DNA plasmids used in these studies can be formulated at concentrations greater than or equal to 10 mg/mL.
  • the manufacturing techniques also include or incorporate various devices and protocols that are commonly known to those of ordinary skill in the art, in addition to those described in U.S. Patent Application Publication No. 20090004716 and those described in U.S. Patent No. 7,238,522, incorporated by reference in their entireties herein.
  • the high concentrations of plasmids used with the skin electroporation devices and delivery techniques described herein allow for administration of plasmids into the ID/SC space in a reasonably low volume and aids in enhancing expression and immunization effects.
  • Preferred unit dosage formulations are those containing a daily dose or unit, daily sub- dose, as hereinabove recited, or an appropriate fraction thereof, of the administered ingredient.
  • the dosage regimen for treating a disorder or a disease with the tumor specific neo- antigenic peptides of this invention and/or compositions of this invention is based on a variety of factors, including the type of disease, the age, weight, sex, medical condition of the patient, the severity of the condition, the route of administration, and the particular compound employed. Thus, the dosage regimen may vary widely, but can be determined routinely using standard methods.
  • the amounts and dosage regimens administered to a subject will depend on a number of factors, such as the mode of administration, the nature of the condition being treated, the body weight of the subject being treated and the judgment of the prescribing physician.
  • the quantity of DNA included within therapeutically active formulations according to the present invention is an effective amount for treating the disease or condition. Determination of an effective amount is well within the capability of those skilled in the art, especially in light of the detailed disclosure provided herein. Generally, an efficacious or effective amount of an agent is determined by first administering a low dose of the agent(s) and then incrementally increasing the administered dose or dosages until a desired effect (e.g., reduce or eliminate symptoms associated with viral infection or autoimmune disease) is observed in the treated subject, with minimal or acceptable toxic side effects.
  • a desired effect e.g., reduce or eliminate symptoms associated with viral infection or autoimmune disease
  • Applicable methods for determining an appropriate dose and dosing schedule for administration of a pharmaceutical composition of the present invention are described, for example, in Goodman and Gilman's The Pharmacological Basis of Therapeutics, Goodman et al., eds., l lth Edition, McGraw-Hill 2005, and Remington: The Science and Practice of Pharmacy, 20th and 2lst Editions, Gennaro and ETniversity of the
  • the pharmaceutical composition is administered once daily; in other embodiments, the pharmaceutical composition is administered twice daily; in yet other embodiments, the pharmaceutical composition is administered once every two days, once every three days, once every four days, once every five days, once every six days, once every seven days, once every two weeks, once every three weeks, once every four weeks, once every two months, once every six months, or once per year.
  • the dosing interval can be adjusted according to the needs of individual patients. For longer intervals of administration, extended release or depot formulations can be used.
  • several divided dosages, as well as staggered dosages can be administered daily or sequentially, or the dose can be continuously infused, or can be a bolus injection. Further, the dosages of the compound(s) of the disclosure can be proportionally increased or decreased as indicated by the exigencies of the therapeutic or prophylactic situation.
  • the present disclosure also relates to methods for administration of the pharmaceutical compositions described herein using a prime-boost regimen.
  • the term of "prime- boost" refers to the successive administrations of two different immunogenic or immunological composition types having at least one immunogen in common.
  • the priming administration is the administration of a first immunogenic or immunological composition type and may comprise one, two or more administrations.
  • the boost administration is the administration of a second immunogenic or immunological composition type and may comprise one, two or more administrations, and, for instance, may comprise or consist essentially of annual administrations.
  • the “boost” may be administered from about 2 weeks to about 32 weeks after the “priming”, or from about 4 to about 30 weeks after the priming, or from about 8 to about 28 weeks after the priming, advantageously from about 16 to about 24 weeks after the priming, and more advantageously, about 24 weeks after the priming.
  • the pharmaceutical compositions described herein can be used to treat diseases and disease conditions that are acute, and may also be used for treatment of chronic conditions.
  • the pharmaceutical composition of the invention are administered for time periods exceeding two weeks, three weeks, one month, two months, three months, four months, five months, six months, one year, two years, three years, four years, or five years, ten years, or fifteen years; or for example, any time period range in days, months or years in which the low end of the range is any time period between 14 days and 15 years and the upper end of the range is between 15 days and 20 years (e.g., 4 weeks and 15 years, 6 months and 20 years).
  • treatment according to the invention is effective for at least two weeks, three weeks, one month, two months, three months, four months, five months, six months, one year, two years, three years, four years, or five years, ten years, fifteen years, twenty years, or for the remainder of the subject's life.
  • the pharmaceutical compositions described herein may be administered with one or more additional therapeutic agents.
  • any of the additional therapeutic agents is administered chronologically after or simultaneously with the DNA vaccine.
  • the additional therapeutic agent is administered 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 7 hours, 8 hours, 9 hours, 10 hours, 11 hours, 12 hours, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9, days, 10 days, 11 days, 12 days, 13 days, 14 days, 15 days, 16 days, 17 days, 18 days, 19 days, 20 days, 21 days, 22 days, 23 days, 24 days, 25 days, 26 days, 27 days,
  • the additional therapeutic agent is administered 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 7 hours, 8 hours, 9 hours, 10 hours, 11 hours, 12 hours, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9, days,
  • the method further comprises administering an adjuvant to the subject.
  • Administration may be either prior to, simultaneously with, or after treatment with the DNA vaccine or immunogenic compositions described herein.
  • Effective vaccine or immunogenic compositions described herein may include a strong adjuvant to initiate an immune response.
  • the adjuvant is selected from the group consisting of poly-ICLC, 1018 ISS, aluminum salts, Amplivax. AS15, BCG, CP- 870,893, CpG7909, CyaA, GM-CSF, IC30, IC31 , Imiquimod, ImuFact 1MP321 , IS Patch, ISS, ISCOMATRIX, Juvlmmune, LipoVac, monophosphoryf lipid A, Montanide IMS 1312, Montanide ISA 206, Montanide ISA 50V, Montanide ISA-51, OK-432, OM-174, OM-197-MP-EC, ONTAK, PEPTEL, vector system, PLGA micropartieles, resiquimod, S L172, Virosomes and other Virus-like particles, YF-17D, VEGF trap, R848, beta-gluean, Pam3Cys, acrylic or methacrylic polymers, copolymers of maleic anhydr
  • poly-ICLC an agonist of TLR3 and the RNA helicase -domains of MDA5 and RIG3, has shown several desirable properties for a vaccine or immunogenic composition adjuvant. These properties include the induction of local and systemic activation of immune cells in vivo, production of stimulatory chemokines and cytokines, and stimulation of antigen-presentation by DCs. Furthermore, poly-ICLC can induce durable CD4+ and CD 8+ responses in humans. Importantly, striking similarities in the upregulation of transcriptional and signal transduction pathways were seen in subjects vaccinated with poly-ICLC and in volunteers who had received the highly effective, replication-competent yellow fever vaccine.
  • poly- ICLC ovarian carcinoma patients immunized with poly- ICLC in combination with a NY- ESO-l peptide vaccine (in addition to Montanide) showed induction of CD4+ and CD8+ T cell, as well as antibody responses to the peptide in a recent phase 1 study.
  • poly- ICLC has been extensively tested in more than 25 clinical trials to date and exhibited a relatively benign toxicity profile.
  • the neoantigen vaccines of the present disclosure may be combined with an adjuvant (e.g., poly- ICLC).
  • these neoantigens are expected to bypass central thymic tolerance (thus allowing stronger anti-tumor T cell response), while reducing the potential for autoimmunity (e.g., by avoiding targeting of normal self- antigens).
  • TLRs Toll-like receptors
  • poly-ICLC a synthetic double- stranded RNA mimic
  • poly-ICLC has been shown to be safe and to induce a gene expression profile in peripheral blood cells comparable to that induced by one of the most potent live attenuated viral vaccines, the yellow fever vaccine YF-17D (Caskey et al, Synthetic double- stranded RNA induces innate immune responses similar to a live viral vaccine in humans J Exp Med 208:2357 (201 1)).
  • YF-17D Yellow fever vaccine
  • other adjuvants described herein are envisioned.
  • a combination of any one or more (e.g. 1, 2, 3, 4, 5 or more) adjuvants can be used in combination with the DNA vaccine or immunogenic compositions described herein.
  • the pharmaceutical composition comprising a first plasmid encoding one or a plurality of neoantigens and a second and/or third and/or fourth plasmid, each second, third or fourth plasmid comprising a nucleic acid sequence encoding a cytokine or functional fragment thereof.
  • the method further comprises administering a checkpoint inhibitor to the subject.
  • Administration may be either prior to, simultaneously with, or after treatment with the DNA vaccine or immunogenic compositions described herein.
  • T cells play a central role in cell-mediated immunity.
  • Checkpoint proteins interact with specific ligands which send a signal into the T cell and essentially switch off or inhibit T cell function.
  • Cancer cells take advantage of this system by driving high levels of expression of checkpoint proteins on their surface which results in control of the T cells expressing checkpoint proteins on the surface of T cells that enter the tumor microenvironment, thus suppressing the anticancer immune response. As such, inhibition of checkpoint proteins would result in restoration of T cell function and an immune response to the cancer cells.
