WO2019121983A1 - Fermentation process - Google Patents
Fermentation process Download PDFInfo
- Publication number
- WO2019121983A1 WO2019121983A1 PCT/EP2018/085941 EP2018085941W WO2019121983A1 WO 2019121983 A1 WO2019121983 A1 WO 2019121983A1 EP 2018085941 W EP2018085941 W EP 2018085941W WO 2019121983 A1 WO2019121983 A1 WO 2019121983A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- nucleic acid
- replicative
- auto
- extra
- acid molecule
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/70—Vectors or expression systems specially adapted for E. coli
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/24—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Enterobacteriaceae (F), e.g. Citrobacter, Serratia, Proteus, Providencia, Morganella, Yersinia
- C07K14/245—Escherichia (G)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2800/00—Nucleic acids vectors
- C12N2800/10—Plasmid DNA
- C12N2800/101—Plasmid DNA for bacteria
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2800/00—Nucleic acids vectors
- C12N2800/20—Pseudochromosomes, minichrosomosomes
- C12N2800/204—Pseudochromosomes, minichrosomosomes of bacterial origin, e.g. BAC
Definitions
- Embodiments herein relate to a method for producing a product of interest with a microbial host using an auto-replicative extra-chromosomal nucleic acid molecule comprising a first nucleic acid sequence whose genetic activity confers an advantage to the host, optionally wherein the genetic activity of said first nucleic acid molecule is controlled.
- Antibiotics are widely used as selection agents for the production of a product of interest in microbial cells.
- antibiotics such as large-scale spreading of antibiotics in the environment.
- sequence coding for the resistance of the antibiotic in the DNA constructs represent an energetic burden for the cell and therefore negatively affects the yield of the product. This energetic burden is particularly relevant when the resistance- conferring gene is a large gene, when it is expressed at a high level and/or when it is expressed constitutively.
- a method for producing a product of interest with a microbial host comprising the steps of:
- said auto-replicative extra-chromosomal nucleic acid molecule comprises a second nucleic acid sequence that is involved in the production of said product of interest, wherein the genetic activity of said second nucleic acid sequence is controlled independently from the first sequence;
- Step a) comprises providing a microbial host comprising an auto-replicative extra- chromosomal nucleic acid molecule comprising a first nucleic acid sequence whose genetic activity confers an advantage to the host, optionally wherein the genetic activity of said first nucleic acid sequence is controlled.
- the auto-replicative extra-chromosomal nucleic acid molecule can be provided in a microbial host (e.g., a microbial cell as described herein).
- the host or a predecessor of the host may have been previously transformed with the auto-replicative extra-chromosomal nucleic acid molecule.
- step a) comprises providing a microbial cell host comprising an auto -replicative extra-chromosomal nucleic acid molecule comprising a first nucleic acid sequence whose genetic activity confers an advantage to the host, optionally wherein the genetic activity of said first nucleic acid sequence is controlled.
- the microbial host is transformed with the auto-replicative extra- chromosomal nucleic acid molecule under conditions allowing only host that has received said auto-replicative extra-chromosomal nucleic acid molecule to survive, thus providing a microbial host comprising an auto-replicative extra-chromosomal nucleic acid molecule.
- the method further comprises transforming the microbial host with said auto-replicative extra-chromosomal nucleic acid molecule prior to or during step a) under conditions allowing only host that has received said auto-replicative extra-chromosomal nucleic acid molecule to survive, thus providing the microbial host comprising the auto-replicative extra-chromosomal nucleic acid molecule.
- the auto-replicative extra-chromosomal nucleic acid molecule transformed into the microbial host optionally comprises the second nucleic acid sequence of step b).
- the microbial host comprising the auto-replicative extra-chromosomal nucleic acid molecule can subsequently be cultured according to step c).
- an auto-replicative extra-chromosomal nucleic acid molecule comprising a first nucleic acid sequence.
- An auto-replicative extra- chromosomal nucleic acid molecule can exist free of the genome and may be derived from or comprise, consist essentially of, or consist of a plasmid, or episome, minichromosome, or alike. This feature is attractive as a higher number (from one to hundreds of copies or from 10 to 50 copies depending on the plasmid used) of copies of such nucleic acid molecule can be introduced and maintained into the microbial cell host.
- any host can be used in the methods of embodiments herein.
- an auto-replicative extra-chromosomal nucleic acid molecule usually comprises an origin of replication, a first nucleic acid sequence which is of interestand a regulatory region.
- a first nucleic acid sequence encoding an immunity modulator acts as a selectable marker to maintain the presence and function of the auto-replicative extra-chromosomal nucleic acid in the host cell.
- the first nucleic acid sequence encoding the immunity modulator maintains the presence of the auto- replicative extra-chromosomal nucleic acid so that a product can be produced.
- the product can alter the environment in which the host is present, for example by fermenting a substance in the environment to produce one or more new substances.
- genetic drift is minimized by providing selective pressure against auto- replicative extra-chromosomal nucleic acids that have acquired mutations, and do not produce a functional immunity modulator, produce an immunity modulator with reduced function, and/or produced lower levels of immunity modulator than an auto-replicative extra-chromosomal nucleic acid that has not acquired the mutation(s).
- the first nucleic acid molecule represented by the first nucleic acid sequence is able to exhibit a genetic activity, said genetic activity confering an selective advantage to the microbial host cell wherein it is present and wherein this genetic activity is expressed.
- This genetic activity is provided by the product encoded by the first nucleic acid molecule.
- this genetic activity can be controlled or is expressed constitutively at a low level or is tunable or is under the control of a weak constitutive promoter. The control of said activity is believed to provide an advantage to limit the burden of energy for the host.
- an advantage to limit the energy burden of the host may be obtained when the genetic activity is expressed constitutively at a low level or is tunable or is under the control of a weak constitutive promoter.
- the concept“conferring an advantage” may be replaced by“conferring immunity to a bacteriocin” or “conferring resistance to a bacteriocin”.
- the first nucleic acid sequence encodes an immunity modulator as described herein, and thereby confers an advantage to the host.
- the product of interest comprises an enzyme that is useful in an industrial process, for example a fermentation process.
- the fermentation process can ferment at least one compound in the culture medium.
- the product of interest comprises an industrially useful molecule, for example a carbohydrate, a lipid, an organic molecule, a nutrient, a fertilizer, a biofuel, a cosmetic (or precursor thereof), a pharmaceutical or biopharmaceutical product (or precursor thereof), or two or more of any of the listed items.
- a genetic activity may mean any activity that is caused by or linked with the presence of the first nucleic acid molecule in a microbial host.
- the advantage of said activity may be the ability to survive or survive and grow under given conditions (pH, temperature, presence of a given molecule such as a bacteriocin or combination of two or more bacteriocins as described herein,). Accordingly the advantage of said activity may be assessed by determining the number of microbial cells/hosts comprising the auto-replicative extrachromosomal nucleic acid molecule.
- the assessment may be carried out at the end of and/or during the optional transforming step (but prior to culturing step c), or prior to steps a) and culturing step c)) and/or prior to culturing step c).
- the number of microbial host cells comprising the auto-replicative extra-chromosomal nucleic acid molecule present has not been decreased and may be increased by at least 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or more compared to the number of initial microbial cells/host when the cells are being cultured under conditions allowing the microbial host that has received said auto- replicative extra-chromosomal nucleic acid molecule to survive (e.g., by possessing immunity to one or more
- the control of a genetic activity may mean either an increase or decrease of activity of a nucleic acid molecule (i.e. first and/or second nucleic acid molecule). Accordingly, the control of a genetic activity can be controlled or is expressed constitutively at a low level or is tunable or is under the control of a weak constitutive promoter.
- the coding product for which genetic activity is regulated/controlled comprises, consists essentially of, or consists of an immunity modulator or is involved in the production of a product of interest. In some embodiments, genetic activity is regulated/controlled at the level of gene expression.
- genetic activity is regulated at the transcriptional level, for example by activating or repressing a promoter.
- promoters in this context are inducible promoters.
- promoters in this context are weak promoters. Without being limited by theory, weak promoters of some embodiments can be amendable to up- or down- regulating the level of transcription so that the advantage conferred to the host (e.g. immunity modulator activity) is sensitive to changes in levels and/or activity of the gene product(s) under the control of the promoter.
- the promoter comprises, consists of, or consists essentially of the P24 promoter represented by SEQ ID NO:707 and/or the ProC promoter represented by SEQ ID NO: 708 and/or the P24 LacO hybrid promoter.
- the P24LacO hybrid promoter is a tunable/controlled promoter.
- gene activity is regulated/controlled at the post-transcriptional level, for example through regulation of RNA stability.
- genetic activity is regulated/controlled at the translational level, for example through regulation of initiation of translation.
- genetic activity is regulated/controlled at the post-translational level, for example through regulation of polypeptide stability, post-translational modifications to the polypeptide, or binding of an inhibitor to the polypeptide.
- genetic activity is increased.
- activity of at least one of an immunity modulator and/or the coding product of the second nucleic acid molecule is involved in the production of a product of interest is increased.
- genetic activity can be increased by directly activating genetic activity, or by decreasing the activity of an inhibitor of genetic activity.
- genetic activity is activated by at least one of: inducing promoter activity, inhibiting a transcriptional repressor, increasing RNA stability, inhibiting a post-transcriptional inhibitor (for example, inhibiting a ribozyme or antisense oligonucleotide), inducing translation (for example, via a regulatable tRNA), making a desired post-translational modification, or inhibiting a post-translational inhibitor (for example a protease directed to a polypeptide encoded by the gene).
- a compound present in a desired environment induces a promoter.
- the presence of iron in culture medium can induce transcription by an iron-sensitive promoter as described herein.
- a compound present in a desired culture medium inhibits a transcriptional repressor.
- the presence of tetracycline in an environment can inhibit the tet repressor, and thus allow activity from the tetO promoter.
- a compound found only outside of a desired culture medium induces transcription.
- genetic activity is decreased.
- genetic activity can be decreased by directly inhibiting genetic activity, or by decreasing the activity of an activator of genetic activity.
- genetic activity is reduced, but some level of activity remains. In some embodiments, genetic activity is fully inhibited.
- genetic activity is decreased by at least one of inhibiting promoter activity, activating a transcriptional repressor, decreasing RNA stability, activating a post-transcriptional inhibitor (for example, expressing a ribozyme or antisense oligonucleotide), inhibiting translation (for example, via a regulatable tRNA), failing to make a required post-translational modification, inactivating a polypeptide (for example by binding an inhibitor or via a polypeptide-specific protease), or failing to properly localize a polypeptide.
