Classifications

• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K38/00—Medicinal preparations containing peptides
  • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
  • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
  • A61K38/19—Cytokines; Lymphokines; Interferons
  • A61K38/20—Interleukins [IL]
  • A61K38/2086—IL-13 to IL-16
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P35/00—Antineoplastic agents
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K1/00—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
  • C07K1/14—Extraction; Separation; Purification
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
  • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
  • C07K14/52—Cytokines; Lymphokines; Interferons
  • C07K14/54—Interleukins [IL]
  • C07K14/5443—IL-15
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
  • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
  • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
  • C07K14/715—Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons
  • C07K14/7155—Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons for interleukins [IL]
• • C—CHEMISTRY; METALLURGY
  • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
  • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
  • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
  • C12N15/09—Recombinant DNA-technology
  • C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
  • C12N15/62—DNA sequences coding for fusion proteins
• • C—CHEMISTRY; METALLURGY
  • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
  • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
  • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
  • C12N15/09—Recombinant DNA-technology
  • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
  • C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
  • C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
• • A—HUMAN NECESSITIES
  • A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
  • A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
  • A01K2207/00—Modified animals
  • A01K2207/12—Animals modified by administration of exogenous cells
• • A—HUMAN NECESSITIES
  • A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
  • A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
  • A01K2227/00—Animals characterised by species
  • A01K2227/10—Mammal
  • A01K2227/105—Murine
• • A—HUMAN NECESSITIES
  • A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
  • A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
  • A01K2267/00—Animals characterised by purpose
  • A01K2267/03—Animal model, e.g. for test or diseases
  • A01K2267/0331—Animal model for proliferative diseases
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K38/00—Medicinal preparations containing peptides
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2319/00—Fusion polypeptide
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2319/00—Fusion polypeptide
  • C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2319/00—Fusion polypeptide
  • C07K2319/32—Fusion polypeptide fusions with soluble part of a cell surface receptor, "decoy receptors"
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2319/00—Fusion polypeptide
  • C07K2319/50—Fusion polypeptide containing protease site

