WO2019075216A1 - ANTIBODIES BINDING TO PELTIN-1 AND USES THEREOF - Google Patents

ANTIBODIES BINDING TO PELTIN-1 AND USES THEREOF Download PDF

Info

Publication number
WO2019075216A1
WO2019075216A1 PCT/US2018/055438 US2018055438W WO2019075216A1 WO 2019075216 A1 WO2019075216 A1 WO 2019075216A1 US 2018055438 W US2018055438 W US 2018055438W WO 2019075216 A1 WO2019075216 A1 WO 2019075216A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
cancer
seq
antigen binding
plectin
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2018/055438
Other languages
English (en)
French (fr)
Other versions
WO2019075216A8 (en
Inventor
Kimberly A. Kelly
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Zielbio Inc
Original Assignee
ITI Health Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by ITI Health Inc filed Critical ITI Health Inc
Priority to JP2020542037A priority Critical patent/JP7379347B2/ja
Priority to CN201880079957.6A priority patent/CN112105380A/zh
Publication of WO2019075216A1 publication Critical patent/WO2019075216A1/en
Publication of WO2019075216A8 publication Critical patent/WO2019075216A8/en
Priority to US16/846,031 priority patent/US12053530B2/en
Anticipated expiration legal-status Critical
Priority to JP2023127717A priority patent/JP2023155262A/ja
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/28Compounds containing heavy metals
    • A61K31/282Platinum compounds
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/505Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
    • A61K31/519Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with heterocyclic rings
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7042Compounds having saccharide radicals and heterocyclic rings
    • A61K31/7052Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides
    • A61K31/706Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom
    • A61K31/7064Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines
    • A61K31/7068Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines having oxo groups directly attached to the pyrimidine ring, e.g. cytidine, cytidylic acid
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K33/00Medicinal preparations containing inorganic active ingredients
    • A61K33/24Heavy metals; Compounds thereof
    • A61K33/243Platinum; Compounds thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39558Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/65Peptidic linkers, binders or spacers, e.g. peptidic enzyme-labile linkers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/6811Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6851Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/303Liver or Pancreas
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • Pancreatic ductal adenocarcinoma is the 4th leading cause of cancer death in the United States showing a rapid clinical course leading to death. Once diagnosed, PDAC has a median survival of 6 months and a 5-year survival rate of only 3 percent (Li et al., Lancet 363: 1049-1057 (2004)).
  • the disclosure relates to compositions and methods useful for treating certain cancers (e.g. , pancreatic cancer, ovarian cancer, etc.).
  • the disclosure is based, in part, on combinations of anti-plectin-1 antibodies and anti-cancer agents (e.g. , small molecules, such as gemcitabine, pyrrolobenzodiazepines (PBDs), etc.), administered as a single composition or separately, that act together (e.g. , synergistically) to inhibit cancer cell growth.
  • the combinations are formulated to produce an antibody-drug-conjugate (ADC).
  • ADC antibody-drug-conjugate
  • the disclosure provides a composition comprising: an antibody that specifically binds to plectin- 1 exposed on the surface of a cancer cell; and one or more anti-cancer agents, wherein the antibody and the anticancer agents are not linked.
  • the disclosure provides a composition comprising an antibody or antigen binding fragment that specifically binds an amino acid sequence having at least 85% identity to SEQ ID NO: 2 (e.g.
  • an anti- plectin-1 antibody and the anti-cancer agent act synergistically (e.g. , as measured by the Chou- Talalay method).
  • an antibody or antigen binding fragment comprises a heavy chain variable region having a sequence set forth as: SEQ ID NO: 23 or SEQ ID NO: 67. In some embodiments, an antibody or antigen binding fragment comprises a light chain variable region having a sequence set forth as: SEQ ID NO: 45 or SEQ ID NO: 89.
  • an antibody comprises a heavy chain variable region having a sequence set forth as: SEQ ID NO 23 and a light chain variable region having a sequence set forth as: SEQ ID NO: 45.
  • an antibody comprises a heavy chain variable region having a sequence set forth as: SEQ ID NO 67 and a light chain variable region having a sequence set forth as: SEQ ID NO: 89.
  • an antibody or antigen binding fragment binds to cell-surface exposed plectin- 1 (e.g. , plectin- 1 expressed on the surface of a cell, for example a cancer cell).
  • an anti-cancer agent is selected from the group consisting of
  • the disclosure provides an antibody-drug-conjugate (ADC) comprising an antibody or antigen binding fragment that specifically binds to plectin-1 exposed on the surface of a cell (e.g. , a cancer cell) linked to one or more anti-cancer agent molecules (e.g. , between 2 and 100 anti-cancer agent molecules).
  • ADC antibody-drug-conjugate
  • the disclosure provides an antibody-drug-conjugate (ADC) comprising an antibody or antigen binding fragment that specifically binds an amino acid sequence having at least 85% identity to SEQ ID NO: 2 (e.g. , an amino acid sequence having at least 90%, at least 95%, at least 96%, at least 97% at least 98% or at least 99% identity to SEQ ID NO: 2) linked to one or more anti-cancer agent molecules (e.g. , between 2 and 100 anti-cancer agent molecules).
  • ADC antibody-drug-conjugate
  • one or more anti-cancer agent molecules are directly linked to an antibody or antigen binding fragment.
  • one or more anti-cancer agent molecules are indirectly linked to the antibody or antigen binding fragment via a linker, for example a photolinker or a flexible amino acid sequence linker.
  • a linker for example a photolinker or a flexible amino acid sequence linker.
  • 2, 3, 4, or 5 anti-cancer agent molecules are linked to an antibody or antigen binding fragment.
  • an anti-cancer agent molecule is auristatin or
  • a PBD molecule is a PBD dimer.
  • the disclosure provides a method for treating cancer, the method comprising administering to a subject having cancer an effective amount of an antibody or antigen binding fragment that specifically binds an amino acid sequence having at least 85% identity to SEQ ID NO: 2, and an anti-cancer agent.
  • the subject is a mammal, for example a human.
  • an antibody or antigen binding fragment and an anti-cancer agent are administered together (e.g. , as a composition or ADC as described herein). In some embodiments, an antibody or antigen binding fragment and an anti-cancer agent are administered separately to a subject.
  • a cancer is characterized by expression of plectin-1 on the surface of the cancer cell.
  • a cancer is ovarian cancer, esophageal cancer, head and neck squamous cell carcinoma, or pancreatic cancer. In some embodiments, the pancreatic cancer is pancreatic ductal adenocarcinoma (PDAC).
  • an antibody, anti-cancer agent, ADC, or composition is administered at a dose in a range of 1 ng/kg and 100 mg/kg.
  • FIGs. 1A-1B show representative data for affinity and specificity of an anti-plecl antibody on human recombinant protein (FIG. 1A) and human (YapC and L3.6pl) and mouse (Hanl4.3) pancreatic cell lines (FIG. IB).
  • FIGs. 2A-2C show treatment of YapC cells with anti-plecl antibody.
  • FIG. 2A shows treatment of cells with anti-plecl results in GO and G2 growth arrest.
  • FIG. 2B shows representative data for EC50 of anti-plecl for YapC cells.
  • FIG. 2C shows the phenotypic effect of anti-plecl treatment on YapC microtubule (top, left to right) and actin microfilaments (bottom, left to right).
  • FIG. 3 shows a combination of anti-plecl with gemcitabine (gem) has synergistic effects on cancer cells. Equal molar concentrations of anti-plecl and gem were incubated with cells for 72 hrs. After incubation, cells were processed. Combination therapy resulted in a 20-fold decrease in IC50.
  • the disclosure relates, in some aspects, to compositions and methods for treatment of certain cancers (e.g. , cancers characterized by surface expression of plectin-1).
  • Plectin- 1 is a useful biomarker for a variety of cancers, including ovarian, esophageal, and head and neck squamous cells carcinomas, as well as pancreatic ductal adenocarcinoma.
