WO2019038368A1 - CHIMERIC ANTIGEN RECEPTOR AND CAR CXCR5 BINDING T CARRIER - Google Patents

CHIMERIC ANTIGEN RECEPTOR AND CAR CXCR5 BINDING T CARRIER Download PDF

Info

Publication number
WO2019038368A1
WO2019038368A1 PCT/EP2018/072750 EP2018072750W WO2019038368A1 WO 2019038368 A1 WO2019038368 A1 WO 2019038368A1 EP 2018072750 W EP2018072750 W EP 2018072750W WO 2019038368 A1 WO2019038368 A1 WO 2019038368A1
Authority
WO
WIPO (PCT)
Prior art keywords
cells
cell
car
seq
domain
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2018/072750
Other languages
English (en)
French (fr)
Inventor
Uta HÖPKEN
Armin REHM
Julia BLUHM
Wolfgang Uckert
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Humboldt Universitaet zu Berlin
Max Delbrueck Centrum fuer Molekulare in der Helmholtz Gemeinschaft
Original Assignee
Humboldt Universitaet zu Berlin
Max Delbrueck Centrum fuer Molekulare in der Helmholtz Gemeinschaft
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to EP18759305.8A priority Critical patent/EP3672989A1/en
Priority to US16/641,181 priority patent/US11643468B2/en
Priority to CA3072859A priority patent/CA3072859A1/en
Priority to JP2020511383A priority patent/JP7395465B2/ja
Priority to SG11202001011XA priority patent/SG11202001011XA/en
Priority to KR1020207008094A priority patent/KR102804751B1/ko
Application filed by Humboldt Universitaet zu Berlin, Max Delbrueck Centrum fuer Molekulare in der Helmholtz Gemeinschaft filed Critical Humboldt Universitaet zu Berlin
Priority to CN201880056053.1A priority patent/CN111094349B/zh
Priority to AU2018321134A priority patent/AU2018321134B2/en
Publication of WO2019038368A1 publication Critical patent/WO2019038368A1/en
Anticipated expiration legal-status Critical
Priority to AU2025204455A priority patent/AU2025204455A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2866Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/11T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/31Chimeric antigen receptors [CAR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/421Immunoglobulin superfamily
    • A61K40/4211CD19 or B4
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/4214Receptors for cytokines
    • A61K40/4219Receptors for chemokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/7051T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70517CD8
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70521CD28, CD152
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70578NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0636T lymphocytes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0646Natural killers cells [NK], NKT cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • A61K2039/507Comprising a combination of two or more separate antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/31Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the route of administration
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/38Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/46Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
    • A61K2239/48Blood cells, e.g. leukemia or lymphoma
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/33Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/70Fusion polypeptide containing domain for protein-protein interaction
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00Genetically modified cells