  • Checkpoint inhibitors include any agent that blocks or inhibits the inhibitory pathways of the immune system. Such inhibitors may include small molecule inhibitors or may include antibodies, or antigen binding fragments thereof, that bind to and block or inhibit immune checkpoint receptors or antibodies that bind to and block or inhibit immune checkpoint receptor ligands.
  • Illustrative checkpoint molecules that may be targeted for blocking or inhibition include, but are not limited to, CTLA-4, PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, GAL9, LAG3, TIM3, VISTA, KIR, 2B4 (belongs to the CD2 family of molecules and is expressed on all NK, gd, and memory CD8+ (ab) T cells), CD160 (also referred to as BY55), CGEN-15049, CHK 1 and CHK2 kinases, A2aR and various B-7 family ligands.
  • B7 family ligands include, but are not limited to, B7- 1, B7-2, B7-DC, B7-H1, B7-H2, B7-H3, B7-H4, B7-H5, B7-H6 and B7- H7.
  • Checkpoint inhibitors include antibodies, or antigen binding fragments thereof, other binding proteins, biologic therapeutics or small molecules, that bind to and block or inhibit the activity of one or more of CTLA-4, PDL1, PDL2, PD1, BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD 160 and CGEN- 15049.
  • Illustrative immune checkpoint inhibitors include
  • Tremelimumab (CTLA-4 blocking antibody), anti-OX40, PD-L1 monoclonal Antibody (Anti -B 7- Hl; MED 14736), MK-3475 (PD-l blocker), Nivolumab (anti-PDl antibody), CT- 011 (anti-PDl antibody), BY55 monoclonal antibody, AMP224 (anti-PDLl antibody), BMS- 936559 (anti- PDL1 antibody), MPLDL3280A (anti-PDLl antibody), MSB0010718C (anti- PDL1 antibody) and Yervoy/ipilimumab (anti-CTLA-4 checkpoint inhibitor).
  • Checkpoint protein ligands include, but are not limited to PD-L1, PD-L2, B7-H3, B7-H4, CD28, CD86 and TIM-3.
  • the present disclosure covers the use of a specific class of checkpoint inhibitor are drugs that block the interaction between immune checkpoint receptor programmed cell death protein 1 (PD-l) and its ligand PDL-l.
  • PD-l immune checkpoint receptor programmed cell death protein 1
  • PDL-l programmed cell death protein 1
  • PD-l is expressed on and regulates the activity of T-cells. Specifically, when PD-l is unbound to PDL-l, the T-cells can engage and kill target cells. However, when PD-l is bound to PDL-l it causes the T-cells to cease engaging and killing target cells.
  • PD-l acts proximately such the PDLs are overexpresseed directly on cancer cells which leads to increased binding to the PD-l expressing T-cells.
  • checkpoint inhibitors which are antibodies that can act as agonists of PD-l, thereby modulating immune responses regulated by PD-l.
  • the anti -PD-l antibodies can be antigen-binding fragments.
  • Anti -PD-l antibodies disclosed herein are able to bind to human PD-l and agonize the activity of PD-l, thereby inhibiting the function of immune cells expressing PD-l.
  • Suitable anti-CTLA4 antagonist agents for use in the methods of the invention include, without limitation, anti-CTLA4 antibodies, human anti-CTLA4 antibodies, mouse anti-CTLA4 antibodies, mammalian anti- CTLA4 antibodies, humanized anti-CTLA4 antibodies, monoclonal anti-CTLA4 antibodies, polyclonal anti-CTLA4 antibodies, chimeric anti-CTLA4 antibodies, MDX-010 (ipilimumab), tremelimumab, anti-CD28 antibodies, anti-CTLA4 adnectins, anti-CTLA4 domain antibodies, single chain anti-CTLA4 fragments, heavy chain anti-CTLA4 fragments, light chain anti-CTLA4 fragments, inhibitors of CTLA4 that agonize the co-stimulatory pathway, the antibodies disclosed in PCT Publication No.
  • CTLA-4 antibodies are described in U.S. Pat. Nos. 5,811,097, 5,855,887, 6,051,227, and 6,984,720; in PCT Publication Nos. WO 01/14424 and WO 00/37504; and in U.S. Publication Nos. 2002/0039581 and 2002/086014.
  • Other anti-CTLA-4 antibodies that can be used in a method of the present invention include, for example, those disclosed in: WO 98/42752; U.S. Pat.
  • Additional anti-CTLA4 antagonists include, but are not limited to, the following: any inhibitor that is capable of disrupting the ability of CD28 antigen to bind to its cognate ligand, to inhibit the ability of CTLA4 to bind to its cognate ligand, to augment T cell responses via the co- stimulatory pathway, to disrupt the ability of B7 to bind to CD28 and/or CTLA4, to disrupt the ability of B7 to activate the co-stimulatory pathway, to disrupt the ability of CD80 to bind to CD28 and/or CTLA4, to disrupt the ability of CD80 to activate the co-stimulatory pathway, to disrupt the ability of CD86 to bind to CD28 and/or CTLA4, to disrupt the ability of CD86 to activate the co- stimulatory pathway, and to disrupt the co- stimulatory pathway, in general from being activated.
  • the present disclosure covers the use of a specific class of checkpoint inhibitor drugs that inhibit TIM-3.
  • TIM-3 has been identified as an important inhibitory receptor expressed by exhausted CD8+ T cells.
  • TIM-3 has also been reported as a key regulator of nucleic acid mediated antitumor immunity.
  • TIM-3 has been shown to be upregulated on tumor-associated dendritic cells (TADCs).
  • a check point inhibitor and DNA vaccine or immunogenic composition described herein can be more effective in treating cancer in some subjects and/or can initiate, enable, increase, enhance or prolong the activity and/or number of immune cells (including T cells, B cells, NK cells and/or others) or convey a medically beneficial response by a tumor (including regression, necrosis or elimination thereof).
  • a combination of any one or more (e.g. 1, 2, 3, 4, 5 or more) checkpoint inhibitors can be used in combination with the DNA vaccine or immunogenic compositions described herein.
  • the method further comprises administering one or more immunostimulatory agents to the subject. Administration may be either prior to, simultaneously with, or after treatment with the DNA vaccine or immunogenic compositions described herein.
  • the present invention is directed to the use of immunostimulatory agents, including T cell growth factors and interleukins.
  • Immunostimulatory agents are substances (drugs and nutrients) that stimulate the immune system by inducing activation or increasing activity of any of its components. Immunostimulants include bacterial vaccines, colony stimulating factors, interferons, interleukins, other immunostimulants, therapeutic vaccines, vaccine combinations and viral vaccines.
  • T cell growth factors are proteins which stimulate the proliferation of T cells.
  • T cell growth factors include 11-2, IL-7, IL-15, IL-17, IL-21 and IL-33.
  • Interleukins are a group of cytokines that were first seen to be expressed by white blood cells. The function of the immune system depends in a large part on interleukins, and rare deficiencies of a number of them have been described, all featuring autoimmune diseases or immune deficiency. The majority of interleukins are synthesized by helper CD4 T lymphocytes, as well as through monocytes, macrophages, and endothelial cells. They promote the
  • interleukins include IL-l, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-l l, IL-12, IL- 13, IL-l 4, IL-l 5 and IL-17.
  • the interleukin is IL-12.
  • the DNA plasmids are delivered with immunostimulatory agents that are genes for proteins which further enhance the immune response against such target proteins.
  • immunostimulatory agents that are genes for proteins which further enhance the immune response against such target proteins.
  • genes are those which encode other cytokines and lymphokines such as alpha-interferon, gamma-interferon, platelet derived growth factor (PDGF), TNF a, TNFp, GM-CSF, epidermal growth factor (EGF), IL-l, IL-2, IL-4, IL-5, IL-6, IL-10, IL-12, IL-18, MHC, CD80,CD86 and IL-15 including IL-15 having the signal sequence deleted and optionally including the signal peptide from IgE.
  • cytokines and lymphokines such as alpha-interferon, gamma-interferon, platelet derived growth factor (PDGF), TNF a, TNFp, GM-CSF, epidermal growth factor (EGF), IL
  • genes which may be useful include those encoding: MCP-l, MTP-la, MIP-lp, IL-8, RANTES, L-selectin, P-selectin, E-selectin, CD34, GlyCAM-l, MadCAM-l, LFA-l, VLA-l, Mac-l, pl50.95, PECAM, ICAM-l, ICAM-2, ICAM-3, CD2, LFA-3, M-CSF, G-CSF, IL-4, mutant forms of IL-l 8, CD40, CD40L, vascular growth factor, fibroblast growth factor, IL-7, nerve growth factor, vascular endothelial growth factor, Fas, TNF receptor, Fit, Apo-l, p55, WSL-l, DR3, TRAMP, Apo-3, AIR, LARD, NGRF, DR4, DR5, KILLER, TRAIL-R2, TRICK2, DR6, Caspase ICE, Fos, c-jun, Sp-l, Ap
  • a combination of any one or more (e.g. 1, 2, 3, 4, 5 or more) immunostimulatory agents can be used in combination with the DNA vaccine or immunogenic compositions described herein.
  • the method further comprises administering a
  • chemotherapeutic agent targeted therapy or radiation to the subject.
  • Administration may be either prior to, simultaneously with, or after treatment with the DNA vaccine or immunogenic compositions described herein.
  • cancer therapeutic agents or chemotherapeutic agents include alkylating agents such as thiotepa and cyclophosphamide (CYTOXAN); alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethylenethiophosphaoramide and trimethylolomelamine; nitrogen mustards such as chlorambucil, chlomaphazine, cholophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterine, prednimustine, trofosfamide, uracil mustard; nitrosureas such as carmus
  • elliptinium acetate etoglucid; gallium nitrate; hydroxyurea; lentinan; lonidamine; mitoguazone; mitoxantrone; mopidamol; nitracrine; pentostatin; phenamet; pirarubicin; podophyllinic acid; 2- ethylhydrazide; procarbazine; PSK.RTM.; razoxane; sizofiran; spirogermanium; tenuazonic acid; triaziquone; 2, 2',2"-trichlorotriethylamine; urethan; vindesine; dacarbazine; mannomustine; mitobronitol; mitolactol; pipobroman; gacytosine; arabinoside ("Ara-C"); cyclophosphamide; thiotepa; taxoids, e.g.
  • paclitaxel TAXOLTM, Bristol-Myers Squibb Oncology, Princeton, N.J.
  • TAXOTEPvETM Pvhne-Poulenc Rorer, Antony, France
  • chlorambucil TAXOLTM, Bristol-Myers Squibb Oncology, Princeton, N.J.
  • gemcitabine 6- thioguanine; mercaptopurine; methotrexate; platinum analogs such as cisplatin and carboplatin; vinblastine; trastuzumab, docetaxel, platinum; etoposide (VP- 16); ifosfamide; mitomycin C; mitoxantrone; vincristine; vinorelbine; navelbine; novantrone; teniposide;
  • daunomycin aminopterin
  • xeloda ibandronate
  • CPT-l 1 topoisomerase inhibitor RFS 2000