  • antibody targets such as CD30, which is targeted by Brentuximab vedotin, and Her2, which is targeted by Ado-trastuzumab Emtansine
  • plectin- 1 is a particularly useful target because it is present on the cell surface exclusively in certain cancer cells (e.g. , pancreatic ductal
  • the disclosure relates to antibodies and antigen binding fragments that bind specifically to plectin- 1 on the surface of cancer cells, and methods of use thereof.
  • binding of an anti-plectin- 1 antibody as described by the disclosure to a plectin-1 expressing cell induces death (e.g. , triggers apoptosis) of the cell.
  • the disclosure is based, in part, on the recognition that certain combinations of anti- plectin-1 antibodies and anti-cancer agents are capable of mediating enhanced inhibition of cancer cell growth when delivered together, either as separate compositions or as a single composition (e.g. , a composition comprising an anti-plectin-1 antibody and an anti-cancer agent, or an ADC as described herein).
  • compositions comprising antibodies and antigen binding fragments that bind to plectin-1 on the surface of cancer cells.
  • the monoclonal antibodies of the disclosure may be murine, humanized or chimeric or in other forms. A detailed description of the antibodies of the disclosure is provided herein.
  • Plectin-1 is a high molecular weight protein (500 kDa) that links intermediate filaments to microtubules and microfilaments, in addition to anchoring the cytoskeleton the plasma and nuclear membranes (reviewed in Sonnenberg, et al., Exp Cell Res 313:2189-2203 (2007)).
  • plectin-1 levels are low in normal pancreatic ductal cells but its expression is upregulated in cells having certain cancers (e.g. , precursor pancreatic intraepithelial neoplasis (PanlNs), pancreatic ductal adenocarcinoma cells (PDACs), ovarian cancer cells, etc.).
  • Plectin-1 exhibits distinct cytoplasm and nuclear localization in normal fibroblasts, whereas an aberrant expression on the cell membrane is observed in cells having certain cancers (e.g. , PDACs).
  • plectin- 1 Altered subcellular localization of plectin- 1 has also been observed in an autoimmune condition, paraneoplastic pemphigus, and in the associated lymphoproliferative neoplasm, Castleman's disease (Aho et al. , J Invest Dermatol 113:422-423 (1999)). Plectin-1 also has important roles in signal transduction. Thus, plectin- 1 in cells having certain cancers (e.g. , precursor pancreatic intraepithelial neoplasis (PanlNs), pancreatic ductal adenocarcinoma cells (PDACs), ovarian cancer cells, etc.) may have an impact on signaling pathways that regulate cell migration, polarity and energy metabolism related to carcinogenesis. Accordingly, in some embodiments, the disclosure provides antibodies and antigen binding fragments that bind to plectin- 1 on the surface of cancer cells.
  • PanlNs precursor pancreatic intraepithelial neoplasis
  • antibodies also known as immunoglobulins
  • immunoglobulins are tetrameric glycosylated proteins composed of two light (L) chains of approximately 25 kDa each and two heavy (H) chains of approximately 50 kDa each.
  • Two types of light chain, termed lambda and kappa, may be found in antibodies.
  • immunoglobulins can be assigned to five major classes: A, D, E, G, and M, and several of these may be further divided into subclasses (isotypes), e.g., IgGi, IgG 2 , IgG 3 , IgG 4 , IgAi, and IgA 2 .
  • Each light chain typically includes an N-terminal variable (V) domain (VL) and a constant (C) domain (CL).
  • Each heavy chain typically includes an N-terminal V domain (VH), three or four C domains (CH1-3), and a hinge region.
  • the CH domain most proximal to VH is designated as CHI.
  • the VH and VL domains consist of four regions of relatively conserved sequences called framework regions (FR1, FR2, FR3, and FR4), which form a scaffold for three regions of hypervariable sequences (complementarity determining regions, CDRs).
  • the CDRs contain most of the residues responsible for specific interactions of the antibody with the antigen.
  • CDRs are referred to as CDRl, CDR2, and CDR3.
  • CDRH1, CDRH2, and CDRH3 CDR constituents on the heavy chain are referred to as CDRH1, CDRH2, and CDRH3, while CDR constituents on the light chain are referred to as CDRL1, CDRL2, and CDRL3.
  • the CDRs typically refer to the Kabat CDRs, as described in Sequences of Proteins of Immunological Interest, US Department of Health and Human Services (1991), eds. Kabat et al.
  • Another standard for characterizing the antigen binding site is to refer to the hypervariable loops as described by Chothia. See, e.g., Chothia, D. et al. (1992) /. Mol. Biol. 227:799-817; and Tomlinson et al. (1995) EMBO J. 14:4628-4638.
  • Still another standard is the AbM definition used by Oxford Molecular' s AbM antibody modeling software. See, generally, e.g., Protein
  • anti-plectin- 1 antibodies of the present disclosure and the nucleic acid molecules of the present disclosure that encode the antibodies include the CDR amino acid and nucleic acid sequences shown in Table 1 below. Table 1.
  • anti-plectin- 1 binding agents e.g. , anti-plectin- 1 antibodies
  • anti-plectin- 1 antibodies include any antibody or antigen binding fragment that includes a CDRHl, CDRH2, CDRH3, CDRLl, CDRL2, or CDRL3, or combinations thereof, as provided for any one of the antibodies shown in Table 1.
  • anti- plectin- 1 binding agents include the CDRHl, CDRH2, CDRH3, CDRLl, CDRL2, and CDRL3 of any one of the antibodies shown in Table 1.
  • the disclosure also includes any nucleic acid sequence that encodes a CDRHl, CDRH2, CDRH3, CDRLl, CDRL2, or CDRL3 as provided for any one of the antibodies shown in Table 1.
  • Antibody heavy and light chain CDR3 domains may play a particularly important role in the binding specificity/affinity of an antibody for an antigen. Accordingly, the anti-plectin- 1 antibodies of the disclosure, or the nucleic acid molecules thereof, may include at least the heavy and/or light chain CDR3s of antibodies as shown in Table 1 or as set forth by SEQ ID NOs: 14, 21, 23, 36, 43, 45, 58, 65, 67, 80, 87 or 89.
  • anti-plectin antibodies of the disclosure include any antibody that includes a heavy chain variable domain or a light chain variable domain or both as shown in Table 1, or as described in the sequence listing of this disclosure (e.g. , SEQ ID NOs: 14, 23, 36, 45, 58, 67, 80, or 89).
  • the disclosure also includes any nucleic acid molecule encoding an antibody that includes a heavy chain variable domain or a light chain variable domain nucleic acid sequence, or both, as shown in Table 1 or as described in the sequence listing of this disclosure (e.g. , SEQ ID NOs: 3, 12, 25, 34, 47, 56, 69, or 78).
  • Anti-plectin- 1 antibodies of this disclosure may optionally comprise antibody constant regions or parts thereof.
  • a VL domain may be attached at its C-terminal end to a light chain constant domain like CK or C .
  • a VH domain or portion thereof may be attached to all or part of a heavy chain like IgA, IgD, IgE, IgG, and IgM, and any isotype subclass.
  • Antibodies may include suitable constant regions (see, for example, Kabat et al., Sequences of Proteins of Immunological Interest, No. 91-3242, National Institutes of Health Publications, Bethesda, Md. (1991)).
  • anti-plectin-1 antibodies of the disclosure comprise a heavy chain constant region comprising a sequence represented by SEQ ID NOs: 3, 13, 25, 35, 47, 57, 69, or 79.
  • the VH and/or VL domains may be reverted to germline sequence, e.g. , the FR of these domains are mutated using conventional molecular biology techniques to match those produced by the germline cells. In other embodiments, the FR sequences remain diverged from the consensus germline sequences.
  • anti-plectin- 1 antibodies or antigen binding fragments may or may not include the framework region of the antibodies, for example as set forth in SEQ ID NOs: 5, 7, 9, 11, 16, 18, 20, 22, 27, 29, 31, 33, 38, 40, 42, 44, 49, 51, 53, 55, 60, 62, 64, 66, 71, 73, 75, 77, 82, or 84.
  • anti-plectin-1 antibodies are murine antibodies.
  • anti-plectin-1 antibodies are chimeric or humanized antibodies.
  • the disclosure contemplates variants (e.g. , homologs) of amino acid and nucleic acid sequences for the heavy chain variable region and light chain variable region of the antibodies.
  • “Homology” refers to the percent identity between two polynucleotides or two polypeptide moieties.
  • substantially homology when referring to a nucleic acid, or fragment thereof, indicates that, when optimally aligned with appropriate nucleotide insertions or deletions with another nucleic acid (or its complementary strand), there is nucleotide sequence identity in about 90 to 100% of the aligned sequences.