Definitions

  • the invention relates to an isolated chimeric antigen receptor polypeptide (CAR), wherein the CAR comprises an extracellular antigen-binding domain, comprising an antibody or antibody fragment that binds a CXC chemokine receptor type 5 (CXCR5) protein.
  • CAR CXC chemokine receptor type 5
  • the invention further relates to a nucleic acid molecule encoding the CAR of the invention, a genetically modified immune cell, preferably a T cell, expressing the CAR of the invention and the use of said cell in the treatment of a medical disorder associated with the presence of pathogenic cells expressing CXCR5, preferably pathogenic mature B cells and/or memory B cells, and/or pathogenic T cells and/or T follicular helper cells, in particular mature B cell non-Hodgkin's lymphoma (B-NHL), T cell non-Hodgkin's lymphoma, or autoantibody-dependent autoimmune disease, preferably selected from systemic lupus
  • SLE erythematosus
  • rheumatoid arthritis erythematosus
  • B-NHLs are heterogenous and can be distinguished by an aggressive and indolent course.
  • the standard of care is typically combined antibody/chemotherapy, either alone or in combination with autologous stem cell transplantation, immunomodulatory drugs, irradiation, proteasome inhibitors, signaling pathway inhibitors, and for very few patients allogeneic stem cell transplantation applies.
  • immunomodulatory drugs irradiation, proteasome inhibitors, signaling pathway inhibitors, and for very few patients allogeneic stem cell transplantation applies.
  • irradiation irradiation
  • proteasome inhibitors irradiation
  • signaling pathway inhibitors for very few patients allogeneic stem cell transplantation applies.
  • co-morbidities also exist that preclude intense and extended chemotherapies or even allogeneic bone marrow transplantations.
  • BCR B cell receptor
  • CD 19 CAR-T cell therapies targeted at the broadly expressed CD 19 antigen on leukemia and lymphoma B cells has brought about substantial clinical efficacy and currently, more than 40 CD 19 CAR-T cell studies are registered at the FDA for the treatment of B- NHL and B-ALL (www-clinicaltrials.gov).
  • B- NHL and B-ALL www-clinicaltrials.gov.
  • anti-CD19 antibody or CAR-T cell therapies directed against B-NHL resistance can occur due to antigen loss.
  • escape variants emerged that resulted from the selection for alternatively spliced CD 19 isoforms and thus, loss of the cognate CD 19 CAR epitope.
  • CXCR5 emerges as an alternative target for immunotherapy of B-cell lymphomas besides existing therapeutic mAbs or CAR-T cell therapies.
  • B cell derived lymphoproliferative disorders with distinctive nodal lodging such as acute
  • B-ALL lymphoblastic leukemia
  • CLL chronic lymphocytic leukemia
  • FL follicular lymphoma
  • MCL mantle cell lymphoma
  • DLBCL diffuse large B-cell lymphoma
  • CXCR5 is physiologically expressed on mature recirculating B cells and on a small subset of CD4+ T cells, the follicular T-helper cells (Tfh) and regulates their homeostatic trafficking and homing to B-cell follicles within secondary lymphoid organs.
  • Tfh follicular T-helper cells
  • CXCR5 is not expressed on B cell precursors within the bone marrow (BM), neither do plasma cells express this receptor.
  • anti-CD19 CAR constructs standard therapies such as cytotoxic chemotherapies, corticosteroids, immunomodulators like IMIDs, proteasome inhibitors, autologous stem cell transplantation, allogeneic stem cell transplantation, signaling inhibitors, and antibodies directed against CD20, Rituximab, and anti-CD19, Oletuzumab and with bispecific antibodies (BITE), comprised of an Fab fragment targeting CD19 and an anti-CD3 fragment (Blinatumomab).
  • standard therapies such as cytotoxic chemotherapies, corticosteroids, immunomodulators like IMIDs, proteasome inhibitors, autologous stem cell transplantation, allogeneic stem cell transplantation, signaling inhibitors, and antibodies directed against CD20, Rituximab, and anti-CD19, Oletuzumab and with bispecific antibodies (BITE), comprised of an Fab fragment targeting CD19 and an anti-CD3 fragment (Blinatumomab).
  • the technical problem underlying the invention was the provision of an agent suitable for treating diseases associated with pathogenic B cells and/or T cells, in particular non- Hodgkin's lymphoma or autoantibody-dependent autoimmune diseases.
  • the invention relates to a chimeric antigen receptor polypeptide (CAR), comprising:
  • an extracellular antigen-binding domain comprising an antibody or antibody fragment that binds CXC chemokine receptor type 5 (CXCR5) protein,
  • the present invention therefore relates to an anti-CXCR5 CAR construct and corresponding immune cells expressing said construct, preferably a CAR-T cell product that confers human T cells with a high cytotoxic activity against defined, mature B-NHLs, while sparing normal hematopoietic cells such as T cells (except for Tfh or other T cell lymphomas described herein), plasma B cells and their bone marrow precursors.
  • a CAR-T cell product that confers human T cells with a high cytotoxic activity against defined, mature B-NHLs, while sparing normal hematopoietic cells such as T cells (except for Tfh or other T cell lymphomas described herein), plasma B cells and their bone marrow precursors.
  • all myeloid cells and NK cells are likewise spared; as the CAR-T cell product of the present invention shows no activity against these cells.
  • patient-derived T cells are transduced, preferably retrovirally, to express an artificial immune receptor as described herein, composed of an extracellular antibody-derived antigen recognition part, fused to a transmembrane section, and followed by intracellular signaling domains.
  • an artificial immune receptor as described herein, composed of an extracellular antibody-derived antigen recognition part, fused to a transmembrane section, and followed by intracellular signaling domains.
  • the construct described herein therefore confers transduced T cells with anti-tumor cytolytic capacity.
  • T cells Due to the preferred autologous transfer of T cells, a graft-versus-host-disease cannot occur upon treatment with the CAR-Ts of the present invention. Memory T cell formation, which is important for the prevention of a relapse, can develop.
  • Such mature B-NHL entities include, but are not limited to, certain stages of follicular lymphoma, diffuse large B-cell lymphoma, mantle cell lymphoma, and chronic lymphocytic leukemia.
  • the anti-CXCR5 CAR-T cells will enable targeting of the tumor cells in the tumor microenvironment, because lymphoma growth-promoting Tfh cells will be eradicated concomitantly.
  • Tumor cells within a given tumor entity are homogenously positive for the target antigen CXCR5, thus precluding unwanted positive selection of low/non-expressing tumor cells.
  • the CAR is applicable for salvage therapies even after progressive disease and multiple lines of other standard of care therapies have failed
  • the anti-CXCR5 CAR described herein confers high avidity to T cells, necessary for anti-tumor efficacy. It has been demonstrated that the anti-CXCR5 CAR of the present invention does not confer T cell-reactivity against physiological plasma B cells, T cells (except for Tfh cells and specific pathological CXCR5-expressing T-cells), NK cells, all myeloid cell lineages and their precursors. Thus, the present invention has an unprecedented low off-target reactivity on other hematopoietic tissues.
  • the anti-CXCR5 CAR of the present invention has no unwanted reactivity against immature B-NHLs, precursor B-cell neoplasia or physiological benign B- cell precursors.
  • anti-CXCR5 CAR-T cells become activated upon exposure to CXCR5-expressing human B-NHL tumor cell lines. These T cells then develop an effector phenotype with high level secretion of IFN-gamma, a phenotype that is predictive of a cytotoxic activity. Additionally, a cytotoxicity assay (51 Cr-release) against selected target cell lines, B-NHL, B and T cell leukemia, CXCR5-negative cells and CXCR5-transfectants, shows that selective cellular cytotoxicity is obtained only in cell lines positive for CXCR5.
  • Additional pre-clinical testing encompasses i) in vitro cytotoxicity testing against suitable B-NHL cell lines from patients, and ii) in vivo testing of anti-CXCR5 CAR activity against xenotransplanted B- NHL cell lines.
  • the CAR of the present invention represents a surprising and beneficial approach towards the treatment of the medical conditions described herein.
  • the employment of anti-CXCR5 CARs has not been previously attempted or described as a promising approach towards treating NHL.
  • the minimal (if not non-existent) unwanted side effects, due to the selectivity of the marker also represent a beneficial and surprising aspect of the present invention.
  • the present invention represents a very promising approach towards eradication of malignancies.
  • the invention relates to a chimeric antigen receptor (CAR) polypeptide as described herein, wherein when said CAR is expressed in a genetically modified immune cell, preferably a T lymphocyte, said immune cell binds CXCR5 on the surface of a CXCR5-expressing cell and is activated, thereby inducing cytotoxic activity against said CXCR5-expressing cell.
  • a genetically modified immune cell preferably a T lymphocyte
  • the invention relates to a chimeric antigen receptor polypeptide (CAR), comprising:
  • an extracellular antigen-binding domain comprising an antibody or antibody fragment that binds CXC chemokine receptor type 5 (CXCR5) protein, wherein said antibody or antibody fragment comprises VH and VL domains of a single chain antibody fragment, wherein preferably a linker polypeptide is positioned between the VH and VL domains, wherein said linker is preferably configured to not interfere with the antibody fragment-CXCR5 antigen interaction;
  • CXCR5 CXC chemokine receptor type 5
  • spacer polypeptide also referred to as a hinge
  • said spacer polypeptide is preferably configured to not interfere with the antibody fragment-CXCR5 antigen interaction and/or with T cell activation when said CAR is expressed in a T cell expressing said CAR
  • transmembrane domain wherein said transmembrane domain is preferably configured to not interfere with the antibody fragment-CXCR5 antigen interaction and/or with T cell activation when said CAR is expressed in a T cell expressing said CAR
  • said intracellular domain comprises a co-stimulatory domain and a signalling domain, wherein said intracellular domain is preferably configured to provide signals to stimulate T cell activation upon binding to the CXCR5 target, for example by increasing cytokine production and/or facilitating T cell replication, thus leading to cytotoxic effect.
  • the CAR of the present invention may therefore employ various formats, comprising potentially different protein sequences for each of the functional domains described herein.
  • a skilled person is capable of selecting and testing the desired function of the CARs, for example based on the experimental approaches demonstrated in the examples below.
  • the election of any given specific protein sequence to be used in the CAR of the invention, in any of the functional domains discussed herein, can be assessed by a skilled person using routine methods for functional efficacy.
  • various linker polypeptide sequences positioned between the VH and VL domains may be employed.
  • various spacer polypeptide sequences also referred to as a hinge
  • various transmembrane domains and various intracellular domains may be employed.
  • the CAR, and each of the elements or domains mentioned herein are configured to not detrimentally interfere with the antibody fragment-CXCR5 antigen interaction, to not detrimentally interfere with T cell activation when said CAR is expressed in a T cell expressing said CAR, and to not detrimentally interfere with the CAR providing signals to stimulate T cell activation upon binding to the CXCR5 target.
  • the present invention relates to the first described CXCR5 CAR, and first functional evidence of a desired therapeutic effect of a CXCR5 CAR in a medical setting.
  • the provision of a CXCR5 CAR independent of the particular sequences employed in the various functional domains described herein, represents a significant and beneficial breakthrough in treating the many diseases associated with pathogenic mature B cells and/or memory B cells, and/or pathogenic T cells and/or T follicular helper cells.
  • H-CDR1 heavy chain complementary determining region 1 with at least 80% sequence identity to SEQ ID NO 1 (GFTFSTSG),
  • VL variable light chain
  • L-CDR1 light chain complementary determining region 1 with at least 80% sequence identity to SEQ ID NO 4 (KSRLSRMGITP),
  • L-CDR2 light chain complementary determining region 2
  • RMS SEQ ID NO 5
  • the amino acid sequence of the scFV fragment was obtained originally from a rat-anti-human CXCR5 antibody and has been modified with respect to multiple improvements, for example by humanization of the VL and VH chains, in order to allow folding and expression in the context of a transmembrane receptor structure.
  • the order of the light and heavy chain fragments may be inverted upon the desired configuration of the antigen binding fragment.
  • linker sequence between heavy and light chains has been modified, for example by shortening, in order to enhance the CAR function.
  • nucleic acid sequence encoding the CAR has been codon-optimized in order to improve expression of the CAR.
  • the anti-CXCR5 CAR-T cell product described herein is characterised by unique properties.
  • the anti-CXCR5 CAR as described herein has a high affinity and confers high specificity and avidity to T cells. These properties enable CAR-T cells to i) recognize, ii) be activated against, and iii) kill tumor target cells with high and low CXCR5 surface expression.
  • the VH and VL fragments described herein may be arranged in multiple configurations in the CAR and still maintain high specificity and high affinity for the target epitope.
  • the CAR may be configured in the VH-VL or VL-VH configuration, with variation in the linker, hinge, transmembrane domain, co-stimulatory domain and/or activation domains, and still maintain its efficacy.
  • sequences below also encompass generalized sequences representing both rat and humanized forms of the antigen-binding domains.
  • each X represents a potential amino acid change. Preferred amino acid substitutions are those described for each of the potentially altered positions.
  • the invention relates to a chimeric antigen receptor (CAR) polypeptide as described herein, comprising a VH domain with at least 70%, 80% sequence identity, preferably at least 85%, 90%, 95% or with 100% sequence identity, to SEQ ID NO 7:
  • CAR chimeric antigen receptor
  • X1-X12 may be any amino acid, preferably X1 : G or K, X2: R or K; X3: A or S; X4: N or H; X5: E or D; X6: S or A; X7: S or A; X8: S or T; X9: M or L; X10: R or K, X1 1 : A or S; X12: V or I;
  • VL domain with at least 80% sequence identity, preferably at least 85%, 90%, 95% or with 100% sequence identity, to SEQ ID NO 8:
  • X1-X7 may be any amino acid, preferably X1 : S or A; X2: L or V; X3: P or S; X4: S or N; X5: Q or K; X6: R or L; X7: G or E.
  • sequence variants with 80% or more sequence identity to the specific VH and VL sequences listed herein maintain CXCR5 binding with essentially the same or similar functional properties as VH and VL domains with the specific sequences recited herein, i.e. the CXCR5 binding is essentially the same or similar with respect to affinity, specificity and epitope binding mode.
  • the invention relates to a chimeric antigen receptor (CAR) polypeptide as described herein, comprising
  • the invention relates to a chimeric antigen receptor (CAR) polypeptide that comprises one or more linker, spacer, transmembrane, and signaling domains.
  • the CAR comprises an intracellular domain, which comprises a co-stimulatory domain and a signalling (activation) domain.
  • the invention relates to a chimeric antigen receptor (CAR) polypeptide as described herein, wherein the extracellular antigen-binding domain comprises a linker polypeptide positioned between the VH and VL domains, wherein said linker is preferably selected from
  • the invention relates to a chimeric antigen receptor (CAR) polypeptide as described herein, wherein the transmembrane domain is selected from:
  • CD8a domain SEQ ID NO 20; IYIWAPLAGTCGVLLLSLVITLYC
  • CD28 domain SEQ ID NO 21 ; FWVLVVVGGVLACYSLLVTVAFIIFWV, or
  • the invention relates to a chimeric antigen receptor (CAR) polypeptide as described herein, wherein the intracellular domain comprises:
  • a co-stimulatory domain selected from a 4-1 BB co-stimulatory domain (SEQ ID NO 22; KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL), and/or
  • a co-stimulatory domain comprising both a 4-1 BB (SEQ ID NO 22) and a CD28 co- stimulatory domain (SEQ ID NO 23) arranged adjacently, or
  • a co-stimulatory domain with at least 80% sequence identity to SEQ ID NO 22 or 23.
  • the invention relates to a chimeric antigen receptor (CAR) polypeptide as described herein, comprising additionally a signaling domain (otherwise known as an activation domain), wherein said signaling domain is
  • CD3zeta (4-1 BB or CD28) signaling domain (SEQ ID NO 24;
  • the invention relates to a chimeric antigen receptor (CAR) polypeptide as described herein, comprising a sequence according to any one of SEQ ID NO 25, 26, 27, 28 or 29.
  • CAR chimeric antigen receptor
  • the exchange of signaling domains meets the demands for either a strong and rapid effector phase (CD28 co-stimulatory domain), or a long-lasting relapse control as secured by a T cell memory population (4-1 BB signaling domain).
  • the various signaling domains may be exchanged in multiple configuration, providing a CAR with flexibility with respect to its design without loss of the advantageous binding properties.
  • an unusually high transduction rate for human T cells can be achieved.
  • the transduction system is variable due to a modular design of the CAR construct, meaning that lentiviruses as well as transposons can be employed, depending on the needs and preferences of the skilled person when carrying out the invention.
  • Transfer of the genetic information/nucleic acid molecule for the CXCR5 CAR also includes CrispR/Cas and TALEN mediated insertion into target cell lines, preferably T lymphocytes, Natural Killer Cells, and induced pluripotent stem cells, iPS.
  • All suitable methods for transferring the genetic information/nucleic acid molecule for the CXCR5 CAR into the cell expressing said CAR are encompassed by the present invention, and a suitable method may be selected by a skilled person when carrying out the invention.
  • a suitable method may be selected by a skilled person when carrying out the invention.
  • multiple methods of transforming T cells are known in the art, including any given viral-based gene transfer method, such as those based on modified Retroviridae, and non-viral methods such as DNA-based transposons and direct transfer of mRNA by electroporation.
  • the signaling components of the CAR construct have been exchanged in a three step cloning procedure that allows for a modular composition, and tailor-made construction by a skilled person, of clinically applicable anti-CXCR5 CARs.
  • the invention relates to an isolated nucleic acid molecule, preferably in the form of a vector, such as a viral vector or a transposon vector, preferably a sleeping beauty vector, selected from the group consisting of:
  • nucleic acid molecule comprising a nucleotide sequence
  • CAR chimeric antigen receptor
  • nucleic acid molecule comprising a nucleotide sequence having sufficient sequence
  • nucleotide sequence according to a) or b comprising preferably a sequence identity to a nucleotide sequence according to a) or b) of at least 80%;
  • nucleic acid molecule which, as a consequence of the genetic code, is degenerate to a nucleotide sequence according to a) through c);
  • nucleic acid molecule comprising a nucleotide sequence
  • CAR chimeric antigen receptor
  • nucleotide sequence according to a) or b comprising a sequence identity to a nucleotide sequence according to a) or b) of at least 80%, preferably 90%, or 95% sequence identity to a nucleotide sequence according to a) or b), wherein functional analogy relates to binding CXCR5 target antigen, and when corresponding T cells express said construct, the CAR-T cell product confers T cells with a cytotoxic activity against mature B-NHLs, while sparing normal hematopoietic cells such as T cells (except for Tfh or other T cell lymphomas described herein), plasma B cells and their bone marrow precursors; and/or
  • d) a nucleic acid molecule which, as a consequence of the genetic code, is degenerate to a nucleotide sequence according to a) through c).
  • GLX5WVX6YISSSSGFVYADX7VKGRFTISRDNAQNX8LYLQX9NSLX1 "generalized" 0X11 EDTAX12YYCARSEAAFWGQGTLVTVSS encompassing both rat and humanized sequences wherein X1 : G OR K, X2: R OR K; X3: A OR S; X4: N OR H; X5: E OR
  • CARSEAAFWGQGTLVTVSS encompassing both rat and humanized wherein X is any amino acid, preferably those above.
  • YCAQFLEYPPTFGSGTKLEIK encompassing both rat and humanized wherein X1 : S or A; X2: L or V; X3: P or S; X4: S or N; X5: Q or K; X6: R
  • a further aspect of the invention relates to a vector comprising a nucleic acid molecule as described herein, preferably a viral vector, more preferably a gamma retroviral vector.
  • the invention relates to a transposon vector, preferably a sleeping beauty vector, encoding and preferably capable of expressing the inventive CAR.
  • a further aspect of the invention relates to a genetically modified immune cell comprising a nucleic acid molecule or vector as described herein, and/or expressing a CAR as described herein.
  • the immune cells intended for administering in treatment of the diseases mentioned herein are genetically modified with a nucleic acid as described herein, encoding and expressing the anti-CXCR5 CAR as described herein, using a "Sleeping beauty" transposon system, in particular a sleeping beauty transposase.
  • the Sleeping Beauty transposon system is a synthetic DNA transposon designed to introduce precisely defined DNA sequences into the chromosomes of vertebrate animals, in the context of the present invention for the purposes of modifying immune cells to express the CAR as described herein.
  • the sleeping beauty transposons combine the advantages of viruses and naked DNA. Viruses have been evolutionarily selected based on their abilities to infect and replicate in new host cells.
  • CrispR/Cas and TALEN-mediated insertion of the CXCR5 CAR encoding nucleic acid may be employed.
  • CrispR/Cas known to a skilled person, which is adapted from a naturally occurring process in bacteria, may be employed to precisely and efficiently edit DNA to insert the appropriate coding sequences into the immune cell, preferably T cell, of interest.
  • Cas9 a protein that acts as a molecular pair of scissors, is guided to a specific DNA sequence by an associated RNA molecule (a guide RNA).
  • a guide RNA RNA
  • CRISPR/Cas9 can deliver the CAR gene to a very specific site within the T cell genome, which may reduce the risk of gene insertion at incorrect or undesired locations.
  • the immune cell is preferably selected from the group consisting of a T lymphocyte or an NK cell, more preferably cytotoxic T lymphocytes.
  • the genetically modified immune cell comprising a nucleic acid molecule or vector as described herein, and/or expressing a CAR as described herein, is characterised in that it is CD4+ and/or CD8+ T cell, preferably a mixture of CD4+ and CD8+ T cells.
  • CD4+ and/or CD8+ T cell preferably a mixture of CD4+ and CD8+ T cells.
  • These T cell populations, and preferably the composition comprising both CD4+ and CD8+ transformed cells show particularly effective cytolytic activity against various malignant B cells, such as B-NHL, preferably against those cells and/or the associated medical conditions described herein.
  • the genetically modified immune cells comprising a nucleic acid molecule or vector as described herein, and/or expressing a CAR as described herein, are CD4+ and CD8+ T cells, preferably in a ration of 1 : 10 to 10:1 , more preferably in a ratio of 5: 1 to 1 :5, 2: 1 to 1 :2 or 1 : 1.
  • An additional and surprising aspect of the invention is an improved stability of the CAR as disclosed herein.
  • the CAR polypeptide can readily be stored for extended periods under appropriate conditions without any loss of binding affinity.
  • a further aspect of the invention relates to a genetically modified immune cell as described herein for use in the treatment of a medical disorder associated with the presence of pathogenic cells expressing CXCR5.
  • the medical disorder to be treated is associated with the presence of pathogenic mature B cells and/or memory B cells.
  • the medical disorder to be treated is mature B cell non-Hodgkin's lymphoma (B- NHL).
  • the medical disorder to be treated is a B cell derived lymphoproliferative disorder, selected preferably from the group consisting of acute lymphoblastic leukemia (B-ALL), chronic lymphocytic leukemia (CLL), follicular lymphoma (FL), mantle cell lymphoma (MCL) and diffuse large B cell lymphoma (DLBCL).
  • B-ALL acute lymphoblastic leukemia
  • CLL chronic lymphocytic leukemia
  • FL follicular lymphoma
  • MCL mantle cell lymphoma
  • DLBCL diffuse large B cell lymphoma
  • the medical disorder to be treated is associated with the presence of pathogenic T cells and/or T follicular helper cells.
  • the medical disorder to be treated is a T cell non-Hodgkin's lymphoma, with or without a leukemic tumor cell dissemination.
  • the medical disorder to be treated is a T cell derived lymphoproliferative disorder, selected preferably from the group consisting of angioimmunoblastic T cell lymphoma, cutaneous T cell lymphoma and T cell lymphoma with a leukemic dissemination.
  • a further aspect of the invention relates to a genetically modified immune cell as described herein expressing the inventive CAR for use as a medicament in the treatment of an autoantibody- dependent autoimmune disease.
  • the autoimmune disease is selected from systemic lupus erythematosus (SLE) or rheumatoid arthritis.
  • SLE systemic lupus erythematosus
  • rheumatoid arthritis rheumatoid arthritis
  • CAR-T cells have also been discussed as a targeted approach to treat autoantibody- mediated diseases (Ellebrecht et al. (2016) Science 353:179-184).
  • the ability to target CXCR5 would inhibit co-localization of autoreactive B cells and Tfh cells, which would be of great benefit for the treatment of autoimmune diseases.
  • autoimmune disease Mild forms of autoimmune disease are usually initially treated with nonsteroidal anti-inflammatory drugs (NSAID) or disease-modifying anti-rheumatic drugs (DMARD). More severe forms of rheumatoid arthritis (RA) and systemic lupus erythematosus (SLE), involving organ dysfunction due to active disease, usually are treated with steroids in conjunction with strong immunosuppressive agents such as cyclophosphamide, a cytotoxic agent that targets cycling cells.
  • cyclophosphamide a cytotoxic agent that targets cycling cells.
  • FDA Food and Drug Administration
  • TNF inhibitors were the first licensed biological agents, followed by abatacept, rituximab, and tocilizumab and others: they suppress key inflammatory pathways involved in joint inflammation and destruction, which, however, comes at the price of an elevated infection risk due to relative immunosuppression (Chan et al. (2010) Nat Rev Immunol 10:301-316, Keyser (201 1 ) Curr Rheumatol Rev 7:77-87).
  • Rituximab a monoclonal antibody that depletes B cells from the circulation, in particular has increasingly been prescribed for the treatment of RA but also for granulomatosis with polyangiitis and other antineutrophil cytoplasmic antibody-associated vasculitides. But rituximab is not without risks and carries a similar adverse event risk rate as cyclophosphamide (Shah et al. (2015)
  • a chimeric antigen receptor polypeptide comprises an extracellular antigen-binding domain, comprising an antibody or antibody fragment that binds a target antigen, a transmembrane domain, and an intracellular domain.
  • CARs are typically described as comprising an extracellular ectodomain (antigen-binding domain) derived from an antibody and an endodomain comprising signaling modules derived from T cell signaling proteins.
  • the ectodomain preferably comprises variable regions from the heavy and light chains of an immunoglobulin configured as a single-chain variable fragment (scFv).
  • the scFv is preferably attached to a hinge region that provides flexibility and transduces signals through an anchoring transmembrane moiety to an intracellular signaling domain.
  • the transmembrane domains originate preferably from either CD8a or CD28.
  • the signaling domain consists of the zeta chain of the TCR complex.
  • generation refers to the structure of the intracellular signaling domains.
  • Second generation CARs are equipped with a single costimulatory domain originated from CD28 or 4-1 BB.
  • Third generation CARs already include two costimulatory domains, e.g. CD28, 4-1 BB, ICOS or OX40, CD3 zeta.
  • the present invention preferably relates to a second or third generation CAR.
  • CARs genetically engineered receptors that redirect cytotoxicity of immune effector cells toward B cells. These genetically engineered receptors referred to herein as chimeric antigen receptors (CARs).
  • CARs are molecules that combine antibody-based specificity for a desired antigen (e.g., CXCR5) with a T cell receptor-activating intracellular domain to generate a chimeric protein that exhibits a specific anti-CXCR5 cellular immune activity.
  • a desired antigen e.g., CXCR5
  • T cell receptor-activating intracellular domain e.g., T cell receptor-activating intracellular domain
  • chimeric describes being composed of parts of different proteins or DNAs from different origins.
  • CARs contemplated herein comprise an extracellular domain (also referred to as a binding domain or antigen-binding domain) that binds to CXCR5, a transmembrane domain, and an intracellular domain, or intracellular signaling domain.
  • an extracellular domain also referred to as a binding domain or antigen-binding domain
  • CXCR5 a transmembrane domain
  • intracellular domain or intracellular signaling domain.
  • CARs The main characteristic of CARs are their ability to redirect immune effector cell specificity, thereby triggering proliferation, cytokine production, phagocytosis or production of molecules that can mediate cell death of the target antigen expressing cell in a major histocompatibility complex (MHC) independent manner, exploiting the cell specific targeting abilities of monoclonal antibodies, soluble ligands or cell specific co-receptors.
  • MHC major histocompatibility complex
  • a CAR comprises an extracellular binding domain that comprises a humanized CXCR5-specific binding domain; a transmembrane domain; one or more intracellular signaling domains.
  • a CAR comprises an extracellular binding domain that comprises a humanized anti-CXCR5 antigen binding fragment thereof; one or more spacer domains; a transmembrane domain; one or more intracellular signaling domains.
  • extracellular antigen-binding domain or "extracellular binding domain” are used
  • the binding domain may be derived either from a natural, synthetic, semisynthetic, or recombinant source. Preferred are scFv domains.
  • Specific binding is to be understood as via one skilled in the art, whereby the skilled person is clearly aware of various experimental procedures that can be used to test binding and binding specificity. Methods for determining equilibrium association or equilibrium dissociation constants are known in the art. Some cross-reaction or background binding may be inevitable in many protein- protein interactions; this is not to detract from the "specificity" of the binding between CAR and epitope.
  • Specific binding describes binding of an anti-CXCR5 antibody or antigen binding fragment thereof (or a CAR comprising the same) to CXCR5 at greater binding affinity than background binding. The term “directed against” is also applicable when considering the term “specificity” in understanding the interaction between antibody and epitope.
  • an “antigen (Ag)” refers to a compound, composition, or substance that can stimulate the production of antibodies or a T cell response in an animal.
  • the target antigen is an epitope of a CXCR5 polypeptide.
  • An “epitope” refers to the region of an antigen to which a binding agent binds. Epitopes can be formed both from contiguous amino acids or noncontiguous amino acids juxtaposed by tertiary folding of a protein.
  • Single-chain Fv or “scFv” antibody fragments comprise the VH and VL domains of an antibody, wherein these domains are present in a single polypeptide chain and in either orientation ⁇ e.g., VL- VH or VH-VL).
  • the scFv polypeptide further comprises a polypeptide linker between the VH and VL domains which enables the scFv to form the desired structure for antigen binding.
  • a CAR contemplated herein comprises antigen-specific binding domain that is an scFv and may be a murine, human or humanized scFv.
  • Single chain antibodies may be cloned from the V region genes of a hybridoma specific for a desired target.
  • the antigen-specific binding domain that is a humanized scFv that binds a human CXCR5 polypeptide is a humanized scFv that binds a human CXCR5 polypeptide.
  • An illustrative example of a variable heavy chain that is suitable for constructing anti-CXCR5 CARs contemplated herein include, but are not limited to the amino acid sequence set forth in SEQ ID NO: 9.
  • An illustrative example of a variable light chain that is suitable for constructing anti-CXCR5 CARs contemplated herein include, but is not limited to the amino acid sequence set forth in SEQ ID NO: 1 1.
  • mini-antibodies and multivalent antibodies such as diabodies, triabodies, tetravalent antibodies and peptabodies can be used in a method of the invention.
  • the immunoglobulin molecules of the invention can be of any class (i.e. IgG, IgE, IgM, IgD and IgA) or subclass of immunoglobulin molecules.
  • the term antibody, as used herein also includes antibodies and antibody fragments comprised by the CAR of the invention, either produced by the modification of whole antibodies or synthesized de novo using recombinant DNA methodologies.
  • an “antibody” generally refers to a protein consisting of one or more polypeptides substantially encoded by immunoglobulin genes or fragments of immunoglobulin genes. Where the term “antibody” is used, the term “antibody fragment” may also be considered to be referred to.
  • the recognized immunoglobulin genes include the kappa, lambda, alpha, gamma, delta, epsilon and mu constant region genes, as well as the myriad immunoglobulin variable region genes. Light chains are classified as either kappa or lambda.
  • the CARs of the invention are intended to bind against mammalian, in particular human, protein targets.
  • the use of protein names may correspond to either mouse or human versions of a protein.
  • binding domain polypeptides and CAR proteins can be readily determined using conventional techniques, e.g., by competitive ELISA (enzyme-linked immunosorbent assay), or by binding association, or displacement assays using labeled ligands, or using a surface-plasmon resonance device such as the Biacore.
  • Humanized antibodies comprising one or more CDRs of antibodies of the invention or one or more CDRs derived from said antibodies can be made using any methods known in the art. For example, four general steps may be used to humanize a monoclonal antibody. These are: (1 ) determining the nucleotide and predicted amino acid sequence of the starting antibody light and heavy variable domains (2) designing the humanized antibody, i.e., deciding which antibody framework region to use during the humanizing process (3) the actual humanizing methodologies/techniques and (4) the transfection and expression of the humanized antibody. See, for example, U.S. Pat. Nos. 4,816,567; 5,807,715; 5,866,692; 6,331 ,415; 5,530, 101 ; 5,693,761 ; 5,693,762; 5,585,089; 6, 180,370;
  • humanized antibodies refer also to forms of non-human (e.g. murine, camel, llama, shark) antibodies that are specific chimeric immunoglobulins, immunoglobulin chains, or fragments thereof (such as Fv, Fab, Fab', F(ab')2 or other antigen-binding subsequences of antibodies) that contain minimal sequence derived from non-human immunoglobulin.
  • non-human e.g. murine, camel, llama, shark
  • fragments thereof such as Fv, Fab, Fab', F(ab')2 or other antigen-binding subsequences of antibodies
  • human or humanized antibody or antibody fragment means an antibody having an amino acid sequence corresponding to that of an antibody produced by a human and/or has been made using any of the techniques for making human antibodies known in the art or disclosed herein.
  • Human antibodies or fragments thereof can be selected by competitive binding experiments, or otherwise, to have the same epitope specificity as a particular mouse antibody.
  • the humanized antibodies of the present invention surprisingly share the useful functional properties of the mouse antibodies to a large extent.
  • Human polyclonal antibodies can also be provided in the form of serum from humans immunized with an immunogenic agent.
  • such polyclonal antibodies can be concentrated by affinity purification using amyloid fibrillar and/or non-fibrillar polypeptides or fragments thereof as an affinity reagent.
  • Monoclonal antibodies can be obtained from serum according to the technique described in WO 99/60846.
  • variable region of an antibody refers to the variable region of the antibody light chain or the variable region of the antibody heavy chain, either alone or in combination.
  • the variable regions of the heavy and light chain each consist of four framework regions (FR) connected by three complementarity determining regions (CDRs) also known as hypervariable regions.
  • FR framework regions
  • CDRs complementarity determining regions
  • the CDRs in each chain are held together in close proximity by the FRs and, with the CDRs from the other chain, contribute to the formation of the antigen-binding site of antibodies.
  • a CDR may refer to CDRs defined by one or more approach, or by a combination of these approaches.
  • the invention provides an antibody or fragment thereof incorporated into a CAR, wherein said antibody or fragment thereof comprises at least one CDR, at least two, at least three, or more CDRs that are substantially identical to at least one CDR, at least two, at least three, or more CDRs of the antibody of the invention.
  • Other embodiments include antibodies which have at least two, three, four, five, or six CDR(s) that are substantially identical to at least two, three, four, five or six CDRs of the antibodies of the invention or derived from the antibodies of the invention.