  • difluoromethylomithine (DMFO) retinoic acid derivatives such as TargretinTM (bexarotene), PanretinTM (alitretinoin); ONTAKTTM (denileukin diftitox); esperamicins; capecitabine; and pharmaceutically acceptable salts, acids or derivatives of any of the above.
  • DMFO difluoromethylomithine
  • retinoic acid derivatives such as TargretinTM (bexarotene), PanretinTM (alitretinoin); ONTAKTTM (denileukin diftitox); esperamicins; capecitabine; and pharmaceutically acceptable salts, acids or derivatives of any of the above.
  • anti-hormonal agents that act to regulate or inhibit hormone action on tumors
  • anti-estrogens including for example tamoxifen, raloxifene, aromatase inhibiting 4(5)- imidazoles, 4-hydroxytamoxifen, trioxifene, keoxifene, LY 1 17018, onapristone, and toremifene (Fareston); and anti-androgens such as flutamide, nilutamide, bicalutamide, leuprolide, and goserelin; and pharmaceutically acceptable salts, acids or derivatives of any of the above.
  • cancer therapeutic agents include sorafenib and other protein kinase inhibitors such as afatinib, axitinib, bevacizumab, cetuximab, crizotinib, dasatinib, erlotinib, fostamatinib, gefitinib, imatinib, lapatinib, lenvatinib, mubritinib, nilotinib, panitumumab, pazopanib, pegaptanib, ranibizumab, ruxolitinib, trastuzumab, vandetanib, vemurafenib, and sunitinib; sirolimus (rapamycin), everolimus and other mTOR inhibitors.
  • protein kinase inhibitors such as afatinib, axitinib, bevacizumab, cetuximab, crizotinib, dasatinib,
  • chemotherapeutic agents include topoisomerase I inhibitors (e.g., irinotecan, topotecan, camptothecin and analogs or metabolites thereof, and doxorubicin);
  • topoisomerase II inhibitors e.g., etoposide, teniposide, and daunorubicin
  • alkylating agents e.g., melphalan, chlorambucil, busulfan, thiotepa, ifosfamide, carmustine, lomustine, semustine, streptozocin, decarbazine, methotrexate, mitomycin C, and cyclophosphamide
  • intercalators e.g., cisplatin, oxaliplatin, and carboplatin
  • DNA intercalators and free radical generators such as bleomycin
  • nucleoside mimetics e.g., 5- fluorouracil, capecitibine, gemcitabine, fludarabine, cytarabine, mercaptopurine, thioguanine, pentostatin, and
  • chemotherapeutic agents that disrupt cell replication include: paclitaxel, docetaxel, and related analogs; vincristine, vinblastin, and related analogs; thalidomide, lenalidomide, and related analogs (e.g., CC-5013 and CC- 4047); protein tyrosine kinase inhibitors (e.g., imatinib mesylate and gefitinib); proteasome inhibitors (e.g., bortezomib); NF-kB inhibitors, including inhibitors of IKB kinase; antibodies which bind to proteins overexpressed in cancers and other inhibitors of proteins or enzymes known to be upregulated, over-expressed or activated in cancers, the inhibition of which downregulates cell replication.
  • paclitaxel, docetaxel, and related analogs e.g., vincristine, vinblastin, and related analogs
  • thalidomide e.g., lenalidomide,
  • a combination of any one or more (e.g. 1, 2, 3, 4, 5 or more) chemotherapeutic agents can be used in combination with the DNA vaccine or immunogenic compositions described herein.
  • the subject nucleic acid molecules, and compositions comprising the nucleic acid molecules, of the disclosure can be used alone.
  • the present invention is directed to an immunogenic composition, e.g., a vaccine, composition comprising the nucleic acid molecules described herein, capable of raising an immune response, and in particular a specific T-cell response.
  • an immunogenic composition e.g., a vaccine, composition comprising the nucleic acid molecules described herein, capable of raising an immune response, and in particular a specific T-cell response.
  • DNA vaccines are described in US. Patent Nos. 5,593,972, 5,739,118, 5,817,637, 5,830,876, 5,962,428, 5,981,505, 5,580,859, 5,703,055, 5,676,594, and the priority applications cited therein, which are each incorporated herein by reference.
  • alternative methods of delivering DNA are described in US. Patent Nos. 4,945,050 and 5,036,006, which are both incorporated herein by reference.
  • the vaccine composition comprises mutant neo-antigenic nucleic acid molecules as described herein (e.g. comprising a nucleic acid sequence comprising the formula: [ (antigen expression domain 1) - (linker) - (antigen expression domain 2) - (linker)] n), corresponding to tumor specific neo-antigens identified by the methods described herein.
  • a suitable vaccine will preferably contain a plurality of tumor specific neo-antigenic nucleic acid molecules.
  • the vaccine will include between about 1 to about 200 nucleic acid molecules, between about 2 to about 100 nucleic acid molecules, between about 2 to about 58 nucleic acid molecules, between about 2 to about 29 nucleic acid molecules.
  • the vaccine will include about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 nucleic acid molecules.
  • the vaccine will include about 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49 or 50 nucleic acid molecules.
  • the vaccine will include about 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69 or 70 nucleic acid molecules.
  • the vaccine will include about 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73,74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89 or 90 nucleic acid molecules.
  • the vaccine will include about 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94,
  • the vaccine composition is capable of enhancing a CD8+ T cell immune response in a subject.
  • enhancing the CD8+ T cell immune response comprises activating CD8+ T cells.
  • enhancing the CD8+ T cell immune response comprises expanding CD8+ T cells.
  • the vaccine composition is capable of raising a specific cytotoxic T-cells response and/or a specific helper T- cell response.
  • the vaccine composition can further comprise an adjuvant and/or a carrier.
  • Adjuvants are described herein, and are any substance whose admixture into the vaccine composition increases or otherwise modifies the immune response to the mutant peptide.
  • Carriers are scaffold structures, for example a polypeptide or a polysaccharide, to which the neo- antigenic peptides, is capable of being associated.
  • adjuvants are conjugated covalently or non-covalently to the peptides or polypeptides of the invention.
  • an adjuvant to increase the immune response to an antigen is typically manifested by a significant increase in immune-mediated reaction, or reduction in disease symptoms.
  • an increase in humoral immunity is typically manifested by a significant increase in the titer of antibodies raised to the antigen
  • an increase in T-cell activity is typically manifested in increased cell proliferation, or cellular cytotoxicity, or cytokine secretion.
  • An adjuvant may also alter an immune response, for example, by changing a primarily humoral or Th2 response into a primarily cellular, or Thl response. Suitable adjuvants are described herein.
  • a vaccine composition according to the present invention may comprise more than one different adjuvant.
  • the invention encompasses a therapeutic composition comprising any adjuvant substance including any of the above or combinations thereof. It is also contemplated that the nucleic acid molecule, and the adjuvant can be administered separately in any appropriate sequence.
  • Cytotoxic T-cells recognize an antigen in the form of a peptide bound to an MHC molecule rather than the intact foreign antigen itself.
  • the MHC molecule itself is located at the cell surface of an antigen presenting cell.
  • an activation of CTLs is only possible if a trimeric complex of peptide antigen, MHC molecule, and APC is present. Therefore, in some embodiments the vaccine composition according to the present invention additionally contains at least one antigen presenting cell.
  • the antigen-presenting cell typically has an MHC class I or II molecule on its surface, and In some embodiments is substantially incapable of itself loading the MHC class I or II molecule with the selected antigen.
  • the antigen presenting cells are dendritic cells.
  • the dendritic cells are autologous to a subject.
  • the antigen presenting cell comprises an expression construct comprising the nucleic acid molecules of the present invention. The nucleic acid molecules are capable of transducing the dendritic cell, thus resulting in the presentation of a peptide and induction of immunity.
  • the disclosure features a method of making an individualized cancer vaccine for a subject suspected of having or diagnosed with a cancer, comprising identifying a plurality of mutations in a sample from the subject; analyzing the plurality of mutations to identify one or more neoantigen mutations; and producing, based on the identified subset, a personalized cancer vaccine.
  • identifying comprises sequencing the cancer. Methods for carrying out sequencing are described herein.
  • identifying comprises sequencing the cancer.
  • analyzing further comprises determining one or more binding characteristics associated with the neoantigen mutation, the binding characteristics selected from the group consisting of binding of the subject-specific peptides to T-cell receptor, binding of the subject-specific peptides to a HLA protein of the subject and binding of the subject-specific peptides to transporter associated with antigen processing (TAP); and ranking, based on the determined characteristics, each of the neo-antigenic mutations.
  • TAP antigen processing
  • the method further comprises cloning nucleic acid sequences encoding the one or plurality of neoantigen mutations into a nucleic acid molecule.
  • the nucleic acid molecule is a plasmid.
  • the nucleic acid molecule comprises a nucleic acid sequence of Formula I that is positioned within the multiple cloning site of a plasmid selected from the group consisting of selected from the group consisting of pGX450l, pGX4503, pGX 4504, pGX4505, and pGX4506.
  • the nucleic acid sequence of Formula I is positioned with the multiple cloning site of pGX450l.
  • the nucleic acid sequence of Formula I is positioned with the multiple cloning site of a plasmid selected from the group consisting of pGX4503.
  • the nucleic acid sequence of Formula I is positioned with the multiple cloning site of a plasmid selected from the group consisting of ppGX 4504. In some embodiments, the nucleic acid sequence of Formula I is positioned with the multiple cloning site of a plasmid selected from the group consisting of pGX4505. In some embodiments, the nucleic acid sequence of Formula I is positioned with the multiple cloning site of a plasmid selected from the group consisting of pGX4506. In some embodiments, the plasmid is pGX4505. In some embodiments, the plasmid comprises the backbone and linker sequence of pGX4505 with at least two or more AED nucleotide sdequence encoding one or more neoantigens from a subject. Kits