- a post-transcriptional inhibitor for example, expressing a ribozyme or antisense oligonucleotide
- inhibiting translation for example, via a regulatable tRNA
- inactivating a polypeptide for example by binding an inhibitor or via a polypeptide-specific protease
- genetic activity is decreased by removing a gene from a desired location, for example by excising a gene using a FLP-FRT or cre- lox cassette, homologous recombination or CRIPR-CAS9 activity or through loss or degradation of a plasmid.
- a gene product e.g. a polypeptide
- a product produced by a gene product e.g. the product of an enzymatic reaction
- inhibits further gene activity e.g. a negative feedback loop.
- the advantage conferred to a microbial host by the genetic activity of the first nucleic acid molecule is the ability to survive or survive and grow in a medium comprising a bacteriocin (or a mix of bacteriocins).
- a bacteriocin or a mix of bacteriocins
- bacteriocin encompasses a cell-free or chemically synthesized version of such a polypeptide.
- A“bacteriocin,” and variations of this root term, may also refer to a polypeptide that had been secreted by a host cell.
- a bacteriocin therefore encompasses a proteinaceous toxin produced by bacteria to inhibit the growth of similar or closely related bacterial strain(s). They are similar to yeast and paramecium killing factors, and are structurally, functionally, and ecologically diverse.
- a bacteriocin also encompasses a synthetic variant of a bacteriocin secreted by a host cell.
- Synthetic variant of a bacteriocin may be derived from the bacteriocin secreted by a host cell in any way as long as the synthetic variant still exhibits at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% of the activity of the corresponding bacteriocin secreted by a host cell.
- a detailed description of an antibiotic is provided in the part dedicated to general descriptions at the end of the specification.
- A“bacteriocin” can neutralize at least one cell other than the individual host cell in which the polypeptide is made, including cells clonally related to the host cell and other microbial cells.
- a cell that expresses a particular "immunity modulator" is immune to the neutralizing effects of a particular bacteriocin or group of bacteriocins.
- bacteriocins can neutralize a cell producing the bacteriocin and/or other microbial cells, so long as these cells do not produce an appropriate immunity modulator.
- a bacteriocin can exert cytotoxic or growth- inhibiting effects on a plurality of other microbial organisms.
- a bacteriocin is produced by the translational machinery (e.g. a ribosome, etc.) of a microbial cell.
- a bacteriocin is chemically synthesized.
- bacteriocins can be derived from a polypeptide precursor.
- the polypeptide precursor can undergo cleavage (for example processing by a protease) to yield the polypeptide of the bacteriocin itself.
- a bacteriocin is produced from a precursor polypeptide.
- a bacteriocin comprises, consists essentially of, or consists of a polypeptide that has undergone post -translational modifications, for example cleavage, or the addition of one or more functional groups.
- Neutralizing activity of bacteriocins can include arrest of microbial reproduction, or cytotoxicity.
- Some bacteriocins have cytotoxic activity (e.g.
- Bacteriocide effects
- microbial organisms for example bacteria, yeast, algae, synthetic micoorganisms, and the like.
- Some bacteriocins can inhibit the reproduction of microbial organisms (e.g. "bacteriostatic” effects), for example bacteria, yeast, algae, synthetic micoorganisms, and the like, for example by arresting the cell cycle.
- bacteriocins A number of bacteriocins have been identified and characterized (see tables 1.1 and 1.2.). Without being limited by any particular theory, exemplary bacteriocins can be classified as "class I" bacteriocins, which typically undergo post -translational modification, and "class II" bacteriocins, which are typically unmodified. Additionally, exemplary bacteriocins in each class can be categorized into various subgroups, as summarized in Table 1.1 , which is adapted from Cotter, P.D. et al. "Bacteriocins- a viable alternative to antibiotics" Nature Reviews Microbiology 1 1 : 95-105, hereby incorporated by reference in its entirety.
- bacteriocins can effect neutralization of a target microbial cell in a variety of ways.
- a bacteriocin can permeabilize a cell wall, thus depolarizing the cell wall and interfering with respiration.
- Table 1.1 Classification of Exemplary Bacteriocins.
- a number of bacteriocins can be used in accordance with embodiments herein.
- bacteriocins are shown in Table 1.2.
- at least one bacteriocin comprising, consisting essentially of, or consisting of a polypeptide sequence of Table 1.2 is provided.
- some bacteriocins function as pairs of molecules.
- bacteriocins function as pairs of molecules.
- organisms of origin listed in parentheses indicate alternative names and/or strain information for organisms known to produce the indicated bacteriocin.
- Embodiments herein also include peptides and proteins with identity to bacteriocins described in Table 1.2.
- identity is meant to include nucleic acid or protein sequence homology or three-dimensional homology.
- a vast range of functional bacteriocins can incorporate features of bacteriocins disclosed herein, thus providing for a vast degree of identity to the bacteriocins in Table 1.2.
- a bacteriocin has at least 50% identity, for example, at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%,
- Percent identity may be determined using the BLAST software (Altschul, S.F., et al. (1990) "Basic local alignment search tool.” J. Mol. Biol. 215:403-410, accessible on the world wide web at blast.ncbi.nlm.nih.gov) with the default parameters.
- bacteriocins other than the bacteriocins of Table 1.2 or variants thereof, or synthetic bacteriocins can be used according to some embodiments herein.
- synthetic bacteriocins can be used according to some embodiments herein.
- such variants have enhanced or decreased levels of cytotoxic or growth inhibition activity on the same or a different microorganism or species of
- a synthetic bacteriocin comprises an N-terminal sequence with at least 50% identity to SEQ ID NO: 2, for example at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%,
- a synthetic bacteriocin comprises a N-terminal sequence comprising SEQ ID NO: 2.
- some class lib bacteriocins comprise a GxxxG motif (x means any amino acid). Without being limited by any particular theory, it is believed that the GxxxG motif can mediate association between helical proteins in the cell membrane, for example to facilitate bacteriocin-mediated neutralization through cell membrane interactions.
- the bacteriocin comprises a motif that facilitates interactions with the cell membrane.
- the bacteriocin comprises a GxxxG motif.
- the bacteriocin comprising a GxxxG motif can comprise a helical structure.
- "bacteriocin” as used herein also encompasses structures that have substantially the same effect on microbial cells as any of the bacteriocins explicitly provided herein.
- fusion polypeptides comprising, consisting essentially of, or consisting of two or more bacteriocins or portions thereof can have neutralizing activity against a broader range of microbial organisms than either individual bacteriocin.
- a hybrid bacteriocin, Ent35-MccV (GKY Y GN G V SCNKKGC S VD WGRAIGIIGNN S AANL AT GG AAG WKS GGG AS GR DIAMAIGTLSGQFVAGGIGAAAGGVAGGAIYDYASTHKPNPAMSPSGLGGTIK QKPEGIPSE AWNYAAGRLCNWSPNNLSDVCL, SEQ ID NO: 3), displays antimicrobial activity against pathogenic Gram-positive and Gram-negative bacteria (Acuna et al.
- Ent35-MccV fusion bacteriocin comprises, from N -terminus to C-terminus, an N-terminal glycine, Enterocin CRL35, a linker comprising three glycines, and a C-terminal Microcin V.
- bacteriocins can comprise fusions of two or more polypeptides having bacteriocin activity.
- a fusion polypeptide of two or more bacteriocins is provided.
- the two or more bacteriocins comprise, consist essentially of, or consist of polypeptides from Table 1.2, or modifications thereof.
- the fusion polypeptide comprising of two or more bacteriocins has a broader spectrum of activity than either individual bacteriocin, for example having neutralizing activity against more microbial organisms, neutralizing activity under a broader range of environmental conditions, and/or a higher efficiency of neutralization activity.
- a fusion of two or more bacteriocins is provided, for example two, three, four, five, six, seven, eight, nine, or ten bacteriocins.
- two or more bacteriocin polypeptides are fused to each other via a covalent bond, for example a peptide linkage.
- a linker is positioned between the two bacteriocin polypeptides.
- the linker comprises, consists essentially of, or consists of one or more glycines, for example about 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, or 20 glycines.
- the linker is cleaved within the cell to produce the individual bacteriocins included in the fusion protein.
- a bacteriocin as provided herein is modified to provide a desired spectrum of activity relative to the unmodified bacteriocin.
- the modified bacteriocin may have enhanced or decreased activity against the same organisms as the unmodified bacteriocin.
- the modified bacteriocin may have enhanced activity against an organism against which the unmodified bacteriocin has less activity or no activity.
- Table 1.2 Exemplary Bacteriocins
- an anti-fimgal activity (such as anti- yeast activity) is desired.
- a number of bacteriocins with anti- fimgal activity have been identified.
- bacteriocins from Bacillus have been shown to have neutralizing activity against yeast strains (see Adetunji and Olaoye (2013) Malaysian Journal of
- Enterococcus faecalis peptide (WLPPAGLLGRCGRWFRPWLLWLQ SGAQY KWLGNLFGLGPK, SEQ ID NO: 1) has been shown to have neutralizing activity against Candida species (see Shekh and Roy (2012) BMC Microbiology 12: 132, hereby incorporated by reference in its entirety), and bacteriocins from Pseudomonas have been shown to have neutralizing activity against fungi such as Curvularia lunata, Fusarium species, Helminthosporium species, and Biopolaris species (Shalani and Srivastava (2008) The Internet Journal of Microbiology. Volume 5 Number 2.
- botrycidin AJ1316 see Zuber, P et al. (1993) Peptide Antibiotics. In Bacillus subtilis and Other Gram-Positive Bacteria: Biochemistry, Physiology, and Molecular Genetics ed Sonenshein et al., pp. 897-916, American
- a bacteriocin comprises at least one of botrycidin AJ1316 or alirin B 1.
- bacteriocin activity in a culture of cyanobacteria is desirable.
- bacteriocins are provided to neutralize cyanobacteria.
- bacteriocins are provided to neutralize invading microbial organisms typically found in a cyanobacteria culture environment. Clusters of conserved bacteriocin polypetides have been identified in a wide variety of
- cyanobacteria species For example, at least 145 putative bacteriocin gene clusters have been identified in at least 43 cyanobacteria species, as reported in Wang et al. (2011), Genome Mining Demonstrates the Widespread Occurrence of Gene Clusters Encoding Bacteriocins in Cyanobacteria. PLoS ONE 6(7): e22384, hereby incorporated by reference in its entirety. Exemplary cyanobacteria bacteriocins are shown in Table 1.2 as SEQ ID NO's 420, 422, 424, 426, 428, 30, 432, 434, 436, 438, 440, 442, 444, 446, 448, and 450.