  • linkers include glycine polymers; glycine-serine polymers; glycine-alanine polymers; alanine-serine polymers; and other flexible linkers known in the art, such as the Whitlow linker.
  • Glycine and glycine-serine polymers are relatively unstructured, and therefore may be able to serve as a neutral tether between domains of fusion proteins such as the CARs described herein.
  • the binding domain of the CAR is followed by one or more "spacers" or "spacer polypeptides,” which refers to the region that moves the antigen binding domain away from the effector cell surface to enable proper cell/cell contact, antigen binding and activation.
  • the spacer domain comprises the CH2 and CH3 domains of lgG1 or lgG4.
  • the Fc-binding domain of such a spacer/hinge region is mutated in a manner that prevents binding of the CAR to Fc-receptors expressed on macrophages and other innate immune cells.
  • the binding domain of the CAR may in some embodiments be followed by one or more "hinge domains," which play a role in positioning the antigen binding domain away from the effector cell surface to enable proper cell/cell contact, antigen binding and activation.
  • a CAR may comprise one or more hinge domains between the binding domain and the transmembrane domain (TM).
  • the hinge domain may be derived either from a natural, synthetic, semi-synthetic, or recombinant source.
  • the hinge domain can include the amino acid sequence of a naturally occurring
  • hinge domains suitable for use in the CARs described herein include the hinge region derived from the extracellular regions of type 1 membrane proteins such as CD8 alpha, CD4, CD28, PD1 , CD 152, and CD7, which may be wild-type hinge regions from these molecules or may be altered.
  • the hinge domain comprises a PD1 , CD 152, or CD8 alpha hinge region.
  • the "transmembrane domain” is the portion of the CAR that fuses the extracellular binding portion and intracellular signaling domain and anchors the CAR to the plasma membrane of the immune effector cell.
  • the TM domain may be derived either from a natural, synthetic, semi-synthetic, or recombinant source.
  • the TM domain may be derived from the alpha, beta or zeta chain of the T-cell receptor, CD3s, ⁇ 3 ⁇ , CD4, CD5, CD8 alpha, CD9, CD 16, CD22, CD27, CD28, CD33, CD37, CD45, CD64, CD80, CD86, CD 134, CD 137, CD 152, CD 154, and PD1 .
  • the CARs contemplated herein comprise a TM domain derived from CD8 alpha or CD28
  • CARs contemplated herein comprise an intracellular signaling domain.
  • An "intracellular signaling domain,” refers to the part of a CAR that participates in transducing the message of effective anti-CXCR5 CAR binding to a human CXCR5 polypeptide into the interior of the immune effector cell to elicit effector cell function, e.g., activation, cytokine production, proliferation and cytotoxic activity, including the release of cytotoxic factors to the CAR-bound target cell, or other cellular responses elicited with antigen binding to the extracellular CAR domain.
  • effector function refers to a specialized function of an immune effector cell.
  • Effector function of the T cell may be cytolytic activity or help or activity including the secretion of a cytokine.
  • intracellular signaling domain refers to the portion of a protein which transduces the effector function signal and that directs the cell to perform a specialized function.
  • CARs contemplated herein comprise one or more co-stimulatory signaling domains to enhance the efficacy, expansion and/or memory formation of T cells expressing CAR receptors.
  • co-stimulatory signaling domain refers to an intracellular signaling domain of a co- stimulatory molecule. Co-stimulatory molecules are cell surface molecules other than antigen receptors or Fc receptors that provide a second signal required for efficient activation and function of T lymphocytes upon binding to antigen.
  • the CAR comprises an intracellular domain, which comprises a co-stimulatory domain and a signalling (activation) domain.
  • the CAR construct may therefore include an intracellular signaling domain (CD3 zeta) of the native T cell receptor complex and one or more co- stimulatory domains that provide a second signal to stimulate full T cell activation.
  • Co-stimulatory domains are thought to increase CAR T cell cytokine production and facilitate T cell replication and T cell persistence. Co-stimulatory domains have also been shown to potentially prevent CAR T cell exhaustion, increase T cell antitumor activity, and enhance survival of CAR T cells in patients.
  • CAR constructs with the 4-1 BB co-stimulatory domain have been associated with gradual, sustained expansion and effector function, increased persistence, and enriched central memory cells (TCM) in the T cell subset composition in preclinical studies.
  • 4-1 BB is a member of the tumor necrosis factor (TNF) superfamily, and it is an inducible glycoprotein receptor in vivo that is primarily expressed on antigen-activated CD4 and CD8 T cells.
  • CD28 is member of the immunoglobulin (Ig) superfamily. It is constitutively expressed on resting and activated CD4 and CD8 T cells and plays a critical role in T cell activation by stimulating the PI3K- AKT signal transduction pathway.
  • the intracellular domain comprises both 4- 1 BB and CD28 co-stimulatory domains.
  • Other co-stimulatory domains comprise ICOS and OX40 that can be combined with the CD3 zeta signaling (activation) domain.
  • Polypeptide polypeptide
  • polypeptide fragment protein
  • protein protein
  • Polypeptides are not limited to a specific length, e.g., they may comprise a full length protein sequence or a fragment of a full length protein, and may include post-translational modifications of the polypeptide, for example, glycosylations, acetylations, phosphorylations and the like, as well as other modifications known in the art, both naturally occurring and non-naturally occurring.
  • the CAR polypeptides contemplated herein comprise a signal (or leader) sequence at the N-terminal end of the protein, which co-translationally or post-translationally directs transfer of the protein.
  • Polypeptides can be prepared using any of a variety of well-known recombinant and/or synthetic techniques. Polypeptides contemplated herein specifically encompass the CARs of the present disclosure, or sequences that have deletions from, additions to, and/or substitutions of one or more amino acid of a CAR as disclosed herein.
  • polynucleotide or “nucleic acid molecule” refers to messenger RNA (mRNA), RNA, genomic RNA (gRNA), plus strand RNA (RNA(+)), minus strand RNA (RNA(-)), genomic DNA (gDNA), complementary DNA (cDNA) or recombinant DNA.
  • Polynucleotides include single and double stranded polynucleotides.
  • polynucleotides of the invention include polynucleotides or variants having at least about 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100%) sequence identity to any of the reference sequences described herein, typically where the variant maintains at least one biological activity of the reference sequence.
  • the present invention contemplates, in part, polynucleotides comprising expression vectors, viral vectors, and transfer plasmids, and
  • compositions, and cells comprising the same.
  • Polynucleotides can be prepared, manipulated and/or expressed using any of a variety of well-established techniques known and available in the art.
  • a nucleotide sequence encoding the polypeptide can be inserted into appropriate vector.
  • vectors are plasmid, autonomously replicating sequences, and transposable elements.
  • Additional exemplary vectors include, without limitation, plasmids, phagemids, cosmids, artificial chromosomes such as yeast artificial chromosome (YAC), bacterial artificial chromosome (BAC), or Pl-derived artificial chromosome (PAC), bacteriophages such as lambda phage or Ml 3 phage, and animal viruses.
  • control elements or “regulatory sequences” present in an expression vector are those non-translated regions of the vector - origin of replication, selection cassettes, promoters, enhancers, translation initiation signals (Shine Dalgarno sequence or Kozak sequence) introns, a polyadenylation sequence, 5' and 3' untranslated regions - which interact with host cellular proteins to carry out transcription and translation.
  • Such elements may vary in their strength and specificity.
  • any number of suitable transcription and translation elements including ubiquitous promoters and inducible promoters may be used.
  • a cell e.g., an immune effector cell, such as a T cell
  • a retroviral vector e.g., a lentiviral vector
  • an immune effector cell is transduced with a vector encoding a CAR that comprises a humanized anti-CXCR5 antibody or antigen binding fragment that binds a CXCR5 polypeptide, with a transmembrane and intracellular signaling domain, such that these transduced cells can elicit a CAR-mediated cytotoxic response.
  • Retroviruses are a common tool for gene delivery.
  • a retrovirus is used to deliver a polynucleotide encoding a chimeric antigen receptor (CAR) to a cell.
  • CAR chimeric antigen receptor
  • the term "retrovirus” refers to an RNA virus that reverse transcribes its genomic RNA into a linear double-stranded DNA copy and subsequently covalently integrates its genomic DNA into a host genome. Once the virus is integrated into the host genome, it is referred to as a "provirus.”
  • the provirus serves as a template for RNA polymerase II and directs the expression of RNA molecules which encode the structural proteins and enzymes needed to produce new viral particles.
  • retroviruses suitable for use in particular embodiments include, but are not limited to:
  • Moloney murine leukemia virus M-MuLV
  • Moloney murine sarcoma virus MoMSV
  • Harvey murine sarcoma virus HaMuSV
  • murine mammary tumor virus MuMTV
  • gibbon ape leukemia virus GaLV
  • feline leukemia virus FLV
  • spumavirus Friend murine leukemia virus
  • MSCV Murine Stem Cell Virus
  • RSV Rous Sarcoma Virus
  • lentivirus refers to a group (or genus) of complex retroviruses.
  • Illustrative lentiviruses include, but are not limited to: HIV (human immunodeficiency virus; including HIV type 1 , and HIV type 2); visna-maedi virus (VMV) virus; the caprine arthritis-encephalitis virus (CAEV); equine infectious anemia virus (EIAV); feline immunodeficiency virus (FIV); bovine immune deficiency virus (BIV); and simian immunodeficiency virus (SIV).
  • HIV based vector backbones i.e., HIV cis-acting sequence elements
  • a lentivirus is used to deliver a polynucleotide comprising a CAR to a cell.
  • vector is used herein to refer to a nucleic acid molecule capable transferring or transporting another nucleic acid molecule.
  • the transferred nucleic acid is generally linked to, e.g., inserted into, the vector nucleic acid molecule.
  • a vector may include sequences that direct autonomous replication in a cell, or may include sequences sufficient to allow integration into host cell DNA.
  • Useful vectors include, for example, plasmids (e.g., DNA plasmids or RNA plasmids), transposons, cosmids, bacterial artificial chromosomes, and viral vectors.
  • Useful viral vectors include, e.g., replication defective retroviruses and lentiviruses.
  • CrispR/Cas and TALEN-mediated insertion of the CXCR5 CAR encoding nucleic acid may be employed.
  • Appropriate vectors for CrispR/Cas and TALEN-mediated insertion are known to a skilled person.
  • viral vector is widely used to refer either to a nucleic acid molecule (e.g., a transfer plasmid) that includes virus-derived nucleic acid elements that typically facilitate transfer of the nucleic acid molecule or integration into the genome of a cell or to a viral particle that mediates nucleic acid transfer.
  • Viral particles will typically include various viral components and sometimes also host cell components in addition to nucleic acid(s).
  • viral vector may refer either to a virus or viral particle capable of transferring a nucleic acid into a cell or to the transferred nucleic acid itself.
  • Viral vectors and transfer plasmids contain structural and/or functional genetic elements that are primarily derived from a virus.
  • the term "retroviral vector” refers to a viral vector or plasmid containing structural and functional genetic elements, or portions thereof, that are primarily derived from a retrovirus.
  • the invention therefore relates to a method for transfecting cells with an expression vector encoding a CAR.
  • the vector comprises additional sequences, such as sequences that facilitate expression of the CAR, such a promoter, enhancer, poly-A signal, and/or one or more introns.
  • the CAR-coding sequence is flanked by transposon sequences, such that the presence of a transposase allows the coding sequence to integrate into the genome of the transfected cell.
  • the genetically transformed cells are further transfected with a transposase that facilitates integration of a CAR coding sequence into the genome of the transfected cells.
  • the transposase is provided as DNA expression vector.
  • the transposase is provided as an expressible RNA or a protein such that long-term expression of the transposase does not occur in the transgenic cells.
  • the transposase is provided as an mRNA (e.g., an mRNA comprising a cap and poly- A tail). Any transposase system may be used in accordance with the embodiments of the present invention.
  • the transposase is salmonid-type Tel -like transposase (SB).
  • the transposase can be the so called "Sleeping beauty" transposase, see e.g., U.S. Patent 6,489,458, incorporated herein by reference.
  • the transposase is an engineered enzyme with increased enzymatic activity.
  • Some specific examples of transposases include, without limitation, SB 10, SB 1 1 or SB 100X transposase (see, e.g., Mates et al, 2009, Nat Genet. 41 (6):753-61 , or US9228180, herein incorporated by reference).
  • a method can involve electroporation of cells with an mRNA encoding an SB 10, SB 1 1 or SB 100X transposase.
  • Sequence variants of the claimed nucleic acids, proteins, antibodies, antibody fragments and/or CARs for example those defined by % sequence identity, that maintain similar binding properties of the invention are also included in the scope of the invention.
  • Such variants which show alternative sequences, but maintain essentially the same binding properties, such as target specificity, as the specific sequences provided are known as functional analogues, or as functionally analogous.
  • Sequence identity relates to the percentage of identical nucleotides or amino acids when carrying out a sequence alignment.
  • sequence identity refers to the extent that sequences are identical on a nucleotide-by-nucleotide basis or an amino acid-by-amino acid basis over a window of comparison.
  • a “percentage of sequence identity” may be calculated by comparing two optimally aligned sequences over the window of comparison, determining the number of positions at which the identical nucleic acid base (e.g., A, T, C, G, I) or the identical amino acid residue (e.g., Ala, Pro, Ser, Thr, Gly, Val, Leu, He, Phe, Tyr, Trp, Lys, Arg, His, Asp, Glu, Asn, Gin, Cys and Met) occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison (i.e., the window size), and multiplying the result by 100 to yield the percentage of sequence identity.
  • the identical nucleic acid base e.g., A, T, C
  • nucleotides and polypeptides having at least about 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to any of the reference sequences described herein, typically where the polypeptide variant maintains at least one biological activity of the reference polypeptide.
  • substitutions are modifications made to the amino acid sequence of the protein, whereby one or more amino acids are replaced with the same number of (different) amino acids, producing a protein which contains a different amino acid sequence than the primary protein. Substitutions may be carried out that preferably do not significantly alter the function of the protein. Like additions, substitutions may be natural or artificial. It is well known in the art that amino acid substitutions may be made without significantly altering the protein's function. This is particularly true when the modification relates to a "conservative" amino acid substitution, which is the substitution of one amino acid for another of similar properties.
  • Such "conserved" amino acids can be natural or synthetic amino acids which because of size, charge, polarity and conformation can be substituted without significantly affecting the structure and function of the protein. Frequently, many amino acids may be substituted by conservative amino acids without deleteriously affecting the protein's function.
  • This list is not exhaustive. For example, it is well known that Ala, Gly, Ser and sometimes Cys can substitute for each other even though they belong to different groups.
  • Substitution variants have at least one amino acid residue in the antibody molecule removed and a different residue inserted in its place.
  • the sites of greatest interest for substitutional mutagenesis include the hypervariable regions, but FR alterations are also contemplated. If such substitutions result in a change in biological activity, then more substantial changes, denominated "exemplary substitutions" in the table immediately below, or as further described below in reference to amino acid classes, may be introduced and the products screened.
  • Conservative amino acid substitutions are not limited to naturally occurring amino acids, but also include synthetic amino acids.
  • Commonly used synthetic amino acids are omega amino acids of various chain lengths and cyclohexyl alanine which are neutral non-polar analogs; citrulline and methionine sulfoxide which are neutral non-polar analogs, phenylglycine which is an aromatic neutral analog; cysteic acid which is a negatively charged analog and ornithine which is a positively charged amino acid analog.
  • this list is not exhaustive, but merely exemplary of the substitutions that are well known in the art.
  • the present invention contemplates, in particular embodiments, cells genetically modified to express the CARs contemplated herein, for use in the treatment of B cell related conditions.
  • the term “genetically engineered” or “genetically modified” refers to the addition of extra genetic material in the form of DNA or RNA into the total genetic material in a cell.
  • the terms, “genetically modified cells,” “modified cells,” and, “redirected cells,” are used interchangeably.
  • the term "gene therapy” refers to the introduction-permanently or transiently- of extra genetic material in the form of DNA or RNA into the total genetic material in a cell that restores, corrects, or modifies expression of a gene, or for the purpose of expressing a therapeutic polypeptide, e.g., a CAR.
  • a therapeutic polypeptide e.g., a CAR.
  • the CARs contemplated herein are introduced and expressed in immune effector cells so as to redirect their specificity to a target antigen of interest, e.g., a CXCR5 polypeptide.
  • an “immune cell” or “immune effector cell” is any cell of the immune system that has one or more effector functions (e.g., cytotoxic cell killing activity, secretion of cytokines, induction of ADCC and/or CDC).
  • An immune effector cell can be also differentiated from iPSCs (induced pluriotent stem cells)
  • Immune effector cells of the invention can be autologous/autogeneic ("self) or non-autologous ("non- self,” e.g., allogeneic, syngeneic or xenogeneic).