  • kits comprising a pharmaceutical composition comprising one or a plurality of nucleic acid molecules as described herein.
  • the components of the kit are preferably formulated in pharmaceutically acceptable carriers.
  • kits are instructions for use in methods of treating cancer in a subject or enhancing a CD8+ T cell immune response in a subject.
  • mice were purchased from Jackson labs.
  • TC1 and LLC tumors were generated by injecting 100,000 cells subcutaneously.
  • ID8 tumors were generated by injecting 2 million cells intraperitoneally.
  • Mice were treated by injecting 25pg of DNA resuspended in 30pL of water into the tibialis anterior muscle followed by electroporation with the CELLECTRA-3P device (Inovio Pharmaceuticals). For each immunization, mice were delivered two 0.1 Amp electric constant current square-wave pulses.
  • the mouse exome and RNA sequencing were performed on Illumina HiSeq-2500 platform.
  • the SureSelect Mouse All Exon Kit (Agilent Technologies, ETSA) was used. All samples generated greaterl3 Gb of data, with greater than 98% of the exomes covered at >150C.
  • RNA sequencing was performed using TrueSeq RNA library prep kit v2 (Illumina, ETSA). All samples generated >100 million reads. Reads mapping to ribosomal and mitochondrial genome were removed before performing alignment. The reads were aligned using STAR (2.4.1) aligner. Overall 96-98% of the total pre-processed reads mapped to the reference gene model/genome. The gene expression was estimated using Cufflinks v2.2. l.
  • Neoepitopes were prioritized from non-synonymous coding missense and frameshift mutants, where the mutant allele expression >1 FPKM.
  • MHC class I binding analysis was performed for all coding missense and frameshift mutations.
  • 9-mer peptides were processed using NetMHCons vl.l on the C57B1/6 MHC alleles (H-2-Kb,H-2-Db).
  • Peptides were further prioritized based on lower proteasomal processing score using NetChop3.l (IEDB). Peptides showing a score >0.7 were selected.
  • Peptides were scored for TAP binding and peptides having binding affinity ⁇ 0.5 were prioritized.
  • Neoantigen vaccines were designed by selecting the predicted neoantigens from the DNA and RNA sequencing data obtained from the TC1, LLC and ID8 established tumors. Twelve epitopes were included, defined as the predicted sequence that would bind to H2-K(b) or H2- D(b), keeping the mutated amino acid in the central position and keeping 12 non-mutated amino acids flanking on each side. Twelve 33-mers were concatenated with furin cleavage sites and each construct was subcloned into the pVaxl plasmid (GenScript).
  • FIG. 28 is a map of the 2999 basepair backbone vector plasmid pVAXl (Invitrogen, Carlsbad Calif.). The CMV promoter is located at bases 137-724. The T7 promoter/priming site is at bases 664-683. Multiple cloning sites are at bases 696-811. Bovine GH polyadenylation signal is at bases 829-1053. The CMV promoter is located at bases 137-724
  • Kanamycin resistance gene is at bases 1226-2020.
  • the pUC origin is at bases 2320-2993.
  • BD LSRII flow cytometer (BD Biosciences) was used.
  • Anti-mouse antibodies used were directly fluorochrome conjugated. The following antibodies were used: CD3e (17A2), CD4 (RM4-5), CD 8b (YTS 156.7.7), Interferon-g (XMG1.2), TNFa (MP6-XT22), Interleukin-2 (JES6-5H4), and T-bet (4B10), all from Biolegend. Live/dead exclusion was done with Violet viability kit (Invitrogen).
  • neoantigen peptides 5pg/mL
  • Golgi-stop protein transport inhibitor BD biosciences
  • CDl07a antibody 1D4B
  • Splenocytes were harvested and coincubated with each neoantigen derived peptide pool comprising l5-mers overlapping by 9 amino acids. After a 24 hour incubation, mouse interferon- g ELISPOT was performed according to the manufacturer’s instructions (Mabtech). Spots were read using an ImmunoSpot CTL reader, and spot forming units (SFU) were calculated by subtracting media alone wells from stimulated wells. Concanavalin A was used as a positive control (not shown) to ensure spot development.
  • Splenocytes were harvested from vaccinated mice and pulsed with 5ug/ml of neoantigen specific peptides and 30UI/ml of IL-2.
  • Peptides and IL-2 (Peprotech) were refreshed with irradiated (4000 rad) splenocytes from naive mice (1 :3-10 T-cell :splenocyte ratio) once a week. 4-6 weeks after initiating the T-cell expansion, splenocytes were cocultured with the tumor cells for performing in vitro cytotoxicity experiments.
  • luciferase transduced TC1 or ID8 cells were plated per well in a 96-well plate. 18 hours later, the cells were coincubated for 24 hours with 10 or 50,000 in vitro expanded T-cells. Cytotoxicity was measured using CYTOTOX-GLO Cytotoxicity Assay (Promega), according to the manufacturer’s instructions. Cytotoxicity was reported as a ratio of luciferase expression in the T cell containing study wells divided by luciferase expression in the wells with tumor cells only (no T cells).
  • C57B1/6 mice were implanted with three different tumor types: LLC and TC1, mouse lung tumor models, as well as ID8, a mouse ovarian tumor model. LLC and TC1 tumor cells were injected subcutaneously, and ID8 tumor cells into the peritoneum. After 3 weeks, tumors were harvested and DNA and RNA isolation was performed, as well as exome and RNA sequencing (FIG. 1 A). DNA and RNA sequencing of cell lines cultured in vitro to the same cell lines implanted into mice (FIG. 5). Mutations that were expressed with an Alt allele depth in RNA-seq >1, a proteasomal cleavage score of >10, and a TAP processing score ⁇ 0.5 (see methods for more detail) were included. As previously reported (13), a substantial proportion of mutations were differently expressed in tumors compared to cell lines, indicating differential expression of these genes in the context of the three-dimensional tumor microenvironment (FIG.
  • the seven plasmids are as follows:
  • FIG. 2C nucleotide sequence
  • FIG. 2D amino acid sequence
  • TC1 Plasmid #2 is shown in FIG. 3C (nucleotide sequence) and FIG. 3D (amino acid sequence).
  • FIG. 4A nucleotide sequence
  • FIG. 4B amino acid sequence
  • ID8 Plasmid #2 is shown in FIG. 4C (nucleotide sequence) and FIG. 4D (amino acid sequence).
  • the threshold for immunoreactivity was set to be > 30 spot forming units per million splenocytes by IFNy ELISpot against the peptides corresponding to the mutated peptide.
  • epitopes classified as immunogenic required responses to the mutant peptide that were statistically significantly higher than those induced by mice immunized with control pVax plasmid. Using these criteria, 12/36 epitopes were identified from the LLC model, 3/24 epitopes were identified from the TC1 tumor model, and 5/24 epitopes were identified from the ID8 model that were immunogenic when delivered using DNA vaccines (FIG. 1E).
  • DNA vaccines generate predominantly CD8 + T cell responses to neoantigens
  • Intracellular staining and flow cytometry were performed to determine which of these epitopes generated CD8 + T cell responses, CD4 + T cell responses, or both (FIG. 6A-F).
  • FIG. 9A and FIG. 9B Both netMHCII-l .1 (SMM align) and netMHCII-2.2 (NN align) prediction programs were tested, and it was found that neither program had demonstrable power to specifically predict CD4 + T cell epitopes.
  • the SMM align prediction program did not predict immunogenic epitopes (28.6% of the epitopes with ⁇ 500nM binding affinity generated immune responses, FIG. 9A).
  • the NN align program did select for immunogenic epitopes (37.5% of epitopes with ⁇ 500nM binding affinity generated immune responses), this program did not specifically select for CD4 + T cell responses (FIG.9B).
  • Immune responses generated from the immunized mice against the corresponding wild- type (non-mutated) neoantigen epitope were compared. It was found that the majority of immune responses are specific to the mutated epitope rather than the wild-type epitope (FIG. 10A and FIG. 10B). 75% of immune responses generated were at least 1.5 fold higher for the mutated epitope compared to the wild-type epitope. The remaining 25% of immune responses were similar when comparing mutant versus wild-type epitopes (FIG. 10B). These results are similar to what has been previously reported for neoantigen SLP vaccines, in which 68.8% of responses were specific to the mutated epitope (Castle et al. American Association for Cancer Research; 2012;72: 1081-91).
  • MHC class II Although physiological expression of MHC class II is restricted to antigen presenting cells, some tumors in both humans and mice express this presenting protein complex, allowing for CD4 + direct recognition. To determine if there was potential direct recognition and potential cytotoxicity by CD4 + T cells, MHC class II was measured in the tumor cells. It was found that, unlike B 16 melanoma or ID8, TC1 and LLC cells did not have MHC class II expression upon incubation with various doses of IFNy (FIG. 11E and FIG. 12), and therefore tumor killing must occur through an MHC class I restricted mechanism.
  • mice were implanted with the TC1 cell line, and 7 days later the mice were vaccinated with weekly doses of the dodecamer vaccine Plasmid 1 (containing the immunogenic neoantigens Sgsm2 and
  • neoantigen-specific CD4 + T cells were likely not as effective at delaying tumor progression in this TC1 tumor model, because the TC1 cells do not express MHC class II (FIG. 11E).
  • the level of expression of the Lta4h neoantigen was relatively low (FIG.l 1D) compared to the neoantigens present in Plasmid 1.
  • Examples 1-5 describe for the first time the possibility of generating effective anti -turn or immune responses against cancer neoantigens using DNA based vaccines.
  • the DNA vaccine platform has several a priori advantages over other assayed platforms for generating effective anti-tumor neoantigen vaccines such as speed of vaccine production, vaccine stability and manufacturing cost. Time is a critical factor in cancer treatment. Even patients with surgically resectable tumors are at risk for development of micrometastases with potentially immune suppressive microenvironments. Therefore, the speed in which a personalized vaccine can be manufactured is of paramount importance.
  • DNA vaccine production is more rapid than other platforms because it does not require complex peptide synthesis or RNA in vitro transcription. Furthermore, DNA is stable at room temperature, and, unlike RNA and peptide vaccines, does not require a cold chain. This ease of manufacturing and transport contributes to the much lower cost of DNA vaccines, making it an ideal technology for personalized patient specific therapeutic applications.
  • CD8 + T cells are thought to be the major mediators of anti -tumor T cell responses.