- a bacteriocin may work via different mechanisms on a microbial cell as explained herein, a bacteriocin may be said to be active when the number of microbial host has decreased by at least 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or more compared to the number of initial microbial host when the microbial hosts are being cultured with a medium comprising a bacteriocin.
- This culture step may have a duration of at least 12 hours, 24 hours, 36 hours, 48 hours, 60 hours, 72 hours or more before assessing the activity of the bacteriocin by counting the number of microbial hosts present.
- the activity may be assessed by counting the cells under the microscope or by any known microbial techniques.
- a bacteriocin is active when the growth has been arrested in at least a specified number or paercentage of microbial hosts, for example at least 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% of the microbial hosts arrested compared to the initial popualtion of microbial hosts when the microbial hosts are being cultured with a medium comprising a bacteriocin.
- the bacteriocin is B17 or C7 represented by an amino acid sequence comprising or consisting of SEQ ID NO: 198 or 200 respectively.
- B17 and C7 have been experimentally confirmed to be selection agents simple to produce, easy to use and stable in culture medium in accordance with some embodiments herein ( See Example l).
- Some of methods, uses, compositions, hosts, and nucleic acids of embodiments herein also encompass the use a bacteriocin having at least 50% identity to SEQ ID NO: 198 or 200, for example at least 50%, 51%, 52%, 53%, 54%, 55%,
- variants of B17 or C7 may be used in methods, uses, compositions, hosts, and nucleic acids of embodiments herein as long as they exhibit at least a substantial activity of B17 or C7.
- substantial means, for example, at least 50%, at least 60%, at least 705, at least 80%, at least 90%, or at least 100% or more of the activity of B17 or C7 having SEQ ID NO: 198 or 200. The activity of a bacteriocin has been described earlier herein.
- bacteriocin B17 or C7 inventors were able to prepare culture medium comprising said bacteriocin in a concentration which allows one to carry out the methods and uses of embodiments herein, i.e. to observe or visualize an advantage of the expression of said genetic activity.
- the quantity of bacteriocin in said medium or agar plate is such that the number of host that does not comprise said auto-replicative extra-chromosomal has been decreased by at least 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or more compared to the number of initial microbial cells/host when the cells are being cultured under conditions allowing the microbial host that has received said auto-replicative extra-chromosomal nucleic acid molecule to survive and to grow.
- This assessment step may have a duration of at least 6 hours, 12 hours, 24 hours, 36 hours, 48 hours, 60 hours, 72 hours, 84 hours, 96 hours, 108 hours, 120 hours or more.
- Said culture medium may be sterilized without losing substantial bacteriocin activity.
- substantial means, for example, more than 50%, more than 60%, more than 70%, more than 80%, more than 90% of the bacteriocin activity present in the culture medium before sterilization.
- nucleic acid sequences suitable for methods, uses, compositions, hosts, and nucleic acids of some embodiments herein, and whose product provides immunity to a bacteriocin are shown in Table 2.
- Table 2 Exemplary nucleic acid sequences whose provide immunity to a bacteriocin
- bacteriocins of Table 2 While the sequence providing immunity to a bacteriocin of Table 2 are naturally- occurring, the skilled artisan will appreciate that variants of such molecules , naturally- occurring molecules other than the ones of Table 2, or synthetic ones can be used according to some embodiments herein.
- Exemplary bacteriocins to which molecules can confer immunity are identified in Table 2. While Table 2 identifies an "organism of origin" for a molecule conferring immunity, these molecules conferring immunity can readily be expressed in other naturally-occurring, genetically modified, or synthetic
- immuno modulator or“molecule conferring or providing immunity to a bacteriocin” encompasses not only to structures expressly provided herein, but also structures that have substantially the same effect as the "immunity modulator” structures described herein, including fully synthetic immunity modulators, and immunity modulators that provide immunity to bacteriocins that are functionally equivalent to the bacteriocins disclosed herein.
- Exemplary polynucleotide sequences encoding the polypeptides of Table 2 are indicated in Table 2.
- the genetic code is degenerate, and moreover, codon usage can vary based on the particular organism in which the gene product is being expressed, and as such, a particular polypeptide can be encoded by more than one polynucleotide.
- a polynucleotide encoding a bacteriocin immunity modulator is selected based on the codon usage of the organism expressing the bacteriocin immunity modulator.
- a polynucleotide encoding a bacteriocin immunity modulator is codon optimized based on the particular organism expressing the bacteriocin immunity modulator.
- a vast range of functional immunity modulators can incorporate features of immunity modulators disclosed herein, thus providing for a vast degree of identity to the immunity modulators in Table 2.
- an immunity modulator has at least about 50% identity, for example, at least 50%, 51%, 52%, 53%, 54%, 55%, 56%,
- resistance or immunity to a bacteriocin may mean the number of microbial cells at the end of a culturing step with a bacteriocin has not been decreased, and in some embodiments has been increased of at least 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or more compared to the number of initial microbial cells when the cells are being cultured with a medium comprising a bacteriocin.
- This culture step may have a duration of at least 12 hours, 24 hours, 36 hours, 48 hours, 60 hours, 72 hours, 84 hours, 96 hours, 108 hours, 120 hours or more before assessing the activity of the bacteriocin by counting the number of microbial cells present.
- a nucleic acid molecule suitable for methods, uses, compositions, hosts, and nucleic acids of some embodiments herein and whose encoding product confers immunity is McbG (Immunity to the bacteriocin B17), which is represented by SEQ ID NO: 699. McbG has been experimentally confirmed to be useful as a selectable marker either constitutively or inducibly in accordance with some embodiments herien ( See Example 3).
- MccE Immunity to the bacteriocin Cl
- SEQ ID NO: 700 or its c-terminal portion represented by SEQ ID NO: 701.
- MccE hsd been used as a vector selection marker in strains sensitive to microcines/bacteriocins ( See Example 2).
- Methods, uses, compositions, hosts, and nucleic acids of some embodiments also encompass the use of a nucleic acid molecule whose encoding product confers immunity to bacteriocin B17 and/or C7 and having at least 50% identity to SEQ ID NO: 699, 700, or 701, for example at least 50%, 51%,
- McbG and/or MccE may be used in methods, uses, compositions, hosts, and nucleic acids of embodiments hereinas long as they exhibit at least a substantial activity of McbG (respectively MccE).
- substantial means, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 100% or more of the activity of McbG (respectively MccE) having SEQ ID NO: 699, 700 or 701.
- the immunity conferred by the encoding product of McbG (respectively MccE) has been described earlier herein.
- MccE which is represented by SEQ ID NO: 701 is sufficient to confer resistance to bacteriocin C7.
- Part means in this context, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90% or more of the original nucleic acid molecule.
- This is quite attractive and surprising that such a short nucleic acid molecule can confer resistance to a bacteriocin. It is expected that an auto-replicative extra-chromosomal nucleic acid molecule comprising such short nucleic acid molecule does not form any burden for the microbial cell.
- a further suitable nucleic acid molecule for methods, uses, compositions, hosts, and nucleic acids of some embodiments herein, and whose product provides immunity to a bacteriocin is a single nucleic acid molecule whose single product provides immunity to at least two distinct bacteriocins.
- such product of such nucleic acid molecule provides immunity to B17 and C7 or to ColV and C7 or to ColV and B17 or to B17, C7 and ColV.
- a nucleic acid encoding ColV is identified as SEQ ID NO: 65 and a corresponding coding amino acid sequence is identified as SEQ ID NO: 64.
- a nucleic acid molecule whose product provides immunity to B17 and C7 is represented by a sequence having at least 50% identity to SEQ ID NO: 715 or 716 for example at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%,
- SEQ ID NO: 715 is a nucleic acid molecule of McbG fused to MccE.
- SEQ ID NO: 716 is a nucleic acid molecule of McbG fused to the C-terminal part of MccE as earlier described herein.
- a nucleic acid molecule whose product provides immunity to ColV and C7 is represented by a sequence having at least 50% identity to SEQ ID NO: 717 or 718 for example at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%,
- SEQ ID NO: 717 is a nucleic acid molecule of Cvi fused to MccE.
- SEQ ID NO: 718 is a nucleic acid molecule of Cvi fused to the C-terminal part of MccE as earlier described herein.
- compositions, hosts, and nucleic acids of embodiments herein as long as they exhibit at least a substantial activity of the molecule they derived from as earlier described herein.
- each of these nucleic acid molecules described herein whose product confers immunity to a single or to more than one or to at least two bacteriocins may be operably linked to a promoter as described herein.
- the promoter is a weak promoter.
- the weak promoter is the proC promoter represented by SEQ ID NO : 708 or the P24 promoter represented by SEQ ID NO : 707, which has been experimentally confirmed (See, e.g. Example 3).
- Suitable constructs useful in methods, uses, compositions, hosts, and nucleic acids of embodiments herein can comprise a first nucleic acid molecule whose product confers immunity to a bacteriocin, and these constructs may comprise, consist essentially of, or consist of SEQ ID NO : 702, 703, 710, 711, 704, 705, 712, 713 or 714.
- SEQ ID NO : 702, 703, 710, 711, 704, 705, 712, 713 or 714 Each of these constructs has been extensively described in the experimental part of the application, which notes that each of these constructs was actually constructed and confirmed to be suitable in accordance with some embodiments herein (See, e.g., Examples 1 and 2 and 3).
- the bacteriocin added to the culture medium is a B17 and/or a C7 and/or a ColV as identified herein
- the method may allow the production of any product of interest.
- the product of interest is a microbial biomass, the auto-replicative extra- chromosomal nucleic acid molecule, the transcript of said second nucleic sequence, a polypeptide encoded by said second sequence or a metabolite produced directly or indirectly by said polypeptide.
- the product of interest is purified at the end of the culturing step c). This may be carried out using techniques known to the skilled person. Since the energetic burden associated with the presence of the auto-replicative extra- chromosomal nucleic acid molecule has been minimized, the yield of the product of interest is expected to be optimal.