  • autologous refers to cells from the same subject, and represent a preferred embodiment of the invention.
  • Allogeneic refers to cells of the same species that differ genetically to the cell in comparison.
  • T lymphocytes refers to T lymphocytes.
  • T cell or T lymphocyte
  • CIK cells cytokine-induced killer cells
  • Cytokine-induced killer (CIK) cells are typically CD3- and CD56-positive, non-major histocompatibility complex (MHC)- restricted, natural killer (NK)-like T lymphocytes.
  • a T cell can be a T helper (Th; CD4+ T cell) cell, for example a T helper 1 (Th1 ) or a T helper 2 (Th2) cell.
  • the T cell can be a cytotoxic T cell (CTL; CD8+ T cell), CD4+CD8+ T cell, CD4 CD8 T cell, or any other subset of T cells.
  • CTL cytotoxic T cell
  • Other illustrative populations of T cells suitable for use in particular embodiments include naive T cells and memory T cells and stem cell-like memory cells TSCM).
  • the T cells modified with the CAR of the invention as described herein may recognize and kill tumor cells.
  • CIK cells may have enhanced cytotoxic activity compared to other T cells, and therefore represent a preferred embodiment of an immune cell of the present invention.
  • immune effector cells also include NK cells, NKT cells, neutrophils, and macrophages.
  • Immune effector cells also include progenitors of effector cells wherein such progenitor cells can be induced to differentiate into an immune effector cells in vivo or in vitro. Progenitors can be iPSCs that become immune effector cells under defined culture conditions.
  • the present invention provides methods for making the immune effector cells which express the CAR contemplated herein. In one embodiment, the method comprises transfecting or transducing immune effector cells isolated from an individual such that the immune effector cells express one or more CAR as described herein.
  • the immune effector cells are isolated from an individual and genetically modified without further manipulation in vitro. Such cells can then be directly re-administered into the individual.
  • the immune effector cells are first activated and stimulated to proliferate in vitro prior to being genetically modified to express a CAR.
  • the immune effector cells may be cultured before and/or after being genetically modified (i.e., transduced or transfected to express a CAR contemplated herein).
  • the source of cells is obtained from a subject.
  • the CAR-modified immune effector cells comprise T cells.
  • T cells can be obtained from a number of sources including, but not limited to, peripheral blood mononuclear cells, bone marrow, lymph nodes tissue, cord blood, thymus issue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumors.
  • T cells can be obtained from a unit of blood collected from a subject using any number of techniques known to the skilled person, such as sedimentation, e.g., FICOLLTM separation, antibody-conjugated bead-based methods such as MACSTM separation (Miltenyi).
  • cells from the circulating blood of an individual are obtained by apheresis.
  • the apheresis product typically contains lymphocytes, including T cells, monocytes, granulocyte, B cells, other nucleated white blood cells, red blood cells, and platelets.
  • the cells collected by apheresis may be washed to remove the plasma fraction and to place the cells in an appropriate buffer or media for subsequent processing.
  • the cells can be washed with PBS or with another suitable solution that lacks calcium, magnesium, and most, if not all other, divalent cations.
  • a washing step may be accomplished by methods known to those in the art, such as by using a semiautomated flow through centrifuge. For example, the Cobe 2991 cell processor, the Baxter CytoMate, or the like.
  • the cells may be resuspended in a variety of biocompatible buffers or other saline solution with or without buffer.
  • the undesirable components of the apheresis sample may be removed in the cell directly resuspended culture media.
  • T cells are isolated from peripheral blood mononuclear cells (PBMCs) by lysing the red blood cells and depleting the monocytes, for example, by centrifugation through a PERCOLLTM gradient.
  • PBMCs peripheral blood mononuclear cells
  • a specific subpopulation of T cells can be further isolated by positive or negative selection techniques.
  • One method for use herein is cell sorting and/or selection via negative magnetic immunoadherence or flow cytometry that uses a cocktail of monoclonal antibodies directed to cell surface markers present on the cells negatively selected.
  • PBMC may be directly genetically modified to express CARs using methods contemplated herein.
  • T lymphocytes after isolation of PBMC, T lymphocytes are further isolated and in certain embodiments, both cytotoxic and helper T lymphocytes can be sorted into naive, memory, and effector T cell subpopulations either before or after genetic modification and/or expansion.
  • CD8+ cells can be obtained by using standard methods.
  • CD8+ cells are further sorted into naive, central memory, and effector cells by identifying cell surface antigens that are associated with each of those types of CD8+ cells.
  • the immune cell of the present invention for example the T cells described herein, can be obtained from inducible pluripotent stem cells (iPSCs) using methods known to a skilled person.
  • Accepted approaches for producing CAR T cells rely on the genetic modification and expansion of mature circulating T-cells. Such processes utilize autologous T cells and reduce risk of graft-versus- host (GvHD) disease from allogeneic T cells through endogenous TCR expression as well as rejection through MHC incompatibility.
  • GvHD graft-versus- host
  • direct in vitro differentiation of engineered T cells from pluripotent stem cells, such as inducible pluripotent stem cells provides an essentially unlimited source of cells that can be genetically modified to express the CAR of the present invention.
  • a so-called master iPSC line can be maintained, which represents a renewable source for consistently and repeatedly manufacturing homogeneous cell products.
  • the transformation of a master iPSC cell line with the CAR encoding nucleic acid is contemplated, prior to expansion and differentiation to the desired immune cell, preferably T cell.
  • T lymphocytes can for example be generated from iPSCs, such that iPSCs could be modified with the CAR encoding nucleic acids and subsequently expanded and differentiated to T cells for administration to the patient. Differentiation to the appropriate immune cell, such a T cell, could also be conducted from the iPSCs before transformation with CAR encoding nucleic acids and expansion prior to administration. All possible combinations of iPSC expansion, genetic modification and expansion to provide suitable numbers of cells for administration are contemplated in the invention.
  • the immune effector cells can be genetically modified following isolation using known methods, or the immune effector cells can be activated and expanded (or differentiated in the case of progenitors) in vitro prior to being genetically modified.
  • the immune effector cells such as T cells
  • T cells can be activated and expanded before or after genetic modification to express a CAR, using methods as described, for example, in U.S. Patents 6,352,694; 6,534,055; 6,905,680; 6,692,964; 5,858,358; 6,887,466;
  • a mixture of, e.g., one, two, three, four, five or more, different expression vectors can be used in genetically modifying a donor population of immune effector cells wherein each vector encodes a different chimeric antigen receptor protein as contemplated herein.
  • the resulting modified immune effector cells forms a mixed population of modified cells, with a proportion of the modified cells expressing more than one different CAR proteins.
  • the invention provides a method of storing genetically modified murine, human or humanized CAR protein expressing immune effector cells which target a CXCR5 protein, comprising cryopreserving the immune effector cells such that the cells remain viable upon thawing.
  • a fraction of the immune effector cells expressing the CAR proteins can be cryopreserved by methods known in the art to provide a permanent source of such cells for the future treatment of patients afflicted with the B cell related condition. When needed, the cryopreserved transformed immune effector cells can be thawed, grown and expanded for more such cells.
  • compositions contemplated herein may comprise one or more polypeptides, polynucleotides, vectors comprising same, genetically modified immune effector cells, etc., as contemplated herein.
  • Compositions include, but are not limited to pharmaceutical compositions.
  • a "pharmaceutical composition” refers to a composition formulated in pharmaceutically-acceptable or physiologically- acceptable solutions for administration to a cell or an animal, either alone, or in combination with one or more other modalities of therapy.
  • compositions of the invention may be administered in combination with other agents as well, such as, e.g., cytokines, growth factors, hormones, small molecules, chemotherapeutics, pro-drugs, drugs, antibodies, or other various pharmaceutically-active agents.
  • agents such as, e.g., cytokines, growth factors, hormones, small molecules, chemotherapeutics, pro-drugs, drugs, antibodies, or other various pharmaceutically-active agents.
  • phrases "pharmaceutically acceptable” is employed herein to refer to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
  • pharmaceutically acceptable carrier includes without limitation any adjuvant, carrier, excipient, glidant, sweetening agent, diluent, preservative, dye/colorant, flavor enhancer, surfactant, wetting agent, dispersing agent, suspending agent, stabilizer, isotonic agent, solvent, surfactant, or emulsifier which has been approved by the United States Food and Drug Administration as being acceptable for use in humans or domestic animals.
  • pharmaceutically acceptable carrier, diluent or excipient includes without limitation any adjuvant, carrier, excipient, glidant, sweetening agent, diluent, preservative, dye/colorant, flavor enhancer, surfactant, wetting agent, dispersing agent, suspending agent, stabilizer, isotonic agent, solvent, surfactant, or emulsifier which has been approved by the United States Food and Drug Administration as being acceptable for use in humans or domestic animals.
  • pharmaceutically acceptable carriers include, but are not limited to, to sugars, such as lactose, glucose and sucrose; starches, such as corn starch and potato starch; cellulose, and its derivatives, such as sodium carboxymethyl cellulose, ethyl cellulose and cellulose acetate; tragacanth; malt; gelatin; talc; cocoa butter, waxes, animal and vegetable fats, paraffins, silicones, bentonites, silicic acid, zinc oxide; oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil and soybean oil; glycols, such as propylene glycol; polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol; esters, such as ethyl oleate and ethyl laurate; agar; buffering agents, such as magnesium hydroxide and aluminum hydroxide; alginic acid; pyrogen-free water; is
  • compositions of the present invention comprise an amount of CAR- expressing immune effector cells contemplated herein.
  • amount refers to "an amount effective” or “an effective amount” of a genetically modified therapeutic cell, e.g., T cell, to achieve a beneficial or desired prophylactic or therapeutic result, including clinical results.
  • prophylactically effective amount refers to an amount of a genetically modified therapeutic cell effective to achieve the desired prophylactic result. Typically but not necessarily, since a prophylactic dose is used in subjects prior to or at an earlier stage of disease, the prophylactically effective amount is less than the therapeutically effective amount.
  • prophylactic does not necessarily refer to a complete prohibition or prevention of a particular medical disorder.
  • the tern prophylactic also refers to the reduction of risk of a certain medical disorder occurring or worsening in its symptoms.
  • a “therapeutically effective amount” of a genetically modified therapeutic cell may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the stem and progenitor cells to elicit a desired response in the individual.
  • a therapeutically effective amount is also one in which any toxic or detrimental effects of the virus or transduced therapeutic cells are outweighed by the therapeutically beneficial effects.
  • the term "therapeutically effective amount” includes an amount that is effective to "treat" a subject ⁇ e.g., a patient). When a therapeutic amount is indicated, the precise amount of the compositions of the present invention to be administered can be determined by a physician with consideration of individual differences in age, weight, tumor size, extent of infection or metastasis, and condition of the patient (subject).
  • a pharmaceutical composition comprising the T cells described herein may be administered at a dosage of 10 2 to 10 10 cells/kg body weight, preferably 10 5 to 10 7 cells/kg body weight, including all integer values within those ranges.
  • the number of cells will depend upon the ultimate use for which the composition is intended as will the type of cells included therein.
  • the cells are generally in a volume of a liter or less, can be 500 imLs or less, even 250 imLs or 100 imLs or less.
  • the density of the desired cells is typically greater than 10 6 cells/ml and generally is greater than 10 7 cells/ml, generally 10 8 cells/ml or greater.
  • the clinically relevant number of immune cells can be apportioned into multiple infusions that cumulatively equal or exceed 10 5 , 10 6 , 10 7 , 10 8 , 10 9 , 10 10 , 10 11 , or 10 12 cells.
  • lower numbers of cells may be administered.
  • CAR expressing cell compositions may be administered multiple times at dosages within these ranges.
  • the cells may be allogeneic, syngeneic, xenogeneic, or autologous to the patient undergoing therapy.
  • compositions comprising the cells activated and expanded as described herein may be utilized in the treatment and prevention of diseases that arise in individuals who are
  • compositions comprising the CAR-modified T cells contemplated herein are used in the treatment of B cell malignancies.
  • the CAR-modified T cells of the present invention may be administered either alone, or as a pharmaceutical composition in combination with carriers, diluents, excipients, and/or with other components such as IL-2 or other cytokines or cell populations.
  • pharmaceutical compositions contemplated herein comprise an amount of genetically modified T cells, in combination with one or more pharmaceutically or physiologically acceptable carriers, diluents or excipients.
  • compositions of the present invention comprising a CAR-expressing immune effector cell population, such as T cells, may comprise buffers such as neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); and preservatives.
  • Compositions of the present invention are preferably formulated for parenteral administration, e.g., intravascular (intravenous or intraarterial), intraperitoneal or intramuscular administration.
  • the liquid pharmaceutical compositions may include one or more of the following: sterile diluents such as water for injection, saline solution, preferably physiological saline, Ringer's solution, isotonic sodium chloride, fixed oils such as synthetic mono or diglycerides which may serve as the solvent or suspending medium, polyethylene glycols, glycerin, propylene glycol or other solvents; antibacterial agents such as benzyl alcohol or methyl paraben; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; buffers such as acetates, citrates or phosphates and agents for the adjustment of tonicity such as sodium chloride or dextrose.
  • the parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic.
  • An injectable pharmaceutical composition is preferably sterile.
  • compositions contemplated herein comprise an effective amount of
  • the CAR-expressing immune effector cell compositions may be administered alone or in combination with other known cancer treatments, such as radiation therapy, chemotherapy, transplantation, immunotherapy, hormone therapy, photodynamic therapy, etc.
  • the compositions may also be administered in combination with antibiotics.
  • Such therapeutic agents may be accepted in the art as a standard treatment for a particular disease state as described herein, such as a particular cancer.
  • Exemplary therapeutic agents contemplated include cytokines, growth factors, steroids, NSAIDs, DMARDs, anti-inflammatories, chemotherapeutics, radiotherapeutics, therapeutic antibodies, or other active and ancillary agents.
  • the genetically modified immune effector cells contemplated herein provide improved methods of adoptive immunotherapy for use in the treatment of medical disorders associated with the presence of pathogenic cells expressing CXCR5 that include, but are not limited to immunoregulatory conditions and hematological malignancies.
  • pathogenic cells expressing CXCR5 refer to medical conditions, such as a cancer or autoimmune disease, in which the cells involved in pathophysiology of the disease demonstrate expression of CXCR5, and preferably presentation of CXCR5 on the cell surface.
  • the expression of CXCR5 can be determined by various methods known to a skilled person, for example by isolating cells from a patient and assessing these by PCR using primers directed CXCR5 transcripts, immune-staining with anti CXCR5 antibodies, or by analysis by flow cytometry.
  • Such pathogenic cells may typically be pathogenic mature B cells and/or memory B cells, and/or pathogenic T cells and/or T follicular helper cells.
  • compositions comprising CAR-modified T cells contemplated herein are used in the treatment of hematologic malignancies, including but not limited to B cell malignancies such as, for example, non-Hodgkin's lymphoma (NHL), such as B cell NHL or T cell non-Hodgkin's lymphoma, with or without a leukemic tumor cell dissemination.
  • B cell malignancies such as, for example, non-Hodgkin's lymphoma (NHL), such as B cell NHL or T cell non-Hodgkin's lymphoma
  • NHL non-Hodgkin's lymphoma
  • Non-Hodgkin lymphoma encompasses a large group of cancers of lymphocytes (white blood cells).
  • Non-Hodgkin lymphomas can occur at any age and are often marked by lymph nodes that are larger than normal, fever, and weight loss.
  • Non-Hodgkin lymphomas can also present on extranodal sites, such as the central nervous system, mucosal tissues including lung, intestine, colon and gut.
  • Non-Hodgkin lymphomas can be derived from B cells and T-cells.
  • the term "non- Hodgkin lymphoma” includes both "B cell” and "T cell” non-Hodgkin lymphoma.
  • B cell non-Hodgkin lymphomas include Burkitt lymphoma, chronic lymphocytic leukemia/small lymphocytic lymphoma (CLL/SLL), diffuse large B cell lymphoma, follicular lymphoma, immunoblastic large cell lymphoma, precursor B-lymphoblastic lymphoma, and mantle cell lymphoma. Lymphomas that occur after bone marrow or stem cell transplantation are usually B cell non-Hodgkin lymphomas.
  • T-cell lymphomas account for approximately 15 percent of all NHLs in the United States. There are many different forms of T-cell lymphomas, such as angioimmunoblastic T-cell lymphoma (AITL), which is a mature T-cell lymphoma of blood or lymph vessel immunoblasts. Further forms of T cell lymphomas relate to cutaneous T cell lymphoma and T cell lymphoma with a leukemic