  • DNA vaccines are able to generate robust CD8 + T cell responses. Examples 1-5 show that, as expected, DNA encoded neoantigens predicted for high MHCI binding generated CD8 + or CD8 + /CD4 + neoantigen specific immune responses.
  • RNA and peptide-based vaccines generated based on predicted MHCI restricted responses have surprisingly resulted in MHCII-restricted responses (Ott et al. 2017; Sahin et al. 2017).
  • MHCI presentation of epitopes requires intracellular protein synthesis and proteasomal degradation (Rock et al. Trends Immunol. 2017). Synthetic long peptides are injected directly into tissues, and therefore are primarily engulfed and presented by antigen presenting cells, which will skew them towards a class II presentation. In the case of RNA and DNA, peptide synthesis occurs in the cell and can be cleaved as necessary by the proteasome and enter the MHC class I pathway. The strong CD4 + bias from RNA vaccines could be due to the pro-inflammatory properties of RNA.
  • RNA is sensed by multiple innate immune receptors such as TLR3,7,8 and RIG-I like receptors which promote pro-inflammatory cytokine production (for instance, IL-6 or TNFa) (Pardi et al. Nat Rev Drug Discov. 2018).
  • This inflammatory response can be detrimental to CD8 + activation and cytokine production (Wu et al. Sci Rep. 2015), and can additionally inhibit mRNA replication, stall translation and result in RNA degradation (Pardi et al. 2018; J Virol. 2012;86:2900-10).
  • CD4 + T cells can generate anti-tumor cytotoxicity.
  • CD4 + T cells can exert direct cytotoxicity based on granule exocytosis or Fas-Fas ligand pathway upon recognition of MHC class II-peptide complex (Fang et al. Proc Natl Acad Sci U S A. 201;
  • neoantigens in cancer varies widely according to the tumor type but has been defined to be approximately between 33 and 163 expressed, non-synonym ous mutations (Vogelstein 2013).
  • Using the described DNA platform to generate neoantigen based vaccines allows the encoding of a high number of neoantigens in each plasmid. Considering the insert size (33aa) and the linker (7aa), a vaccine with 50 neoantigens would only require an insert of 6150 bp. This would permit possible immunization of all identified neoantigens in most cancer patients using only one plasmid.
  • neoantigens could be included using 2 or 3 plasmids. This strategy would increase exponentially the ability to generate a wide range of anti-tumor T-cell responses. Because driver mutations are rarely immunogenic, and immunogenic neoantigens typically occur as passenger mutations, immunizing against a larger number of neoantigens per tumor would prevent or delay tumor immune escape. This approach of immunizing against all potential neoantigens also eliminates the need to validate experimentally the real (vs predicted) value of each individual epitope, shortening valuable time before the vaccine can be produced and administered to the patient. In addition, because humans have 6 different MHC class I molecules (more than the 2 different molecules present in inbred mice), it is likely that a higher proportion of epitopes will be able to bind to human HLA and generate responses to the vaccine.
  • Examples 1-5 show for the first time that DNA vaccines against tumor neoantigens are able to generate CD8 + T-cell anti -turn or specific responses and delay tumor progression.
  • This promising technology possesses advantages such as rapid manufacturing time, lower manufacturing costs, higher stability and the ability to target most, if not all, of the neoantigens present in each patient.
  • FIG. 15 shows a schematic of the design of poly-neoepitope DNA vaccine against B 16 model.
  • pGX450l and pGX4503 plasmids were used.
  • F indicates a furin cleavage site, or linker.
  • P2A indicates a porcine teschovirus-l cleavage site, or linker.
  • FIG. 16 shows the strategy for assessment of immune responses induced by a DNA vaccine against B16.
  • Splenic lymphocytes were stimulated for 18 hours with peptides for the full neoeptiope sequence (MHC II) or l5-mer peptides overlapping by 11 amino acids (MHC I). Peptides were design to not include cleavage sites. ⁇ FNy ELISpot assay was carried out at week 5.
  • FIG. 17 shows a panel of graphs that show the results from the ELISpot assay, measuring the amount of ⁇ FNy SFET/l0e6 splenocytes, which corresponds to T cell activation, in response to the full length peptide, pooled l5-mer peptides and individual neoepitopes. As shown in FIG.
  • FIG. 18 shows proof of concept neoantigen studies: B16 neoantigens.
  • pGX450l can induce an immune response in mice, particularly in the M33 region, which is a CD8 epitope.
  • Example 7 Design of poly-neoepitope DNA vaccine against CT26 model
  • FIG. 19 shows a schematic of the design of poly-neoepitope DNA vaccine against B 16 model.
  • pGX4504, pGX5405 and pGC4506 plasmids were used.
  • F indicates a furin linker.
  • P2A indicates a porcine teschovirus-l linker.
  • FIG. 20 shows the strategy for assessment of immune responses induced by a DNA vaccine against B16.
  • Splenic lymphocytes were stimulated for 18 hours with peptides for the full neoeptiope sequence (MHC II) or l5-mer peptides overlapping by 11 amino acids (MHC I). Peptides were design to not include cleavage sites. IFNy ELISpot assay was carried out at week 5.
  • FIG. 21 shows a panel of graphs that show the results from the ELISpot assay, measuring the amount of IFNy SFET/l0e6 splenocytes, corresponding to T cell activation, for the tested full length peptide, pooled l5-mer peptides and individual neoepitopes.
  • the individual neoepitopes presented in the CT26 furin neoantigen generated the strongest response.
  • the CT26 fusion neoantigen construct (top), the CT26 furin neoantigen (middle) and the CT26 furin/ P2A neoantigen construct (bottom) were tested.
  • FIG. 22 shows proof of concept neoantigen studies: CT26 neoantigens.
  • Example 8 Expression of DNA vaccines for ex vivo priming using dendritic cells
  • Neoantigen DNA vaccines can also be used to prime T cells against neoantigens ex vivo.
  • Dendritic cells are differentiated from the host, and are transfected with the DNA plasmids. T cells are added to the culture to obtain a selective expansion of T cells that can detect the neoantigen MHC-peptide complex.
  • T-cells at 10 On day 8: plate T-cells at 10 (Tcells): l(BMDC) ratio (so 5 million per well) with 20IU IL-2/ml and lng/ml IL7.
  • Example 9 Delivery of a plurality of epitopes in one formulation and effect on tumor challenge efficacy
  • the purpose of this study is to demonstrate the ability to deliver 60 epitopes in one formulation (5 plasmids), and to demonstrate that delivery of more epitopes does not impact tumor challenge efficacy.
  • mice are implanted with tumors (TC1 tumors specifically) and are delivered the following vaccine combinations:
  • group #2, group #4 and group #5 will have similar anti tumor activity, and that group #1 and group #3 will have no anti -turn or activity.
  • FIG. 30 A map of the plasmid is depicted in Fig. 30.
  • Purpose #1 Compare the efficacy of a l2-epitope plasmid versus 24-epitope plasmid versus 40- epitope plasmid.
  • Purpose #2 Alter the position of Sgsm2 within each plasmid to determine if that has an impact.
  • Plasmid sequences of pVAXl were created comprising nucleic acid constructs that encode the epitopes below. As indicated nucleic acid sequences encoding the amino acid seqeunce provided were cloned into the pVAXl vector multiple cloning site with 10 antigens, 20 antigens or 40 antigens. Animals were vaccinated using the protocol depicted in FIG. 31. The labels of each plasmid depict the number and order in which antigens are presented within the plasmid. After vaccination, ELISPOT assays with the protocol identified in Example 1 above were performed and CD8+ cells as well as CD4+ cells were isolated using the above flow cytometry protocol of Example 1. Results of the how many IFN-gamma producing cells of those particular subsets were calculated and depicted in FIG.32.
  • Sgsm2 V656A SHVQRLVHRDSTISNDAFISVDDLEPSGPQDLE (SEQ ID NO:1)
  • Herpud2 V85L DHLQLKDILRKQDEYHMVHLLCASRSPPSSPKS (SEQ ID NO:2)
  • Lta4h V463A WNTWLYAPGLPPVKPNYDATLTNACIALSQRWV (SEQ ID NO:3)
  • Phactr4 V253L AQRNSNPIIAELSQAMNSGTLLSKPSPPLPPKR (SEQ ID NO:4)
  • Aunip E168G GESKGPLDSSFSQYLGRSCLLDQREAKRKGEGL (SEQ ID NO:5)
  • Gpn2 1151V KFISVLCTSLATMLHVELPHVNLLSKMDLIEHY (SEQ ID NO:7)
  • Zmyml P172S ACSSSYNSAVMESSSVNVSMVHSSSKENLCPKK (SEQ ID NO:9)
  • Sema6d V255M REIAVEHNNLGKAVYSRMARICKNDMGGSQRVL (SEQ ID NO:10)
  • Ubr1 G1412S PGLLSVDLFHVLVSAVLAFPSLYWDDTVDLQPS (SEQ ID NO:11)
  • Zgrfl Y1638C LCLMGHKPVLLRTQCRCHPAISAIANDLFYEGS (SEQ ID NO:12)
  • Caszl L1087P TSAAETKPPLAPSSPPAPPGTMVAGSSLEGPAP (SEQ ID NO: 13)
  • Adgrb2 L572P RSLQELLARRTYYSGDPLFSVDILRNVTDTFKR (SEQ ID NO: 14)
  • ObsM T1764M GGHVCWMREGVELCPGNKYEMRRHGTTHSLVIH (SEQ ID NO:15)
  • Dhrs9 L146P EPIEVNLFGLINVTPNMLPLVKKARGRVINVSS (SEQ ID NO:16)
  • Zmyml T466R VDFNKICGQAYDSATNFRVKLNEVVAEFKKEEP (SEQ ID NO:17)
  • Nrp2 W664L NCNFDFPEETCGWVYDHAKLLRSTWISSANPND (SEQ ID NO:18)
  • RGRKRRS (SEQ ID NO:41)- furin cleavage site 10-epitope plasmid:
  • Lta4h V463A WNTWLYAPGLPPVKPNYDATLTNACIALSQRWV 9.
  • Zmyml P172S ACSSSYNSAVMESSSVNVSMVHSSSKENLCPKK 11.
  • Ubr1 G1412S PGLLSVDLFHVLVSAVLAFPSLYWDDTVDLQPS
  • Nrp2 W664L NCNFDFPEETCGWVYDHAKLLRSTWISSANPND
  • Phactr4 V253L AQRNSNPIIAELSQAMNSGTLLSKPSPPLPPKR
  • Zgrfl Y1638C LCLMGHKPVLLRTQCRCHPAISAIANDLFYEGS
  • Caszl L1087P TSAAETKPPLAPSSPPAPPGTMVAGSSLEGPAP
  • Adgrb2 L572P RSLQELLARRTYYSGDPLFSVDILRNVTDTFKR
  • Nrp2 W664L NCNFDFPEETCGWVYDHAKLLRSTWISSANPND
  • Phactr4 V253L AQRNSNPIIAELSQAMNSGTLLSKPSPPLPPKR
  • Zmyml P172S ACSSSYNSAVMESSSVNVSMVHSSSKENLCPKK 10.
  • Sema6d V255M REIAVEHNNLGKAVYSRMARICKNDMGGSQRVL
  • Zgrfl Y1638C LCLMGHKPVLLRTQCRCHPAISAIANDLFYEGS
  • Caszl L1087P TSAAETKPPLAPSSPPAPPGTMVAGSSLEGPAP
  • Adgrb2 L572P RSLQELLARRTYYSGDPLFSVDILRNVTDTFKR
  • Nrp2 W664L NCNFDFPEETCGWVYDHAKLLRSTWISSANPND
  • Non-immunogenic epitopes are non-immunogenic epitopes.
  • Hdac4 W1020C ANAVHSMEKVMDIHSKYCRCLQRLSSTVGHSLI (SEQ ID NO:21)
  • Gmppa H24Y EVPKPLFPVAGVPMIQYHIEACAQVPGMQEILL (SEQ ID NO:22)
  • Frasl L3135P SNEDREWHESFSLVLGPDDPVEAVLGDVTTATV (SEQ ID NO:23)
  • Padi3 L193P MSVMVLRTQGPEAPFEDHRLILHTSSCDAERAR (SEQ ID NO:24)
  • Pdia3 Y264C CPHMTEDNKDLIQGKDLLTACYDVDYEKNAKGS (SEQ ID NO:25)
  • Pnisr R476G TRGLAYLHTELPQGDHYKPAISHRDLNSRNVLV (SEQ ID NO:26)
  • Nckapl K344T ECKEAAVSHAGSMHRERRTFLRSALKELATVLS (SEQ ID NO:31)
  • Map7d1 R577W RMREEQLAREAEAWAEREAEARRREEQEAREKA (SEQ ID NO:32)
  • C77080 S770A LSQTPPPAPPPSAGSEPLARLPQKDSVGKHSGA (SEQ ID NO:33)
  • Wdr37 H110Y TTTSRAICQLVKEYIGYRDGIWDVSVTRTQPIV (SEQ ID NO:35)
  • Fam160b2 S575R N GY DTY VH DAY GLFQECRSRVAH WG WP LG P A P L (SEQ ID NO:36)
  • Mb21d1 Y346S IQGWLGTKVRTNLRREPFSLVPKNAKDGNSFQG (SEQ ID NO:37)
  • Jmjdlc L1715P WMKCVKGQPHDHKHLMPTQIIPGSVLTDLLDAM (SEQ ID NO:39)
  • Smekl E665K SILRNHRYRRDARTLEDKEEMWFNTDEDDMEDG (SEQ ID NO:40)