- the method may use any suitable microbial cells, for example as hosts. Suitable microbial cells are listed in the part of the specification entitled general descriptions. Suitable microbial cells per se and for use in methods, uses, compositions, and hosts of embodiments herein include, but are not limited to: a bacterium (for example, a Gram negative bacterium, for example an E. cob species), a yeast, a filamentous fungus or an algae. In some embodiments, the microbial cell is a synthetic microbial cell.
- the first nucleic acid sequence present on the auto-replicative extra- chromosomal nucleic acid molecule may be operably linked to a promoter.
- said promoter is a weak promoter.
- said promoter is a constitutive promoter.
- said promoter is inducible.
- said promoter is a weak constitutive promoter.
- said promoter is a weak inducible promoter. The inducibility of said promoter is a way of controlling the presence of the genetic activity of the first nucleic acid sequence. Promoters are well known in the art. A detailed description is provided in the part of the specification dedicated to the general descriptions.
- a promoter can be used to drive the transcription of one or more coding sequences.
- said auto-replicative extra-chromosomal nucleic acid molecule comprises a second nucleic acid sequence that is involved in the production of a product of interest, wherein the genetic activity of said second nucleic acid sequence is controlled independently from the one of the first sequence.
- control of the genetic activity of said second nucleic acid sequence is not independent from the control of the genetic activity of the first sequence.
- a second promoter drives expression of said second nucleic acid sequence being involved in the production of a product of interest as described herein.
- a first promoter drives expression of an immunity modulator polynucleotide as described herein.
- a promoter that could be used herein may be not native to a nucleic acid molecule to which it is operably linked, i.e. a promoter that is heterologous to the nucleic acid molecule (coding sequence) to which it is operably linked.
- a promoter of some embodiments is heterologous to a coding sequence to which it is operably linked
- a promoter is homologous, e.g., endogenous to a microbial cell.
- a heterologous promoter (to the nucleotide sequence) is capable of producing a higher steady state level of a transcript comprising a coding sequence (or is capable of producing more transcript molecules, i.e.
- promoters can drive transcription at all times (“constitutive promoters”). Some promoters can drive transcription under only select circumstances (“conditional promoters” or“inducible promoter”), for example depending on the presence or absence of an environmental condition, chemical compound, gene product, stage of the cell cycle, or the like.
- an appropriate promoter can be selected, and placed in cis (i.e. or is operably linked with) with a sequence to be expressed.
- Exemplary promoters with exemplary activities are provided in Table 3.1-3.11 herein.
- Some promoters are compatible with particular transcriptional machinery (e.g. R A polymerases, general transcription factors, and the like).
- promoters are identified for some promoters described herein, it is contemplated that according to some embodiments herein, these promoters can readily function in microorganisms other than the identified species, for example in species with compatible endogenous transcriptional machinery, genetically modified species comprising compatible transcriptional machinery, or fully synthetic microbial organisms comprising compatible transcriptional machinery.
- the promoters of Tables 3.1-3.11 herein are publicly available from the Bio bricks foundation. It is noted that the Biobricks foundation encourages use of these promoters in accordance with BioBrickTM Public Agreement (BPA).
- BPA BioBrickTM Public Agreement
- any of the "coding" polynucleotides described herein is generally amenable to being expressed under the control of a desired promoter.
- a first nucleic acid sequence is under the control of a first promoter.
- a second nucleic acid sequence involved in the production of a product of interest is under the control of a second promoter.
- translation initiation for a particular transcript is regulated by particular sequences at 5 ' end of the coding sequence of a transcript.
- a coding sequence can begin with a start codon configured to pair with an initiator tRNA.
- an initiator tRNA can be engineered to bind to any desired triplet or triplets, and accordingly, triplets other than AUG can also function as start codons in certain embodiments. Additionally, sequences near the start codon can facilitate ribosomal assembly, for example a Kozak sequence ((gcc)gccNccAUGG,
- a transcript comprising a "coding" polynucleotide sequence for example a first nucleic acid sequence, or second nucleic acid sequence involved in the production of a fermentation product, comprises an appropriate start codon and translational initiation sequence.
- each "coding" polynucleotide sequences for example if two or more "coding" polynucleotide sequences are positioned in cis on a transcript, each
- polynucleotide sequence comprises an appropriate start codon and translational initiation sequence(s).
- the two sequences are under control of a single translation initiation sequence, and either provide a single polypeptide that can function with both encoded polypeptides in cis, or provide a means for separating two polypeptides encoded in cis, for example a 2A sequence or the like.
- a translational intiator tRNA is regulatable, so as to regulate initiation of translation of an immunity modulator or industrially useful molecule.
- Table 3.7 Exemplary Constitutive B. subtilis s B Promoters
- Table 3.8 Exemplary Constitutive Promoters from miscellaneous prokaryotes
- a promoter may be a synthetic promoter.
- Suitable promoters for methods, uses, compositions, hosts, and nucleic acids of some embodiments herein have been described earlier herein e.g., proC represented by SEQ ID NO: 708 which has been experimentally confirmed in accordance with some embodiments herein ( See Example 2) and P24 represented by SEQ ID NO: 707 which has been experimentally confirmed in accordance with some embodiments herein ( See Example 3).
- a suitable inducible promoter is the P24 LacO hybrid promoter, which is repressed in the presence of Lacl and active in presence of IPTG. This promoter has been experimentally confirmed in accordance with some embodiments herein ( See Example 3).
- a variant, fully synthetic or synthetic or engineer promoter is said to be active or functional and can therefore be used in methods, uses, compositions, hosts, and nucleic acids of embodiments herein when tested in a control or reference plasmid being operably linked with a nucleic acid molecule encoding a transcript, a detectable amount of said transcript molecule is present when said plasmid is present in a cell.
- a variant, fully synthetic or synthetic or engineer promoter may have at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 100% of the activity of the promoter it derives from.
- the method comprises transforming said microbial host with said auto- replicative extra-chromosomal nucleic acid molecule under conditions allowing the host that has received said auto-replicative extra-chromosomal nucleic acid molecule to survive.
- the auto-replicative extra-chromosomal nucleic acid molecule can be provided in a microbial cell (e.g., if the microbial cell, or a predecessor thereof was transformed with the auto-replicative extra-chromosomal nucleic acid molecule), and as such, in some embodiments, the transformation step is not needed in the method.
- the transforming step can be performed prior to the culturing of step c).
- the transforming step is provided prior to step a) so as to provide the host cell comprising the auto-replicative extra-chromosomal nucleic acid molecule.
- the auto-replicative extra-chromosomal nucleic acid molecule used in the transforming step further comprises the second nucleic acid of optional step b).
- a microorganism is genetically modified to comprise said auto-replicative extra-chromosomal nucleic acid molecule comprising a first nucleic acid sequence and optionally a molecule involved in the production of a product of interest.
- Polynucleotides or nucleic acid molecules can be delivered to microorganisms.
- a microbial cell is positively selected for by the genetic activity of the first nucleic acid sequence corresponding to at least one given condition allowing the cell that has received the said auto-replicative extra-chromosomal nucleic acid molecule to survive and said conditions can be environmental conditions.
- Environmental conditions may be a culture medium.
- a cassette for inserting one or more desired distinct first nucleic acid sequences is provided.
- Exemplary cassettes include, but are not limited to, a Cre/lox cassette or FLP/FRT cassette.
- a microbial cell comprises more than one (more than two, more than three, ...) different auto-replicative extra-chromosomal nucleic acid molecule comprising a first nucleic acid sequence as described herein, meaning that said cell can exhibit more than one (more than two, more than three,...) genetic activity, each genetic activity conferring an advantage to the cell.
- a first promoter is present in each of the different auto-replicative extra-chromosomal nucleic acid molecule, each of said first promoters may be different or identical.
- plasmid conjugation can be used to introduce a desired plasmid from a "donor" microbial cell to a recipient microbial cell.
- plasmid conjugation can genetically modify a recipient microbial cell by introducing a conjugation plasmid from a donor microbial cell to a recipient microbial cell.
- conjugation plasmids that comprise the same or functionally same set of replication genes typically cannot coexist in the same microbial cell.
- plasmid conjugation "reprograms" a recipient microbial cell by introducing a new conjugation plasmid to supplant another conjugation plasmid that was present in the recipient cell.
- plasmid conjugation is used to engineer (or reengineer) a microbial cell with a particular combination of first nucleic acid molecules (which can code for immunity modulators in some embodiments).
- first nucleic acid molecules which can code for immunity modulators in some embodiments
- plasmid conjugation comprising different combinations of first acid sequence (which can code for immunity modulators in some embodiments) is provided.
- the plasmids can comprise additional genetic elements as described herein, for example promoters, translational initiation sites, and the like.
- the variety of conjugation plasmids is provided in a collection of donor cells, so that a donor cell comprising the desired plasmid can be selected for plasmid conjugation.
- a particular combination of immunity modulators is selected, and an appropriate donor cell is conjugated with a microbial cell of interest to introduce a conjugation plasmid comprising that combination into a recipient cell.
- the recipient cell is a "newly engineered" cell, for example to be introduced into or for initiating a culture.
- the method further comprises optional step b) wherein said auto-replicative extra-chromosomal nucleic acid molecule comprises a second nucleic acid sequence that is involved in the production of said product of interest, wherein the genetic activity of said second nucleic acid sequence is controlled independently from the one of the first sequence.
- the expression“controlled independently” has its customary and ordinary meanings as understood by one of skill in the art in view of this disclosure, including meaning that distinct ways are used for controlling the genetic activity of the first and the second nucleic acid sequences. Ways of controlling the genetic activity of a nucleic acid sequence have been already described in detail herein.
- step a) (which optionally includes transforming as described herein) and optional step b) is followed by step c), which comprises culturing said transformed microbial host under conditions allowing said transformed microbial host to express the first nucleic acid sequence to a given level to maintain the auto- replicative extra-chromosomal molecule into the growing microbial population.
- step c) optionally controlling the second sequence coding for said product of interest.
- at least part of step c) conditions are such that the first nucleic acid sequence does not exhibit said genetic activity.“Part of step c)” means, for example, at least 20%, 30%, 40%, 50%, 60%, 70%, 80% or 90% or up to 100% of the duration of step c).
- step c) This embodiment of the method is quite attractive as part of step c) is carried out without the presence of the genetic activity of the first nucleic acid sequence.
- the presence of said genetic activity forms an energetic burden for the microbial host cell and is not always needed in order to keep a suitable production level of a product of interest.
- a microbial cell may be cultured in any suitable microbial culture environment.