  • nucleic acid sequences sharing substantial homology are at least 90%, at least 91%, at least 92% at least 93%, at least 94%, at least 95%, at least 96% at least 97%, at least 98% at least 99% sequence identity.
  • substantially homology indicates that, when optimally aligned with appropriate gaps, insertions or deletions with another polypeptide, there is nucleotide sequence identity in about 90 to 100% of the aligned sequences.
  • highly conserved means at least 80% identity, preferably at least 90% identity, and more preferably, over 97% identity.
  • highly conserved proteins share at least 85%, at least 90%, at least 91%, at least 92% at least 93%, at least 94%, at least 95%, at least 96% at least 97%, at least 98% at least 99% identity.
  • highly conserved may refer to 100% identity. Identity is readily determined by one of skill in the art by, for example, the use of algorithms and computer programs known by those of skill in the art.
  • an anti-plectin-1 antibodies of the disclosure can bind to plectin-1 with high affinity, e.g. , with a Kd less than 10 "7 M, 10 "8 M, 10 "9 M, 10 "10 M, 10 "11 M or lower.
  • anti-plectin-1 antibodies or antigen binding fragments thereof can bind to plectin- lwith an affinity between 5 pM and 500 nM, e.g. , between 50 pM and 100 nM, e.g. , between 500 pM and 50 nM.
  • the disclosure also includes antibodies or antigen binding fragments that compete with any of the antibodies described herein for binding to plectin- 1 and that have an affinity of 50 nM or lower ⁇ e.g. , 20 nM or lower, 10 nM or lower, 500 pM or lower, 50 pM or lower, or 5 pM or lower).
  • the affinity and binding kinetics of the anti-plectin-1 antibody can be tested using any method known in the art including but not limited to biosensor technology ⁇ e.g. , OCTET or BIACORE).
  • antibody generally refers to an immunoglobulin. All derivatives thereof which maintain or possess specific binding ability are also provided herein.
  • An antibody preparation may be monoclonal or polyclonal.
  • antibody fragment or "antigen binding fragment” refers to any derivative of an antibody which is less than full-length. Generally, an antigen binding fragment retains at least a significant portion of the full-length antibody's specific binding ability.
  • antigen binding fragments include, but are not limited to, Fab, Fab', F(ab')2, scFv, Fv, dsFv diabody, affibodies, and Fd fragments.
  • Antigen binding fragments may be produced by any appropriate means. For instance, an antigen binding fragment may be enzymatically or chemically produced by fragmentation of an intact antibody or it may be recombinantly produced from a gene encoding the partial antibody sequence. Alternatively, an antigen binding fragment may be wholly or partially synthetically produced. An antigen binding fragment may optionally be a single chain antibody fragment. Alternatively, a fragment may comprise multiple chains which are linked together, for instance, by disulfide linkages. An antigen binding fragment may also optionally be a multimolecular complex. A functional antigen binding fragment will typically comprise at least about 50 amino acids and more typically will comprise at least about 200 amino acids.
  • Single-chain Fvs are recombinant antigen binding fragments consisting of only the variable light chain (VL) and variable heavy chain (VH) covalently connected to one another by a polypeptide linker.
  • VL variable light chain
  • VH variable heavy chain
  • the polypeptide linker may be of variable length and composition so long as the two variable domains are bridged without serious steric interference.
  • the linkers are comprised primarily of stretches of glycine and serine residues with some glutamic acid or lysine residues interspersed for solubility.
  • Diabodies are dimeric scFvs.
  • the components of diabodies typically have shorter peptide linkers than most scFvs, and they show a preference for associating as dimers.
  • a Fv fragment is an antigen binding fragment which consists of one VH and one VL domain held together by noncovalent interactions.
  • the term dsFv is used herein to refer to an Fv with an engineered intermolecular disulfide bond to stabilize the VH-VL pair.
  • a F(ab')2 fragment is an antigen binding fragment essentially equivalent to that obtained from immunoglobulins (typically IgG) by digestion with an enzyme pepsin at pH 4.0-4.5.
  • the fragment may be recombinantly produced.
  • a Fab fragment is an antigen binding fragment essentially equivalent to that obtained by reduction of the disulfide bridge or bridges joining the two heavy chain pieces in the F(ab')2 fragment.
  • the Fab' fragment may be recombinantly produced.
  • a Fab fragment is an antigen binding fragment essentially equivalent to that obtained by digestion of immunoglobulins (typically IgG) with the enzyme papain.
  • the Fab fragment may be recombinantly produced.
  • the heavy chain segment of the Fab fragment is the Fd piece.
  • An affibody is a small protein comprising a three-helix bundle that functions as an antigen binding molecule (e.g. , an antibody mimetic).
  • affibodies are approximately 58 amino acids in length and have a molar mass of approximately 6 kDa.
  • Affibody molecules with unique binding properties are acquired by randomization of 13 amino acids located in two alpha-helices involved in the binding activity of the parent protein domain.
  • Specific affibody molecules binding a desired target protein can be isolated from pools (libraries) containing billions of different variants, using methods such as phage display.
  • ADCs Antibody-drug conjugates
  • antibody drug conjugate refers to molecules comprising an antibody, or antigen binding fragment thereof, linked to one or more targeted molecules (e.g. , a biologically active molecule, such as a therapeutic molecule, and/or a detectable label).
  • antibodies or antigen binding fragments of the disclosure may be modified with a therapeutic agent.
  • therapeutic agent refers to chemicals or drugs or proteins that are able to inhibit cell function, inhibit cell replication or kill mammalian cells, preferably human cells, more preferably human cancer cells.
  • therapeutic agents include but are not limited to cytotoxic moieties, radioisotopes, molecules of plant, fungal, or bacterial origin (e.g. , plant-derived toxins (e.g. , secondary metabolites), glycosides, antimicrobial compounds (e.g. , streptomycin, penicillin, etc.), biological proteins (e.g. , protein toxins), particles (e.g.
  • the therapeutic agent can be an intracellularly active drug or other agent, such as short-range radiation emitters, including, for example, short-range, high-energy alpha- emitters (e.g. , 131 I).
  • short-range radiation emitters including, for example, short-range, high-energy alpha- emitters (e.g. , 131 I).
  • a therapeutic agent is an anti-cancer agent.
  • anti-cancer agent refers to chemicals or drugs or proteins that are able to inhibit cancer cell function, inhibit cancer cell growth or replication, or kill cancer cells.
  • an anti-cancer agent is a chemical or drug or protein that is approved by the U.S. Food and Drug Administration (FDA) for treatment of cancer.
  • FDA U.S. Food and Drug Administration
  • anti-cancer agents include but are not limited to Abraxane (Paclitaxel Albumin-stabilized Nanoparticle Formulation), Adrucil (Fluorouracil), Afinitor (Everolimus), Efudex (Fluorouracil), Erlotinib Hydrochloride, Everolimus, Fluoroplex (Fluorouracil), Fluorouracil, Gemcitabine Hydrochloride, Gemzar (Gemcitabine Hydrochloride), Mitomycin C, Mitozytrex (Mitomycin C), Mutamycin (Mitomycin C), Paclitaxel Albumin- stabilized Nanoparticle Formulation, Sunitinib Malate, Sutent (Sunitinib Malate), and Tarceva (Erlotinib Hydrochloride), Altretamine, Alkeran (Melphalan), Avastin (Bevacizumab),
  • the anti-cancer agent is gemcitabine (gem) or cisplatin.
  • an anti-cancer agent is a pyrrolobenzodiazepine (PBD).
  • PBD pyrrolobenzodiazepine
  • PDBs are a class of dimerized crosslinking agents that bind to the DNA minor-groove in a sequence-specific manner, for example as described by Antonow D et al. (2011) Chem Rev 111 : 2815-2864; Cipolla et al. (2009) Anticancer Agents Med Chem 9: 1-31 ; and Gerratana (2012) Med Res Rev 32: 254-293.
  • the therapeutic agent e.g. , anti-cancer agent
  • immunomodulatory moiety e.g. , immunomodulatory agent
  • immunomodulatory agent refers to a compound or molecule that increases or decreases the immune response of a subject in response to the agent.
  • an immunomodulatory agent may enhance the immune response of a subject to a tumor, e.g. , increase the level of inflammatory cytokines such as interleukin- 1 (IL- 1), and tumor necrosis factor-alpha (TNF-a).