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Medicinal Chemistry (AREA)
  • Epidemiology (AREA)
  • Genetics & Genomics (AREA)
  • Immunology (AREA)
  • Zoology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Microbiology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Mycology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Toxicology (AREA)
  • Oncology (AREA)
  • Wood Science & Technology (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Pathology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Plant Pathology (AREA)
  • Cell Biology (AREA)
  • Hospice & Palliative Care (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
PCT/US2019/034229 2018-05-25 2019-05-28 Tumor-specific neoantigens and methods of using the same Ceased WO2019227106A1 (en)

Priority Applications (9)

Application Number Priority Date Filing Date Title
CN201980039164.6A CN112261947A (zh) 2018-05-25 2019-05-28 肿瘤特异性新抗原和其使用方法
KR1020207037379A KR20210018321A (ko) 2018-05-25 2019-05-28 종양 특이적 신생항원 및 이를 사용하는 방법
CA3100974A CA3100974A1 (en) 2018-05-25 2019-05-28 Tumor-specific neoantigens and methods of using the same
JP2021516553A JP2021525549A (ja) 2018-05-25 2019-05-28 腫瘍特異的ネオ抗原およびその使用方法
EP19808366.9A EP3801597A4 (en) 2018-05-25 2019-05-28 TUMOR-SPECIFIC NEOANTIGENS AND METHODS OF USE
US17/058,999 US12528848B2 (en) 2018-05-25 2019-05-28 Tumor-specific neoantigens and methods of using the same
MX2020012649A MX2020012649A (es) 2018-05-25 2019-05-28 Neoantígenos especificos de tumor y métodos de uso de estos.
JP2024073051A JP2024091964A (ja) 2018-05-25 2024-04-26 腫瘍特異的ネオ抗原およびその使用方法
US19/208,273 US20260085100A1 (en) 2018-05-25 2025-05-14 Methods of antigen production