  • Chronic lymphocytic leukemia can also be treated with the present CAR, and is an indolent (slow-growing) cancer that causes a slow increase in immature white blood cells (B lymphocytes). Cancer cells spread through the blood and bone marrow, and can also affect the lymph nodes or other organs such as the liver and spleen. CLL eventually causes the bone marrow to fail. A different presentation of the disease is called small lymphocytic lymphoma and localizes mostly to secondary lymphoid organs, e.g. lymph nodes and spleen.
  • the CAR or immune cell expressing said CAR is intended for use in the treatment of an autoimmune disease, preferably an auto-antibody-dependent autoimmune disease, preferably an autoimmune disease with an inflammatory component.
  • CXCR5-expressing follicular T-helper (Tfh) cells represent an important mechanism contributing to exacerbated humoral immune responses and autoantibody production during autoimmune diseases.
  • CXCR5-expressing Tfh cells represent a feasible target in the context of autoimmunity.
  • the autoimmune disease to be treated is preferably selected from Takayasu Arteritis, Giant-cell arteritis, familial Mediterranean fever, Kawasaki disease, Polyarteritis nodosa, cutanous Polyarteritis nodosa, Hepatitis-associated arteritis, Behcet's syndrome, Wegener's granulomatosis, ANCA- vasculitidies, Churg-Strauss syndrome, microscopic polyangiitis, Vasculitis of connective tissue diseases, Hennoch-Schonlein purpura, Cryoglobulinemic vasculitis, Cutaneous leukocytoclastic angiitis, Tropical aortitis, Sarcoidosis, Cogan's syndrome, Wiskott-Aldrich Syndrome, Lepromatous arteritis, Primary angiitis of the CNS, Thromboangiitis obliterans, Paraneoplastic ateritis, Urticaria, Dego'
  • Rheumatoid Arthritis atherosclerosis, Amyloidosis, Morbus Chron, Colitis ulcerosa, Autoimmune Myositis, Diabetes mellitus, Guillain-Barre Syndrome, histiocytosis, Osteoarthritis, atopic dermatitis, periodontitis, chronic rhinosinusitis, Psoriasis, psoriatic arthritis, Microscopic colitis, Pulmonary fibrosis, glomerulonephritis, Whipple's disease, Still's disease, erythema nodosum, otitis, cryoglobulinemia, Sjogren's syndrome, Lupus erythematosus, preferably systemic lupus
  • Tfh Follicular T-helper cells
  • HAV Human Immunodeficiency Virus
  • CD4+ T helper cells Long et al. 2017, Frontiers in Immunology, 8:622
  • CAR immune cells expressing the CAR of the present invention could target the follicular reservoir of HIV-producing T helper cells.
  • the CAR of the present invention may be used in eliminating or inhibiting a reservoir of HIV-producing T helper cells in the treatment of HIV.
  • the reservoir of HIV-producing T helper cells is therefore to be considered as a group of pathogenic cells expressing CXCR5, in particular pathogenic T cells.
  • a subject includes any animal that exhibits symptoms of a disease, disorder, or condition of the hematopoietic system, e.g., a B cell malignancy, that can be treated with the cell- based therapeutics and methods disclosed herein.
  • Suitable subjects include laboratory animals (such as mouse, rat, rabbit, or guinea pig), farm animals, and domestic animals or pets (such as a cat or dog).
  • Non-human primates and, preferably, human patients, are included. Typical subjects include human patients that have a B cell malignancy, have been diagnosed with a B cell malignancy, or are at risk or having a B cell malignancy.
  • prevention and similar words such as “prevented,” “preventing” or “prophylactic” etc., indicate an approach for preventing, inhibiting, or reducing the likelihood of the occurrence or recurrence of, a disease or condition. It also refers to delaying the onset or recurrence of a disease or condition or delaying the occurrence or recurrence of the symptoms of a disease or condition. As used herein, “prevention” and similar words also includes reducing the intensity, effect, symptoms and/or burden of a disease or condition prior to onset or recurrence of the disease or condition.
  • a method of treating a B cell related condition in a subject in need thereof comprises administering an effective amount, e.g., therapeutically effective amount of a composition comprising genetically modified immune effector cells contemplated herein.
  • an effective amount e.g., therapeutically effective amount of a composition comprising genetically modified immune effector cells contemplated herein.
  • the quantity and frequency of administration will be determined by such factors as the condition of the patient, and the type and severity of the patient's disease, although appropriate dosages may be determined by clinical trials.
  • compositions contemplated herein may be carried out in any convenient manner, including by aerosol inhalation, injection, ingestion, transfusion, implantation or
  • compositions are administered parenterally.
  • parenteral administration and “administered parenterally” as used herein refers to modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravascular, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intratumoral, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal and intrasternal injection and infusion.
  • the compositions contemplated herein are administered to a subject by direct injection into a tumor, lymph node, or site of infection.
  • Figure 1 Schematic representation of preferred CAR structures.
  • Figure 2 Schematic representation of preferred CAR constructs H28, R28, HBB1 , HBB2, and H28BB.
  • Figure 4 Sequence comparisons between the mAb binding regions and the preferred humanized sequences employed in the present CAR.
  • Figure 6 Sequence depiction of the DNA sequence encoding the mAb binding region hLC.
  • Figure 7 GeneArtTM Plasmid with the humanized and rat CXCR5-CAR Sequence.
  • Figure 8 Gel electrophoresis of the construct and vectors after restriction.
  • FIG. 11 Co-cultures of CAR-transduced human T cells with different target cell lines show specific T cell activation by distinct CXCR5+ B-NHL and control cell lines.
  • FIG. 14 Co-cultures of CAR-transduced human T cells with different target cell lines show specific T cell activation by distinct CXCR5+ B-NHL and control cell lines.
  • FIG. 15 Co-cultures of CAR-transduced human T cells with CXCR5-negative primary cells of different human tissues as targets show no off-target T cell activation, whereas the CXCR5- expressing B-NHL cell line JeKo-1 mediates specific T cell activation and serves as a positive control.
  • Figure 1 Schematic representation of preferred CAR structures. Depicted are the VL and VH domains of the antigen-binding domain, including the linker positioned between the VH and VL domains. Also depicted is the spacer region, positioned between the antigen-binding domain and the transmembrane domain. Also depicted are variants of the intracellular domain, comprising for example co-stimulatory and activation domains.
  • FIG. 2 Schematic representation of preferred CAR constructs H28, R28, HBB1 , HBB2, and H28BB.
  • the preferred constructs of the invention comprise variants of the transmembrane domain, costimulatory and activation domains.
  • the preferred embodiments of the invention enable exchange of these various domains, preferably of those particular embodiments disclosed herein, although also encompassing additional domains with analogous functions known to one skilled in the art.
  • Figure 3 List of preferred constructs and potential combinations of the various structural elements of the CARs as described herein.
  • Figure 4 Sequence comparisons between the mAb binding regions and the preferred humanized sequences employed in the present CAR. Alignments are depicted showing sequence identity between the rat and humanized hHC and hl_C sequences. As is depicted, 89% sequence identity is evident between humanized and rat hHC sequences, and 93% sequence identity is evident between humanized and rat hl_C sequences.
  • Figure 5 Sequence depiction of the DNA sequence encoding the mAb binding regions hHC, in particular showing a sequence comparison between the original and codon optimized (CO) DNA sequences encoding the humanized hHC.
  • Figure 6 Sequence depiction of the DNA sequence encoding the mAb binding region hl_C, in particular showing a sequence comparison between the original and codon optimized (CO) DNA sequences encoding the humanized hl_C.
  • FIG. 7 GeneArtTM Plasmid with the humanized and rat CXCR5-CAR Sequence. Excised scFV was demonstrated using gel electrophoresis.
  • Figure 8 Gel electrophoresis of the construct and vectors after restriction. Also depicted is a plasmid MP71 comprising the CAR-encoding construct.
  • CXCR5 expression was assessed on a panel of primary cells derived from human healthy tissues. None of the tested primary human cells (HUVEC, human umbilical vein endothelial cells; HUAEC, human umbilical artery endothelial cells; HA, human astrocytes; HN, human neurons; HPNC, human perineurial cells; HCoEpiC, human colonic epithelial cells) showed CXCR5 surface expression by anti-CXCR5 immunostaining and flow cytometry analysis.
  • HUAEC human umbilical vein endothelial cells
  • HUAEC human umbilical artery endothelial cells
  • HA human astrocytes
  • HN human neurons
  • HPNC human perineurial cells
  • HCoEpiC human colonic epithelial cells
  • C Quantitative determination of CXCR5 density per cell on selected B-NHL cell lines (SU-DHL4, OCI-Ly7, DOHH-2, SC-1 , JeKo-1 , MEC-1 , JVM-3), on the MM cell line (NCI-H929), on B- (REH, NALM-6) and T-ALL (Jurkat) cell lines, on the colon adenocarcionoma cell line (SW-620), and the non- or CXCR5-transfected embryonic kidney cell line (HEK293, HEK-CXCR5, respectively) was performed by employing QuantiBRITE PE calibration beads and a CXCR5-specific antibody.
  • FIG. 11 Co-cultures of CAR-transduced human T cells with different target cell lines show specific T cell activation by distinct CXCR5+ B-NHL and control cell lines. Functional in vitro co- cultivation and IFN-gamma ELISA was performed. The levels of IFN-gamma released is indicative of T cell activation. Untransduced (UT; left bar in each series), CXCR5-CAR expressing T cells
  • CXCR5 H28
  • SP6 T cells SP6; right bar in each series
  • DOHH-2, SU-DHL4, OCI-Ly7, JeKo-1 NALM6, REH, NCI-H929 and Jurkat cells.
  • DOHH-2, SU-DHL4, OCI-Ly7 and JeKo-1 target cells show specific IFN-gamma release in response to treatment with the CXCR5 CAR-T cells of the present invention.
  • JVM-3 also shows IFN-gamma release after treatment.
  • FIG. 12 Cytotoxicity assays reveal selective killing of CXCR5-postive cell lines; essentially no killing was seen in CXCR5-negative cell lines.
  • Two independent functional in vitro co-cultivation and 51 Cr release assays were performed.
  • CXCR5 redirected CAR-T cells are effective against B-cell non Hodgkin's lymphoma (B- NHL) in a xenografted NSG mouse model.
  • B- NHL B-cell non Hodgkin's lymphoma
  • NSG N2rg tm1 w i'/SzJ mice
  • NSG mice do not develop T, B, and NK cells and are therefore suitable for tolerance and growth of xenotransplantated human cells.
  • A Engraftment of MCL tumors in a xenografted NSG mouse model. Mice were challenged by i.v. transplantation of MCL cells. At day 5 after tumor inoculation, tumor cell growth was visualized by MS imaging. To measure onset of tumor burden, imaging was extended to 120 sec (day 0).
  • B To follow treatment efficacy and to scale down bioluminescence intensity for better presentation, mice as in (A) were again imaged for 10 sec at day 0.
  • C Mean values of bioluminescence signals obtained from regions of interests covering the entire body of each mouse are plotted for each group at each time point ( Figure 13C).
  • FIG. 14 Co-cultures of CAR-transduced human T cells with different target cell lines show specific T cell activation by distinct CXCR5+ B-NHL and control cell lines. Functional in vitro cocultivation and IFN-gamma (upper panel), IL-2 (middle panel), and TNF-alpha (lower panel) ELISA was performed. The levels of IFN-gamma, IL-2, and TNF-alpha released are indicative of T cell activation and T cell functionality.
  • FIG. 15 Co-cultures of CAR-transduced human T cells with CXCR5-negative primary cells of different human tissues as targets show no off-target T cell activation, whereas the CXCR5- expressing B-NHL cell line JeKo-1 mediates specific T cell activation and serves as a positive control. Functional in vitro co-cultivation and IFN-gamma ELISA was performed.
  • CXCR5-negative cell lines e.g. Nalm6 and NCI-H929.
  • the CAR scFv sequences were synthesized using GeneArtTM (Gene Synthesis Service). Restriction digestion of the synthesized sequences was carried out using Notl and Csil (Fig. 7) in order to release the scFv insert from the GeneArt plasmid.
  • the retroviral vector MP71 comprising additional CAR sequences, was digested with Notl and Csil to enable subsequent ligation of the isolated scFv insert into the CAR construct in the vector.
  • the digested vector was subsequently dephosphorylated.
  • the fragments were separated using gel electrophoresis (Fig. 8) and purified.
  • the CAR scFv sequence generated as described above was subsequently ligated into the purified vector comprising the additional CAR sequences (50ng) at a ratio of 3:1. Transformation of the ligation mixture into MACH-1 was carried out. A control digest was conducted and the Mini- preparation was sequenced. The constructs were subsequently re-transformed into MACH-1. A maxi-preparation of the MP71-CXCR5-CAR plasmid was produced.
  • MP71 is a single (+)-strand-RNA- Virus.
  • Reverse-Transcriptase converts the retroviral RNA-Genome into a DNA copy.
  • the DNA integrates as a provirus at a random position into the target genome. Through cell division the virus reproduces stably as a provirus.
  • MP71 comprises the following regulatory cis elements:
  • LTRs long terminal repeats originate from the murine myeloproliferative sarcoma virus (MPSV), which contain promotors.
  • the leader sequence of the vector is derived from the murine embryonic stem cell virus.
  • the PRE posttranscriptional regulatory element originally comes from the woodchuck hepatitis virus.
  • MP71 has been deactivated, since retroviral genes are missing and it is thus no longer replication- competent.
  • Structural genes were previously introduced separately into two helper plasmids in the packaging cell line. Transfection requires gag, pol and env gene products. Infectious viral particles are released into the cell culture supernatant and can be used to transduce PBLs. High transduction rates with high expression rates in human PBLs can be achieved.
  • Day 0 Seeding HEK-T(293T)- or GalV-cells for virus production in 6 well plates
  • Day 1 Transient 3-plasmid transfection for retrovirus production (calcium phosphate transfection).
  • 18pg of DNA was used, in 250mM Cacl2, 150 ⁇ H20, according to standard protocols. Cells are incubated for 6 h at 37 °C, medium is exchanged, further incubation carried out for 48 h at 37 °C.
  • the readout employed for CAR-T cell activation was release of IFN-gamma as an effector cytokine from T cells.
  • Retrovirus-transduced human T cells were generated, as detailed above. The following T cells were employed: CXCR5-CD28 CAR-receptor variant (H28), CXCR5-4-1 BB CAR-receptor variant
  • B-CLL leukemia
  • T-ALL leukemia
  • Cytotoxicity assays reveal selective killing of CXCR5-oostive cell lines; essentially no killing was seen in CXCR5-negative cell lines
  • the 51 Cr-release assay was employed for quantitation of cytotoxic T lymphocyte activity.
  • the assay enables the measurement of target cell cytolysis.
  • Retrovirus-transduced human T cells were genrated, as detailed above.
  • Example 4 In vivo experiments using a xenotransplantation NSG mouse model to assess adoptively transferred CAR-T cells against B-NHL cell lines
  • CXCR5+ B-NHL cell lines are transplanted via an i.v. route into NSG-mice (NOD.Cg-Prkdc scid N2rg tm1 Wjl/SzJ).
  • the CXCR5+ B-NHL cell lines are:
  • SU-DHL4 (DLBCL), JEKO-1 (mantle cell lymphoma), JVM3 (CLL), DOHH-2 (FL), OCI-Ly7 or SC-1.
  • a negative control cell line is included, that is REH (ALL), which is not destroyed by the anti CXCR5 CAR T cells in vitro, but is a target for anti CD 19 CAR.
  • mice are specifically suited for a xenotransplantation because they support human cell growth by cytokine provision and have no T, B, and NK cells for rejection of the transplant.
  • the B-NHL cell lines are also stably transduced with a firefly-luciferase gene that allows for in vivo tumor cell detection by applying luciferin. Progression and distribution of tumors injected are monitored by bioluminescence imaging using the IVIS-system.
  • human CAR T-cells are administered in a titrated manner, starting with 5 x 10 5 up to 5 x 10 6 cells per recipient on an i.v. route.
  • Anti-CXCR5 CAR T cells are compared with an anti CD 19 CAR and two suitable negative controls, such as an irrelevant SP6 control and an untransduced T cell control.
  • Figure 14 shows alternative CAR components with (1 ) 4-1 BB or CD28 as a co-stimulatory component and (2) a 3rd generation CAR with CD28 and 4-1 BB as co-stimulatory components, and their functional effect in co-culture experiments using CAR T cells with tumor cell lines. Specific activation of CAR-T cells by CXCR5-bearing tumor cells is demonstrated by the release of IFN- gamma, IL-2 and TNF-alpha.
  • CXCR5-CD28 (H28) CAR appears to be the most effective, the two alternative CARs, CXCR5-4-1 BB (HBB1 ) and CXCR5-CD28/4-1 BB (H28BB), also show distinct specific activity.
  • Figure 15 shows that primary cells from healthy human tissues that do not carry CXCR5 (also refer data in Figure 10B) do not induce specific activity of CXCR5-CD28 CAR-T cells.
  • Example 5 Clinical approaches in particular patient collectives
  • the invention is expected to show efficacy in B-NHL patients with diffuse large B-cell lymphoma, follicular lymphoma, chronic lymphocytic leukemia, and mantle cell lymphoma.
  • Patients with the following characteristics are to be enrolled in a clinical phase I study: i) patients with multidrug resistancies, ii) patients not eligible for allogeneic stem cell transplantation, iii) patients with co-morbidities that preclude further chemotherapies, iv) aged patients who do not tolerate chemotherapies, v) patients for salvage therapies after progressive disease has appeared and multiple lines of other standard of care therapies have failed, vi) patients with rapid progressive disease after autologous stem cell transplantation, vii) patients with progressive disease after allogeneic stem cell transplantation, viii) as a bridging therapy before allogeneic stem cell transplantation, and/or ix) patients exhibiting escape variants or mutants of CD19 and/or CD20 on tumor cells, such that current antibody therapies (anti CD20, Rituximab, anti CD19, Oletuzumab, BITE CD19/CD3, Blimatumomab) or anti-CD 19 CAR therapies have lost/downregulated their target structures and become ineffective.
  • the invention is expected to show efficacy in T-NHL patients with angioimmunoblastic T-cell lymphoma, and various forms of T-cell lymphoma with leukemic dissemination, skin localization or any other organ dissemination.
  • selective treatments do not exist, except for generalized chemotherapy regimens. Therefore, patients with following characteristics are to be enrolled in a clinical phase I study: i) patients with multidrug resistancies, ii) patients not eligible for allogeneic stem cell transplantation, iii) patients with comorbidities that preclude further chemotherapies, iv) aged patients who do not tolerate

