WO2018226880A1 - A htp genomic engineering platform for improving escherichia coli - Google Patents
A htp genomic engineering platform for improving escherichia coli Download PDFInfo
- Publication number
- WO2018226880A1 WO2018226880A1 PCT/US2018/036333 US2018036333W WO2018226880A1 WO 2018226880 A1 WO2018226880 A1 WO 2018226880A1 US 2018036333 W US2018036333 W US 2018036333W WO 2018226880 A1 WO2018226880 A1 WO 2018226880A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- coli strain
- library
- gene
- coli
- swap
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
- C12N15/1034—Isolating an individual clone by screening libraries
- C12N15/1058—Directional evolution of libraries, e.g. evolution of libraries is achieved by mutagenesis and screening or selection of mixed population of organisms
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
- C12N15/1034—Isolating an individual clone by screening libraries
- C12N15/1079—Screening libraries by altering the phenotype or phenotypic trait of the host
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/70—Vectors or expression systems specially adapted for E. coli
- C12N15/73—Expression systems using phage (lambda) regulatory sequences
Definitions
- the present disclosure is directed to high-throughput (HTP) microbial genomic engineering for Escherichia coli.
- HTP genomic engineering platform is computationally driven and integrates molecular biology, automation, and advanced machine learning protocols.
- This integrative platform utilizes a suite of HTP molecular tool sets to create HTP genetic design libraries, which are derived from, inter alia, scientific insight and iterative pattern recognition.
- the present disclosure provides a high-throughput (HTP) genomic engineering platform for E. coli that does not suffer from the myriad of problems associated with traditional microbial strain improvement programs.
- HTP high-throughput
- the HTP platform taught herein is able to rehabilitate E. coli strains that have accumulated non-beneficial mutations through decades of random mutagenesis-based strain improvement programs.
- the disclosure also provides for unique genomic engineering toolsets and procedures, which undergird the HTP platform's functionality in an E. coli system.
- the disclosed HTP genomic engineering platform is computationally driven and integrates molecular biology, automation, and advanced machine learning protocols.
- This integrative platform utilizes a suite of HTP molecular tool sets to create HTP genetic design libraries, which are derived from, inter alia, scientific insight and iterative pattern recognition.
- the taught HTP genetic design libraries function as drivers of the genomic engineering process, by providing libraries of particular genomic alterations for testing inE. coli.
- the microbes engineered utilizing a particular library, or combination of libraries are efficiently screened in a HTP manner for a resultant outcome, e.g. production of a product of interest.
- This process of utilizing the HTP genetic design libraries to define particular genomic alterations for testing in a microbe and then subsequently screening host microbial genomes harboring the alterations is implemented in an efficient and iterative manner.
- the iterative cycle or "rounds" of genomic engineering campaigns can be at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, or more iterations/cycles/rounds.
- the present disclosure teaches methods of conducting at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 50, 51 , 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, 400,
- the present disclosure teaches a linear approach, in which each subsequent HTP genetic engineering round is based on genetic variation identified in the previous round of genetic engineering. In other embodiments the present disclosure teaches a non-linear approach, in which each subsequent HTP genetic engineering round is based on genetic variation identified in any previous round of genetic engineering, including previously conducted analysis, and separate HTP genetic engineering branches.
- the genetic design libraries of the present disclosure comprise at least 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 50, 51 , 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91 , 92, 93, 94, 95, 96, 97, 98, 99, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375
- the present disclosure teaches a high-throughput (HTP) method of genomic engineering to evolve an E. coli strain to acquire a desired phenotype, comprising: a) perturbing the genomes of an initial plurality of E. coli strains having the same strain background, to thereby create an initial HTP genetic design E. coli strain library comprising individual strains with unique genetic variations; b) screening and selecting individual strains of the initial HTP genetic design E. coli strain library for the desired phenotype; c) providing a subsequent plurality of E. coli microbes that each comprise a unique combination of genetic variation, said genetic variation selected from the genetic variation present in at least two individual E.
- HTP high-throughput
- the present disclosure teaches that the initial HTP genetic design E. coli strain library is at least one selected from the group consisting of a promoter swap microbial strain library, SNP swap microbial strain library, start/stop codon microbial strain library, optimized sequence microbial strain library, a terminator swap microbial strain library, a protein solubility tag microbial strain library, a protein degradation tag microbial strain library or any combination thereof.
- the present disclosure teaches methods of making a subsequent plurality of E. coli strains that each comprise a unique combination of genetic variations, wherein each of the combined genetic variations is derived from the initial HTP genetic design E. coli strain library or the HTP genetic design E. coli strain library of the preceding step.
- the combination of genetic variations in the subsequent plurality of E. coli strains will comprise a subset of all the possible combinations of the genetic variations in the initial HTP genetic design E. coli strain library or the HTP genetic design E. coli strain library of the preceding step.
- the present disclosure teaches that the subsequent HTP genetic design E. coli strain library is a full combinatorial strain library derived from the genetic variations in the initial HTP genetic design E. coli strain library or the HTP genetic design E. coli strain library of the preceding step.