- Microbial culture environments can comprise a wide variety of culture media, for example feedstocks.
- the selection of a particular culture medium can depend upon the desired application. Conditions of a culture medium include not only chemical composition, but also temperature, amounts of light, pH, C0 2 levels, and the like.
- the culture medium can comprise a bacteriocin.
- a compound that induces the activity of the bacteriocin is present outside of the feedstock, but not in the feedstock.
- a genetically engineered or transformed microorganism as described herein is added to a culture medium that comprises at least one feedstock.
- the culture medium comprises a compound that induces the activity or expression of an immunity modulator.
- feedstock has is customary and ordinary meaning as understood by one of skill in the art in view of this disclosure, and encompasses material that can be consumed, fermented, purified, modified, or otherwise processed by microbial organisms, for example in the context of industrial processes. As such, “feedstock” is not limited to food or food products. As used herein a “feedstock” is a category of culture medium. Accordingly, as used herein “culture medium” includes, but it is not limited to feedstock. As such, whenever a "culture medium” is referred to herein, feedstocks are also expressly contemplated. Before culturing a transformed microbial cell, it can be useful to determine the effects, if any, or optimize the conditions allowing the host that has received said auto- replicative extra-chromosomal nucleic acid molecule to survive and optionally to grow.
- a microbial cell or microbial host or microbial host cell or synthetic microbial host cell comprising an auto-replicative extra-chromosomal nucleic acid molecule is provided, comprising a first nucleic acid sequence whose genetic activity confers an advantage to a microbial host wherein the genetic activity of said first nucleic acid sequence is controlled, and optionally comprising a second nucleic acid sequence that is directly or indirectly involved in the production of a product of interest.
- an auto-replicative extra-chromosomal nucleic acid molecule comprising a first nucleic acid sequence whose genetic activity confers an advantage to a microbial host wherein the genetic activity of said first nucleic acid sequence is controlled, and optionally comprising a second nucleic acid sequence that is directly or indirectly involved in the production of a product of interest.
- microbial organism As used herein, "microbial organism,” “microorganism,”“microbial cell” or“microbial host” and variations of these root terms (such as pluralizations and the like) have their customary and ordinary meanings as understood by one of skill in the art in view of this disclosure, including any naturally-occurring species or synthetic or fully synthetic prokaryotic or eukaryotic unicellular organism, as well as Archae species. Thus, this expression can refer to cells of bacterial species, fungal species, and algae. Exemplary microorganisms that can be used in accordance with embodiments herein include, but are not limited to, bacteria, yeast, filamentous fungi, and algae, for example
- the microorganism is fully synthetic.
- a desired combination of genetic elements, including elements that regulate gene expression, and elements encoding gene products can be assembled on a desired chassis into a partially or fully synthetic microorganism.
- Description of genetically engineered microbial organisms for industrial applications can also be found in Wright, et al.
- Bacillus species for example Bacillus coagulans, Bacillus subtilis, and Bacillus licheniformis
- Paenibacillus species Streptomyces species, Micrococcus species, Corynebacterium species, Acetobacter species, Cyanobacteria species, Salmonella species, Rhodococcus species, Pseudomonas species, Lactobacillus species, Enterococcus species, Alcaligenes species, Klebsiella species, Paenibacillus species, Arthrobacter species, Corynebacterium species, Brevibacterium species, Thermus aquaticus, Pseudomonas stutzeri, Clostridium thermocellus, and
- yeast species and strains can be used in accordance with embodiments herein, and genetically modified variants, or synthetic yeast based on a "chassis" of a known species can be provided.
- Exemplary yeast with industrially applicable characteristics include, but are not limited to Saccharomyces species (for example, Saccharomyces cerevisiae, Saccharomyces bayanus, Saccharomyces boulardii), Candida species (for example, Candida utilis, Candida krusei), Schizosaccharomyces species (for example
- algae species and strains can be used in accordance with embodiments herein, and genetically modified variants, or synthetic algae based on a "chassis" of a known species can be created.
- the algae comprises, consists essentially of, or consists of photosynthetic microalgae.
- filamentous fungal species and strains can be used in accordance with embodiments herein, and genetically modified variants, or synthetic filamentous fungi based on a "chassis" of a known species can be provided.
- Exemplary filamentous fungi with industrially applicable characteristics, which can be used in accordance with embodiments herein include, but are not limited to an Acremonium, Agaricus,
- Melanocarpus Meripilus, Mucor, Myceliophthora, Neocaffimastix, Neurospora, Paecilomyces, Peniciffium, Phanerochaete, Piromyces, Poitrasia, Pseudoplectania, Pseudotrichonympha, Rhizomucor, Schizophyllum, Scytalidium, Talaromyces, Thermoascus, Thielavia, Tolypocladium, Trichoderma, Trichophaea, Verticillium, Volvariella, or Xylaria.
- Species include Acremonium cellulolyticus, Aspergillus aculeatus, Aspergillus awamori, Aspergillus foetidus, Aspergillus fumigatus, Aspergillus japonicus,
- Chrysosporium tropicum Chrysosporium zona turn, Fusarium bactridioides, Fusarium cerealis, Fusarium crookwellense, Fusarium culmorum, Fusarium graminearum, Fusarium graminum, Fusarium heterosporum, Fusarium negundi, Fusarium oxysporum, Fusarium reticulatum, Fusarium roseum, Fusarium sambucinum, Fusarium
- sarcochroum Fusarium sporotrichioides, Fusarium sulphureum, Fusarium torulosum, Fusarium trichothecioides, Fusarium venenatum, Humicola grisea, Humicola insolens, Humicola lanuginosa, Irpex lacteus, Mucor miehei, Myceliophthora thermophila, Neurospora crassa, Penicillium funiculosum, Penicillium purpurogenum,
- Antibiotic and variations of this root term, have their customary and ordinary meanings as understood by one of skill in the art in view of this disclosure, including a metabolite, or an intermediate of a metabolic pathway which can kill or arrest the growth of at least one microbial cell.
- Some antibiotics can be produced by microbial cells, for example bacteria.
- Some antibiotics can be synthesized chemically. It is understood that bacteriocins are distinct from antibiotics, at least in that bacteriocins refer to gene products (which, in some embodiments, undergo additional post-translational processing) or synthetic analogs of the same, while antibiotics refer to intermediates or products of metabolic pathways or synthetic analogs of the same.
- Sequence identity has its customary and ordinary meanings as understood by one of skill in the art in view of this disclosure, including a relationship between two or more amino acid (polypeptide or protein) sequences or two or more nucleic acid (polynucleotide) sequences, as determined by comparing the sequences. Usually, sequence identities or similarities are compared over the whole length of the sequences compared. In the art, “identity” can also refer to the degree of sequence relatedness between amino acid or nucleic acid sequences, as the case may be, as determined by the match between strings of such sequences. "Similarity" between two amino acid sequences can be determined by comparing the amino acid sequence and its conserved amino acid substitutes of one polypeptide to the sequence of a second polypeptide. “Identity” and “similarity” can be readily calculated by various methods, known to those skilled in the art. In someembodiments, sequence identity is determined by comparing the whole length of the sequences as identified herein.
- Some methods to determine identity are designed to give the largest match between the sequences tested. Methods to determine identity and similarity are codified in publicly available computer programs. Computer program methods to determine identity and similarity between two sequences include e.g. the BestFit, BLASTP, BLASTN, and FASTA (Altschul, S. F. et al., J. Mol. Biol. 215:403-410 (1990), publicly available from NCBI and other sources (BLAST Manual, Altschul, S., et al, NCBI NLM NIH Bethesda, MD 20894). An algorithm used can be EMBOSS (accessible on the world wide web at www.ebi.ac.uk/emboss/align).
- Parameters for amino acid sequences comparison using EMBOSS can include gap open 10.0, gap extend 0.5, Blosum 62 matrix.
- Parameters for nucleic acid sequences comparison using EMBOSS can include gap open 10.0, gap extend 0.5, DNA full matrix (DNA identity matrix).
- amino acids having aliphatic side chains is glycine, alanine, valine, leucine, and iso leucine; a group of amino acids having aliphatic-hydroxyl side chains is serine and threonine; a group of amino acids having amide-containing side chains is asparagine and glutamine; a group of amino acids having aromatic side chains is phenylalanine, tyrosine, and tryptophan; a group of amino acids having basic side chains is lysine, arginine, and histidine; and a group of amino acids having sulphur-containing side chains is cysteine and methionine.
- Suitable conservative amino acids substitution groups include: valine- leucine-iso leucine, phenylalanine-tyrosine, lysine-arginine, alanine-valine, and asparagine-glutamine.
- Substitutional variants of the amino acid sequence disclosed herein are those in which at least one residue in the disclosed sequences has been removed and a different residue inserted in its place. In some embodiments, the amino acid change is conservative.
- Suitable conservative substitutions for each of the naturally occurring amino acids include: Ala to ser; Arg to lys; Asn to gln or his; Asp to glu; Cys to ser or ala; Gln to asn; Glu to asp; Gly to pro; His to asn or gln; Ile to leu or val; Leu to ile or val; Lys to arg; gln or glu; Met to leu or ile; Phe to met, leu or tyr; Ser to thr; Thr to ser; Trp to tyr; Tyr to trp or phe; and, Val to ile or leu.
- homologous has its customary and ordinary meanings as understood by one of skill in the art in view of this disclosure, including when used to indicate the relation between a given (recombinant) nucleic acid or polypeptide molecule and a given host organism or host cell, it can be understood to mean that in nature the nucleic acid or polypeptide molecule is produced by a host cell or organisms of the same species, optionally of the same variety or strain. If homologous to a host cell, a nucleic acid sequence encoding a polypeptide will typically be operably linked to another promoter sequence than in its natural environment.
- the term "homologous" has its customary and ordinary meanings as understood by one of skill in the art in view of this disclosure, and can refer to one single- stranded nucleic acid sequence that may hybridize to a complementary single- stranded nucleic acid sequence.
- the degree of hybridization may depend on a number of factors including the amount of identity between the sequences and the hybridization conditions such as temperature and salt concentration as earlier presented.
- the region of identity can be greater than about 5 bp, the region of identity can be greater than 10 bp.
- two nucleic acid or polypeptides sequences are said to be homologous when they have more than 80% identity.