  • IL-1 interleukin- 1
  • TNF-a tumor necrosis factor-alpha
  • immunomodulatory agents that increase the immune response of a subject include granulocyte colony-stimulating factor (G-CSF), interferons, imiquimod, cellular membrane fractions from bacteria, certain interleukins and cytokines (e.g.
  • an immunomodulatory agent may decrease the immune response of a subject (e.g. , mediate or achieve immunosuppression). Examples of immunosuppressive
  • immunomodulators include but are not limited to immunosuppressive drugs (e.g. ,
  • glucococorticoids e.g. , cytostatics, anti-inflammatory monoclonal antibodies (e.g. , anti-IL-2 receptor antibodies)), and drugs targeting immunophilins (e.g. , ciclosporin, sirolimus, etc.).
  • One or more therapeutic agents may be coupled or conjugated either directly to the anti-plectin-1 antibodies of the disclosure or indirectly, through an intermediate (such as, for example, a linker known in the art) using techniques known in the art.
  • multiple (e.g. , 2, 3, 4, 5, 6, 7, 8, 9, 10, or more) therapeutic agents (e.g. , anti-cancer agent molecules) are coupled or conjugated to an anti-plectin-1 antibody.
  • an ADC comprises 1, 2, 3, 4, or 5 PDB molecules (e.g. , PDB dimers, trimers, etc.) conjugated to an anti-plectin- 1 antibody.
  • the antibody is coupled to the targeted agent via a linker.
  • linker refers to a molecule or sequence, such as an amino acid sequence, that attaches, as in a bridge, one molecule or sequence to another molecule or sequence.
  • Linker refers to a molecule or sequence, such as an amino acid sequence, that attaches, as in a bridge, one molecule or sequence to another molecule or sequence.
  • "Linked,” “conjugated,” or “coupled” means attached or bound by covalent bonds, or non-covalent bonds, or other bonds, such as van der Waals forces.
  • Antibodies described by the disclosure can be linked to the targeted agent (e.g. , therapeutic moiety or detectable moiety) directly, e.g. , as a fusion protein with protein or peptide detectable moieties (with or without an optional linking sequence, e.g.
  • the linker is a flexible amino acid sequence.
  • flexible amino acid sequences include glycine and serine rich linkers, which comprise a stretch of two or more glycine residues, (e.g. , GGGS; SEQ ID NO: 91).
  • the linker is a photolinker. Examples of photolinkers include ketyl-reactive benzophenone (BP),
  • AQ anthraquinone
  • NPA nitrene-reactive nitrophenyl azide
  • PTD carbene-reactive phenyl- (trifluoromethyl)diazirine
  • the disclosure relates to pharmaceutical compositions comprising anti- plectin-1 antibodies (e.g. , ADCs comprising anti-plectin- 1 antibodies).
  • the composition comprises an anti-plectin-1 antibody, an anti-cancer agent, and a
  • the ratio (e.g. , concentration ratio) of anti-plectin-1 antibody to anti-cancer agent in a composition of the disclosure can vary. In some
  • the ratio of anti-plectin- 1 antibody to anti-cancer agent ranges from about 1 : 100 to about 100: 1, for example any ratio therebetween. In some embodiments, the ratio (e.g. , concentration ratio) of anti-plectin- 1 antibody to anti-cancer agent is about 1 : 1.
  • compositions can be prepared as described below.
  • the active ingredients may be admixed or compounded with any conventional, pharmaceutically acceptable carrier or excipient.
  • the compositions may be sterile.
  • compositions are formulated for delivering an effective amount of an agent (e.g. , a composition comprising an anti-plectin- 1 antibody, or antibody drug conjugate comprising an anti-plectin- 1 antibody and an anti-cancer agent).
  • an "effective amount" of an active agent refers to an amount sufficient to elicit the desired biological response (e.g. , killing of a cancerous cell or suppression of tumor growth).
  • An effective amount of an agent may vary depending on such factors as the desired biological endpoint, the pharmacokinetics of the compound, the disease being treated (e.g. , certain cancers characterized by surface expression of plectin-1), the mode of administration, and the patient.
  • a composition is said to be a "pharmaceutically acceptable carrier" if its administration can be tolerated by a recipient patient.
  • Sterile phosphate-buffered saline is one example of a pharmaceutically acceptable carrier.
  • Other suitable carriers are well-known in the art. See, for example, REMINGTON'S PHARMACEUTICAL SCIENCES, 18th Ed. (1990).
  • any mode of administration, vehicle or carrier conventionally employed and which is inert with respect to the active agent may be utilized for preparing and administering the pharmaceutical compositions of the present disclosure.
  • Illustrative of such methods, vehicles and carriers are those described, for example, in Remington's Pharmaceutical Sciences, 4th ed. (1970), the disclosure of which is incorporated herein by reference.
  • Those skilled in the art, having been exposed to the principles of the disclosure, will experience no difficulty in determining suitable and appropriate vehicles, excipients and carriers or in compounding the active ingredients therewith to form the pharmaceutical compositions of the disclosure.
  • an effective amount, also referred to as a therapeutically effective amount, of a compound is an amount sufficient to ameliorate at least one adverse effect associated with cancer (e.g., tumor growth, metastasis).
  • the therapeutically effective amount to be included in pharmaceutical compositions depends, in each case, upon several factors, e.g., the type, size and condition of the patient to be treated, the intended mode of administration, the capacity of the patient to incorporate the intended dosage form, etc.
  • an amount of active agent is included in each dosage form to provide from about 0.1 to about 250 mg/kg, and preferably from about 0.1 to about 100 mg/kg.
  • an amount of active agent is included in each dosage form to provide from about 0.1 to about 250 mg/kg, and preferably from about 0.1 to about 100 mg/kg.
  • One of ordinary skill in the art would be able to determine empirically an appropriate therapeutically effective amount.
  • an effective prophylactic or therapeutic treatment regimen can be planned which does not cause substantial toxicity and yet is entirely effective to treat the particular subject.
  • the effective amount for any particular application can vary depending on such factors as the disease or condition being treated, the particular therapeutic agent being administered, the size of the subject, or the severity of the disease or condition.
  • One of ordinary skill in the art can empirically determine the effective amount of a particular nucleic acid and/or other therapeutic agent without necessitating undue experimentation.
  • colloidal dispersion systems include lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes.
  • a colloidal system of the disclosure is a liposome. Liposomes are artificial membrane vessels which are useful as a delivery vector in vivo or in vitro. It has been shown that large unilamellar vesicles (LUVs), which range in size from 0.2 - 4.0 ⁇ can encapsulate large macromolecules.
  • LUVs large unilamellar vesicles
  • Liposomes may be targeted to a particular tissue by coupling the liposome to a specific ligand such as a monoclonal antibody, sugar, glycolipid, or protein.
  • Ligands which may be useful for targeting a liposome to, for example, an smooth muscle cell include, but are not limited to: intact or fragments of molecules which interact with smooth muscle cell specific receptors and molecules, such as antibodies, which interact with the cell surface markers of cancer cells. Such ligands may easily be identified by binding assays well known to those of skill in the art.
  • the liposome may be targeted to a tissue by coupling it to an antibody known in the art.
  • Compounds described by the disclosure may be administered alone (e.g., in saline or buffer) or using any delivery vehicle known in the art.
  • delivery vehicles have been described: cochleates; Emulsomes; ISCOMs; liposomes; live bacterial vectors (e.g., Salmonella, Escherichia coli, Bacillus Calmette-Guerin, Shigella, Lactobacillus); live viral vectors (e.g., Vaccinia, adenovirus, Herpes simplex); microspheres; nucleic acid vaccines; polymers (e.g., carboxymethylcellulose, chitosan); polymer rings; proteosomes; sodium fluoride; transgenic plants; virosomes; and, virus-like particles.
  • compositions of the disclosure are administered in pharmaceutically acceptable solutions, which may routinely contain pharmaceutically acceptable concentrations of salt, buffering agents, preservatives, compatible carriers, adjuvants, and optionally other therapeutic ingredients.