- a partial combinatorial of said variations could include a subsequent HTP genetic design E. coli strain library comprising three strains with each comprising either the AB, AC, or AD unique combinations of genetic variations (order in which the mutations are represented is unimportant).
- a full combinatorial E. coli strain library derived from the genetic variations of the HTP genetic design library of the preceding step would include six microbes, each comprising either AB, AC, AD, BC, BD, or CD unique combinations of genetic variations.
- the methods of the present disclosure teach perturbing the genome of E. coli utilizing at least one method selected from the group consisting of: random mutagenesis, targeted sequence insertions, targeted sequence deletions, targeted sequence replacements, or any combination thereof.
- the initial plurality of E. coli comprise unique genetic variations derived from an industrial production E. coli strain.
- the initial plurality of E. coli comprise industrial production E. coli strains denoted SiGeni and any number of subsequent microbial generations derived therefrom denoted S n Gen n .
- the present disclosure teaches a method for generating a SNP swap E. coli strain library, comprising the steps of: a) providing a reference E. coli strain and a second E. coli strain, wherein the second E. coli strain comprises a plurality of identified genetic variations selected from single nucleotide polymorphisms, DNA insertions, and DNA deletions, which are not present in the reference strain; b) perturbing the genome of either the reference strain, or the second strain, to thereby create an initial SNP swap E. coli strain library comprising a plurality of individual E.
- the genome of the reference E. coli strain is perturbed to add one or more of the identified single nucleotide polymorphisms, DNA insertions, or DNA deletions, which are found in the second E. coli strain.
- the genome of the second E. coli strain is perturbed to remove one or more of the identified single nucleotide polymorphisms, DNA insertions, or DNA deletions, which are not found in the reference E. coli strain.
- the genetic variations of the SNP swap library will comprise a subset of all the genetic variations identified between the reference E. coli strain and the second E. coli strain.
- the genetic variations of the SNP swap library will comprise all of the identified genetic variations identified between the reference E. coli strain and the second E. coli strain.
- the present disclosure teaches a method for rehabilitating and improving the phenotypic performance of an industrial E. coli strain, comprising the steps of: a) providing a parental lineage E. coli strain and an industrial E. coli strain derived therefrom, wherein the industrial strain comprises a plurality of identified genetic variations selected from single nucleotide polymorphisms, DNA insertions, and DNA deletions, not present in the parental lineage strain; b) perturbing the genome of either the parental lineage strain, or the industrial strain, to thereby create an initial SNP swap E.
- coli strain library comprising a plurality of individual strains with unique genetic variations found within each strain of said plurality of individual strains, wherein each of said unique genetic variations corresponds to a single genetic variation selected from the plurality of identified genetic variations between the parental lineage strain and the industrial strain; c) screening and selecting individual strains of the initial SNP swap E. coli strain library for phenotype performance improvements over a reference E. coli strain, thereby identifying unique genetic variations that confer said E. coli strains with phenotype performance improvements; d) providing a subsequent plurality of E. coli strains that each comprise a unique combination of genetic variation, said genetic variation selected from the genetic variation present in at least two individual strains screened in the preceding step, to thereby create a subsequent SNP swap E.
- the present disclosure teaches methods for rehabilitating and improving the phenotypic performance of an industrial E. coli strain, wherein the genome of the parental lineage E. coli strain is perturbed to add one or more of the identified single nucleotide polymorphisms, DNA insertions, or DNA deletions, which are found in the industrial E. coli strain.
- the present disclosure teaches methods for rehabilitating and improving the phenotypic performance of an industrial E. coli strain, wherein the genome of the industrial E. coli strain is perturbed to remove one or more of the identified single nucleotide polymorphisms, DNA insertions, or DNA deletions, which are not found in the parental lineage E. coli strain.
- the present disclosure teaches a method for generating a promoter swap E. coli strain library, said method comprising the steps of: a) providing a plurality of target genes endogenous to a base E. coli strain, and a promoter ladder, wherein said promoter ladder comprises a plurality of promoters exhibiting different expression profiles in the base ?. coli strain; b) engineering the genome of the base E. coli strain, to thereby create an initial promoter swap E. coli strain library comprising a plurality of individual E. coli strains with unique genetic variations found within each strain of said plurality of individual strains, wherein each of said unique genetic variations comprises one of the promoters from the promoter ladder operably linked to one of the target genes endogenous to the base E. coli strain.
- the present disclosure teaches a promoter swap method of genomic engineering to evolve an E. coli strain to acquire a desired phenotype, said method comprising the steps of: a) providing a plurality of target genes endogenous to a base ?. coli strain, and a promoter ladder, wherein said promoter ladder comprises a plurality of promoters exhibiting different expression profiles in the base E. coli strain; b) engineering the genome of the base E. coli strain, to thereby create an initial promoter swap E. coli strain library comprising a plurality of individual E.