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Zoology (AREA)
  • Biochemistry (AREA)
  • Biomedical Technology (AREA)
  • Cell Biology (AREA)
  • Medicinal Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Biotechnology (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Epidemiology (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Hematology (AREA)
  • Microbiology (AREA)
  • General Engineering & Computer Science (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Developmental Biology & Embryology (AREA)
  • Virology (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
PCT/EP2018/072750 2017-08-23 2018-08-23 CHIMERIC ANTIGEN RECEPTOR AND CAR CXCR5 BINDING T CARRIER Ceased WO2019038368A1 (en)

Priority Applications (9)

Application Number Priority Date Filing Date Title
US16/641,181 US11643468B2 (en) 2017-08-23 2018-08-23 Chimeric antigen receptors and CAR-T cells that bind CXCR5 and methods of use thereof to treat medical disorders
CA3072859A CA3072859A1 (en) 2017-08-23 2018-08-23 Chimeric antigen receptor and car-t cells that bind cxcr5
JP2020511383A JP7395465B2 (ja) 2017-08-23 2018-08-23 キメラ抗原受容体と、cxcr5に結合するcar-t細胞
SG11202001011XA SG11202001011XA (en) 2017-08-23 2018-08-23 Chimeric antigen receptor and car-t cells that bind cxcr5
KR1020207008094A KR102804751B1 (ko) 2017-08-23 2018-08-23 Cxcr5에 결합하는 키메라 항원 수용체 및 car-t 세포
EP18759305.8A EP3672989A1 (en) 2017-08-23 2018-08-23 Chimeric antigen receptor and car-t cells that bind cxcr5
CN201880056053.1A CN111094349B (zh) 2017-08-23 2018-08-23 嵌合抗原受体和结合cxcr5的car-t细胞
AU2018321134A AU2018321134B2 (en) 2017-08-23 2018-08-23 Chimeric antigen receptor and CAR-T cells that bind CXCR5
AU2025204455A AU2025204455A1 (en) 2017-08-23 2025-06-14 Chimeric antigen receptor and car-t cells that bind cxcr5

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
EP17187554 2017-08-23
EP17187554.5 2017-08-23

Publications (1)

Publication Number Publication Date
WO2019038368A1 true WO2019038368A1 (en) 2019-02-28

Family

ID=59713849

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2018/072750 Ceased WO2019038368A1 (en) 2017-08-23 2018-08-23 CHIMERIC ANTIGEN RECEPTOR AND CAR CXCR5 BINDING T CARRIER

Country Status (9)

Country Link
US (1) US11643468B2 (enExample)
EP (1) EP3672989A1 (enExample)
JP (1) JP7395465B2 (enExample)
KR (1) KR102804751B1 (enExample)
CN (1) CN111094349B (enExample)
AU (2) AU2018321134B2 (enExample)
CA (1) CA3072859A1 (enExample)
SG (1) SG11202001011XA (enExample)
WO (1) WO2019038368A1 (enExample)

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2020193628A1 (en) 2019-03-25 2020-10-01 Max-Delbrück-Centrum Für Molekulare Medizin In Der Helmholtz-Gemeinschaft Enhancement of cytolytic t-cell activity by inhibiting ebag9
JP2022527162A (ja) * 2019-03-26 2022-05-31 ガビッシュ-ガリラヤ バイオ アプリケーションズ リミテッド Carを発現する遺伝的にリプログラミングされたtreg
CN114761560A (zh) * 2019-11-25 2022-07-15 国立大学法人京都大学 T细胞主细胞库
WO2025179294A2 (en) 2024-02-22 2025-08-28 Capstan Therapeutics, Inc. Immune engineering amplification

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN113549599B (zh) * 2021-07-20 2024-02-20 徐州医科大学 靶向cxcr5阳性细胞的car-t细胞、核酸、载体、慢病毒及car-t细胞的应用
WO2025031500A1 (zh) * 2023-08-10 2025-02-13 深圳市三启生物技术有限公司 含有gprc5d抗体的嵌合抗原受体及其应用