  • pharmaceutically-acceptable carrier means one or more compatible solid or liquid filler, diluents or encapsulating substances which are suitable for administration to a human or other vertebrate animal.
  • carrier denotes an organic or inorganic ingredient, natural or synthetic, with which the active ingredient is combined to facilitate the application.
  • the components of the pharmaceutical compositions also are capable of being commingled with the compounds of the present disclosure, and with each other, in a manner such that there is no interaction which would substantially impair the desired pharmaceutical efficiency.
  • Dragee cores are provided with suitable coatings.
  • suitable coatings For this purpose, concentrated sugar solutions may be used, which may optionally contain gum arabic, talc, polyvinyl pyrrolidone, carbopol gel, polyethylene glycol, and/or titanium dioxide, lacquer solutions, and suitable organic solvents or solvent mixtures.
  • Dyestuffs or pigments may be added to the tablets or dragee coatings for identification or to characterize different combinations of active compound doses.
  • the compounds may also be formulated as a depot preparation.
  • Such long-acting formulations may be formulated with suitable polymeric or hydrophobic materials (for example as an emulsion in an acceptable oil) or ion exchange resins, or as sparingly soluble derivatives, for example, as a sparingly soluble salt.
  • compositions also may comprise suitable solid or gel phase carriers or excipients.
  • suitable solid or gel phase carriers or excipients include but are not limited to calcium carbonate, calcium phosphate, various sugars, starches, cellulose derivatives, gelatin, and polymers such as polyethylene glycols.
  • Suitable liquid or solid pharmaceutical preparation forms are, for example, aqueous or saline solutions for inhalation, microencapsulated, encochleated, coated onto microscopic gold particles, contained in liposomes, nebulized, aerosols, pellets for implantation into the skin, or dried onto a sharp object to be scratched into the skin.
  • the pharmaceutical compositions also include granules, powders, tablets, coated tablets, (micro)capsules, suppositories, syrups, emulsions, suspensions, creams, drops or preparations with protracted release of active compounds, in whose preparation excipients and additives and/or auxiliaries such as disintegrants, binders, coating agents, swelling agents, lubricants, flavorings, sweeteners or solubilizers are customarily used as described above.
  • the pharmaceutical compositions are suitable for use in a variety of drug delivery systems. For a brief review of methods for drug delivery, see Langer R (1990) Science 249: 1527-1533, which is incorporated herein by reference.
  • the compounds may be administered per se (neat) or in the form of a pharmaceutically acceptable salt.
  • the salts should be pharmaceutically acceptable, but non-pharmaceutically acceptable salts may conveniently be used to prepare pharmaceutically acceptable salts thereof.
  • Such salts include, but are not limited to, those prepared from the following acids: hydrochloric, hydrobromic, sulphuric, nitric, phosphoric, maleic, acetic, salicylic, p-toluene sulphonic, tartaric, citric, methane sulphonic, formic, malonic, succinic, naphthalene-2-sulphonic, and benzene sulphonic.
  • such salts can be prepared as alkaline metal or alkaline earth salts, such as sodium, potassium or calcium salts of the carboxylic acid group.
  • Suitable buffering agents include: acetic acid and a salt (1-2% w/v); citric acid and a salt (1-3% w/v); boric acid and a salt (0.5-2.5% w/v); and phosphoric acid and a salt (0.8-2% w/v).
  • Suitable preservatives include benzalkonium chloride (0.003-0.03% w/v); chlorobutanol (0.3- 0.9% w/v); parabens (0.01-0.25% w/v) and thimerosal (0.004-0.02% w/v).
  • compositions may conveniently be presented in unit dosage form and may be prepared by any of the methods well known in the art of pharmacy. All methods include the step of bringing the compounds into association with a carrier which constitutes one or more accessory ingredients. In general, the compositions are prepared by uniformly and intimately bringing the compounds into association with a liquid carrier, a finely divided solid carrier, or both, and then, if necessary, shaping the product.
  • Liquid dose units are vials or ampoules. Solid dose units are tablets, capsules and suppositories.
  • aspects of the disclosure relate to combinations of anti-plectin- 1 antibodies and anticancer agents, administered as a single composition or separately, that act together ⁇ e.g., synergistically) to inhibit growth of certain cancer cells. Methods of measuring synergism are known and are described, for example by Chou (2010) Cancer Res. 70(2): 440-6.
  • a combination of anti-plectin- 1 antibody and one or more anti-cancer agents inhibits growth of a cell ⁇ e.g., a cancer cell) by between 2-fold and 100-fold ⁇ e.g., 2-fold, 4-fold, 5-fold, 10-fold, 20-fold, 25-fold, 50-fold, 75-fold, etc.) more than either the antibody or anticancer agent alone.
  • a combination of anti-plectin- 1 antibody and one or more anti-cancer agents inhibits growth of a cell ⁇ e.g., a cancer cell) more than 100-fold relative to either the antibody or anti-cancer agent alone.
  • compositions and ADCs described by the disclosure are useful, in some embodiments, for treating cancer characterized by surface expression of plectin-1.
  • treating cancer refers to decreasing the number of cancer cells in a patient, slowing the growth of cancer cells in a patient, reducing the metastasis of cancer cells in a patient and includes any type of response for either relieving cancer symptoms or increasing the life-span of a patient.
  • Examples of cancers characterized by surface expression of plectin-1 include but are not limited to ovarian cancer cell, esophageal cancer cell, head and neck squamous cell carcinoma cancer cell, or pancreatic cancer cell ⁇ e.g., pancreatic ductal adenocarcinoma (PDAC)).
  • PDAC pancreatic ductal adenocarcinoma
  • cancers such as lung cancer, bladder cancer, breast cancer, esophageal cancer, mouth cancer, tongue cancer, gum cancer, skin cancer ⁇ e.g., melanoma, basal cell carcinoma, Kaposi's sarcoma, etc.
  • muscle cancer heart cancer, liver cancer, bronchial cancer, cartilage cancer, bone cancer, stomach cancer, prostate cancer, testicular cancer, cervical cancer, endometrial cancer, uterine cancer, colon cancer, colorectal, gastric cancer, kidney cancer, bladder cancer, lymphoma cancer, spleen cancer, thymus cancer, thyroid cancer, brain cancer, neuronal cancer, mesothelioma, gall bladder cancer, ocular cancer ⁇ e.g., cancer of the cornea, cancer of uvea, cancer of the choroids, cancer of the macula, vitreous humor cancer, etc.), joint cancer (such as synovium cancer), glioblastoma, white blood cell cancer (e.g.
  • lymphoma, leukemia, etc. may be characterized by surface expression of plectin- 1 and/or treated using compositions and ADCs described by the disclosure.
  • Cancers further exemplified by sarcomas may, in some embodiments, be treated using compositions and ADCs described by the disclosure.
  • the disclosure provides a method for treating cancer, the method comprising administering to a subject having cancer an effective amount of a composition or ADC as described by the disclosure (e.g. , a composition or ADC comprising an anti-plectin-1 antibody and an anti-cancer agent).
  • a composition or ADC as described by the disclosure
  • the subject is a mammal. In some embodiments, the subject is a human.
  • antibodies and pharmaceutical compositions of the disclosure preferably contain a pharmaceutically acceptable carrier or excipient suitable for rendering the compound or mixture administrable orally as a tablet, capsule or pill, or parenterally, intravenously, intradermally, intramuscularly or subcutaneously, or transdermally.
  • compositions and/or ADCs can be administered by any suitable route for administering medications.
  • a variety of administration routes are available.
  • the particular mode selected will depend, of course, upon the particular agent or agents selected, the particular condition being treated, and the dosage required for therapeutic efficacy.
  • the methods of this disclosure may be practiced using any mode of
  • an effective amount of the anti-plectin-1 antibody and/or other therapeutic agent can be administered to a subject by any mode that delivers the agent to the desired surface, e.g. , mucosal, systemic.
  • Administering the pharmaceutical composition of the present disclosure may be accomplished by any means known to the skilled artisan.