- heterologous has its customary and ordinary meanings as understood by one of skill in the art in view of this disclosure, including when used with respect to a nucleic acid (DNA or RNA) or protein, it can refer to a nucleic acid or protein (also named polypeptide or enzyme) that does not occur naturally as part of the organism, cell, genome or DNA or RNA sequence in which it is present, or that is found in a cell or location or locations in the genome or DNA or RNA sequence that differ from that in which it is found in nature.
- Heterologous nucleic acids or proteins are not endogenous to the cell into which it is introduced, but has been obtained from another cell or synthetically or recombinantly produced.
- nucleic acids encode proteins that are not normally produced by the cell in which the DNA is transcribed or expressed.
- exogenous RNA encodes for proteins not normally expressed in the cell in which the exogenous RNA is present.
- Heterologous nucleic acids and proteins may also be referred to as foreign nucleic acids or proteins. Any nucleic acid or protein that one of skill in the art would recognize as heterologous or foreign to the cell in which it is expressed is herein encompassed by the term heterologous nucleic acid or protein.
- heterologous also applies to non-natural combinations of nucleic acid or amino acid sequences, i.e. combinations where at least two of the combined sequences are foreign with respect to each other.
- operably linked has its customary and ordinary meanings as understood by one of skill in the art in view of this disclosure, and can refer to a linkage of polynucleotide elements (or coding sequences or nucleic acid sequence or nucleic acid molecule) in a functional relationship.
- a nucleic acid sequence is "operably linked” when it is placed into a functional relationship with another nucleic acid sequence.
- a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the coding sequence.
- Operably linked means that the nucleic acid sequences being linked are typically contiguous and, where necessary to join two protein coding regions, contiguous and in reading frame.
- promoter has its customary and ordinary meanings as understood by one of skill in the art in view of this disclosure, and can refer to a nucleic acid fragment that functions to control the transcription of one or more nucleic acid molecules, located upstream with respect to the direction of transcription of the transcription initiation site of the nucleic acid molecule, and is structurally identified by the presence of a binding site for DNA-dependent RNA polymerase, transcription initiation sites and any other DNA sequences, including, but not limited to transcription factor binding sites, repressor and activator protein binding sites, and any other sequences of nucleotides known to one of skill in the art to act directly or indirectly to regulate/control the amount of transcription from the promoter.
- a “constitutive” promoter is a promoter that is active under most environmental and developmental conditions.
- An “inducible” promoter is a promoter that is active under environmental or developmental regulation.
- the verb "to comprise” and its conjugations is used in its non-limiting sense to mean that items following the word are included, but items not specifically mentioned are not excluded.
- the verb“to consist” may be replaced by“to consist essentially of’ meaning that an auto -replicative extra- chromosomal nucleic acid molecule, a microbial host (or a method) as defined herein may comprise additional component(s) (or additional steps) than the ones specifically identified, said additional component(s) (or additional steps) not altering the unique characteristic of the invention.
- indefinite article “a” or “an” does not exclude the possibility that more than one of the element is present, unless the context clearly requires that there be one and only one of the elements.
- the indefinite article “a” or “an” thus usually means “at least one”.
- SEQ ID NO: 4-698, 720-759 Sequences in tables 1-3 (half DNA/half protein as indicated in the tables)
- SEQ ID NO: 719 vector pUC-ColY Description of the figures
- Figure 1 Construction: pSyn2-McbE/F: containing the gene McbE and F under Ptac.
- Figure 2 Construction: pSyn2-McbG : containing the gene McbG under Ptac.
- FIG. 3 Construction: pMcbG 1.1 : containing the gene McbG under P24.
- Figure 4 Construction: pMcbG 1.0: containing the gene McbG under P24 LacO.
- Figure 5 pBACT5.0 vector
- Figure 8 Tuning promoter. In the absence of inductor (upper part), repressor can bind to operator and prevent expression of selection gene. In the presence of inductor (lower part) , repressor cannot bind to operator allowing expression of selection gene.
- Figure 9 Comparison of overexpression of protein X in E. coli with KanR (pKan- pLac) and with 2 immunities against microcines C7 and ColV (pBACT6.0-pLac). 5 mg of total extract was analysed in SDS-PAGE.
- Figure 10 Comparison of overexpression of iota-carrageenase protein in E. coli with KanR (pKan-T7prom) and with 2 immunities against microcines C7 and ColV
- Figure 11 Comparison of overexpression of lambda-carrageenase protein in E. coli with KanR (pKan-T7prom) and with 2 immunities against microcines C7 and ColV (pBACT5.0-T7prom). 5 mg of total extract was analysed in SDS-PAGE.
- Example 1 Use of bacteriocin B17 and C7 as selection agent
- mice B17 The vector used for producing Mic B17 is described in the table below.
- Table X Vector used for producing Mic B17 These constructs were described in detail in Rodriguez-Sainz, M. C, C. et al .1990. Mol. Microbiol. 4: 1921-1932.
- the vector used for producing Mic C7 is Pp70. This vector is based on pBR322 and bears a ⁇ 6000 bp DNA fragment with the mcc gene cluster (as described in Zukher I et al, Nucleic Acids Research, 2014, Vol. 42, No. 19 11891-11902).
- the vector used for producing Co IV is pUC-ColV (SEQ ID NO: 719). This vector is based on pUC57 and bear a ⁇ 5000 bp DNA fragment with the ColV gene cluster.
- the strains harbouring these recombinant vectors were grown in LB medium at 37°C. After an overnight culture the fermented medium was centrifuged and the supernatant flit red on a 0,2 micron filter.
- the bacteriocin activity present in the supernatant was estimated by the size of the diffusion inhibition growth on a plate containing a sensitive strain.
- Petri plates containing medium with such a bacteriocin activity were stored at +4oC for several weeks (at least 4 weeks). We did not observe a decrease of activity. Therefore we demonstrated that such B17, C7 or ColV activities as present in culture medium are stable.
- Bacteriocins B17, C7 and ColV produced by fermentation in laboratory are selection agents simple to produce, easy to use and stable in culture medium. These properties are similar to the ones of antibiotics used as classical selection agent.
- Example 2 Identification of the minimum genetic elements necessary to confer resistance to C7 and B17
- the literature has made it possible to determine the elements necessary for the production of the host against the production of its own bacteriocin, also in the case of B17 bacteriocin: McbG for B17, represented by SEQ ID NO: 699 and pumps (McbE and McbF for B17, represented by SEQ ID NO: 703). These genes are known to be necessary (or more precisely involved in protection against the action of bacteriocin B17).
- the literature for the B17 locus does not identify which is or is the sufficient element to give resistance.
- MccE which is represented by SEQ ID NO: 701 is sufficient to confer resistance to bacteriocin C7.
- expression from a plasmid of the McbG and MccE genes are capable when cloned into a vector to give resistance to B17 and C7 respectively and that these proteins can be used as a vector selection marker in strains sensitive to these microcines/bacteriocins.
- the vector used is pBACT2.0 ( Figure 6, SEQ ID NO: 713).
- SEQ ID NO: 710 represents the construct proC-McbG-CterMecE
- SEQ ID NO: 711 represents the construct proC- Cvi-CterMceE
- Example 3 Can we generate a selectable marker using little or no energy from the bacteria from McbG?
- McbG gene was cloned under a weak promoter P24 (SEQ ID NO: 707).
- the P24 promoter was described in Braatsch S et al, Biotechniques. 2008 Sep;45(3):335-7.
- strains used are the following:
- the BL2l(DE3) strain was transformed with vector pMcbGl.O or pMcbGl.l (see figure 3 or 4). After transformation, transformants were selected on plates containing B17. Isolated colonies were re-grown and the plasmid they contained was analyzed by gel electrophoresis after treatment with relevant restriction enzymes.
- McbG a weak transcription of McbG is sufficient to give the resistance to B17.
- this selection marker is inducible via the P24 LacO promoter and that the vectors containing this gene gives the phenotype of resistance only in presence of IPTG.
- McbG gene it is possible to use the McbG gene as a selectable marker either constitutively or inducibly. Thus, it is shown that constitutive expression at a low level and inducible expression according to the need during the process, allows to reduce the energy burden for the producing cell, without loss of the plasmid from the producing cell.
- Example 4 production of m-cherry protein
- SEQ ID NO : 714 represents the construct used for producing the m-cherry protein. This construct is depicted in figure 7.
- the m-cherry protein was produced and visualised as the bacterial colony turns red on petri dish in the presence of IPTG.
- Example 5 tuning promoter
- Figure 9 shows the comparison of overexpression of protein X in E. coli with KanR (pKan-pLac) and with 2 immunities against microcines C7 and ColV (pBACT6.0- pLac). 5 mg of total extract was analysed in SDS-PAGE.
- Figure 10 shows the comparison of overexpression of iota-carrageenase protein in E. coli with KanR (pKan-T7prom) and with 2 immunities against microcines C7 and ColV (pBACT5.0-T7prom). 5 mg of total extract was analysed in SDS-PAGE.
- the vector used is based on the pBACT5.0 vector (SEQ ID NO: 712).
- Figure 11 shows the comparison of overexpression of lambda-carrageenase protein in E. coli with KanR (pKan-T7prom) and with 2 immunities against microcines C7 and ColV (pBACT5.0-T7prom). 5 mg of total extract was analysed in SDS-PAGE. The vector used is based on the pBACT5.0 vector (SEQ ID NO: 712).
- the weak constitutive proC promoter used in this example allows to reduce the energy burden for the host.