Definitions

• the invention generally relates to novel fusion proteins and therapeutic uses thereof.
• the invention provides novel fusion proteins of Interleukin 15 and prodrugs, and compositions and methods of preparation thereof, useful in treating various diseases and disorders (e.g ., hyperplasia, solid tumor or hematopoietic malignancy).
• diseases and disorders e.g ., hyperplasia, solid tumor or hematopoietic malignancy.
• Interleukin 15 a 14-15 kDa glycoprotein, is a soluble cytokine that was first discovered in 1994. (Grabstein et al. 1994 Science 264:965-8.) Similar to Interleukin 2, IL15 belongs to the family of the four-helix-bundle cytokines. The human IL15 gene was mapped to chromosome 4 region q25-35. Mature IL15 consists of 112 amino acid and containing 3 N-glycosylation sites. The expression of IL15 is tightly regulated.
• IL-15 mRNA can be found in many tissues and cells, including fibroblasts, muscle cells, keratinocytes, kidney cells, lymphocytes, mast cells, and tumor cells, a mature protein mainly produced by dendritic cells, monocytes, macrophages, and stromal cells, but not T cells.
• cytokines such as granulocyte- macrophage colony-stimulating factor (GM-CSF), interferons, and agonists of Toll-like receptors (TLRs).
• GM-CSF granulocyte- macrophage colony-stimulating factor
• TLRs Toll-like receptors
• IL15 receptor belongs to the super family of hemopoietic system.
• the heterotrimeric IL15R comprises a, b (CD122) and g (CD132, common gamma chain, yc) subunits.
• the b subunit (IL15Rb) is shared with the IL2 receptor.
• Human ILl5Ra belongs to type I transmembrane protein. Both IL2Ra and ILl5Ra contain a conserved sushi domain.
• IL15 would have some similar functions as IL2, such as promoting the proliferation of T and NK cells 131 .
• ILl5Ra is mainly expressed in dendritic cells (DCs) and monocytes. In most cases, IL15 binds to the receptor in a trans-presented form. In a trans-presentation model, IL15 and ILl5Ra are synthesized in the same cell. IL15 and ILl5Ra sushi domain bind to each other with high affinity in cytoplasm and transports IL-15 to the cell membrane. ILl5Ra can then trans-present IL-15 to responding cells, such as T cells and NK cells.
• IL15 displays pleiotropic functions in homeostasis and activation of both innate and adaptive immunity as follows:
• IL15 plays an important role in the activation, proliferation and survival of CD8 + T cells
• IL15 plays an important role in the activation and homeostasis of memory CD8 + T cells
• IL15 plays an important role in the development, activation and proliferation of NK cells and NKT cells;
• IL15 plays an important role in the production of anti -tumor antibody
• IL15 plays an important role in the activation, proliferation and differentiation of DC by autocrine model, promotes the expression of MHC II and CD80/CD86 on DC and increases the presentation of DC to CD8 + T cells;
• IL15 plays an important role in the activation of monocyte and macrophage
• IL15 plays an important role in the inhibition of AICD, protects T cells from inhibition by Treg and overcomes the resistance to tumor antigen.
• IL2 has been approved by the FDA for the treatment of metastatic renal cell carcinoma and malignant melanoma.
• the effectiveness of IL-2 as an anti-cancer therapeutic has been questioned due to its pivotal role in the maintenance of CD4 + CD25 + T-regulatory cells and in activation-induced cell death (AICD). This process leads to the elimination of stimulated T cells and induction of T-cell tolerance, thereby limiting the therapeutic effects.
• IL15 is not involved in the activation-induced cell death (AICD) and maintenance of regulatory T cells.
• AICD activation-induced cell death
• IL15 may have significant advantages over IL2 in treating cancer.
• Recent reports have shown that administration of preformed complexes of IL15 with its soluble receptor ILl5Ra enhanced the half-life of IL15 and elevated the proliferation of T and NK cells. (Thomas et al. 2006 J of Immunology 177:6072-6080.)
• the soluble fusion protein of ILl5Ra sushi domain and IL15 exhibited enhanced half-life of IL15 and proliferation of T and NK cells.
• this fusion protein could inhibit tumor growth and suppress metastasis of tumor.
• IL15 exhibited enhanced anti-tumor effect or suppressed the growth of tumor in combination studies. (Cheng et al. 2014 J of Hepatology 61 : 1297-1303; Guo et al. 2017 Cytokine and Growth Factor Reviews 38: 10-21.)
• IL15 therapy Various side-effects have been associated with IL15 therapy, such as:
• cytokine cascade including TNFa, IL1, IL6, GM-CSF and pro- inflammatory cytokines
• the invention is based in part on the surprising discovery of novel fusion proteins and therapeutic uses thereof.
• Novel fusion proteins of IL15 and prodrugs thereof, compositions and methods of preparation thereof, are disclosed herein which are useful in treating various diseases and disorders, e.g., hyperplasia, solid tumor or hematopoietic malignancy.
• the invention generally relates to a fusion protein.
• the fusion protein comprises: a first structural unit: a subunit, or a fragment thereof, of interleukin 15 receptor alpha (ILl5Ra); a second structural unit: an active IL15; a third structural unit: an antibody Fc fragment, located at the C-terminus of the fusion protein; and a first linker segment (Ll) covalently linking the first, second and third structural units, wherein at the N-terminus of the fusion protein is the first structural unit, and the second structural unit is located between the first structural unit and the third structural unit.
• IL5Ra interleukin 15 receptor alpha
• Ll first linker segment
• the invention generally relates to a fusion protein.
• the fusion protein comprises: a first structural unit: a subunit, or a fragment thereof, of interleukin 15 receptor alpha (ILl5Ra); a second structural unit: an active IL15; a third structural unit: an antibody Fc fragment, located at the C-terminus of the fusion protein; and a first linker segment (Ll) covalently linking the first, second and third structural units, wherein at the N-terminus of the fusion protein is the second structural unit, the first structural unit is located between the second structural unit and the third structural unit.
• IL5Ra interleukin 15 receptor alpha
• Ll first linker segment
• the invention generally relates to a fusion protein.
• the fusion protein comprises: a first structural unit: a subunit, or a fragment thereof, of interleukin 15 receptor alpha (ILl5Ra); a second structural unit: an active IL15; a third structural unit: an antibody Fc fragment, located at the C-terminus of the fusion protein; a fourth structural unit: a subunit, or a fragment thereof, of interleukin 15 receptor beta (ILl 5R ⁇ S); and a first linker segment (Ll) covalently linking the first, second, third and fourth structural units, wherein at the N-terminus of the fusion protein is the fourth structural unit, the second structural unit is located between the fourth and the first structural unit, and the first structural unit is located between the second structural unit and the third structural unit.
• ILl5Ra interleukin 15 receptor alpha
• a third structural unit an antibody Fc fragment, located at the C-terminus of the fusion protein
• a fourth structural unit a subunit,
• the invention generally relates to a fusion protein.
• the fusion protein comprises: a first structural unit: a subunit, or a fragment thereof, of interleukin 15 receptor (IL15R); a second structural unit: an active IL15; a third structural unit: an antibody Fc fragment, located at the C-terminus of the fusion protein; a fourth structural unit: a subunit, or a fragment thereof, of interleukin 15 receptor beta (IL 15Kb); a first linker segment (Ll) covalently linking the first, second and third structural units, wherein the first structural unit is located between the second structural unit and the third structural unit; and a second linker segment (L2) covalently linking the fourth structural unit to the second structural unit, wherein at the N-terminus of the fusion protein is the fourth structural unit.
• IL 15R interleukin 15 receptor
• second structural unit an active IL15
• a third structural unit an antibody Fc fragment, located at the C-terminus of the fusion protein
• the invention generally relates to a homodimeric or heterodimeric protein, comprising a fusion protein disclosed herein.
• the invention generally relates to a substantially purified protein, such as a fusion protein or a fragment, disclosed herein.
• the invention generally relates to a polynucleotide encoding a protein, such as a fusion protein or a fragment thereof, disclosed herein.
• the invention generally relates to an expression vector comprising a polynucleotide encoding a protein, such as a fusion protein or a fragment thereof, disclosed herein.
• the invention generally relates to a pharmaceutical composition
• a pharmaceutical composition comprising a protein, such as a fusion protein or a fragment thereof, disclosed herein and a pharmaceutically acceptable excipient, carrier, or diluent.
• the invention generally relates to a pharmaceutical composition comprising a polynucleotide encoding a protein, such as a fusion protein or a fragment thereof, disclosed herein and a pharmaceutically acceptable excipient, carrier, or diluent.
• the invention generally relates to a method for treating a disease or condition.
• the method comprises administering to a patient in need thereof a therapeutically effective amount of a polynucleotide encoding a protein, such as a fusion protein or a fragment thereof, disclosed herein, wherein the disease or condition is selected from hyperplasia, solid tumor or hematopoietic malignancy.
• the invention generally relates to use of a protein, such as a fusion protein or a fragment thereof, disclosed herein for treating or reducing a disease or disorder (e.g ., hyperplasia, solid tumor or hematopoietic malignancy).
• a disease or disorder e.g ., hyperplasia, solid tumor or hematopoietic malignancy.
• the invention generally relates to use of a polynucleotide encoding a protein, such as a fusion protein or a fragment thereof, disclosed herein for treating or reducing a disease or disorder (e.g., hyperplasia, solid tumor or hematopoietic malignancy).
• a disease or disorder e.g., hyperplasia, solid tumor or hematopoietic malignancy.
• the invention generally relates to use of a protein, such as a fusion protein or a fragment thereof, disclosed herein and a pharmaceutically acceptable excipient, carrier, or diluent, in preparation of a medicament for treating or reducing a disease or disorder (e.g., hyperplasia, solid tumor or hematopoietic malignancy).
• a disease or disorder e.g., hyperplasia, solid tumor or hematopoietic malignancy
• the invention generally relates to use of a polynucleotide encoding a protein, such as a fusion protein or a fragment thereof, disclosed herein and a pharmaceutically acceptable excipient, carrier, or diluent, in preparation of a medicament for treating or reducing a disease or disorder (e.g., hyperplasia, solid tumor or hematopoietic malignancy).
• a disease or disorder e.g., hyperplasia, solid tumor or hematopoietic malignancy
• the invention generally relates to a cell line comprising a polynucleotide encoding a protein, such as a fusion protein or a fragment thereof, disclosed herein.
• the invention generally relates to a method for making a protein, comprising culturing the cell line.
• the method further comprises purifying or isolating a produced protein, such as a fusion protein or a fragment thereof, disclosed herein.
• the invention generally relates to a method for making a protein.
• the method comprises: providing an expression vector encoding a protein, such as a fusion protein or a fragment thereof, disclosed herein; introducing the expression vector into a host cell; culturing the host cell in media under conditions sufficient to express the protein; and purifying the protein from the host cell or media.
• the invention generally relates to an isolated protein produced by a method disclosed herein.
• FIG. 1 shows a schematic diagram of the structure of the fusion protein.
• FIG.1A shows schematic diagram of the structure of the ILl5-Fc.
• FIG. IB and FIG 1C show schematic diagrams of two IL15 super agonists (both referred to as super IL15): RA-ILl5-Fc and ILl5-RA-Fc.
• FIG. ID shows a schematic diagram of the fusion protein RB-ILl5-RA-Fc.
• FIG. 2 shows an exemplary SDS-PAGE electropherogram of three fusion proteins.
• FIG. 3 shows exemplary results of lymphocyte proliferation assays by ILl5-Fc and super
• FIG.4 shows exemplary results of lymphocyte proliferation assay by RB-ILl5-RA-Fc and super IL15.
• FIG. 5 shows exemplary results on the therapeutic effects of super IL15 in A20 tumor model.
• FIG. 5A shows exemplary data of super IL15 therapeutic effects through intratumoral injection;
• FIG. 5B shows exemplary data of survival of mice after intratumoral and intraperitoneal injection;
• FIG. 5C shows exemplary data on tumor-cured mice re-challenged with A20 tumor cells.
• FIG. 6 shows exemplary results on the therapeutic effects of super IL15 in MC38 tumor model.
• FIG. 6A shows exemplary data on super IL15 therapeutic effects through intratumoral and intravenous injection.
• FIG. 6B shows exemplary data on survival of mice after treatment.
• FIG. 7 shows exemplary data on the therapeutic effects of super IL15 in the A20 mouse model given a lower dose.
• FIG. 8 shows exemplary comparison of therapeutic effects of RB-ILl5-RA-Fc and super IL15 in A20 tumor model after intravenous injection.
• FIG. 8A shows exemplary tumor growth curve of mice after treatment.
• FIG. 8B shows exemplary level of cytokines in the serum after treatment.
• FIG. 9 shows exemplary comparison of therapeutic effects of RB-ILl5-RA-Fc and super IL15 in the mouse A20 tumor model after intraperitoneal injection.
• FIG. 9A shows exemplary survival of mice after treatment.
• FIG. 9B shows exemplary level of cytokines in the serum after treatment.
• FIG. 10 shows an exemplary SDS-PAGE electropherogram of the purified human IL15 fusion proteins with or without MMP14 digestion.
• RB-ILl5-RA-Fc is displayed as RB-Ll-l5RA-Fc or RB-L2-l5RA-Fc to emphasize whether Ll or L2 is used as the linker segment attached to RB.
• ILl5-RA-Fc is displayed as l5RA-Fc.
• FIG. 11 shows exemplary results of human IL15 fusion protein activity with or without MMP14 incubation evaluated using a HEK-BlueTM IL2 reporter cell assay.
• the trade name includes the product formulation, the generic drug, and the active pharmaceutical ingredient(s) of the trade name product, unless otherwise indicated by context.
• Ranges provided herein are understood to be shorthand for all of the values within the range.
• a range of 1 to 50 is understood to include any number, combination of numbers, or sub-range from the group consisting 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19,
• the term“about” is understood as within a range of normal tolerance in the art, for example within 2 standard deviations of the mean. About can be understood as within 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1%, 0.05%, or 0.01% of the stated value. Unless otherwise clear from context, all numerical values provided herein can be modified by the term about.
• compositions and methods are intended to mean that the compositions and methods include the recited elements, but do not exclude other elements.
• the term“consisting essentially of’ when used to define compositions and methods, shall mean that the compositions and methods include the recited elements and exclude other elements of any essential significance to the compositions and methods. For example,“consisting essentially of’ refers to administration of the pharmacologically active agents expressly recited and excludes pharmacologically active agents not expressly recited.
• compositions and methods consisting essentially of does not exclude pharmacologically inactive or inert agents, e.g., pharmaceutically acceptable excipients, carriers or diluents.
• pharmaceutically acceptable excipients e.g., pharmaceutically acceptable excipients, carriers or diluents.
• consisting of when used to define compositions and methods, shall mean excluding trace elements of other ingredients and substantial method steps. Embodiments defined by each of these transition terms are within the scope of this invention.
• the term“agonist” refers to a compound that, in combination with a receptor, can produce a cellular response.
• An agonist may be a ligand that directly binds to the receptor.
• an agonist may combine with a receptor indirectly by, for example, (a) forming a complex with another molecule that directly binds to the receptor, or (b) otherwise resulting in the modification of another compound so that the other compound directly binds to the receptor.
• the term“antagonist” refers to a compound that competes with an agonist or inverse agonist for binding to a receptor, thereby blocking the action of an agonist or inverse agonist on the receptor.
• an antagonist has no effect on constitutive receptor activity.
• the term“antibody” refers to molecules that are capable of binding an epitope or antigenic determinant.
• the term is meant to include whole antibodies and antigen-binding fragments thereof.
• the term encompasses polyclonal, monoclonal, chimeric, Fabs, Fvs, single-chain antibodies and single or multiple immunoglobulin variable chain or CDR domain designs as well as bispecific and multispecific antibodies.