Citations (25)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
WO1990007861A1 (en) 1988-12-28 1990-07-26 Protein Design Labs, Inc. CHIMERIC IMMUNOGLOBULINS SPECIFIC FOR p55 TAC PROTEIN OF THE IL-2 RECEPTOR
WO1991017271A1 (en) 1990-05-01 1991-11-14 Affymax Technologies N.V. Recombinant library screening methods
WO1992001047A1 (en) 1990-07-10 1992-01-23 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5807715A (en) 1984-08-27 1998-09-15 The Board Of Trustees Of The Leland Stanford Junior University Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin
US5858358A (en) 1992-04-07 1999-01-12 The United States Of America As Represented By The Secretary Of The Navy Methods for selectively stimulating proliferation of T cells
US5866692A (en) 1991-09-18 1999-02-02 Kyowa Hakko Kogyo Co., Ltd. Process for producing humanized chimera antibody
WO1999060846A1 (en) 1998-05-26 1999-12-02 Innogenetics N.V. Method for expanding primate b cells selectively in immunocompromised mice and producing large numbers of antigen-specific b lymphocytes for the production of primate monoclonal antibodies
US6352694B1 (en) 1994-06-03 2002-03-05 Genetics Institute, Inc. Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells
US6489458B2 (en) 1997-03-11 2002-12-03 Regents Of The University Of Minnesota DNA-based transposon system for the introduction of nucleic acid into DNA of a cell
US6534055B1 (en) 1988-11-23 2003-03-18 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
US6548640B1 (en) 1986-03-27 2003-04-15 Btg International Limited Altered antibodies
US6692964B1 (en) 1995-05-04 2004-02-17 The United States Of America As Represented By The Secretary Of The Navy Methods for transfecting T cells
US6797514B2 (en) 2000-02-24 2004-09-28 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US6867041B2 (en) 2000-02-24 2005-03-15 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US6905874B2 (en) 2000-02-24 2005-06-14 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US6905680B2 (en) 1988-11-23 2005-06-14 Genetics Institute, Inc. Methods of treating HIV infected subjects
US20060121005A1 (en) 2000-02-24 2006-06-08 Xcyte Therapies, Inc. Activation and expansion of cells
US7067318B2 (en) 1995-06-07 2006-06-27 The Regents Of The University Of Michigan Methods for transfecting T cells
US7175843B2 (en) 1994-06-03 2007-02-13 Genetics Institute, Llc Methods for selectively stimulating proliferation of T cells
US9228180B2 (en) 2007-07-04 2016-01-05 Max-Delbruck-Centrum Fur Molekulare Medizin Polypeptide variants of sleeping beauty transposase
WO2016090034A2 (en) 2014-12-03 2016-06-09 Novartis Ag Methods for b cell preconditioning in car therapy
WO2016164731A2 (en) 2015-04-08 2016-10-13 Novartis Ag Cd20 therapies, cd22 therapies, and combination therapies with a cd19 chimeric antigen receptor (car) - expressing cell

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE4332256C1 (de) * 1993-09-22 1995-03-09 Lipp Martin Dr Dr Habil Monoklonale Antikörper gegen Leukozyten-spezifische G-Protein-gekoppelte Rezeptoren
SI2195023T1 (en) * 2007-08-29 2018-07-31 Sanofi Humanized anti-CXCR5 antibodies, their derivatives and their uses
SG11201608393TA (en) * 2014-04-10 2016-11-29 Seattle Children S Hospital Dba Seattle Children S Res Inst Transgene genetic tags and methods of use
EA201790438A1 (ru) * 2014-08-22 2017-08-31 Сорренто Терапьютикс, Инк. Антигенсвязывающие белки, которые связываются с cxcr5
MX2019007641A (es) * 2016-12-21 2019-09-09 Bayer Pharma AG Conjugados de ligando-farmaco (adcs) con grupos escindibles enzimaticamente.
WO2018114804A1 (de) * 2016-12-21 2018-06-28 Bayer Pharma Aktiengesellschaft Spezifische antikörper-wirkstoff-konjugate (adcs) mit ksp-inhibitoren

Patent Citations (36)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US6331415B1 (en) 1983-04-08 2001-12-18 Genentech, Inc. Methods of producing immunoglobulins, vectors and transformed host cells for use therein
US5807715A (en) 1984-08-27 1998-09-15 The Board Of Trustees Of The Leland Stanford Junior University Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin
US6548640B1 (en) 1986-03-27 2003-04-15 Btg International Limited Altered antibodies
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
US6534055B1 (en) 1988-11-23 2003-03-18 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
US6905680B2 (en) 1988-11-23 2005-06-14 Genetics Institute, Inc. Methods of treating HIV infected subjects
US7232566B2 (en) 1988-11-23 2007-06-19 The United States As Represented By The Secretary Of The Navy Methods for treating HIV infected subjects
US6887466B2 (en) 1988-11-23 2005-05-03 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
US5883223A (en) 1988-11-23 1999-03-16 Gray; Gary S. CD9 antigen peptides and antibodies thereto
US7144575B2 (en) 1988-11-23 2006-12-05 The Regents Of The University Of Michigan Methods for selectively stimulating proliferation of T cells
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
WO1990007861A1 (en) 1988-12-28 1990-07-26 Protein Design Labs, Inc. CHIMERIC IMMUNOGLOBULINS SPECIFIC FOR p55 TAC PROTEIN OF THE IL-2 RECEPTOR
US5585089A (en) 1988-12-28 1996-12-17 Protein Design Labs, Inc. Humanized immunoglobulins
US6180370B1 (en) 1988-12-28 2001-01-30 Protein Design Labs, Inc. Humanized immunoglobulins and methods of making the same
US5693761A (en) 1988-12-28 1997-12-02 Protein Design Labs, Inc. Polynucleotides encoding improved humanized immunoglobulins
US5693762A (en) 1988-12-28 1997-12-02 Protein Design Labs, Inc. Humanized immunoglobulins
WO1991017271A1 (en) 1990-05-01 1991-11-14 Affymax Technologies N.V. Recombinant library screening methods
WO1992001047A1 (en) 1990-07-10 1992-01-23 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
US5866692A (en) 1991-09-18 1999-02-02 Kyowa Hakko Kogyo Co., Ltd. Process for producing humanized chimera antibody
US5858358A (en) 1992-04-07 1999-01-12 The United States Of America As Represented By The Secretary Of The Navy Methods for selectively stimulating proliferation of T cells
US7175843B2 (en) 1994-06-03 2007-02-13 Genetics Institute, Llc Methods for selectively stimulating proliferation of T cells
US6352694B1 (en) 1994-06-03 2002-03-05 Genetics Institute, Inc. Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells
US6905681B1 (en) 1994-06-03 2005-06-14 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
US6692964B1 (en) 1995-05-04 2004-02-17 The United States Of America As Represented By The Secretary Of The Navy Methods for transfecting T cells
US7172869B2 (en) 1995-05-04 2007-02-06 The United States Of America As Represented By The Secretary Of The Navy Methods for transfecting T cells
US7067318B2 (en) 1995-06-07 2006-06-27 The Regents Of The University Of Michigan Methods for transfecting T cells
US6489458B2 (en) 1997-03-11 2002-12-03 Regents Of The University Of Minnesota DNA-based transposon system for the introduction of nucleic acid into DNA of a cell
WO1999060846A1 (en) 1998-05-26 1999-12-02 Innogenetics N.V. Method for expanding primate b cells selectively in immunocompromised mice and producing large numbers of antigen-specific b lymphocytes for the production of primate monoclonal antibodies
US20060121005A1 (en) 2000-02-24 2006-06-08 Xcyte Therapies, Inc. Activation and expansion of cells
US6905874B2 (en) 2000-02-24 2005-06-14 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US6867041B2 (en) 2000-02-24 2005-03-15 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US6797514B2 (en) 2000-02-24 2004-09-28 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US9228180B2 (en) 2007-07-04 2016-01-05 Max-Delbruck-Centrum Fur Molekulare Medizin Polypeptide variants of sleeping beauty transposase
WO2016090034A2 (en) 2014-12-03 2016-06-09 Novartis Ag Methods for b cell preconditioning in car therapy
WO2016164731A2 (en) 2015-04-08 2016-10-13 Novartis Ag Cd20 therapies, cd22 therapies, and combination therapies with a cd19 chimeric antigen receptor (car) - expressing cell

Non-Patent Citations (14)

* Cited by examiner, † Cited by third party
Title
AI-LAZIKANI ET AL., J. MOLEC. BIOL., vol. 273, 1997, pages 927 - 948
CHAN ET AL., NAT REV IMMUNOL, vol. 10, 2010, pages 301 - 316
ELLEBRECHT ET AL., SCIENCE, vol. 353, 2016, pages 179 - 184
HOSSEIN PANJIDEH ET AL: "Immunotherapy of B-cell non-Hodgkin lymphoma by targeting the chemokine receptor CXCR5 in a preclinical mouse model : Targeting Chemokine Receptor CXCR5 by Antibodies", INTERNATIONAL JOURNAL OF CANCER, vol. 135, no. 11, 29 April 2014 (2014-04-29), US, pages 2623 - 2632, XP055434066, ISSN: 0020-7136, DOI: 10.1002/ijc.28893 *
JACOBI ET AL., ARTHRITIS RHEUM, vol. 62, 2010, pages 201 - 210
KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, NATIONAL INSTITUTES OF HEALTH
KEYSER, CURR RHEUMATOL REV, vol. 7, 2011, pages 77 - 87
LEONG ET AL., FRONTIERS IN IMMUNOLOGY, vol. 8, 2017, pages 622
M. SADELAIN ET AL: "The Basic Principles of Chimeric Antigen Receptor Design", CANCER DISCOVERY, vol. 3, no. 4, 1 April 2013 (2013-04-01), US, pages 388 - 398, XP055287277, ISSN: 2159-8274, DOI: 10.1158/2159-8290.CD-12-0548 *
MATES ET AL., NAT GENET, vol. 41, no. 6, 2009, pages 753 - 61
PANJIDEH ET AL., INTERNATIONAL JOURNAL OF CANCER, vol. 135, no. 11, 29 April 2014 (2014-04-29)
SADELAIN ET AL., CANCER DISCOVERY, vol. 3, no. 4, 1 April 2013 (2013-04-01)
See also references of EP3672989A1
SHAH ET AL., IMMUNOTARGETS AND THERAPY, vol. 4, 2015, pages 173 - 183

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2020193628A1 (en) 2019-03-25 2020-10-01 Max-Delbrück-Centrum Für Molekulare Medizin In Der Helmholtz-Gemeinschaft Enhancement of cytolytic t-cell activity by inhibiting ebag9
JP2022527162A (ja) * 2019-03-26 2022-05-31 ガビッシュ-ガリラヤ バイオ アプリケーションズ リミテッド Carを発現する遺伝的にリプログラミングされたtreg
CN114761560A (zh) * 2019-11-25 2022-07-15 国立大学法人京都大学 T细胞主细胞库
WO2025179294A2 (en) 2024-02-22 2025-08-28 Capstan Therapeutics, Inc. Immune engineering amplification

Also Published As

Publication number Publication date
JP7395465B2 (ja) 2023-12-11
AU2018321134A1 (en) 2020-02-27
CA3072859A1 (en) 2019-02-28
CN111094349A (zh) 2020-05-01
EP3672989A1 (en) 2020-07-01
KR102804751B1 (ko) 2025-05-13
US20200216550A1 (en) 2020-07-09
AU2018321134B2 (en) 2025-06-26
AU2025204455A1 (en) 2025-07-03
JP2020532969A (ja) 2020-11-19
US11643468B2 (en) 2023-05-09
SG11202001011XA (en) 2020-03-30
KR20200039783A (ko) 2020-04-16
CN111094349B (zh) 2025-02-07

Similar Documents

Publication Publication Date Title
US12351640B2 (en) Chimeric antigen receptor and CAR-T cells that bind BCMA
JP7280828B2 (ja) Bcmaを標的とする抗体およびその使用
US11643468B2 (en) Chimeric antigen receptors and CAR-T cells that bind CXCR5 and methods of use thereof to treat medical disorders
EP3946435B1 (en) Enhancement of cytolytic t-cell activity by inhibiting ebag9
CN114667294A (zh) 特异性结合b细胞成熟抗原的抗体及其用途
KR20250088607A (ko) 신규한 cd19 결합제, 이를 포함하는 car-t 작제물, 및 이의 사용 방법
US20230321242A1 (en) Chimeric antigen receptor (car)-expressing cells recognizing cea
US20240009310A1 (en) A CHIMERIC ANTIGEN RECEPTOR CONSTRUCT ENCODING A CHECKPOINT INHIBITORY MOLECULE AND AN IMMUNE STIMULATORY CYTOKINE AND CAR-EXPRESSING CELLS RECOGNIZING CD44v6
CN116745313A (zh) 通过靶向整合ζ缺陷型嵌合抗原受体转基因重编程免疫细胞
US20230158072A1 (en) Combination therapy involving anti-cd39 antibodies and adoptive cell therapy
EP4570262A1 (en) Chimeric antigen receptor directed against the chemokine receptor ccr7

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18759305

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3072859

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2020511383

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2018321134

Country of ref document: AU

Date of ref document: 20180823

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20207008094

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2018759305

Country of ref document: EP

Effective date: 20200323

WWG Wipo information: grant in national office

Ref document number: 201880056053.1

Country of ref document: CN