Landscapes
- Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Biomedical Technology (AREA)
- Wood Science & Technology (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Zoology (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Microbiology (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Gastroenterology & Hepatology (AREA)
- Medicinal Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Priority Applications (7)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US16/955,720 US11932672B2 (en) | 2017-12-19 | 2018-12-19 | Fermentation process |
| CN201880088641.3A CN111757890A (zh) | 2017-12-19 | 2018-12-19 | 发酵工艺 |
| BR112020012543-1A BR112020012543A2 (pt) | 2017-12-19 | 2018-12-19 | processo de fermentação |
| JP2020535048A JP2021506328A (ja) | 2017-12-19 | 2018-12-19 | 発酵プロセス |
| KR1020207020105A KR102777327B1 (ko) | 2017-12-19 | 2018-12-19 | 발효 공정 |
| EP18827063.1A EP3728292A1 (en) | 2017-12-19 | 2018-12-19 | Fermentation process |
| JP2024079625A JP2024105566A (ja) | 2017-12-19 | 2024-05-15 | 発酵プロセス |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP17208600.1 | 2017-12-19 | ||
| EP17208600 | 2017-12-19 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2019121983A1 true WO2019121983A1 (en) | 2019-06-27 |
Family
ID=60781747
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2018/085941 Ceased WO2019121983A1 (en) | 2017-12-19 | 2018-12-19 | Fermentation process |
Country Status (7)
| Country | Link |
|---|---|
| US (1) | US11932672B2 (enExample) |
| EP (1) | EP3728292A1 (enExample) |
| JP (2) | JP2021506328A (enExample) |
| KR (1) | KR102777327B1 (enExample) |
| CN (1) | CN111757890A (enExample) |
| BR (1) | BR112020012543A2 (enExample) |
| WO (1) | WO2019121983A1 (enExample) |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2021034879A1 (en) * | 2019-08-19 | 2021-02-25 | Baylor University | Probiotic delivery of guided antimicrobial peptides |
| WO2021064250A3 (en) * | 2019-10-04 | 2021-05-14 | University Of Plymouth | Antimicrobial peptides |
| WO2021154872A1 (en) * | 2020-01-27 | 2021-08-05 | General Probiotics, Inc. | Compositions including probiotic bacteria for the expression and secretion of enterocins to control clostridia perfringens-induced necrotic enteritis in livestock and related methods |
| US11427800B2 (en) | 2013-08-19 | 2022-08-30 | Syngulon Sa | Controlled growth of microorganisms |
| WO2023041435A1 (en) * | 2021-09-14 | 2023-03-23 | Syngulon S.A. | Bacteriocin for applications against mycobacterium |
| US11932672B2 (en) | 2017-12-19 | 2024-03-19 | Syngulon S.A. | Fermentation process |
Families Citing this family (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2019046577A1 (en) | 2017-08-31 | 2019-03-07 | Syngulon Sa | METHODS AND COMPOSITIONS FOR THE PRODUCTION OF BACTERIOCIN AND ANTIMICROBIAL PEPTIDES |
| WO2019236761A1 (en) | 2018-06-06 | 2019-12-12 | Syngulon Sa | Engineering antimicrobial peptides |
| CN114478722B (zh) * | 2022-02-09 | 2023-07-21 | 淮北师范大学 | 一种细菌素Bacin A1及其应用 |
| CN117126925B (zh) * | 2023-08-07 | 2024-06-07 | 中科枢密生物技术(武汉)有限公司 | 一种能够长期稳定保存的Crispr-Cas核酸检测试剂盒 |
Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2009011940A2 (en) * | 2007-04-06 | 2009-01-22 | University Of Maryland, Baltimore | Microcin h47 plasmid selection system |
Family Cites Families (41)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| ATE107697T1 (de) | 1986-03-26 | 1994-07-15 | Genexpress Aps | Biologische eindämmung. |
| US5464764A (en) | 1989-08-22 | 1995-11-07 | University Of Utah Research Foundation | Positive-negative selection methods and vectors |
| US5300431A (en) | 1991-02-26 | 1994-04-05 | E. I. Du Pont De Nemours And Company | Positive selection vector for the bacteriophage P1 cloning system |
| DE69233336T2 (de) * | 1991-02-26 | 2005-03-31 | Astrazeneca Ab | Vektor |
| BE1006085A3 (fr) | 1992-07-31 | 1994-05-10 | Univ Bruxelles | Vecteur de clonage. |
| US7176029B2 (en) | 1992-07-31 | 2007-02-13 | Universite Libre De Bruxelles | Cloning and/or sequencing vector |
| US5549895A (en) | 1993-05-17 | 1996-08-27 | Iowa State University Research Foundation, Inc. | Method and colicin composition for inhibiting Escherichia coli 0157:H7 in food products |
| JP2590761B2 (ja) | 1994-11-22 | 1997-03-12 | 日本電気株式会社 | Tab式半導体装置およびtab式半導体装置を回路基板に接続する方法 |
| US6143557A (en) | 1995-06-07 | 2000-11-07 | Life Technologies, Inc. | Recombination cloning using engineered recombination sites |
| PT937098E (pt) | 1995-06-07 | 2002-12-31 | Invitrogen Corp | Clonagem recombinatoria in vitro utilizando locais de recombinacao modificados |
| WO1997008553A1 (en) * | 1995-08-22 | 1997-03-06 | The Regents Of The University Of California | Targeting of proteins to the cell wall of gram-positive bacteria |
| WO1997013401A1 (en) | 1995-10-13 | 1997-04-17 | Purdue Research Foundation | Method for the production of hybrid plants |
| US5922583A (en) | 1995-10-17 | 1999-07-13 | Biostar Inc. | Methods for production of recombinant plasmids |
| AU8392698A (en) | 1997-07-09 | 1999-02-08 | Governors Of The University Of Alberta, The | Novel bacteriocins, transport and vector system and method of use thereof |
| NZ504214A (en) | 1997-10-24 | 2003-06-30 | Invitrogen Corp | Recombination cloning using nucleic acids having recombination sites |
| FR2770536B1 (fr) | 1997-11-06 | 2001-09-21 | Texel | Nouveau plasmide non rcr apte a etre transfere dans des bact eries lactiques; utilisation comme outil de clonage et d'expression |
| US7183097B1 (en) | 1998-05-07 | 2007-02-27 | Universite Libre De Bruxelles | Cytotoxin-based biological containment |
| US6271359B1 (en) | 1999-04-14 | 2001-08-07 | Musc Foundation For Research Development | Tissue-specific and pathogen-specific toxic agents and ribozymes |
| EP1224304A4 (en) | 1999-10-25 | 2005-04-06 | Invitrogen Corp | METHOD FOR MANIPULATING AND SEQUENCING NUCLEIC ACID MOLECULES BY TRANSPOSITION AND RECOMBINATION |
| WO2001042509A1 (en) | 1999-12-10 | 2001-06-14 | Invitrogen Corporation | Use of multiple recombination sites with unique specificity in recombinational cloning |
| EP1111061A1 (en) | 1999-12-20 | 2001-06-27 | Universite Libre De Bruxelles | Double selection vector |
| DE10038573A1 (de) | 2000-08-03 | 2002-02-21 | Mpb Cologne Gmbh Molecular Pla | Verfahren zur Selektion auf Wirtszellen mit eliminierten DNA-Sequenzen |
| EP1362110B1 (en) | 2001-02-23 | 2012-09-12 | Université Libre de Bruxelles | Method for the selection of recombinant clones comprising a sequence encoding an antidote protein to a toxic molecule |
| AU2003213889B2 (en) | 2002-03-19 | 2008-12-04 | Universite Libre De Bruxelles | Poison/antidote genetic systems for the selection of genetically modified eucaryote cells or organisms |
| EP1556485B1 (en) | 2002-09-03 | 2008-01-09 | Université Libre de Bruxelles | Reversible, parallel and multitask cloning method and kit |
| US9309518B2 (en) | 2002-09-03 | 2016-04-12 | Universite Libre De Bruxelles | Reversible, parallel and multitask cloning method and kit |
| WO2010060057A1 (en) | 2008-11-22 | 2010-05-27 | Southern Illinois University Edwarsville | Bacteriocin based methods to control lactic acid bacterial growth |
| US20100330041A1 (en) | 2009-05-27 | 2010-12-30 | Bayrock Dennis P | Viral-based antimicrobial agent use in ethanol production |
| US8476048B2 (en) | 2010-12-17 | 2013-07-02 | E I Du Pont De Nemours And Company | Xylose utilizing zymomonas mobilis with improved ethanol production in biomass hydrolysate medium |
| GB201021795D0 (en) * | 2010-12-21 | 2011-02-02 | Msd Biolog Uk Ltd | Expression Process |
| DK2543255T4 (da) | 2011-07-04 | 2023-03-20 | Dsm Ip Assets Bv | Antilisteriel blandet kultur og fremgangsmåde til fremstilling af ost |
| US8697426B2 (en) | 2012-06-15 | 2014-04-15 | E I Du Pont De Nemours And Company | Contaminant control in Zymomonas fermentation using virginiamycin |
| US20140148379A1 (en) | 2012-11-28 | 2014-05-29 | Mei Liu | Control of Unwanted Bacteria in Fermentation Systems with Bacteriocin |
| US8846357B2 (en) | 2012-12-20 | 2014-09-30 | E I Du Pont De Nemours And Company | Stabilized chlorine dioxide for contamination control in Zymomonas fermentation |
| CN110564663B (zh) | 2013-08-19 | 2023-03-10 | 辛格隆股份公司 | 微生物的受控生长 |
| WO2019046577A1 (en) | 2017-08-31 | 2019-03-07 | Syngulon Sa | METHODS AND COMPOSITIONS FOR THE PRODUCTION OF BACTERIOCIN AND ANTIMICROBIAL PEPTIDES |
| CN111757890A (zh) | 2017-12-19 | 2020-10-09 | 辛格隆股份公司 | 发酵工艺 |
| WO2019236761A1 (en) | 2018-06-06 | 2019-12-12 | Syngulon Sa | Engineering antimicrobial peptides |
| WO2020104662A1 (en) | 2018-11-22 | 2020-05-28 | Syngulon S.A. | Peptides for inducing bacteriocin synthesis and methods to identify and/or select and/or optimize the same |
| US20230416797A1 (en) | 2020-11-10 | 2023-12-28 | Syngulon Sa. | Modulating antimicrobial peptide half-life |
| WO2022104320A1 (en) | 2020-11-10 | 2022-05-19 | Syngulon Sa. | Control of microorganisms in microbial communities |
-
2018
- 2018-12-19 CN CN201880088641.3A patent/CN111757890A/zh active Pending
- 2018-12-19 JP JP2020535048A patent/JP2021506328A/ja active Pending