• Antibodies can be from any animal origin. Preferably, the antibodies are mammalian, e.g., human, murine, rabbit, goat, guinea pig, camel, horse and the like, or other suitable animals. Antibodies may recognize polypeptide or polynucleotide antigens.
• the term includes active fragments, including for example, an antigen binding fragment of an
• immunoglobulin a variable and/or constant region of a heavy chain, a variable and/or constant region of a light chain, a complementarity determining region (cdr), and a framework region.
• the terms include polyclonal and monoclonal antibody preparations, as well as preparations including hybrid antibodies, altered antibodies, chimeric antibodies, hybrid antibody molecules, F(ab) 2 and F(ab) fragments; Fv molecules (for example, noncovalent heterodimers), dimeric and trimeric antibody fragment constructs; minibodies, humanized antibody molecules, and any functional fragments obtained from such molecules, wherein such fragments retain specific binding.
• the term“antigen” as used herein is meant any substance that causes the immune system to produce antibodies or specific cell-mediated immune responses against it.
• a disease associated antigen is any substance that is associated with any disease that causes the immune system to produce antibodies or a specific-cell mediated response against it.
• An antigen is capable of being recognized by the immune system and/or being capable of inducing a humoral immune response and/or cellular immune response leading to the activation of B- and/or T-lymphocytes.
• An antigen can have one or more epitopes (B- and/or T-cell epitopes).
• An antigen will preferably react, typically in a highly selective manner, with its corresponding antibody or TCR and not with the multitude of other antibodies or TCRs which may be evoked by other antigens.
• Antigens as used herein may also be mixtures of several individual antigens.
• biologically active entity is one having structural, regulatory, or biochemical functions of a naturally occurring molecule or any function related to or associated with a metabolic or physiological process.
• a biologically active polypeptide or fragment thereof includes one that can participate in a biological process or reaction and/or can produce a desired effect.
• the biological activity can include an improved desired activity, or a decreased undesirable activity.
• an entity demonstrates biological activity when it participates in a molecular interaction with another molecule, when it has therapeutic value in alleviating a disease condition, when it has prophylactic value in inducing an immune response, or when it has diagnostic and/or prognostic value in determining the presence of a molecule.
• a biologically active protein or polypeptide can be naturally-occurring or it can be synthesized from known components, e.g., by recombinant or chemical synthesis and can include heterologous components.
• cancer and“cancerous” refer to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth.
• cancer include but are not limited to, carcinoma, lymphoma, sarcoma, blastoma and leukemia. More particular examples of such cancers include squamous cell carcinoma, lung cancer, pancreatic cancer, cervical cancer, bladder cancer, hepatoma, breast cancer, colon carcinoma, and head and neck cancer.
• the term“cell” refers to any prokaryotic, eukaryotic, primary cell or immortalized cell line, any group of such cells as in, a tissue or an organ. Preferably the cells are of mammalian (e.g ., human) origin and can be infected by one or more pathogens.
• the term“co-administer” refers to the presence of two pharmacological agents in the blood at the same time.
• the two pharmacological agents can be administered concurrently or sequentially.
• polypeptides are expressed simultaneously in a host cell such that the two polypeptides can interact or bind either in the host cell or in the host cell culture medium and form a complex.
• the terms“disease” or“disorder” refer to a pathological condition, for example, one that can be identified by symptoms or other identifying factors as diverging from a healthy or a normal state.
• the term“disease” includes disorders, syndromes, conditions, and injuries. Diseases include, but are not limited to, proliferative, inflammatory, immune, metabolic, infectious, and ischemic diseases.
• the term“effective amount” of an active agent refers to an amount sufficient to elicit the desired biological response.
• the effective amount of a compound of the invention may vary depending on such factors as the desired biological endpoint, the pharmacokinetics of the compound, the disease being treated, the mode of administration, and the patient.
• the term "expression of a nucleic acid molecule” refers to the conversion of the information contained in the nucleic acid molecule into a gene product.
• the gene product can be the direct transcriptional product of a gene (e.g., mRNA, tRNA, rRNA, antisense RNA, ribozyme, structural RNA, or any other type of RNA) or a peptide or polypeptide produced by translation of an mRNA.
• Gene products also include RNAs that are modified by processes such as capping, polyadenylation, methylation, and editing; and proteins modified by, for example, methylation, acetylation, phosphorylation, ubiquitination, ADP-ribosylation, myristilation, and glycosylation.
• the term“host cell” refers to an individual cell or a cell culture that can be or has been a recipient of any recombinant vector(s) or isolated polynucleotide(s).
• a host cell can be a transfected, transformed, transduced or infected cell of any origin, including prokaryotic, eukaryotic, mammalian, avian, insect, plant or bacteria cells, or it can be a cells of any origin that can be used to propagate a nucleic acid described herein.
• Host cells include progeny of a single host cell, and the progeny may not necessarily be completely identical (in morphology or in total DNA complement) to the original parent cell due to natural, accidental, or deliberate mutation and/or change.
• a host cell includes cells transfected or infected in vivo or in vitro with a recombinant vector or a polynucleotide of the invention.
• a host cell that comprises a recombinant vector of the invention may be called a“recombinant host cell.”
• Host cells include, without limitation, the cells of mammals, plants, insects, fungi and bacteria.
• Bacterial cells include, without limitation, the cells of Gram-positive bacteria such as species of the genus Bacillus, Streptomyces and Staphylococcus and cells of Gram-negative bacteria such as cells of the genus Escherichia and Pseudomonas.
• Fungal cells include, preferably, yeast cells such as Saccharomyces, Pichia pastoris and Hansenula polymorpha.
• Insect cells include, without limitation, cells of Drosophila and Sf9 cells.
• Plant cells include, among others, cells from crop plants such as cereals, medicinal or ornamental plants or bulbs.
• Suitable mammal cells for the present invention include epithelial cell lines (porcine, etc.), osteosarcoma cell lines (human, etc.), neuroblastoma cell lines (human, etc.), epithelial carcinomas (human, etc.), glial cells (murine, etc.), liver cell lines (monkey, etc.).
• CHO cells Choinese Hamster Ovary
• COS cells BHK cells
• human ECCs NTERA-2 cells D3 cells of the line of mESCs
• human embryonic stem cells such as HS293 and BGV01, SHEF1, SHEF2 and HS181, cells NIH3T3, 293T, REH and MCF-7 and hMSCs cells.
• Fc refers to a molecule or sequence comprising the sequence of a non-antigen-binding fragment of whole antibody, whether in monomeric or multimeric form.
• the original immunoglobulin source of the native Fc is preferably of human origin and may be any of the immunoglobulins (e.g ., IgGl, IgG2).
• Native Fc's are made up of monomeric polypeptides that may be linked into dimeric or multimeric forms by covalent (i.e., disulfide bonds) and non-covalent association.
• the number of intermolecular disulfide bonds between monomeric subunits of native Fc molecules ranges from 1 to 4 depending on class (e.g., IgG, IgA, IgE) or subclass (e.g., IgGl, IgG2, IgG3, IgAl, IgGA2).
• an Fc domain is capable of interacting with a second Fc domain to form a dimeric complex.
• the Fc domain may be capable of binding cell surface receptors called Fc receptors and/or proteins of the complement system or may be modified to reduce or augment these binding activities.
• the Fc domain may be derived from IgG, IgA, IgD, IgM or IgE antibody isotypes and effect immune activity including opsonization, cell lysis, degranulation of mast cells, basophils, and eosinophils, and other Fc receptor-dependent processes; activation of the complement pathway; and protein stability in vivo.
• Tc domain encompasses native Fc and Fc variant molecules and sequences as defined herein.
• Fc domain includes molecules in monomeric or multimeric form, whether digested from whole antibody or produced by recombinant gene expression or by other means.
• Fc Fusion proteins have been reported to combine the Fc regions of IgG with the domains of another protein, such as various cytokines and soluble receptors. ( e.g ., Capon et al. 1989 Nature 337:525-531; Chamow et al. 1996 Trends Biotechnol. 14:52-60; U.S. Pat. Nos. 5,116,964 and 5,541,087).
• Fc fusion proteins can include variant Fc molecules (e.g., as described in U.S. Pat. No. 7,732,570). Fc fusion proteins can be soluble in the plasma or can associate to the cell surface of cells having specific Fc receptors.
• the term“Fc variant” refers to a molecule or sequence that is modified from a native Fc but still comprises a binding site for the salvage receptor, FcRn.
• International applications WO 97/34631 (published Sep. 25, 1997) and WO 96/32478 describe exemplary Fc variants, as well as interaction with the salvage receptor, and are hereby incorporated by reference.
• the term“Fc variant” comprises a molecule or sequence that is humanized from a non-human native Fc.
• a native Fc comprises sites that may be removed because they provide structural features or biological activity that are not required for the fusion molecules of the present invention.
• the term“Fc variant” comprises a molecule or sequence that lacks one or more native Fc sites or residues that affect or are involved in (1) disulfide bond formation, (2) incompatibility with a selected host cell (3) N-terminal heterogeneity upon expression in a selected host cell, (4) glycosylation, (5) interaction with complement, (6) binding to an Fc receptor other than a salvage receptor, or (7) antibody-dependent cellular cytotoxicity (ADCC).
• ADCC antibody-dependent cellular cytotoxicity
• fusion protein refers to polypeptides comprising two or more regions from different or heterologous proteins covalently linked (i.e.,“fused”) by recombinant, chemical or other suitable method. If desired, the fusion molecule can be fused at one or several sites through a peptide or other linker segment or sequence. For example, one or more peptide linkers may be used to assist in construction of a fusion protein.
• GC content refers to the percentage of a nucleic acid sequence comprised of deoxyguanosine (G) and/or deoxycytidine (C) deoxyribonucleosides, or guanosine (G) and/or cytidine (C) ribonucleoside residues.
• the term“high dosage” is meant at least 5% ( e.g ., at least 10%, 20%, 50%, 100%, 200%, or even 300%) more than the highest standard recommended dosage of a particular compound for treatment of any human disease or condition.
• the term“immune response” refers to a process whereby immune cells are stimulated and/or recruited from the blood to lymphoid as well as non-lymphoid tissues via a multifactorial process that involves distinct adhesive and/or activation steps. Activation conditions cause the release of cytokines, growth factors, chemokines and other factors, upregulate expression of adhesion and other activation molecules on the immune cells, promote adhesion, morphological changes, and/or extravasation concurrent with chemotaxis through the tissues, increase cell proliferation and cytotoxic activity, stimulate antigen presentation and provide other phenotypic changes including generation of memory cell types. Immune response is also meant to refer to the activity of immune cells to suppress or regulate inflammatory or cytotoxic activity of other immune cells. Immune response refers to the activity of immune cells in vivo or in vitro.
• nucleic acids or polypeptide sequences refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same (i.e., about 70% identity, preferably 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or higher identity over a specified region (e.g., of a IL15 or ILl5Ra sequence), when compared and aligned for maximum correspondence over a comparison window or designated region) as measured using a BLAST or BLAST 2.0 sequence comparison algorithms with default parameters described below, or by manual alignment and visual inspection.
• a specified region e.g., of a IL15 or ILl5Ra sequence
• sequences are then said to be“substantially identical.”
• This definition also refers to, or can be applied to, the compliment of a test sequence.
• the definition also includes sequences that have deletions and/or additions, as well as those that have substitutions. As described below, the preferred algorithms can account for gaps and the like.
• identity exists over a region that is at least about 25, 50, 75, 100, 150, 200 amino acids or nucleotides in length, and oftentimes over a region that is 225, 250, 300, 350, 400, 450, 500 amino acids or nucleotides in length or over the full-length of an amino acid or nucleic acid sequences.
• sequence comparison typically one sequence acts as a reference sequence, to which test sequences are compared.
• test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated.
• sequence algorithm program parameters Preferably, default program parameters can be used, or alternative parameters can be designated.
• sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
• a preferred example of algorithm that is suitable for determining percent sequence identity and sequence similarity are the BLAST algorithms, which are described in Altschul et al. 1977 Nuc. Acids Res. 25:3389-3402 and Altschul et al. 1990 J. Mol. Biol. 215:403-410, respectively.
• BLAST software is publicly available through the National Center for Biotechnology Information on the worldwide web at ncbi.nlm.nih.gov/. Both default parameters or other non-default parameters can be used.
• the BLASTP program uses as defaults a wordlength of 3, and expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff & Henikoff, Proc. Natl. Acad. Sci.
• inhibitor refers to any measurable reduction of biological activity.
• inhibit or “inhibition” may be referred to as a percentage of a normal level of activity.
• the term“interleukin 15” or“IL15” refers to a polypeptide that has at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to a native mammalian IL15 amino acid sequence that is biologically active, meaning the mutated protein (“mutein”) has functionality similar (75% or greater) to that of a native IL15 protein in at least one functional assay.
• IL15 is a cytokine that regulates T cell and natural killer cell activation and proliferation.
• IL15 and IL2 share many biological activities, including binding to CD122, the
• IL2p iL l 5b receptor subunit The number of CD8+ memory cells is controlled by a balance between this IL15 and IL2.
• IL15 induces the activation of JAK kinases, as well as the phosphorylation and activation of transcription activators STAT3, STAT5, and STAT6.
• IL15 also increases the expression of apoptosis inhibitor BCL2L1/BCL-X (L), possibly through the transcription activation activity of STAT6, and thus prevents apoptosis.
• Two alternatively spliced transcript variants of the IL15 gene encoding the same mature protein have been reported. [0082]
• Exemplified functional assays of an IL15 polypeptide include proliferation of T-cells ( e.g .
• NK cells NK cells
• macrophages NK cells
• neutrophils activation of NK cells, macrophages and neutrophils.
• Methods for isolation of particular immune cell subpopulations and detection of proliferation i. e ., 3 H-thymidine incorporation
• Cell-mediated cellular cytotoxicity assays can be used to measure NK cell, macrophage and neutrophil activation.
• Cell- mediated cellular cytotoxicity assays including release of isotopes ( 51 Cr), dyes (e.g., tetrazolium, neutral red) or enzymes, are also well known in the art, with commercially available kits (Oxford Biomedical Research, Oxford, M; Cambrex, Walkersville, Md.; Invitrogen, Carlsbad, Calif.).
• IL15 has also been shown to inhibit Fas mediated apoptosis (e.g., Demirci et al. 2004 Cell Mol
• Apoptosis assays including for example, TUNEL assays and annexin V assays, are well known in the art with commercially available kits (R&D Systems, Minneapolis, Minn.) (e.g., Coliga et al. 1991-2006 Current Methods in Immunology John Wiley & Sons.)
• interleukin 15 receptor alpha or“ILl5Ra” refers to an interleukin 15 receptor alpha amino acid sequences from a mammalian species.
• interleukin- 15 receptor alpha nucleic acid and amino acid sequences are publicly available in gene databases, for example, GenBank through the National Center for Biotechnological Information on the worldwide web at ncbi.nlm.nih.gov.
• Exemplified native mammalian IL-15 receptor alpha nucleic acid or amino acid sequences can be from, for example, human, primate, canine, feline, porcine, equine, bovine, ovine, rodentia, murine, rat, hamster, guinea pig, etc.