  • Routes of administration include but are not limited to oral, parenteral, intravenous, intramuscular, intraperitoneal, intranasal, sublingual, intratracheal, inhalation, subcutaneous, ocular, vaginal, and rectal.
  • Systemic routes include oral and parenteral.
  • Several types of devices are regularly used for administration by inhalation. These types of devices include metered dose inhalers (MDI), breath-actuated MDI, dry powder inhaler (DPI), spacer/holding chambers in combination with MDI, and nebulizers.
  • MDI metered dose inhalers
  • DPI dry powder inhaler
  • spacer/holding chambers in combination with MDI and nebulizers.
  • the compounds can be formulated readily by combining the active compound(s) with pharmaceutically acceptable carriers well known in the art.
  • Such carriers enable the compounds of the disclosure to be formulated as tablets, pills, dragees, capsules, liquids, gels, syrups, slurries, suspensions and the like, for oral ingestion by a subject to be treated.
  • Pharmaceutical preparations for oral use can be obtained as solid excipient, optionally grinding a resulting mixture, and processing the mixture of granules, after adding suitable auxiliaries, if desired, to obtain tablets or dragee cores.
  • Suitable excipients are, in particular, fillers such as sugars, including lactose, sucrose, mannitol, or sorbitol; cellulose preparations such as, for example, maize starch, wheat starch, rice starch, potato starch, gelatin, gum tragacanth, methyl cellulose, hydroxypropylmethyl-cellulose, sodium
  • carboxymethylcellulose and/or polyvinylpyrrolidone (PVP).
  • disintegrating agents may be added, such as the cross-linked polyvinyl pyrrolidone, agar, or alginic acid or a salt thereof such as sodium alginate.
  • the oral formulations may also be formulated in saline or buffers for neutralizing internal acid conditions or may be administered without any carriers.
  • compositions which can be used orally include push-fit capsules made of gelatin, as well as soft, sealed capsules made of gelatin and a plasticizer, such as glycerol or sorbitol.
  • the push-fit capsules can contain the active ingredients in admixture with filler such as lactose, binders such as starches, and/or lubricants such as talc or magnesium stearate and, optionally, stabilizers.
  • the active compounds may be dissolved or suspended in suitable liquids, such as fatty oils, liquid paraffin, or liquid polyethylene glycols.
  • stabilizers may be added.
  • Microspheres formulated for oral administration may also be used. Such microspheres have been well defined in the art. All formulations for oral administration should be in dosages suitable for such administration.
  • compositions may take the form of tablets or lozenges formulated in conventional manner.
  • the compounds for use according to the present disclosure may be conveniently delivered in the form of an aerosol spray presentation from pressurized packs or a nebulizer, with the use of a suitable propellant, e.g. ,
  • the dosage unit may be determined by providing a valve to deliver a metered amount.
  • Capsules and cartridges of e.g., gelatin for use in an inhaler or insufflator may be formulated containing a powder mix of the compound and a suitable powder base such as lactose or starch.
  • the compounds when it is desirable to deliver them systemically, may be formulated for parenteral administration by injection, e.g. , by bolus injection or continuous infusion.
  • Formulations for injection may be presented in unit dosage form, e.g. , in ampoules or in multi- dose containers, with an added preservative.
  • the compositions may take such forms as suspensions, solutions or emulsions in oily or aqueous vehicles, and may contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
  • compositions for parenteral administration include aqueous solutions of the active compounds in water-soluble form. Additionally, suspensions of the active compounds may be prepared as appropriate oily injection suspensions. Suitable lipophilic solvents or vehicles include fatty oils such as sesame oil, or synthetic fatty acid esters, such as ethyl oleate or triglycerides, or liposomes. Aqueous injection suspensions may contain substances which increase the viscosity of the suspension, such as sodium carboxymethyl cellulose, sorbitol, or dextran. Optionally, the suspension may also contain suitable stabilizers or agents which increase the solubility of the compounds to allow for the preparation of highly concentrated solutions.
  • the active compounds may be in powder form for constitution with a suitable vehicle, e.g. , sterile pyrogen-free water, before use.
  • a suitable vehicle e.g. , sterile pyrogen-free water
  • the compounds may also be formulated in rectal or vaginal compositions such as suppositories or retention enemas, e.g. , containing conventional suppository bases such as cocoa butter or other glycerides.
  • Other delivery systems can include time-release, delayed release or sustained release delivery systems. Such systems can avoid repeated administrations of the compounds, increasing convenience to the subject and the physician.
  • release delivery systems are available and known to those of ordinary skill in the art. They include polymer base systems such as poly(lactide-glycolide), copolyoxalates, polycaprolactones, polyesteramides,
  • Delivery systems also include non-polymer systems that are: lipids including sterols such as cholesterol, cholesterol esters and fatty acids or neutral fats such as mono-, di-, and tri-glycerides; hydrogel release systems; silastic systems; peptide-based systems; wax coatings; compressed tablets using conventional binders and excipients; partially fused implants; and the like. Specific examples include, but are not limited to: (a) erosional systems in which an agent of the disclosure is contained in a form within a matrix such as those described in U.S.
  • compositions and ADCs described by the disclosure can be administered to a subject (e.g. , a subject having cancer) on multiple occasions.
  • the number of occasions in which an antibody or composition of the disclosure is delivered to a subject is in a range of 2 to 10 times (e.g. , 2, 3, 4, 5, 6, 7, 8, 9, or 10 times).
  • an antibody or composition of the disclosure is delivered to a subject more than 10 times.
  • a dose of a composition or ADC of the disclosure is administered to a subject no more than once per calendar day (e.g. , a 24-hour period). In some embodiments, a dose of a composition or ADC of the disclosure is administered to a subject no more than once per 2, 3, 4, 5, 6, or 7 calendar days. In some embodiments, a dose of a composition or ADC of the disclosure is administered to a subject no more than once per calendar week (e.g. , 7 calendar days). In some embodiments, a dose of composition or ADC of the disclosure is administered to a subject no more than bi-weekly (e.g. , once in a two calendar week period).
  • a dose of a composition or ADC of the disclosure is administered to a subject no more than once per calendar month (e.g. , once in 30 calendar days). In some embodiments, a dose of a composition or ADC of the disclosure is administered to a subject no more than once per six calendar months. In some embodiments, a dose of a composition or ADC of the disclosure is administered to a subject no more than once per calendar year (e.g. , 365 days or 366 days in a leap year).
  • an identical cell assay is performed to determine synergy by incubating cells with increasing drug concentrations with an equipotent anti plecl-to-gem ratio ⁇ e.g., IC50) that is specific to each cell line.
  • Synergy is calculated using the Chou-Talalay method ⁇ e.g., as described in Cancer Res. 2010 Jan 15;70(2):440-6) to determine synergetic effect.
  • Table 3 Effect of anti-plecl on cell survival after 72 hours.
  • Pab2 Heavy Chain GAGGTGCAGCTGGTGGAGTCTGGGGGAGACTTGGTGAAGC 5 FRl CTGGAGGGTCCCTGAAACTCTCCTGTGCAGCCTCTGGATTC
  • Pab2 Heavy Chain GAGGTGCAGCTGGTGGAGTCTGGGGGAGACTTGGTGAAGC 12 Variable Region CTGGAGGGTCCCTGAAACTCTCCTGTGCAGCCTCTGGATTC
  • Pab2 Light Chain TGGTATCTGCAGAAGCCAGGCCAGTCTCCTCAGCTCCTGAT 29 FR2 TTAT
  • TGTATCCATCTTCCC ACCATCCAGTGAGCAGTTAACATCTG GAGGTGCCTCAGTCGTGTGCTTCTTGAACAACTTCTACCCC AAAGACATCAATGTCAAGTGGAAGATTGATGGCAGTGAAC GACAAAATGGCGTCCTGAACAGTTGGACTGATCAGGACAG CAAAGACAGCACCTACAGCATGAGCAGCACCCTCACGTTG ACCAAGGACGAGTATGAACGACATAACAGCTATACCTGTG AGGCCACTCACA
  • PAbl Light Chain GATATTGTGATGACTCAGGCTGCACCCTCTGTACCTGTCAC 78 Variable Region TCCTGGAGAGTCAGTATCCATCTCCTGCAGGTCTAGTAAGA
  • PAbl Light Chain DIVMTQAAPSVPVTPGESVSISCRSSKSLLHSNGNTYLYWFLQ 89 Variable Region RPGQSPQLLIYRMSNLASGVPDRFSGSGSGTAFTLRISRVEAED