- 2018-12-19 BR BR112020012543-1A patent/BR112020012543A2/pt unknown
- 2018-12-19 US US16/955,720 patent/US11932672B2/en active Active
- 2018-12-19 EP EP18827063.1A patent/EP3728292A1/en active Pending
- 2018-12-19 KR KR1020207020105A patent/KR102777327B1/ko active Active
- 2018-12-19 WO PCT/EP2018/085941 patent/WO2019121983A1/en not_active Ceased
-
2024
- 2024-05-15 JP JP2024079625A patent/JP2024105566A/ja active Pending
Patent Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2009011940A2 (en) * | 2007-04-06 | 2009-01-22 | University Of Maryland, Baltimore | Microcin h47 plasmid selection system |
Non-Patent Citations (24)
| Title |
|---|
| ACUNA ET AL., FEBS OPEN BIO, vol. 2, 2012, pages 12 - 19 |
| ADETUNJI; OLAOYE, MALAYSIAN JOURNAL OF MICROBIOLOGY, vol. 9, 2013, pages 130 - 13 |
| ALTSCHUL, S. ET AL.: "BLAST Manual", NCBI NLM NIH |
| ALTSCHUL, S. F. ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410 |
| ALTSCHUL, S.F. ET AL.: "Basic local alignment search tool", J. MOL. BIOL., vol. 215, 1990, pages 403 - 410, XP002949123, DOI: doi:10.1006/jmbi.1990.9999 |
| APPLEYARD GENETICS, vol. 39, 1954, pages 440 - 452 |
| BRAATSCH S ET AL., BIOTECHNIQUES, vol. 45, no. 3, September 2008 (2008-09-01), pages 335 - 7 |
| C.-M. FANG ET AL: "Use of mchI Encoding Immunity to the Antimicrobial Peptide Microcin H47 as a Plasmid Selection Marker in Attenuated Bacterial Live Vectors", INFECTION AND IMMUNITY, vol. 76, no. 10, 1 October 2008 (2008-10-01), pages 4422 - 4430, XP055467029, ISSN: 0019-9567, DOI: 10.1128/IAI.00487-08 * |
| COTTER, P.D. ET AL.: "Bacteriocins- a viable alternative to antibiotics", NATURE REVIEWS MICROBIOLOGY, vol. 1, no. 1, pages 95 - 105 |
| D. A. BREDE ET AL: "Identification of the Propionicin F Bacteriocin Immunity Gene (pcfI) and Development of a Food-Grade Cloning System for Propionibacterium freudenreichii", APPLIED AND ENVIRONMENTAL MICROBIOLOGY, vol. 73, no. 23, 1 December 2007 (2007-12-01), US, pages 7542 - 7547, XP055467000, ISSN: 0099-2240, DOI: 10.1128/AEM.01023-07 * |
| G E ALLISON ET AL: "Functional analysis of the gene encoding immunity to lactacin F, lafI, and its use as a Lactobacillus-specific, food-grade genetic marker", APPLIED AND ENVIRONMENTAL MICROBIOLOGY, 1 December 1996 (1996-12-01), UNITED STATES, pages 4450 - 4460, XP055467010, Retrieved from the Internet <URL:http://aem.asm.org/content/62/12/4450.full.pdf#page=1&view=FitH> * |
| GIBSON ET AL.: "Creation of a Bacterial Cell Controlled by a Chemically Synthesized Genome", SCIENCE, vol. 329, 2010, pages 52 - 56, XP055082599, DOI: doi:10.1126/science.1190719 |
| GONI-MORENO ET AL.: "Multicellular Computing Using Conjugation for Wiring", PLOS ONE, vol. 8, no. 6, 2013, pages e65986 |
| M.R. GREEN; J SAMBROOK: "A laboratory manual", 2012, COLD SPRING HARBOR LABORATORY PRESS, article "Molecular Cloning" |
| RODRIGUEZ-SAINZ, M. C., C. ET AL., MOL. MICROBIOL., vol. 4, 1990, pages 1921 - 1932 |
| SHALANI; SRIVASTAVA, THE INTERNET JOURNAL OF MICROBIOLOGY, vol. 5, no. 2, 2008 |
| SHEKH; ROY, BMC MICROBIOLOGY, vol. 12, 2012, pages 132 |
| SHENIN ET AL., ANTIBIOT KHIMIOTER, vol. 50, 1995, pages 3 - 7 |
| SOPHIE DUQUESNE ET AL: "Microcins, gene-encoded antibacterial peptides from enterobacteria", NATURAL PRODUCT REPORTS, vol. 24, no. 4, 1 January 2007 (2007-01-01), GB, pages 708, XP055467441, ISSN: 0265-0568, DOI: 10.1039/b516237h * |
| TAKALA T. ET AL: "A food-grade cloning vector for lactic acid bacteria based on the nisin immunity gene nisI", APPLIED MICROBIOLOGY AND BIOTECHNOLOGY, vol. 59, no. 4-5, 1 January 2002 (2002-01-01), pages 467 - 471, XP055018982, ISSN: 0175-7598, DOI: 10.1007/s00253-002-1034-4 * |
| WANG ET AL.: "Genome Mining Demonstrates the Widespread Occurrence of Gene Clusters Encoding Bacteriocins in Cyanobacteria", PLOS ONE, vol. 6, no. 7, 2011, pages e22384 |
| WRIGHT ET AL.: "Building-in biosafety for synthetic biology", MICROBIOLOGY, vol. 159, 2013, pages 1221 - 1235, XP055155454, DOI: doi:10.1099/mic.0.066308-0 |
| ZUBER, P ET AL.: "Biochemistry, Physiology, and Molecular Genetics", 1993, AMERICAN SOCIETY FOR MICROBIOLOGY, article "Peptide Antibiotics. In Bacillus subtilis and Other Gram-Positive Bacteria", pages: 897 - 916 |
| ZUKHER I ET AL., NUCLEIC ACIDS RESEARCH, vol. 42, no. 19, 2014, pages 11891 - 11902 |
Cited By (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11427800B2 (en) | 2013-08-19 | 2022-08-30 | Syngulon Sa | Controlled growth of microorganisms |
| US12297422B2 (en) | 2013-08-19 | 2025-05-13 | Syngulon Sa | Controlled growth of microorganisms |
| US11932672B2 (en) | 2017-12-19 | 2024-03-19 | Syngulon S.A. | Fermentation process |
| WO2021034879A1 (en) * | 2019-08-19 | 2021-02-25 | Baylor University | Probiotic delivery of guided antimicrobial peptides |
| WO2021064250A3 (en) * | 2019-10-04 | 2021-05-14 | University Of Plymouth | Antimicrobial peptides |
| WO2021154872A1 (en) * | 2020-01-27 | 2021-08-05 | General Probiotics, Inc. | Compositions including probiotic bacteria for the expression and secretion of enterocins to control clostridia perfringens-induced necrotic enteritis in livestock and related methods |
| US20210268034A1 (en) * | 2020-01-27 | 2021-09-02 | General Probiotics, Inc. | Compositions including probiotic bacteria for the expression and secretion of enterocins to control clostridia perfringens-induced necrotic enteritis in livestock and related methods |
| US12121553B2 (en) | 2020-01-27 | 2024-10-22 | General Probiotics, Inc. | Compositions including probiotic bacteria for the expression and secretion of enterocins to control clostridia perfringens-induced necrotic enteritis in livestock and related methods |
| WO2023041435A1 (en) * | 2021-09-14 | 2023-03-23 | Syngulon S.A. | Bacteriocin for applications against mycobacterium |
Also Published As
| Publication number | Publication date |
|---|---|
| KR102777327B1 (ko) | 2025-03-05 |
| JP2024105566A (ja) | 2024-08-06 |
| US20210070812A1 (en) | 2021-03-11 |
| KR20200116084A (ko) | 2020-10-08 |
| US11932672B2 (en) | 2024-03-19 |
| BR112020012543A2 (pt) | 2021-02-23 |
| EP3728292A1 (en) | 2020-10-28 |
| CN111757890A (zh) | 2020-10-09 |
| JP2021506328A (ja) | 2021-02-22 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| WO2019121983A1 (en) | Fermentation process | |
| US9850501B2 (en) | Simultaneous site-specific integrations of multiple gene-copies | |
| US20190185847A1 (en) | Improving a Microorganism by CRISPR-Inhibition | |
| US20200399665A1 (en) | Processes for the production of hydroxycinnamic acids using polypeptides having tyrosine ammonia lyase activity | |
| DK3036324T3 (en) | Regulated PepC expression | |
| US10358664B2 (en) | Mutant host cells for the production of 3-hydroxypropionic acid | |
| US20190194671A1 (en) | Erythritol production in cyanobacteria | |
| Wang et al. | Improving stress tolerance and cell integrity of Rhodococcus ruber by overexpressing small-shock-protein Hsp16 of Rhodococcus | |
| CN106460002A (zh) | 增加微生物中生物质和脂质含量的方法及展现增强的自噬的基因修饰微生物 | |
| Jang et al. | Fusion of the N-terminal domain of Pseudomonas sp. phytase with Bacillus sp. phytase and its effects on optimal temperature and catalytic efficiency | |
| JP2024531241A (ja) | 負荷依存性産生株 | |
| US20160304887A1 (en) | Introducing or Inactivating Female Fertility in Filamentous Fungal Cells | |
| US20170362613A1 (en) | Recombinant Host Cells For The Production Of 3-Hydroxypropionic Acid | |
| EP2929028A1 (en) | Method for generating site-specific mutations in filamentous fungi | |
| Chungjatupornchai et al. | The rrnA promoter as a tool for the improved expression of heterologous genes in cyanobacteria | |
| KR102688161B1 (ko) | 메틸로루브룸속 균주에서 탄소원 유도 발현이 가능한 발현 벡터 및 이를 이용한 유전자 발현 시스템 | |
| WO2020002575A1 (en) | Polypeptides having pectin lyase activity and polynucleotides encoding same | |
| US11268081B2 (en) | Improving expression of a protease by co-expression with propeptide | |
| JP5785787B2 (ja) | プロトプラスト形質転換効率の向上方法 | |
| KR20200138089A (ko) | 5-아미노레불린산 합성 효소 변이체 및 이의 숙주 세포와 용도 | |
| Wahyuni et al. | Constitutive Expression of Candida antarctica Lipase B (CALB) in Pichia pastoris Using pGAPZα Vector | |
| WO2014151723A1 (en) | Use of thermophilic nucleases for degrading nucleic acids |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18827063 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2020535048 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2018827063 Country of ref document: EP Effective date: 20200720 |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112020012543 Country of ref document: BR |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: 112020012543 Country of ref document: BR Free format text: APRESENTE O COMPLEMENTO DO TEXTO EM PORTUGUES, ADAPTADO A NORMA VIGENTE, DO PEDIDO CONFORME DEPOSITO INTERNACIONAL INICIAL ( REQUER APRESENTAR RELATORIO DESCRITIVO), CONFORME DETERMINA A RESOLUCAO INPI PR NO 77/2013 DE 18/03/2013, ART. 5O E 7O. |
|
| ENP | Entry into the national phase |
Ref document number: 112020012543 Country of ref document: BR Kind code of ref document: A2 Effective date: 20200619 |