• Accession numbers for exemplary native mammalian IL-15 nucleic acid sequences include NM_l 72200.1 (human isoform 2); and NM_002189.2 (human isoform 1 precursor).
• Accession numbers for exemplary native mammalian IL-15 amino acid sequences include NP_751950.1 (human isoform 2); and NP 002180.1 (human isoform 1 precursor).
• “interleukin 15 receptor alpha” or“ILl5Ra” may also refer to a polypeptide that has at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to a native mammalian ILl5Ra amino acid sequence that is biologically active, having functionality similar (75% or greater) to that of a native ILl5Ra protein in at least one functional assay.
• ILl5Ra is a cytokine receptor that specifically binds IL15 with high affinity.
• One functional assay is specific binding to a native IL15 protein.
• an“isolated” molecule such as a polypeptide or
• polynucleotide is one that has been manipulated to exist in a higher concentration than in nature or has been removed from its native environment.
• a subject antibody is isolated, purified, substantially isolated, or substantially purified when at least 10%, or 20%, or 40%, or 50%, or 70%, or 90% of non-subject-antibody materials with which it is associated in nature have been removed.
• a polynucleotide or a polypeptide naturally present in a living animal is not“isolated,” but the same polynucleotide or polypeptide separated from the coexisting materials of its natural state is“isolated.”
• recombinant DNA molecules contained in a vector are considered isolated for the purposes of the present invention.
• Isolated RNA molecules include in vivo or in vitro RNA replication products of DNA and RNA molecules. Isolated nucleic acid molecules further include synthetically produced molecules. Additionally, vector molecules contained in recombinant host cells are also isolated. Thus, not all“isolated” molecules need be“purified.”
• linker or“linking segment” refer to a molecule or group that connects two other molecules or groups.
• a peptide linker may allow the connected molecules or groups to acquire a functional configuration.
• the linker peptide preferably comprises at least two amino acids, at least three amino acids, at least five amino acids, at least ten amino acids, at least 15 amino acids, at least 20 amino acids, at least 30 amino acids, at least 40 amino acids, at least 50 amino acids, at least 60 amino acids, at least 70 amino acids, at least 80 amino acids, at least 90 amino acids or approximately 100 amino acids.
• each component of a fusion protein can be organized in nearly any fashion provided that the fusion protein has the function for which it was intended.
• each component of a fusion protein can be spaced from another component by at least one suitable peptide linker segment or sequence if desired.
• the fusion protein may include tags, e.g., to facilitate modification, identification and/or purification of the fusion protein. More specific fusion proteins are in the examples described below.
• the term“low dosage” refers to at least 5% less (e.g., at least 10%, 20%, 50%, 80%, 90%, or even 95%) than the lowest standard recommended dosage of a particular compound formulated for a given route of administration for treatment of any human disease or condition.
• a low dosage of an agent that is formulated for administration by inhalation will differ from a low dosage of the same agent formulated for oral administration.
• the term“medium” or“media” includes any culture medium, solution, solid, semi-solid, or rigid support that may support or contain any host cell, including bacterial host cells, yeast host cells, insect host cells, plant host cells, eukaryotic host cells, mammalian host cells, CHO cells, prokaryotic host cells, E. coli, or Pseudomonas host cells, and cell contents.
• the term may encompass medium in which the host cell has been grown, e.g., medium into which a polypeptide has been secreted, including medium either before or after a proliferation step.
• the term also may encompass buffers or reagents that contain host cell lysates, such as in the case where a polypeptide is produced intracellularly and the host cells are lysed or disrupted to release the polypeptide.
• the term“modulate” refers to the production, either directly or indirectly, of an increase or a decrease, a stimulation, inhibition, interference, or blockage in a measured activity when compared to a suitable control.
• a “modulator” of a polypeptide or polynucleotide refers to a substance that affects, for example, increases, decreases, stimulates, inhibits, interferes with, or blocks a measured activity of the polypeptide or polynucleotide, when compared to a suitable control.
• a“modulator” may bind to and /or activate or inhibit the target with measurable affinity, or directly or indirectly affect the normal regulation of a receptor activity.
• operably linked refers to a functional linkage between a first nucleic acid sequence and a second nucleic acid sequence, such that the first and second nucleic acid sequences are transcribed into a single nucleic acid sequence. Operably linked nucleic acid sequences need not be physically adjacent to each other.
• the term“operably linked” also refers to a functional linkage between a nucleic acid expression control sequence (such as a promoter, or array of transcription factor binding sites) and a transcribable nucleic acid sequence, wherein the expression control sequence directs transcription of the nucleic acid corresponding to the transcribable sequence.
• the term“pharmaceutically acceptable” excipient, carrier, or diluent refers to a pharmaceutically acceptable material, composition or vehicle, such as a liquid or solid filler, diluent, excipient, solvent or encapsulating material, involved in carrying or transporting the subject pharmaceutical agent from one organ, or portion of the body, to another organ, or portion of the body.
• a pharmaceutically acceptable material, composition or vehicle such as a liquid or solid filler, diluent, excipient, solvent or encapsulating material, involved in carrying or transporting the subject pharmaceutical agent from one organ, or portion of the body, to another organ, or portion of the body.
• Each carrier must be “acceptable” in the sense of being compatible with the other ingredients of the formulation and not injurious to the patient.
• materials which can serve as pharmaceutically-acceptable carriers include: sugars, such as lactose, glucose and sucrose; starches, such as com starch and potato starch; cellulose, and its derivatives, such as sodium carboxymethyl cellulose, ethyl cellulose and cellulose acetate; powdered tragacanth; malt; gelatin; talc; excipients, such as cocoa butter and suppository waxes; oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, com oil and soybean oil; glycols, such as propylene glycol;
• polyols such as glycerin, sorbitol, mannitol and polyethylene glycol
• esters such as ethyl oleate and ethyl laurate
• agar buffering agents, such as magnesium hydroxide and aluminum hydroxide; alginic acid; pyrogen-free water; isotonic saline; Ringer's solution; ethyl alcohol; phosphate buffer solutions; and other non-toxic compatible substances employed in pharmaceutical formulations.
• wetting agents such as sodium lauryl sulfate, magnesium stearate, and polyethylene oxide-polypropylene oxide copolymer as well as coloring agents, release agents, coating agents, sweetening, flavoring and perfuming agents, preservatives and antioxidants can also be present in the compositions.
• nucleic acid As used herein, the terms“polynucleotide,”“nucleic acid molecule,”“nucleotide,” “oligonucleotide,” and “nucleic acid” are used interchangeably herein to refer to polymeric forms of nucleotides, including ribonucleotides as well as deoxyribonucleotides, of any length.
• They can include both double-, single-stranded or triple helical sequences and include, but are not limited to, cDNA from viral, prokaryotic, and eukaryotic sources; mRNA; genomic DNA sequences from viral ( e.g ., DNA viruses and retroviruses) or prokaryotic sources; RNAi; cRNA; antisense molecules; recombinant polynucleotides; ribozymes; and synthetic DNA sequences.
• the term also captures sequences that include any of the known base analogs of DNA and RNA. Nucleotides can be referred to by their commonly accepted single-letter codes.
• Polynucleotides are not limited to polynucleotides as they appear in nature, and also include polynucleotides where unnatural nucleotide analogues and inter-nucleotide bonds appear.
• a nucleic acid molecule may comprise modified nucleic acid molecules (e.g., modified bases, sugars, and/or intemucleotide linkers).
• Non-limitative examples of this type of unnatural structures include polynucleotides wherein the sugar is different from ribose, polynucleotides wherein the
• the polynucleotides of the invention include unnatural inter nucleotide bonds such as peptide nucleic acids (PNA), locked nucleic acids (LNA), C1-C4 alkylphosphonate bonds of the methylphosphonate, phosphoramidate, C1-C6 alkylphosphotriester, phosphorothioate and phosphorodithioate type.
• PNA peptide nucleic acids
• LNA locked nucleic acids
• C1-C4 alkylphosphonate bonds of the methylphosphonate phosphoramidate
• C1-C6 alkylphosphotriester phosphorothioate and phosphorodithioate type.
• the polynucleotides of the invention maintain the capacity to hybridise with target nucleic acids in a similar way to natural
• nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions) and complementary sequences, as well as the sequence explicitly indicated.
• Degenerate codon substitutions can be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues. (Batzer el al. 1991 Nucleic Acid Res. 19:5081; Ohtsuka e/ al. 1985 J. Biol. Chem. 260:2605-2608; Rossolini et al. 1994 Mol. Cell. Probes 8:91-98.)
• the terms“prevent”,“preventing”, or“prevention” refer to a method for precluding, delaying, averting, or stopping the onset, incidence, severity, or recurrence of a disease or condition.
• a method is considered to be a prevention if there is a reduction or delay in onset, incidence, severity, or recurrence of a disease or condition or one or more symptoms thereof in a subject susceptible to the disease or condition as compared to a subject not receiving the method.
• the disclosed method is also considered to be a prevention if there is a reduction or delay in onset, incidence, severity, or recurrence of one or more symptoms of a disease or condition in a subject susceptible to the disease or condition after receiving the method as compared to the subject's progression prior to receiving treatment.
• the reduction or delay in onset, incidence, severity, or recurrence of osteoporosis can be about a 5, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100%, or any amount of reduction in between.
• Prevention and the like do not mean preventing a subject from ever getting the specific disease or disorder. Prevention may require the administration of multiple doses. Prevention can include the prevention of a recurrence of a disease in a subject for whom all disease symptoms were eliminated, or prevention of recurrence in a relapsing-remitting disease.
• promoter refers to a DNA regulatory region capable of binding RNA polymerase in a mammalian cell and initiating transcription of a downstream (3' direction) coding sequence operably linked thereto.
• a promoter sequence includes the minimum number of bases or elements necessary to initiate transcription of a gene of interest at levels detectable above background. Within the promoter sequence may be a transcription initiation site, as well as protein binding domains (consensus sequences) responsible for the binding of RNA polymerase. Eukaryotic promoters will often, but not always, contain“TATA” boxes and“CAT” boxes.
• Promoters include those that are naturally contiguous to a nucleic acid molecule and those that are not naturally contiguous to a nucleic acid molecule. Additionally, the term “promoter” includes inducible promoters, conditionally active promoters such as a cre-lox promoter, constitutive promoters, and tissue specific promoters.
• the terms“protein” and“polypeptide” are used interchangeably to refer to a polymer of amino acid residues, and are not limited to a minimum length. Thus, peptides, oligopeptides, dimers, multimers, and the like, are included within the definition. Both full-length proteins and fragments thereof are encompassed by the definition. The terms also include post- expression modifications of the polypeptide, for example, glycosylation, acetylation,
• a polypeptide may refer to a protein which includes modifications, such as deletions, additions, and substitutions (generally conservative in nature), to the native sequence, as long as the protein maintains the desired activity. These modifications may be deliberate or may be accidental. Amino acids can be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB
• the term“purified” refers to a protein that may be substantially or essentially free of components that normally accompany or interact with the protein as found in its naturally occurring environment, i.e. a native cell, or host cell in the case of a recombinantly produced protein.
• a protein that may be substantially free of cellular material includes preparations of protein having less than about 30%, less than about 20%, less than about 15%, less than about 10%, less than about 5%, less than about 4%, less than about 3%, less than about 2%, or less than about 1% (by dry weight) of contaminating protein(s).
• the protein When a protein or variant thereof is recombinantly produced by the host cells, the protein may be present at about 30%, at about 20%, about 15%, about 10%, about 5%, about 4%, about 3%, about 2%, or about 1% or less of the dry weight of the cells.
• the protein When a protein or variant thereof is recombinantly produced by the host cells, the protein may be present in the culture medium at about 5 g/L, about 4 g/L, about 3 g/L, about 2 g/L, about 1 g/L, about 750 mg/L, about 500 mg/L, about 250 mg/L, about 100 mg/L, about 50 mg/L, about 10 mg/L, or about 1 mg/L or less of the dry weight of the cells.
• a“substantially purified” protein may have a purity level of at least at least about 80%, specifically, a purity level of at least about 85%, and more specifically, a purity level of at least about 90%, a purity level of at least about 95%, a purity level of at least about 99% or greater as determined by appropriate methods such as SDS/PAGE analysis, RP-HPLC, SEC, and capillary electrophoresis.
• Proteins and prodrugs of the present invention are, subsequent to their preparation, preferably isolated and/or purified to obtain a composition containing an amount by weight equal to or greater than 80% (“substantially pure”), which is then used or formulated as described herein. In certain embodiments, the compounds of the present invention are more than 95% pure.
• the term“receptor” refers to proteins, including glycoproteins or fragments thereof, capable of interacting with another molecule, called the ligand.
• the ligand may belong to any class of biochemical or chemical compounds.
• the ligand is usually an extracellular molecule which, upon binding to the receptor, usually initiates a cellular response, such as initiation of a signal transduction pathway.
• the receptor need not necessarily be a membrane-bound protein.
• the term“recombinant,” with respect to a nucleic acid molecule means a polynucleotide of genomic, cDNA, viral, semisynthetic, and/or synthetic origin which, by virtue of its origin or manipulation, is not associated with all or a portion of the polynucleotide with which it is associated in nature.
• the term “recombinant”, as used with respect to a protein or polypeptide means a polypeptide produced by expression of a recombinant polynucleotide.
• the term“recombinant” as used with respect to a host cell means a host cell into which a recombinant polynucleotide has been introduced.
• sample refers to a sample from a human, animal, or to a research sample, e.g., a cell, tissue, organ, fluid, gas, aerosol, slurry, colloid, or coagulated material.
• The“sample” may be tested in vivo, e.g., without removal from the human or animal, or it may be tested in vitro.
• sample also refers, e.g., to a cell comprising a fluid or tissue sample or a cell separated from a fluid or tissue sample.“Sample” may also refer to a cell, tissue, organ, or fluid that is freshly taken from a human or animal, or to a cell, tissue, organ, or fluid that is processed or stored.
• the term“soluble” refers to a fusion molecule, particularly a fusion protein, that is not readily sedimented under low G-force centrifugation (e.g., less than about 30,000 revolutions per minute in a standard centrifuge) from an aqueous buffer, e.g., cell media.
• a fusion molecule is soluble if it remains in aqueous solution at a temperature greater than about 5-37° C. and at or near neutral pH in the presence of low or no concentration of an anionic or non-ionic detergent. Under these conditions, a soluble protein will often have a low sedimentation value, e.g., less than about 10 to 50 svedberg units.