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • Epidemiology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Cell Biology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biomedical Technology (AREA)
  • Oncology (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Inorganic Chemistry (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicinal Preparation (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
PCT/US2018/055438 2017-10-11 2018-10-11 ANTIBODIES BINDING TO PELTIN-1 AND USES THEREOF Ceased WO2019075216A1 (en)

Priority Applications (4)

Application Number Priority Date Filing Date Title
JP2020542037A JP7379347B2 (ja) 2017-10-11 2018-10-11 プレクチン1結合抗体およびその使用
CN201880079957.6A CN112105380A (zh) 2017-10-11 2018-10-11 网蛋白-1结合抗体和其用途
US16/846,031 US12053530B2 (en) 2017-10-11 2020-04-10 Plectin-1 binding antibodies and uses thereof
JP2023127717A JP2023155262A (ja) 2017-10-11 2023-08-04 プレクチン1結合抗体およびその使用

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201762571246P 2017-10-11 2017-10-11
US62/571,246 2017-10-11

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US16/846,031 Continuation-In-Part US12053530B2 (en) 2017-10-11 2020-04-10 Plectin-1 binding antibodies and uses thereof

Publications (2)

Publication Number Publication Date
WO2019075216A1 true WO2019075216A1 (en) 2019-04-18
WO2019075216A8 WO2019075216A8 (en) 2019-06-06

Family

ID=66101714

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2018/055438 Ceased WO2019075216A1 (en) 2017-10-11 2018-10-11 ANTIBODIES BINDING TO PELTIN-1 AND USES THEREOF

Country Status (4)

Country Link
US (1) US12053530B2 (https=)
JP (2) JP7379347B2 (https=)
CN (1) CN112105380A (https=)
WO (1) WO2019075216A1 (https=)

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11168145B2 (en) 2016-04-08 2021-11-09 Zielbio, Inc. Plectin-1 binding antibodies and uses thereof
WO2022034342A1 (en) * 2020-08-14 2022-02-17 Oxford Brookes University Metastatic cancer treatment or prevention
WO2023077099A1 (en) * 2021-10-29 2023-05-04 Zielbio, Inc. Cancer specific plectin-1 specific antibodies and methods of use thereof
US12053530B2 (en) 2017-10-11 2024-08-06 Zielbio, Inc. Plectin-1 binding antibodies and uses thereof

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20040101874A1 (en) * 2002-04-12 2004-05-27 Mitokor Inc. Targets for therapeutic intervention identified in the mitochondrial proteome
US20100279932A1 (en) * 2003-07-26 2010-11-04 Trubion Pharmaceuticals, Inc. Binding constructs and methods for use thereof
US20150299334A1 (en) * 2012-08-14 2015-10-22 Minerva Biotechnologies Corporation Stem cell enhancing therapeutics
US20170087257A1 (en) * 2008-04-14 2017-03-30 The General Hospital Corporation Plectin-1 Targeted Agents for Detection and Treatment of Pancreatic Ductal Adenocarcinoma
US20170267719A1 (en) * 2016-03-16 2017-09-21 Council Of Scientific & Industrial Research Method for regressing pancreatic tumor by a liposomal formulation along with dna vaccines