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201862676563P 2018-05-25 2018-05-25
US62/676,563 2018-05-25

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US17/058,999 A-371-Of-International US12528848B2 (en) 2018-05-25 2019-05-28 Tumor-specific neoantigens and methods of using the same
US19/208,273 Continuation US20260085100A1 (en) 2018-05-25 2025-05-14 Methods of antigen production

Publications (2)

Publication Number Publication Date
WO2019227106A1 true WO2019227106A1 (en) 2019-11-28
WO2019227106A9 WO2019227106A9 (en) 2020-06-04

Family

ID=68616499

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2019/034229 Ceased WO2019227106A1 (en) 2018-05-25 2019-05-28 Tumor-specific neoantigens and methods of using the same

Country Status (8)

Country Link
US (2) US12528848B2 (https=)
EP (1) EP3801597A4 (https=)
JP (2) JP2021525549A (https=)
KR (1) KR20210018321A (https=)
CN (1) CN112261947A (https=)
CA (1) CA3100974A1 (https=)
MX (1) MX2020012649A (https=)
WO (1) WO2019227106A1 (https=)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3795593A1 (en) * 2019-09-19 2021-03-24 Takis S.r.l. Combination of immune-modulators with tumor specific neoantigens for use in prevention and treatment of tumors
US12582609B2 (en) 2015-10-22 2026-03-24 Modernatx, Inc. Cancer vaccines

Families Citing this family (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN112501201A (zh) * 2021-02-07 2021-03-16 无锡市人民医院 一种用于治疗非小细胞肺癌的rna疫苗及其构建方法
AU2023267771A1 (en) * 2022-05-10 2024-12-19 Geneos Therapeutics, Inc. Vaccines and methods of using the same to treat wnt-related cancer
KR20250024532A (ko) * 2022-05-10 2025-02-18 지노스 세라퓨틱스, 인크. 개인 맞춤형 암 에피토프 및 이의 사용 방법
WO2024102764A1 (en) * 2022-11-07 2024-05-16 The Wistar Institute Of Anatomy And Biology Compositions comprising neoantigens and methods of enhancing anti-pd1 therapy
CN116966105B (zh) * 2023-04-20 2025-12-19 合肥核信生物科技有限责任公司 促进皮肤细胞胶原蛋白生成的小分子及其应用

Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20090041792A1 (en) * 2007-07-19 2009-02-12 Istituto Superiore Di Sanita Dendritic cells, uses therefor, and vaccines and methods comprising the same
US20140178438A1 (en) * 2011-05-24 2014-06-26 Ugur Sahin Individualized vaccines for cancer
US20150104413A1 (en) * 2012-01-13 2015-04-16 Memorial Sloan Kettering Cancer Center Immunogenic wt-1 peptides and methods of use thereof
US20160030536A1 (en) * 2013-03-15 2016-02-04 David Weiner Cancer Vaccines And Methods Of Treatment Using The Same
US20160250309A1 (en) * 2007-05-04 2016-09-01 University Health Network Compositions and methods for cancer treatment
WO2017083750A1 (en) * 2015-11-11 2017-05-18 Intrexon Corporation Compositions and methods for expression of multiple biologically active polypeptides from a single vector for treatment of cardiac conditions and other pathologies

Family Cites Families (18)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8212000B2 (en) * 1970-02-11 2012-07-03 Immatics Biotechnologies Gmbh Tumor-associated peptides binding promiscuously to human leukocyte antigen (HLA) class II molecules
EP2569633B1 (en) * 2010-05-14 2016-02-10 The General Hospital Corporation Compositions and methods of identifying tumor specific neoantigens
CN103068846B9 (zh) 2010-08-24 2016-09-28 弗·哈夫曼-拉罗切有限公司 包含二硫键稳定性Fv片段的双特异性抗体
WO2012159643A1 (en) 2011-05-24 2012-11-29 Biontech Ag Individualized vaccines for cancer
CN103160473B (zh) * 2011-12-13 2014-08-20 北京微谷生物医药有限公司 用于拯救麻疹病毒的组合物、试剂盒、用途及方法
EP2983702A2 (en) 2013-04-07 2016-02-17 The Broad Institute, Inc. Compositions and methods for personalized neoplasia vaccines
JP6679484B2 (ja) * 2013-12-11 2020-04-15 ザ ヘンリー エム. ジャクソン ファウンデーション フォー ザ アドヴァンスメント オブ ミリタリー メディシン インコーポレイテッド ヒトヘルペスウイルス三量体糖タンパク質B、三量体gBを含むタンパク質複合体、及びワクチンとしてのそれらの使用
KR20230076867A (ko) * 2013-12-20 2023-05-31 더 브로드 인스티튜트, 인코퍼레이티드 신생항원 백신과의 병용 요법
WO2016040900A1 (en) 2014-09-14 2016-03-17 Washington University Personalized cancer vaccines and methods therefor
IL294183B2 (en) 2015-05-20 2023-10-01 Dana Farber Cancer Inst Inc shared neoantigens
MA42543A (fr) * 2015-07-30 2018-06-06 Modernatx Inc Arn épitope peptidiques concatémériques
EP3400005A1 (en) * 2016-01-08 2018-11-14 Vaccibody AS Neoepitope rna cancer vaccine
WO2017139498A1 (en) * 2016-02-09 2017-08-17 Cour Pharmaceuticals Development Company Inc. Timps encapsulating japanese cedar pollen epitopes
WO2017152042A2 (en) 2016-03-04 2017-09-08 New York University Virus vectors expressing multiple epitopes of tumor associated antigens for inducing antitumor immunity
KR20180117227A (ko) * 2016-03-24 2018-10-26 난트셀, 인크. 네오에피토프 제시를 위한 시퀀스들 및 시퀀스 배열들
EP3452082A1 (en) * 2016-05-04 2019-03-13 Fred Hutchinson Cancer Research Center Cell-based neoantigen vaccines and uses thereof
US20190351040A1 (en) * 2017-02-01 2019-11-21 Modernatx, Inc. Rna cancer vaccines
EP3773649A4 (en) * 2018-03-28 2022-02-23 EpicentRx, Inc. PERSONALIZED CANCER VACCINE

Patent Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20160250309A1 (en) * 2007-05-04 2016-09-01 University Health Network Compositions and methods for cancer treatment
US20090041792A1 (en) * 2007-07-19 2009-02-12 Istituto Superiore Di Sanita Dendritic cells, uses therefor, and vaccines and methods comprising the same
US20140178438A1 (en) * 2011-05-24 2014-06-26 Ugur Sahin Individualized vaccines for cancer
US20150104413A1 (en) * 2012-01-13 2015-04-16 Memorial Sloan Kettering Cancer Center Immunogenic wt-1 peptides and methods of use thereof
US20160030536A1 (en) * 2013-03-15 2016-02-04 David Weiner Cancer Vaccines And Methods Of Treatment Using The Same
WO2017083750A1 (en) * 2015-11-11 2017-05-18 Intrexon Corporation Compositions and methods for expression of multiple biologically active polypeptides from a single vector for treatment of cardiac conditions and other pathologies

Non-Patent Citations (5)

* Cited by examiner, † Cited by third party
Title
DUPERRET ET AL.: "A Synthetic DNA, Multi-Neoantigen Vaccine Drives Predominately MHC Class I CD 8+ T- cell Responses, Impacting Tumor Challenge", CANCER IMMUNOL RES, vol. 7, no. 2, 1 February 2019 (2019-02-01), pages 174 - 182, XP055659068, ISSN: 2326-6066, DOI: 10.1158/2326-6066.CIR-18-0283 *
KREITER ET AL.: "Mutant MHC class II epitopes drive therapeutic immune responses to cancer", NATURE, vol. 520, 30 April 2015 (2015-04-30), pages 692 - 696, XP055231810, ISSN: 0028-0836, DOI: 10.1038/nature14426 *
OTT ET AL.: "An immunogenic personal neoantigen vaccine for patients with melanoma", NATURE, vol. 547, no. 7662, 13 July 2017 (2017-07-13), pages 217 - 221, XP002785348, ISSN: 1476-4687 *
PAUL ET AL.: "HLA class I alleles are associated with peptide-binding repertoires of different size, affinity, and immunogenicity", J IMMUNOL, vol. 191, 4 November 2013 (2013-11-04), pages 1 - 23, XP055539905, ISSN: 0022-1767, DOI: 10.4049/jimmunol.1302101 *
See also references of EP3801597A4 *

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12582609B2 (en) 2015-10-22 2026-03-24 Modernatx, Inc. Cancer vaccines
EP3795593A1 (en) * 2019-09-19 2021-03-24 Takis S.r.l. Combination of immune-modulators with tumor specific neoantigens for use in prevention and treatment of tumors

Also Published As

Publication number Publication date
JP2021525549A (ja) 2021-09-27
US20210361755A1 (en) 2021-11-25
CA3100974A1 (en) 2020-11-28
EP3801597A1 (en) 2021-04-14
MX2020012649A (es) 2021-07-02
KR20210018321A (ko) 2021-02-17
US12528848B2 (en) 2026-01-20
WO2019227106A9 (en) 2020-06-04
CN112261947A (zh) 2021-01-22
JP2024091964A (ja) 2024-07-05
US20260085100A1 (en) 2026-03-26
EP3801597A4 (en) 2022-05-04

Similar Documents

Publication Publication Date Title
US20260085100A1 (en) Methods of antigen production
AU2021269272B2 (en) Neoantigens and methods of their use
JP6702855B2 (ja) 個別化された新生物ワクチンの組成物及び方法
US20240317830A1 (en) Multi-domain protein vaccine
IL298653A (en) New peptides and a combination of peptides for use in immunotherapy against several types of cancer
US20260083831A1 (en) Vaccines and methods of using the same to treat wnt-related cancer
US20250302955A1 (en) Individualized cancer epitopes and methods of using the same
WO2024102764A1 (en) Compositions comprising neoantigens and methods of enhancing anti-pd1 therapy
HK40086688A (zh) 新抗原及其使用方法
HK40004257A (en) Neoantigens and methods of their use

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 19808366

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3100974

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2021516553

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 20207037379

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2019808366

Country of ref document: EP

Effective date: 20210111

WWG Wipo information: grant in national office

Ref document number: 17058999

Country of ref document: US