• Aqueous solutions referenced herein typically have a buffering compound to establish pH, typically within a pH range of about 5-9, and an ionic strength range between about 2 mM and 500 mM. Sometimes a protease inhibitor or mild non-ionic detergent is added. Additionally, a carrier protein may be added if desired (e.g., bovine serum albumin). Exemplary aqueous buffers include standard phosphate buffered saline, tris-buffered saline, or other well-known buffers and cell media formulations.
• the term“soluble IL15 Receptor alpha” refers to forms of IL15 Receptor alpha lacking the transmembrane anchor portion of the receptor and thus able to be secreted out of the cell without being anchored to the plasma membrane.
• the terms“stimulate” or“stimulating” refer to increase, to amplify, to augment, to boost a physiological activity, e.g., an immune response. Stimulation can be a positive alteration. For example, an increase can be by 5%, 10%, 25%, 50%, 75%, or even 90-100%. Other exemplary increases include 2-fold, 5 -fold, 10-fold, 20-fold, 40-fold, or even lOO-fold.
• the terms“subject” and“patient” are used interchangeably herein to refer to a living animal (human or non-human).
• the subject may be a mammal.
• the terms“mammal” or “mammalian” refer to any animal within the taxonomic classification mammalia.
• a mammal may be a human or a non-human mammal, for example, dogs, cats, pigs, cows, sheep, goats, horses, rats, and mice.
• the term "subject” does not preclude individuals that are entirely normal with respect to a disease or condition, or normal in all respects.
• the terms“suppress” or“suppressing” refer to decrease, to attenuate, to diminish, to arrest, or to stabilize a physiological activity, e.g., an immune response. Suppression can be a negative alteration. For example, a decrease can be by 5%, 10%, 25%, 50%, 75%, or even 90- 100%. Exemplary decreases include 2-fold, 5 -fold, 10-fold, 20-fold, 40-fold, or even lOO-fold.
• the term“therapeutically effective amount” refers to the dose of a therapeutic agent or agents sufficient to achieve the intended therapeutic effect with minimal or no undesirable side effects.
• a therapeutically effective amount can be readily determined by a skilled physician, e.g., by first administering a low dose of the pharmacological agent(s) and then incrementally increasing the dose until the desired therapeutic effect is achieved with minimal or no undesirable side effects.
• transfected means possessing introduced DNA or RNA, with or without the use of any accompanying facilitating agents such as lipofectamine.
• Methods for transfection include, for example, calcium phosphate transfection, DEAE dextran transfection, protoplast fusion, electroporation, and lipofection.
• treatment refers to a method of reducing, delaying or ameliorating such a condition, or one or more symptoms of such disease or condition, before or after it has occurred. Treatment may be directed at one or more effects or symptoms of a disease and/or the underlying pathology.
• the treatment can be any reduction and can be, but is not limited to, the complete ablation of the disease or the symptoms of the disease. As compared with an equivalent untreated control, such reduction or degree of prevention is at least 5%, 10%, 20%, 40%, 50%, 60%, 80%, 90%, 95%, or 100% as measured by any standard technique.
• the term“tumor” refers to any malignant or neoplastic cell.
• the term“vector” refers to a nucleic acid molecule that is able to transmit genetic material to a host cell or organism.
• a vector may be composed of either DNA or RNA.
• a vector carries its own origin of replication, one or more unique recognition sites for restriction endonucleases which can be used for the insertion of foreign DNA, and usually selectable markers such as genes coding for antibiotic resistance, and often recognition sequences ( e.g ., promoter) for the expression of the inserted DNA.
• Common vectors include plasmid vectors and phage vectors.
• compositions or methods disclosed herein can be combined with one or more of any of the other compositions and methods provided herein.
• the invention provides novel fusion proteins and therapeutic uses thereof. More particularly, the invention provides novel fusion proteins of IL15 and prodrugs thereof, compositions and methods of preparation thereof, which are useful in treating various diseases and disorders, e.g., hyperplasia, solid tumor or hematopoietic malignancy with reduced off-target toxicities and side effects during treatment.
• various diseases and disorders e.g., hyperplasia, solid tumor or hematopoietic malignancy with reduced off-target toxicities and side effects during treatment.
• the invention generally relates to a fusion protein.
• the fusion protein comprises: a first structural unit: a subunit, or a fragment thereof, of interleukin 15 receptor (IL15R); a second structural unit: an active IL15; a third structural unit: an antibody Fc fragment, located at the C-terminus of the fusion protein; and a first linker segment covalently linking the first, second and third structural units, wherein at the N-terminus of the fusion protein is the first structural unit, and the second structural unit is located between the first structural unit and the third structural unit.
• IL15R interleukin 15 receptor
• a second structural unit an active IL15
• an antibody Fc fragment located at the C-terminus of the fusion protein
• a first linker segment covalently linking the first, second and third structural units, wherein at the N-terminus of the fusion protein is the first structural unit, and the second structural unit is located between the first structural unit and the third structural unit.
• the invention generally relates to a fusion protein.
• the fusion protein comprises: a first structural unit: a subunit, or a fragment thereof, of interleukin 15 receptor (IL15R); a second structural unit: an active IL15; a third structural unit: an antibody Fc fragment, located at the C-terminus of the fusion protein; and a first linker segment covalently linking the first, second and third structural units, wherein at the N-terminus of the fusion protein is the second structural unit, the first structural unit is located between the second structural unit and the third structural unit.
• IL15R interleukin 15 receptor
• a second structural unit an active IL15
• a third structural unit an antibody Fc fragment
• the subunit of the IL15R is selected from a subunit, b subunit and g subunit.
• the subunit of the IL15R is an a subunit.
• the fragment is the sushi domain of a subunit of mouse IL15R, with the amino acid sequence set forth in SEQ ID No. 4.
• the fragment is the sushi domain of a subunit of human IL15R, with the amino acid sequence set forth in SEQ ID No. 5.
• the IL15 is human or murine IL15.
• the IL15 is mouse IL15.
• the mouse IL15 has the amino acid sequence set forth in SEQ ID No. 1.
• the IL15 is human IL15.
• the human IL15 has the amino acid sequence set forth in SEQ ID No. 2.
• the antibody Fc fragment comprises a human Fc fragment.
• the human Fc fragment comprises a human IgGl-Fc having the amino acid sequence set forth in SEQ ID No. 3.
• the linker segment Ll comprises a multiple of GGGS.
• the linker segment Ll linking the first structural unit to the third structural unit comprises the amino acid sequence set forth in SEQ ID No. 9.
• the linker segment Ll linking the first and second structural units comprises the amino acid sequence set forth in SEQ ID No. 8.
• the fusion protein further comprises: a fourth structural unit located at the N-terminus of the fusion protein: an extracellular domain of the IL15 receptor b subunit (R-b); and a linker segment L2 covalently linking the fourth structural unit and the remaining structural units of the fusion protein, wherein the first structural unit is covalently linked to the C- terminus of the fourth structural unit, and the second structural unit is located between the first structural unit and the third structural unit, and wherein the linker segment L2 is capable of being recognized and hydrolyzed by a proteolytic enzyme specifically expressed in a tumor
• the fusion protein further comprises: a fourth structural unit located at the N-terminus of the fusion protein: an extracellular domain of the IL15 receptor b subunit (R-b); and a linker segment L2 covalently linking the fourth structural unit and the remaining structural units of the fusion protein, wherein the second structural unit is covalently linked to the C- terminus of the fourth structural unit, and the first structural unit is located between the second structural unit and the third structural unit, and wherein the linker segment L2 is capable of being recognized and hydrolyzed by a proteolytic enzyme specifically expressed in a tumor
• amino acid sequence of mouse R-b has the amino acid sequence set forth in SEQ ID No. 6.
• amino acid sequence of human R-b has the amino acid sequence set forth in SEQ ID No. 7.
• the proteolytic enzyme specifically expressed in the tumor microenvironment is a matrix metalloproteinase.
• the matrix metalloproteinase is matrix metalloproteinase 9 (MMP9).
• the matrix metalloproteinase is matrix metalloproteinase 14 (MMP14).
• the linker segment L2 comprises an amino acid sequence set forth in SEQ ID Nos. 10-23.
• the invention generally relates to a homodimeric or heterodimeric protein, comprising a fusion protein disclosed herein.
• the homodimeric or heterodimeric protein comprises a monomer of RA-ILl5-Fc: sushi domain of murine IL15 receptor a subunit, the linker segment Ll, murine IL15, the linker segment Ll, a fusion protein of human IgGl Fc, e.g., having the amino acid sequence as set forth in SEQ ID No. 24.
• the homodimeric or heterodimeric protein comprises a monomer of RA-ILl5-Fc: sushi domain of human IL15 receptor a subunit, the linker segment Ll, human IL15, the linker segment Ll, a fusion protein of human IgGl Fc, e.g., having the amino acid sequence as set forth in SEQ ID No. 25.
• the homodimeric or heterodimeric protein comprises a monomer of ILl5-RA-Fc: murine IL15, the linker segment Ll, sushi domain of IL15 receptor a subunit, the linker segment Ll, a fusion protein of human IgGl Fc, e.g., having the amino acid sequence as set forth in SEQ ID No. 26.
• the homodimeric or heterodimeric protein comprises a monomer of ILl5-RA-Fc: human IL15, the linker segment Ll, sushi domain of IL15 receptor a subunit, the linker segment Ll, a fusion protein of human IgGl Fc, e.g., having the amino acid sequence as set forth in SEQ ID No. 27.
• the homodimeric or heterodimeric protein comprises a monomer of RB-ILl5-RA-Fc: an extracellular domain of the mouse IL15 receptor b subunit, the linker segment L2, murine IL15, the linker segment Ll, the sushi domain of IL15 receptor a subunit, the linker segment Ll, a fusion protein of the human IgGl Fc, e.g., having the amino acid sequence as set forth in SEQ ID No. 28.
• the homodimeric or heterodimeric protein comprises a monomer of RB-ILl5-RA-Fc: an extracellular domain of the human IL15 receptor b subunit, the linker segment L2, human IL15, the linker segment Ll, the sushi domain of IL15 receptor a subunit, the linker segment Ll, a fusion protein of the human IgGl Fc, e.g., having an amino acid sequence as set forth in SEQ ID No. 29-41.
• the homodimeric or heterodimeric protein comprises a monomer of RB-ILl5-RA-Fc: an extracellular domain of the human IL15 receptor b subunit, the linker segment Ll, human IL15, the linker segment Ll, the sushi domain of IL15 receptor a subunit, the linker segment Ll, a fusion protein of the human IgGl Fc, e.g., having the amino acid sequence as set forth in SEQ ID No. 42.
• the homodimeric or heterodimeric protein is hydrolyzed by a proteolytic enzyme specifically expressed in a tumor microenvironment.
• the invention generally relates to a substantially purified protein, such as a fusion protein or a fragment, disclosed herein.
• the invention generally relates to a polynucleotide encoding a protein, such as a fusion protein or a fragment thereof, disclosed herein.
• the invention generally relates to an expression vector comprising a polynucleotide encoding a protein, such as a fusion protein or a fragment thereof, disclosed herein.
• the invention generally relates to a pharmaceutical composition
• a pharmaceutical composition comprising a protein, such as a fusion protein or a fragment thereof, disclosed herein and a pharmaceutically acceptable excipient, carrier, or diluent.
• the invention generally relates to a pharmaceutical composition
• a pharmaceutical composition comprising a polynucleotide encoding a protein, such as a fusion protein or a fragment thereof, disclosed herein and a pharmaceutically acceptable excipient, carrier, or diluent.
• the invention generally relates to a method for treating a disease or condition. The method comprises administering to a patient in need thereof a therapeutically effective amount of a polynucleotide encoding a protein, such as a fusion protein or a fragment thereof, disclosed herein, wherein the disease or condition is selected from hyperplasia, solid tumor or hematopoietic malignancy.
• the disease or condition being treated is hyperplasia.
• the disease or condition being treated is a solid tumor.
• the disease or condition being treated is a hematopoietic malignancy.
• the subject being treated is further administered one or more of chemotherapy, radiotherapy, targeted therapy, immunotherapy or hormonal therapy.
• the method further comprises administering a chemotherapeutic agent to the subject.
• the method further comprises administering a radiotherapy to the subject.
• the method further comprises administering a targeted therapy to the subject.
• the method further comprises administering an immunotherapy to the subject.
• the method further comprises administering hormonal therapy to the subject.
• chemotherapeutic agent refers to a chemical compound useful in the treatment of cancer.
• examples of chemotherapeutic agents include Erlotinib (TARCEVA®, Genentech/OSI Pharm.), Bortezomib (VELCADE®, Millennium Pharm.), Fulvestrant
• Imatinib mesylate GLEEVEC®, Novartis
• PTK787/ZK 222584 Novartis
• Oxaliplatin Eloxatin®, Sanofi
• 5-FU 5-fluorouracil
• Leucovorin Rapamycin (Sirolimus, RAPAMUNE®, Wyeth)
• Lapatinib TYKERB®, GSK572016, Glaxo Smith Kline
• Lonafamib SCH 66336
• Sorafenib BAY43-9006, Bayer Labs
• Gefitmib IRESSA®, AstraZeneca
• alkylating agents such as thiotepa and CYTOXAN® cyclosphosphamide
• alkyl sulfonates such as busulfan, improsulfan and piposulfan
• aziridines such as benzodopa, carboquone, me
• calicheamicin especially calicheamicin gammall and calicheamicin omegall (Angew Chem. Intl. Ed. Engl. (1994) 33: 183-186); dynemicin, including dynemicin A; bisphosphonates, such as clodronate; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antibiotic chromophores), aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, caminomycin, carzinophilin, chromomycinis, dactinomycin, daunorubicin, detorubicin, 6- diazo-5-oxo-L-norleucine, ADRIAMYCIN ® (doxorubicin), morpholino-doxorubicin,
• cyanomorpholino-doxorubicin 2-pyrrolino-doxorubicin and deoxydoxorubicin
• epirubicin esonibicin, idarubicin, marcellomycin
• mitomycins such as mitomycin C, mycophenolic acid, nogalamycin, olivomycins, peplomycin, porfiromycin, puromycin, quelamycin, rodorubicin, streptonigrin, streptozocin, tubercidin, ubenimex, zinostatin, zorubicin
• anti-metabolites such as methotrexate and 5-fluorouracil (5-FU); folic acid analogs such as denopterin, methotrexate, pteropterin, trimetrexate; purine analogs such as fludarabine, 6- mercaptopurine, thiamniprine, thioguanine; pyrimidine analogs such as ancitabine, azacitidine, 6-azauridine, carm
• dromostanolone propionate epitiostanol, mepitiostane, testolactone
• anti-adrenals such as aminoglutethimide, mitotane, trilostane
• folic acid replenisher such as frolinic acid; aceglatone; aldophosphamide glycoside; aminolevulinic acid; eniluracil; amsacrine; bestrabucil; bisantrene; edatraxate; defofamine; demecolcine; diaziquone; elformithine; elliptinium acetate; an epothilone; etoglucid; gallium nitrate; hydroxyurea; lentinan; lonidainine; maytansinoids such as maytansine and ansamitocins; mitoguazone; mitoxantrone; mopidanmol; nitraerine; pentostatin; phenamet
• mitobronitol mitolactol; pipobroman; gacytosine; arabinoside ("Ara-C"); cyclophosphamide;
• thiotepa thiotepa
• taxoids e.g. , TAXOL ® (paclitaxel; Bristol-Myers Squibb Oncology, Princeton, N.J.), ABRAXANE® (Cremophor-free), albumin-engineered nanoparticle formulations of paclitaxel (American Pharmaceutical Partners, Schaumberg, 111.), and TAXOTERE ® (doxetaxel; Rhone- Poulenc Rorer, Antony, France); chloranmbucil; GEMZAR ® (gemcitabine); 6-thioguanine;
• mercaptopurine methotrexate
• platinum analogs such as cisplatin and carboplatin
• vinblastine
• etoposide VP- 16
• ifosfamide mitoxantrone; vincristine
• NAVELBINE ® vinylelbine
• novantrone teniposide
• edatrexate daunomycin
• aminopterin capecitabine
• XELODA XELODA ®
• ibandronate CPT-l l
• topoisomerase inhibitor RFS 2000 difluoromethylomithine (DMFO); retinoids such as retinoic acid
• pharmaceutically acceptable salts, acids and derivatives of any of the above etoposide (VP- 16); ifosfamide; mitoxantrone; vincristine; NAVELBINE ® (vinorelbine); novantrone; teniposide; edatrexate; daunomycin; aminopterin; capecitabine (XELODA ® ); ibandronate; CPT-l l; topoisome
• Examples of the second (or further) agent or therapy may include, but are not limited to, immunotherapies (e.g. PD-l inhibitors (pembrolizumab, nivolumab, cemiplimab), PD-L1 inhibitors (atezolizumab, avelumab, durvalumab), CTLA4 antagonist, cell signal transduction inhibitors (e.g., imatinib, gefitinib, bortezomib, erlotinib, sorafenib, sunitinib, dasatinib, vorinostat, lapatinib, temsirolimus, nilotinib, everolimus, pazopanib, trastuzumab, bevacizumab, cetuximab, ranibizumab, pegaptanib, panitumumab and the like), mitosis inhibitors (e.g., paclitaxel, vincri