Family Cites Families (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4946778A (en) 1987-09-21 1990-08-07 Genex Corporation Single polypeptide chain binding molecules
EP0281604B1 (en) 1986-09-02 1993-03-31 Enzon Labs Inc. Single polypeptide chain binding molecules
US5260203A (en) 1986-09-02 1993-11-09 Enzon, Inc. Single polypeptide chain binding molecules
US7754208B2 (en) 2001-01-17 2010-07-13 Trubion Pharmaceuticals, Inc. Binding domain-immunoglobulin fusion proteins
US20050164324A1 (en) 2003-06-04 2005-07-28 Gygi Steven P. Systems, methods and kits for characterizing phosphoproteomes
US7842466B1 (en) 2005-09-16 2010-11-30 Celera Corporation Colon disease targets and uses thereof
US20090110680A1 (en) * 2006-04-07 2009-04-30 Stephanie Sieger Combination of an anti ED-B fibronectin domain antibody and gemcitabine
JP2011501731A (ja) 2007-09-10 2011-01-13 ユニバーシティ オブ マサチューセッツ ミトコンドリア標的化抗腫瘍剤
WO2009079585A2 (en) 2007-12-17 2009-06-25 Dyax Corp. Compositions and methods for treating osteolytic disorders comprising mmp-14 binding proteins
WO2011057078A2 (en) 2009-11-05 2011-05-12 University Of Virginia Patent Foundation Compositions and methods for detecting plectin-1 as a biomarker for cancer
US9856315B2 (en) 2014-10-15 2018-01-02 Cell Signaling Technology, Inc. Methylation and acetylation sites
KR102486507B1 (ko) * 2016-04-08 2023-01-09 아이티아이 헬스, 인크. 플렉틴-1 결합 항체 및 그의 용도
JP7379347B2 (ja) * 2017-10-11 2023-11-14 ジィールバイオ,インコーポレーテッド プレクチン1結合抗体およびその使用

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20040101874A1 (en) * 2002-04-12 2004-05-27 Mitokor Inc. Targets for therapeutic intervention identified in the mitochondrial proteome
US20100279932A1 (en) * 2003-07-26 2010-11-04 Trubion Pharmaceuticals, Inc. Binding constructs and methods for use thereof
US20170087257A1 (en) * 2008-04-14 2017-03-30 The General Hospital Corporation Plectin-1 Targeted Agents for Detection and Treatment of Pancreatic Ductal Adenocarcinoma
US20150299334A1 (en) * 2012-08-14 2015-10-22 Minerva Biotechnologies Corporation Stem cell enhancing therapeutics
US20170267719A1 (en) * 2016-03-16 2017-09-21 Council Of Scientific & Industrial Research Method for regressing pancreatic tumor by a liposomal formulation along with dna vaccines

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
CHENG ET AL.: "Plectin deficiency in liver cancer cells promotes cell migration and sensitivity to sorafenib treatment", CELL ADH MIGR., vol. 12, no. 1, January 2018 (2018-01-01), pages 19 - 27, XP055592222 *
PROBY ET AL.: "Human Autoantibodies against HD1/Plectin in Paraneoplastic Pemphigus", J INVEST DERMATOL, vol. 112, no. 2, February 1999 (1999-02-01), pages 153 - 6, XP055592224 *
SHIN ET AL.: "Unexpected gain of function for the scaffolding protein plectin due to mislocalization in pancreatic cancer", PROC NATL ACAD SCI USA., vol. 110, no. 48, 2013, pages 19414 - 9, XP055175679, DOI: doi:10.1073/pnas.1309720110 *

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11168145B2 (en) 2016-04-08 2021-11-09 Zielbio, Inc. Plectin-1 binding antibodies and uses thereof
US12053530B2 (en) 2017-10-11 2024-08-06 Zielbio, Inc. Plectin-1 binding antibodies and uses thereof
WO2022034342A1 (en) * 2020-08-14 2022-02-17 Oxford Brookes University Metastatic cancer treatment or prevention
CN116916959A (zh) * 2020-08-14 2023-10-20 牛津布鲁克斯大学 转移性癌的治疗或预防
WO2023077099A1 (en) * 2021-10-29 2023-05-04 Zielbio, Inc. Cancer specific plectin-1 specific antibodies and methods of use thereof

Also Published As

Publication number Publication date
US12053530B2 (en) 2024-08-06
JP2020537690A (ja) 2020-12-24
US20200268900A1 (en) 2020-08-27
JP7379347B2 (ja) 2023-11-14
WO2019075216A8 (en) 2019-06-06
JP2023155262A (ja) 2023-10-20
CN112105380A (zh) 2020-12-18

Similar Documents

Publication Publication Date Title
CA2560305C (en) Human anti-epidermal growth factor receptor antibody
US12053530B2 (en) Plectin-1 binding antibodies and uses thereof
EP2793940B1 (en) Surrogate binding proteins
ES2527871T3 (es) Anticuerpos completamente humanos dirigidos contra el receptor del factor de crecimiento 1 similar a la insulina humana
RU2745451C1 (ru) Антитела к человеческому интерлейкину-2 и их применение
JP7607564B2 (ja) Pmel17に対する抗体及びその結合体
WO2022100590A1 (zh) 针对密蛋白18a2的adcc增强型人源化抗体及其应用
KR20240150805A (ko) Sting 효능제를 포함하는 항체 약물 접합체, 조합 및 사용 방법
US20250066499A1 (en) Antibody binding to human cd73, preparation method therefor, and use thereof
CA3226537A1 (en) Humanized anti-human .beta.ig-h3 protein and uses thereof
JP6989645B2 (ja) ErbB3に特異的に結合する抗体、及びその用途
CN120437318A (zh) 抗体药物偶联物和免疫检查点抑制剂的联合应用
WO2025082449A1 (zh) 抗体药物偶联物和免疫检查点抑制剂的联合应用
CN119587691A (zh) 抗her2抗体药物偶联物联合抗her2抗体治疗肿瘤
KR20250131840A (ko) ErbB-2, ErbB-2/ErbB-3 양성 종양을 가진 개체의 치료를 위한, ErbB-2 및 ErbB-3의 세포외 부분 상의 에피토프에 결합하는 항원-결합 부위를 가진 이중특이적 항체 및 ErbB-2 표적화제
TW202543685A (zh) 抗體藥物偶聯物及其製備方法和用途
WO2025252203A1 (zh) 抗Nectin-4抗体药物偶联物治疗肿瘤的用途
AU2024316626A1 (en) Anti-ror1 protein antibody and conjugate thereof
HK40112252A (en) Antibodies to pmel17 and conjugates thereof
WO2025078686A1 (en) Combination therapy involving antibody-drug conjugates against claudin18.2 and pd1/pd-l axis inhibitors for treatment of cancer
CN121568961A (zh) 抗met抗体、抗体药物缀合物、组合物及其用途
TW202602936A (zh) 抗FGFR2b抗體藥物偶聯物及其應用
WO2026082153A1 (zh) 抗Nectin-4抗体药物偶联物治疗肿瘤的用途
TW202600174A (zh) 抗體藥物偶聯物和抗egfr抗體的聯合應用
AU2024298986A1 (en) Pharmaceutical composition containing anti-nectin4 antibody-drug conjugate and anti-pd-1 antibody and use thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18867013

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2020542037

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 18867013

Country of ref document: EP

Kind code of ref document: A1