• the invention generally relates to use of a protein, such as a fusion protein or a fragment thereof, disclosed herein for treating or reducing a disease or disorder (e.g., hyperplasia, solid tumor or hematopoietic malignancy).
• a disease or disorder e.g., hyperplasia, solid tumor or hematopoietic malignancy.
• the invention generally relates to use of a polynucleotide encoding a protein, such as a fusion protein or a fragment thereof, disclosed herein for treating or reducing a disease or disorder (e.g., hyperplasia, solid tumor or hematopoietic malignancy).
• a disease or disorder e.g., hyperplasia, solid tumor or hematopoietic malignancy.
• the invention generally relates to use of a protein, such as a fusion protein or a fragment thereof, disclosed herein and a pharmaceutically acceptable excipient, carrier, or diluent, in preparation of a medicament for treating or reducing a disease or disorder (e.g ., hyperplasia, solid tumor or hematopoietic malignancy).
• a disease or disorder e.g ., hyperplasia, solid tumor or hematopoietic malignancy.
• the invention generally relates to use of a polynucleotide encoding a protein, such as a fusion protein or a fragment thereof, disclosed herein and a pharmaceutically acceptable excipient, carrier, or diluent, in preparation of a medicament for treating or reducing a disease or disorder (e.g., hyperplasia, solid tumor or hematopoietic malignancy).
• a disease or disorder e.g., hyperplasia, solid tumor or hematopoietic malignancy
• the medicament is an anticancer drug.
• the disease or disorder is one or more selected from head and neck cancer, endometrial cancer, colorectal cancer, ovarian cancer, breast cancer, melanoma, lung cancer, renal cancer, liver cancer, anal cancer, sarcoma, lymphoma, leukemia, brain tumors, gastric cancer, testicular cancer, pancreatic cancer, and thyroid cancer.
• the anticancer drug is effective for treating B-cell lymphoma or anti-colorectal cancer.
• the invention generally relates to a cell line comprising a polynucleotide encoding a protein, such as a fusion protein or a fragment thereof, disclosed herein.
• the invention generally relates to a method for making a protein, comprising culturing the cell line.
• the method further comprises purifying or isolating a produced protein, such as a fusion protein or a fragment thereof, disclosed herein.
• the invention generally relates to a method for making a protein.
• the method comprises: providing an expression vector encoding a protein, such as a fusion protein or a fragment thereof, disclosed herein; introducing the expression vector into a host cell; culturing the host cell in media under conditions sufficient to express the protein; and purifying the protein from the host cell or media.
• Any suitable expression vectors may be employed.
• An exemplary expression vector is rEE12.4 expression vector.
• Any suitable host cell may be employed, for examples, 293F and CHO cells.
• Introduction of the expression vector can be accomplished by any suitable transfection method and can be via a transient transfection or a stable cell line.
• Any suitable purification method may be employed.
• An exemplary purification method is by affinity chromatography of ProteinA/G or size exclusion methods.
• the invention generally relates to an isolated protein produced by a method disclosed herein.
• the isolated protein is substantially pure.
• linker sequences can be used to link two or more polypeptides of the biologically active polypeptide to generate a single-chain molecule with a desired functional activity.
• exemplary peptide linker sequences include those having from about 7 to 20 amino acids, e.g., from about 8 to 16 amino acids.
• the linker sequence is preferably flexible so as not hold the biologically active polypeptide or effector molecule in a single undesired conformation.
• the linker sequence can be used, e.g., to space the recognition site from the fused molecule.
• the peptide linker sequence can be positioned so as to provide molecular flexibility.
• the linker preferably predominantly comprises amino acids with small side chains, such as glycine, alanine and serine, to provide for flexibility.
• preparation of the fusion protein complexes of the invention can be accomplished by procedures disclosed herein and by recognized recombinant DNA techniques involving, e.g., polymerase chain amplification reactions (PCR), preparation of plasmid DNA, cleavage of DNA with restriction enzymes, preparation of oligonucleotides, ligation of DNA, isolation of mRNA, introduction of the DNA into a suitable cell, transformation or transfection of a host, culturing of the host.
• the fusion molecules can be isolated and purified using chaotropic agents and well known electrophoretic, centrifugation and chromatographic methods. (Sambrook, et al., Molecular Cloning: A Laboratory Manual (2nd ed. (1989); and Ausubel, et al, Current Protocols in Molecular Biology, John Wiley & Sons, New York (1989) for disclosure relating to these methods.)
• the invention further provides nucleic acid sequences and DNA sequences that encode the present fusion proteins.
• the DNA sequence may be carried by a vector suited for
• extrachromosomal replication such as a phage, virus, plasmid, phagemid, cosmid, YAC, or episome.
• a DNA vector that encodes a desired fusion protein can be used to facilitate preparative methods described herein and to obtain significant quantities of the fusion protein or components thereof.
• the DNA sequence can be inserted into an appropriate expression vector, i.e., a vector that contains the necessary elements for the transcription and translation of the inserted protein-coding sequence.
• a variety of host- vector systems may be utilized to express the protein-coding sequence.
• viruses may include mammalian cell systems infected with virus (e.g., vaccinia virus, adenovirus, etc.); insect cell systems infected with virus (e.g., baculovirus); microorganisms such as yeast containing yeast vectors, or bacteria transformed with bacteriophage DNA, plasmid DNA or cosmid DNA.
• virus e.g., vaccinia virus, adenovirus, etc.
• insect cell systems infected with virus e.g., baculovirus
• microorganisms such as yeast containing yeast vectors, or bacteria transformed with bacteriophage DNA, plasmid DNA or cosmid DNA.
• any one of a number of suitable transcription and translation elements may be used.
• Fusion protein components encoded by the DNA vector can be provided in a cassette format.
• cassette is meant that each component can be readily substituted for another component by standard recombinant methods.
• a DNA vector configured in a cassette format is particularly desirable when the encoded fusion complex is to be used against pathogens that may have or have capacity to develop serotypes.
• DNA coding for the biologically active polypeptide is linked to a sequence coding for the effector peptide by use of suitable ligases.
• DNA coding for the presenting peptide can be obtained by isolating DNA from natural sources such as from a suitable cell line or by known synthetic methods, e.g. the phosphate triester method. (Oligonucleotide Synthesis, IRL Press, M. J. Gait, ed., 1984). Synthetic
• oligonucleotides also may be prepared using commercially available automated oligonucleotide synthesizers.
• the gene coding for the biologically active polypeptide can be amplified by PCR or other means known in the art. Suitable PCR primers to amplify the biologically active polypeptide gene may add restriction sites to the PCR product.
• the PCR product preferably includes splice sites for the effector peptide and leader sequences necessary for proper expression and secretion of the biologically active polypeptide-effector fusion complex.
• the PCR product also preferably includes a sequence coding for the linker sequence, or a restriction enzyme site for ligation of such a sequence.
• the fusion proteins described herein may be produced by standard recombinant DNA techniques. For example, once a DNA molecule encoding the biologically active polypeptide is isolated, sequence can be ligated to another DNA molecule encoding the effector polypeptide.
• the nucleotide sequence coding for a biologically active polypeptide may be directly joined to a DNA sequence coding for the effector peptide or, more typically, a DNA sequence coding for the linker sequence as discussed herein may be interposed between the sequence coding for the biologically active polypeptide and the sequence coding for the effector peptide and joined using suitable ligases.
• the resultant hybrid DNA molecule can be expressed in a suitable host cell to produce the fusion protein complex.
• the DNA molecules are ligated to each other in a 5' to 3' orientation such that, after ligation, the translational frame of the encoded polypeptides is not altered (i.e., the DNA molecules are ligated to each other in-frame).
• the resulting DNA molecules encode an in-frame fusion protein.
• Other nucleotide sequences also can be included in the gene construct.
• a promoter sequence which controls expression of the sequence coding for the biologically active polypeptide fused to the effector peptide, or a leader sequence, which directs the fusion protein to the cell surface or the culture medium, can be included in the construct or present in the expression vector into which the construct is inserted.
• polypeptides may be modified by certain amino acid substitutions, additions, deletions, and post-translational modifications, without loss or reduction of biological activity.
• conservative amino acid substitutions that is, substitution of one amino acid for another amino acid of similar size, charge, polarity and conformation, are unlikely to significantly alter protein function.
• the 20 standard amino acids that are the constituents of proteins can be broadly categorized into four groups of conservative amino acids as follows: the nonpolar (hydrophobic) group includes alanine, isoleucine, leucine, methionine, phenylalanine, proline, tryptophan and valine; the polar (uncharged, neutral) group includes asparagine, cysteine, glutamine, glycine, serine, threonine and tyrosine; the positively charged (basic) group contains arginine, histidine and lysine; and the negatively charged (acidic) group contains aspartic acid and glutamic acid.
• the nonpolar (hydrophobic) group includes alanine, isoleucine, leucine, methionine, phenylalanine, proline, tryptophan and valine
• the polar (uncharged, neutral) group includes asparagine, cysteine, glutamine, glycine, serine, threonine and
• Homology between nucleotide sequences can be determined by DNA hybridization analysis, wherein the stability of the double-stranded DNA hybrid is dependent on the extent of base pairing that occurs. Conditions of high temperature and/or low salt content reduce the stability of the hybrid, and can be varied to prevent annealing of sequences having less than a selected degree of homology. For instance, for sequences with about 55% G-C content, hybridization and wash conditions of 40-50 C, 6*SSC (sodium chloride/sodium citrate buffer) and 0.1% SDS (sodium dodecyl sulfate) indicate about 60-70% homology, hybridization and wash conditions of 50-65 C,
• HSSC and 0.1% SDS indicate about 82-97% homology, and hybridization and wash conditions of 52 C, O. HSSC and 0.1% SDS indicate about 99-100% homology.
• a wide range of computer programs for comparing nucleotide and amino acid sequences (and measuring the degree of homology) are also available. Readily available sequence comparison and multiple sequence alignment algorithms are, respectively, the Basic Local Alignment Search Tool (BLAST) and ClustalW programs.
• BLAST Basic Local Alignment Search Tool
• fusion protein construct described above can be incorporated into a suitable vector by known means such as by use of restriction enzymes to make cuts in the vector for insertion of the construct followed by ligation.
• the vector containing the gene construct is then introduced into a suitable host for expression of the fusion protein.
• Suitable host cells include eukaryotic and prokaryotic cells, preferably those cells that can be easily transformed and exhibit rapid growth in culture medium.
• preferred hosts cells include prokaryotes such as E. colt, Bacillus subtillus, etc. and eukaryotes such as animal cells and yeast strains, e.g., S. cerevisiae.
• Mammalian cells are generally preferred, particularly J558, NSO, SP2-0 or CHO.
• Other suitable hosts include, e.g., insect cells such as Sf9. Conventional culturing conditions are employed. See Sambrook, supra. Stable transformed or transfected cell lines can then be selected.
• Cells expressing a fusion protein complex of the invention can be determined by known procedures. For example, expression of a fusion protein complex linked to an immunoglobulin can be determined by an ELISA specific for the linked immunoglobulin and/or by immunoblotting. Other methods for detecting expression of fusion proteins comprising biologically active polypeptides linked to IL12 or IL12R domains are disclosed in the Examples.
• a host cell can be used for preparative purposes to propagate nucleic acid encoding a desired fusion protein or a component thereof.
• a host cell can include a prokaryotic or eukaryotic cell in which production of the fusion protein is specifically intended.
• host cells specifically include yeast, fly, worm, plant, frog, mammalian cells and organs that are capable of propagating nucleic acid encoding the fusion.
• mammalian cell lines which can be used include CHO dhfr-cells (Urlaub and Chasm, 1980 Proc. Natl. Acad. Sci. USA, 77:4216), 293 cells (Graham et al. 1977 J. Gen. Virol., 36:59 ()) or myeloma cells like SP2 or NSO (Galfre and
• Host cells capable of propagating nucleic acid encoding a desired fusion protein complex encompass non-mammalian eukaryotic cells as well, including insect (e.g., Sp . frugiperda), yeast (e.g., S. cerevisiae, S. pombe, P. pastoris, K. lactis, H. polymorpha as generally reviewed by Fleer, R., 1992 Current Opinion in Biotechnology, 3(5):486496), fungal and plant cells. Also contemplated are certain prokaryotes such as E. colt and Bacillus.
• Nucleic acid encoding a desired fusion protein can be introduced into a host cell by standard techniques for transfecting cells.
• the term“transfecting” or“transfection” is intended to encompass all conventional techniques for introducing nucleic acid into host cells, including calcium phosphate co-precipitation, DEAE-dextran-mediated transfection, lipofection, electroporation, microinjection, viral transduction and/or integration.
• promoters transcriptional initiation regulatory region
• the selection of the appropriate promoter is dependent upon the proposed expression host. Promoters from heterologous sources may be used as long as they are functional in the chosen host.
• Promoter selection is also dependent upon the desired efficiency and level of peptide or protein production.
• Inducible promoters such as tac are often employed in order to dramatically increase the level of protein expression in E. colt. Overexpression of proteins may be harmful to the host cells. Consequently, host cell growth may be limited.
• the use of inducible promoter systems allows the host cells to be cultivated to acceptable densities prior to induction of gene expression, thereby facilitating higher product yields.
• Various signal sequences may be used according to the invention.
• a signal sequence which is homologous to the biologically active polypeptide coding sequence may be used.
• a signal sequence which has been selected or designed for efficient secretion and processing in the expression host may also be used.
• a signal sequence may be joined directly through the sequence encoding the signal peptidase cleavage site to the protein coding sequence, or through a short nucleotide bridge.
• the expression construct can be assembled by employing known recombinant DNA techniques. Restriction enzyme digestion and ligation are the basic steps employed to join two fragments of DNA. Polylinkers and adaptors may be employed to facilitate joining of selected fragments.
• the expression construct can typically be assembled in stages employing rounds of restriction, ligation, and transformation of E. coli. Numerous cloning vectors suitable for construction of the expression construct are known in the art (lZAR and pBLUESCRIPT SK-l, Stratagene, La Jolla, Calif., pET, Novagen Inc., Madison, Wis., rEE12.4, Lonza Biologies, Basel, Switzerland).
• the expression construct may be transformed into the host as the cloning vector construct, either linear or circular, or may be removed from the cloning vector and used as is or introduced onto a delivery vector.
• the delivery vector facilitates the introduction and maintenance of the expression construct in the selected host cell type.
• the expression construct is introduced into the host cells by any of a number of known gene transfer systems (e.g., natural competence, chemically mediated transformation, protoplast transformation, electroporation, biolistic transformation, transfection, or conjugation). The gene transfer system selected depends upon the host cells and vector systems used.
• the present invention further provides a production process for isolating a fusion protein of interest.
• a host cell e.g., a yeast, fungus, insect, bacterial or animal cell
• a nucleic acid encoding the protein of the interest operatively linked to a regulatory sequence
• the fusion protein of interest is isolated from harvested host cells or from the culture medium. Standard protein purification techniques can be used to isolate the protein of interest from the medium or from the harvested cells.
• the purification techniques can be used to express and purify a desired fusion protein on a large-scale (i.e. in at least milligram quantities) from a variety of implementations including roller bottles, spinner flasks, tissue culture plates, bioreactor, or a fermentor.
• An expressed protein fusion complex can be isolated and purified by known methods. Typically, the culture medium is centrifuged or filtered and then the supernatant is purified by affinity or immunoaffmity chromatography, e.g. Protein- A or Protein-G affinity chromatography or an immunoaffmity protocol comprising use of monoclonal antibodies that bind the expressed fusion complex such as a linked TCR or immunoglobulin region thereof.
• affinity or immunoaffmity chromatography e.g. Protein- A or Protein-G affinity chromatography or an immunoaffmity protocol comprising use of monoclonal antibodies that bind the expressed fusion complex such as a linked TCR or immunoglobulin region thereof.
• the fusion proteins of the present invention can be separated and purified by appropriate combination of known techniques.
• methods utilizing solubility such as salt precipitation and solvent precipitation
• methods utilizing the difference in molecular weight such as dialysis, ultra-filtration, gel-filtration, and SDS-polyacrylamide gel electrophoresis
• methods utilizing a difference in electrical charge such as ion-exchange column chromatography
• methods utilizing specific affinity such as affinity chromatography
• methods utilizing a difference in hydrophobicity such as reverse- phase high performance liquid chromatography
• methods utilizing a difference in isoelectric point such as isoelectric focusing electrophoresis
• metal affinity columns such as Ni-NTA.
• the fusion proteins of the present invention be substantially pure. That is, the fusion proteins have been isolated from cell substituents that naturally accompany it so that the fusion proteins are present preferably in at least 80% or 90% to 95% homogeneity (w/w). Fusion proteins having at least 98 to 99% homogeneity (w/w) are most preferred for many pharmaceutical, clinical and research applications.
• the fusion protein should be substantially free of contaminants for therapeutic applications.
• the soluble fusion proteins can be used therapeutically, or in performing in vitro or in vivo assays as disclosed herein. Substantial purity can be determined by a variety of standard techniques such as chromatography and gel electrophoresis.
• the invention also provides a pharmaceutical preparation comprising a therapeutically effective amount of a composition, a fusion protein, a polynucleotide, a gene construct, a vector or a host cell according to the invention and a pharmaceutically acceptable excipient or vehicle.
• Preferred excipients for use in the present invention include sugars, starches, celluloses, gums and proteins.
• the pharmaceutical composition of the invention is formulated in a pharmaceutical form for administration as a solid (for example tablets, capsules, lozenges, granules, suppositories, crystalline or amorphous sterile solids that can be reconstituted to provide liquid forms, etc.), liquid (for example solutions, suspensions, emulsions, elixirs, lotions, unguents, etc.) or semi-solid (gels, ointments, creams and similar).
• a solid for example tablets, capsules, lozenges, granules, suppositories, crystalline or amorphous sterile solids that can be reconstituted to provide liquid forms, etc.
• liquid for example solutions, suspensions, emulsions, elixirs, lotions, unguents, etc.
• semi-solid gels, ointments,
• compositions of the invention can be administered by any route, including, without limitation, oral, intravenous, intramuscular, intraarterial, intramedullary, intratecal, intraventricular, transdermic, subcutaneous, intraperitoneal, intranasal, enteric, topical, sublingual or rectal route.
• routes including, without limitation, oral, intravenous, intramuscular, intraarterial, intramedullary, intratecal, intraventricular, transdermic, subcutaneous, intraperitoneal, intranasal, enteric, topical, sublingual or rectal route.
• a revision of the different forms of administration of active principles, the excipients to be used and their manufacturing procedures can be found in Remington's Pharmaceutical Sciences (A. R.
• compositions comprising said vehicles can be formulated by conventional procedures known in the state of the technique.
• nucleic acids the polynucleotides of the invention, vectors or gene constructs
• the invention contemplates specially prepared pharmaceutical compositions for administering said nucleic acids.
• compositions can comprise said nucleic acids in naked form, in other words, in the absence of compounds protecting the nucleic acids from degradation by the organism's nucleases, which entails the advantage of eliminating the toxicity associated to the reagents used for transfection.
• Suitable routes of administration for the naked compounds include intravascular, intratumoral, intracraneal, intraperitoneal, intrasplenic, intramuscular, subretinal, subcutaneous, mucous, topical and oral route (Templeton, 2002 DNA Cell Biol., 21 :857-867).
• the nucleic acids can be administered forming part of liposomes, conjugated to cholesterol or conjugated to compounds capable of promoting translocation through cell membranes such as the Tat peptide derived from the TAT protein of HIV-l, the third helix of the homeodomain of the Antennapedia protein of D.melanogaster, the VP22 protein of the herpes simplex virus, oligomers of arginine and peptides such as those described in W007069090 (Lindgren, et al. 2000 Trends Pharmacol. Sci 21 :99-103; Schwarze, et al. 2000 Trends Pharmacol. Sci. 21 :45-48; Lundberg, et al. 2003 Mol. Therapy 8: 143-150; and Snyder, et al. 2004 Pharm. Res. 21 :389-393).
• the Tat peptide derived from the TAT protein of HIV-l the third helix of the homeodomain of the Antennapedia protein of D.melanogaster
• polynucleotide can be administered forming part of a plasmidic vector or of a viral vector, preferably vectors based on an adenovirus, in adeno-associated viruses or in retroviruses, such as viruses based on the virus of murine leukaemia (MLV) or on lentiviruses (HIV, FIV, EIAV).
• a viral vector preferably vectors based on an adenovirus, in adeno-associated viruses or in retroviruses, such as viruses based on the virus of murine leukaemia (MLV) or on lentiviruses (HIV, FIV, EIAV).
• compositions of the invention can be administered at doses of less than 10 mg per kilogram of body weight, preferably less than 5, 2, 1, 0.5, 0.1, 0.05, 0.01, 0.005, 0.001, 0.0005, 0.0001, 0.00005 or 0.00001 mg per each kg of body weight and less than 200 nmol of agent, in other words, approximately 4.4x l0 16 copies per kg of body weight or less than 1500, 750, 300, 150, 75, 15, 7.5, 1.5, 0.75, 0.15 or 0.075 nmol per Kg of body weight.
• the unitary dose can be administered by injection, by inhalation or by topical administration.
• the bifunctional polynucleotides and compositions of the invention can be administered directly into the organ in which the target mRNA is expressed in which case doses will be administered of between 0.00001 mg and 3 mg per organ, or preferably between 0.0001 and 0.001 mg per organ, about 0.03 and 3.0 mg per organ, about 0.1 and 3.0 mg per organ or between 0.3 and 3.0 mg per organ.
• the dose will depend on the severity and response to the condition to be treated and may vary between several days and several months or until the condition is seen to remit.
• the optimum dose can be determined by periodically measuring the agent's concentrations in the patient's organism. The optimum dose can be determined from the EC50 values obtained through previous in vitro or in vivo tests in animal models.
• the unitary dose can be administered once a day or less than once a day, preferably, less than once every 2, 4, 8 or 30 days.
• the maintenance regime may involve treating the patient with doses ranging between 0.01 pg and 1.4 mg/kg of body weight per day, for example, 1, 0.1, 0.01, 0.001, or 0.00001 mg per kg of body weight per day.
• Maintenance doses are administered, preferably, at most once every 5, 10 or 30 days.
• the treatment must continue for a time that will vary according to the type of alteration suffered by the patient, its severity and the patient's condition. Following treatment, the patient's evolution must be monitored in order to determine whether the dose ought to be increased in the case of the disease not responding to the treatment or whether the dose ought to be decreased in the case of observing an improvement in the disease or unwanted secondary effects.
• the daily dose can be administered in a single dose or in two or more doses according to the particular circumstances. If a repeated administration or frequent administrations are required, it is advisable to implant an administration device, such as a pump, a semi-permanent catheter (intravenous, intraperitoneal, intracistemal or intracapsular) or a reservoir.
• an administration device such as a pump, a semi-permanent catheter (intravenous, intraperitoneal, intracistemal or intracapsular) or a reservoir.
• compositions of the invention are administered according to methods known to an expert in the art, including, without limitation, intravenous, oral, nasal, parenteral, topical, transdermic, rectal and similar.
• Mouse IL15 was fused to the N terminal of hlgG Fc (named as ILl5-Fc), FIG. 1A.
• the amino acid sequence of mouse IL15 was SEQ ID No. 1.
• the amino acid sequence of hlgGFc was SEQ ID No. 3.
• FIG. IB The schematic representations of ILl5Rasushi-ILl5-Fc (named as RA-ILl5-Fc) and ILl5-ILl5Rasushi-Fc (named as ILl5-RA-Fc) are showed as FIG. IB and FIG. 1C. Similar in biological activity, both structures are referred to interchangeably as super IL15.
• the amino acid sequence of mouse ILl5Rasushi is SEQ ID No. 4.
• the amino acid sequence of human ILl5Rasushi is SEQ ID No. 5.
• the sequence of the linker between ILl5Rasushi and IL15 is SEQ ID No. 8.
• Mouse RA-ILl5-Fc and ILl5-RA-Fc are fully represented by SEQ ID No. 24 and SEQ ID No. 26.
• Human RA-ILl5-Fc and ILl5-RA-Fc are fully represented by SEQ ID No. 25 and SEQ ID No. 27.
• the ECD (extracellular domain) of ILl5R was fused to the N terminal of ILl5-RA-Fc, connected by a linker segment L2.
• FIG. ID The schematic representation of ILl5R ECD-L2-ILl5-ILl5Rasushi-Fc (named as RB- ILl5-RA-Fc) is shown in FIG. ID.
• the amino acid sequence of mouse ILl5R ECD is SEQ ID No.
• Linker segment L2 is a substrate of MMP9 or MMP14.
• the amino acid sequence of the MMP9 substrate linker is SEQ ID No. 10.
• the MMP14 substrate linker amino acid sequences are SEQ ID Nos. 11-23.
• the genes were cloned into an expression vector, such as rEE12.4. Plasmids were transiently transfected into 293F cells. Supernatants were collected on days 4-7 post-transfection. The fusion protein was purified using a Protein A Sepharose. All protein was quantified by ELISA and SDS-PAGE.
• IL15, IL15RA and IL15RB ECD were synthesized and cloned into a pEEl2.4-IgGK- hlgGl Fc plasmid, which contained the mouse IgGK leading sequence and human IgGl Fc. Plasmids were extracted using a standard commercial plasmid extraction kit and stored in -80°C.
• the fusion protein was purified using a Protein A-Sepharose column according to the manual (Repligen Corporation).
• Binding buffer 20 mM sodium phosphate, pH 7.0
• Interleukin 15 was first characterized by its ability to stimulate proliferation of the murine T cell line CTLL-2.
• CTLL-2 cells are cultured in the presence of serial dilutions of murine IL-15 and their growth is measured by CCK8.
• the first top concentration is 10 pg/mL.
• Experiment 2 ( 12.5pg): A20 cells (3 c 10 6 ) were subcutaneously injected into the right flank of Balb/c mice. Mice bearing tumors (60-80 mm 3 ) were treated intratumorally (i.t.) and intravenously (i.v.) with 12.5pg super IL15 on day 10 and day 13. The control group was treated with PBS. Tumor volume was defined as length c width c height / 2. The tumor growth curve was recorded.
• Result (FIG. 7): In the treatment group administered intratumorally, 100% of the mice had complete regression. In contrast, 20% of mice that were treated intravenously had complete regression and the remaining mouse tumors were partially controlled.
• mice administered intratumorally 50% of the mice had complete regression (FIG. 6A), and the survival was significantly increased (FIG. 6B). In contrast, mice administered intravenously did not have complete tumor regression (FIG. 6A) and mice survival increased slightly (FIG. 6B).
• A20 cells (3 x l0 6 ) were subcutaneously injected into the right flank of Balb/c mice. Mice bearing tumors (60-80 mm 3 ) were treated intraperitoneally (i.p.) with 12.5 pg of super IL15 or R-b- ILl5-RA-Fc on day 10 and day 13. Tumor growth was measured twice per week. Serum was collected at 20 hr after the second injection. Cytokine levels in the serum were measured by
• CBA Cytometric Bead Array
• Serum was collected from the ophthalmic vein and stored in -80°C;
• the standard was reconstituted with 2.0 mL of Assay Diluent then recalibrated for at least 15 min. at room temperature.
• the standard was serially diluted at ratios: 1 :2, 1 :4, 1 :8, 1 : 16, 1 :32, 1 :64, 1 : 128, and 1 :256.
• Thl/Th2/Thl7 Cytokine Capture Beads were mixed. The number of assay tubes (including standards and controls) required for the experiment was determined. Each Capture Bead suspension was vigorously vortexed for 3 to 5 seconds before mixing. Add a 2 pL aliquot of each Capture Bead, for each assay tube to be analyzed, into a single tube. 10 pL aliquots of the Mouse Thl/Th2/Thl7 PE Detection Reagent were added to the tube and vortexed thoroughly.
• the Thl/Th2/Thl7 Cytokine Assay was performed: The mixed Capture Beads was vortexed and 20 pL was added to all assay tubes. 50 pL of the Mouse Thl/Th2/Thl7 Cytokine Standard dilutions was added to the control tubes. 50 pL of each unknown sample was added to the appropriately labeled sample assay tubes. Assay tubes were incubated for 2 hr at room temperature, protected from light.
• FIG. 8A The therapeutic effect is shown in FIG. 8A, indicating that the therapeutic effect of RB- ILl5-RA-Fc administered intravenously is similar to that of super IL15.
• A20 cells (3 x l0 6 ) were subcutaneously injected into the right flank of Balb/c mice. Mice bearing tumors (60-80 mm 3 ) were treated intraperitoneally (i.p.) with 25 pg of super IL15 or RB- ILl5-RA-Fc on daylO and day 13. Tumor growth was measured twice per week. Serum was collected at 20 hrs after the second injection. Cytokine levels in the serum were measured by Cytometric Bead Array (CBA) and the tumor curve was recorded.
• CBA Cytometric Bead Array
• Human RB-ILl5-RA-Fc functionality was measured using the HEK-BlueTM IL2 reporter cell assay (Invivogen).
• HEK-BlueTM IL-2 cell trigger the activation of STAT5 and the subsequence secretion of SEAR
• the levels of STAT5 -induced SEAP can be readily monitored using QUANTI-BlueTM. Since IL15 binds to and signals through a complex composed of IL-2/IL-15 receptor b chain and the common g chain, the HEK-BlueTM IL-2 cell line could also be used to measure IL15 and/or pro-ILl5 functional activity.
• HEK-Blue IL-2 cells were gently rinsed in PBS and suspended in fresh, pre- warmed test medium (DMEM, 4.5 g/L glucose, 2mM L-glutamine, 10% (v/v) heat-inactivated PBS (30 mins at 56°C at ⁇ l x 10 6 cells/mL.
• DMEM pre- warmed test medium
• FIG. 11 demonstrates that the RB-L2-l5RA-Fc, constructed with an MMP14 substrate sequence embedded in the linker segment (L2) and incubated with MMP14, displayed function at the same level as l5RA-Fc with or without MMP14.
• RB-Ll-l5RA-Fc constructed without an MMP14 substrate sequence embedded in the linker segment (Ll), performed similarly to samples without MMP14.
• the construct notation 15RA is short for IL15-L1-RA.
• SEQ ID No. 1 mouse IL15
• SEQ ID No. 2 human IL15
• SEQ ID No. 4 mouse Ra-sushi domain GTTCPPPVSIEHADIRVKNYSWSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVP
• SEQ ID No. 24 mouse RA-IL15-Fc
• SEQ ID No. 25 human RA-IL 15-Fc
• SEQ ID No. 26 mouse IL15-RA-Fc NWIDVRYDLEKIESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSN
• SEQ ID No. 27 human IL15-RA-Fc
• SEQ ID No. 28 mouse RB-L2-IL15-RA-Fc
• SEQ ID No. 29 human RB-L2-IL15-RA-Fc
• SEQ ID No. 30 human RB-L2-IL15-RA-Fc
• SEQ ID No. 32 human RB-L2-IL15-RA-Fc
• SEQ ID No. 34 human RB-L2-IL15-RA-Fc AVNGTSQFTCFYNSRANISCVWSQDGALQDTSCQVHAWPDRRRWNQTCELLPVSQASWACNLILGAPDSQKLTTVDI
• SEQ ID No. 36 human RB-L2-IL15-RA-Fc
• SEQ ID No. 37 human RB-L2-IL15-RA-Fc
• SEQ ID No. 38 human RB-L2-IL15-RA-Fc
• SEQ ID No. 40 human RB-L2-IL15-RA-Fc
• SEQ ID No. 42 human RB-Ll-IL15-RA-Fc
• composition and/or method may be practiced without one or more of the specific details, or with other methods, components, materials, and so forth.
• well-known structures, materials, or operations are not shown or described in detail to avoid obscuring aspects of the disclosure.

Landscapes

• Health & Medical Sciences (AREA)
• Life Sciences & Earth Sciences (AREA)
• Chemical & Material Sciences (AREA)
• Organic Chemistry (AREA)
• Genetics & Genomics (AREA)
• General Health & Medical Sciences (AREA)
• Engineering & Computer Science (AREA)
• Molecular Biology (AREA)
• Zoology (AREA)
• Medicinal Chemistry (AREA)
• Biochemistry (AREA)
• Biophysics (AREA)
• Proteomics, Peptides & Aminoacids (AREA)
• Biomedical Technology (AREA)
• Bioinformatics & Cheminformatics (AREA)
• Gastroenterology & Hepatology (AREA)
• General Engineering & Computer Science (AREA)
• Biotechnology (AREA)
• Toxicology (AREA)
• Wood Science & Technology (AREA)
• Immunology (AREA)
• Veterinary Medicine (AREA)
• Public Health (AREA)
• Animal Behavior & Ethology (AREA)
• Pharmacology & Pharmacy (AREA)
• Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
• Chemical Kinetics & Catalysis (AREA)
• Cell Biology (AREA)
• Microbiology (AREA)
• Plant Pathology (AREA)
• Physics & Mathematics (AREA)
• General Chemical & Material Sciences (AREA)
• Epidemiology (AREA)
• Analytical Chemistry (AREA)
• Peptides Or Proteins (AREA)
• Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
• Preparation Of Compounds By Using Micro-Organisms (AREA)
• Micro-Organisms Or Cultivation Processes Thereof (AREA)
• Medicinal Preparation (AREA)

Priority Applications (11)

Applications Claiming Priority (2)

Related Child Applications (2)

Publications (1)

Family

ID=68386875

Family Applications (1)

Country Status (8)

Cited By (18)

Families Citing this family (14)

Citations (1)

Family Cites Families (9)

• 2018
  • 2018-05-04 CN CN201810420739.6A patent/CN110437339B/zh active Active
• 2019
  • 2019-05-03 CN CN202510533077.3A patent/CN120463817A/zh active Pending
  • 2019-05-03 AU AU2019262590A patent/AU2019262590B2/en active Active
  • 2019-05-03 JP JP2020560958A patent/JP7684047B2/ja active Active
  • 2019-05-03 WO PCT/US2019/030594 patent/WO2019213517A1/en not_active Ceased
  • 2019-05-03 CN CN202510533066.5A patent/CN120463816A/zh active Pending
  • 2019-05-03 KR KR1020207034734A patent/KR20210028150A/ko active Pending
  • 2019-05-03 CA CA3099039A patent/CA3099039A1/en active Pending
  • 2019-05-03 CN CN201980045118.7A patent/CN112585161B/zh active Active
  • 2019-05-03 EP EP19796151.9A patent/EP3788068A4/en active Pending
  • 2019-05-03 US US17/051,160 patent/US12441781B2/en active Active
• 2025
  • 2025-05-15 JP JP2025082038A patent/JP2025124695A/ja active Pending

Patent Citations (1)

Non-Patent Citations (2)

Also Published As

Similar Documents

Legal Events