- each of said unique genetic variations comprises one of the promoters from the promoter ladder operably linked to one of the target genes endogenous to the base E. coli strain; c) screening and selecting individual strains of the initial promoter swap E. coli strain library for the desired phenotype; d) providing a subsequent plurality of E. coli strains that each comprise a unique combination of genetic variation, said genetic variation selected from the genetic variation present in at least two individual strains screened in the preceding step, to thereby create a subsequent promoter swap E. coli strain library; e) screening and selecting individual strains of the subsequent promoter swap E.
- coli strain library for the desired phenotype; f) repeating steps d) -e) one or more times, in a linear or non-linear fashion, until a microbe has acquired the desired phenotype, wherein each subsequent iteration creates a new promoter swap E. coli strain library comprising individual strains harboring unique genetic variations that are a combination of genetic variation selected from amongst at least two individual strains of a preceding promoter swap E. coli strain library.
- the present disclosure teaches a method for generating a terminator swap E. coli strain library, said method comprising the steps of: a) providing a plurality of target genes endogenous to a base E. coli strain, and a terminator ladder, wherein said terminator ladder comprises a plurality of terminators exhibiting different expression profiles in the base E. coli strain; b) engineering the genome of the base E. coli strain, to thereby create an initial terminator swap E. coli strain library comprising a plurality of individual strains with unique genetic variations found within each strain of said plurality of individual strains, wherein each of said unique genetic variations comprises one of the target genes endogenous to the base E. coli strain operably linked to one or more of the terminators from the terminator ladder.
- the present disclosure teaches a terminator swap method of genomic engineering to evolve an E. coli strain to acquire a desired phenotype, said method comprising the steps of: a) providing a plurality of target genes endogenous to a base E. coli strain, and a terminator ladder, wherein said terminator ladder comprises a plurality of terminators exhibiting different expression profiles in the base E. coli strain; b) engineering the genome of the base E. coli strain, to thereby create an initial terminator swap E. coli strain library comprising a plurality of individual E. coli strains with unique genetic variations found within each strain of said plurality of individual strains, wherein each of said unique genetic variations comprises one of the target genes endogenous to the base E.
- coli strain operably linked to one or more of the terminators from the terminator ladder; c) screening and selecting individual microbial strains of the initial terminator swap E. coli strain library for the desired phenotype; d) providing a subsequent plurality of E. coli strains that each comprise a unique combination of genetic variation, said genetic variation selected from the genetic variation present in at least two individual strains screened in the preceding step, to thereby create a subsequent terminator swap E. coli strain library; e) screening and selecting individual strains of the subsequent terminator swap E.
- coli strain library for the desired phenotype; f) repeating steps d)-e) one or more times, in a linear or non-linear fashion, until a microbe has acquired the desired phenotype, wherein each subsequent iteration creates a new terminator swap E. coli strain library comprising individual strains harboring unique genetic variations that are a combination of genetic variation selected from amongst at least two individual strains of a preceding terminator swap E. coli strain library.
- the present disclosure teaches iteratively improving the design of candidate E. coli strains by (a) accessing a predictive model populated with a training set comprising (1) inputs representing genetic changes to one or more background E. coli strains and (2) corresponding performance measures; (b) applying test inputs to the predictive model that represent genetic changes, the test inputs corresponding to candidate E. coli strains incorporating those genetic changes; (c) predicting phenotypic performance of the candidate E. coli strains based at least in part upon the predictive model; (d) selecting a first subset of the candidate E. coli strains based at least in part upon their predicted performance; (e) obtaining measured phenotypic performance of the first subset of the candidate E.
- the genetic changes represented by the test inputs comprise genetic changes to the one or more background E.
- selection of the first subset may be based on epistatic effects. This may be achieved by: during a first selection of the first subset: determining degrees of dissimilarity between performance measures of the one or more background E. coli strains in response to application of a plurality of respective inputs representing genetic changes to the one or more background E. coli strains; and selecting for inclusion in the first subset at least two candidate E. coli strains based at least in part upon the degrees of dissimilarity in the performance measures of the one or more background E. coli strains in response to application of genetic changes incorporated into the at least two candidate E. coli strains.
- the present invention teaches applying epistatic effects in the iterative improvement of candidate E. coli strains, the method comprising: obtaining data representing measured performance in response to corresponding genetic changes made to at least one E. coli background strain; obtaining a selection of at least two genetic changes based at least in part upon a degree of dissimilarity between the corresponding responsive performance measures of the at least two genetic changes, wherein the degree of dissimilarity relates to the degree to which the at least two genetic changes affect their corresponding responsive performance measures through different biological pathways; and designing genetic changes to an E. coli background strain that include the selected genetic changes.
- the E. coli background strain for which the at least two selected genetic changes are designed is the same as the at least one E. coli background strain for which data representing measured responsive performance was obtained.
- the present disclosure teaches HTP E. coli strain improvement methods utilizing only a single type of genetic library.
- the present disclosure teaches HTP E. coli strain improvement methods utilizing only SNP swap libraries.
- the present disclosure teaches HTP E. coli strain improvement methods utilizing only PRO swap libraries.
- the present disclosure teaches HTP E. coli strain improvement methods utilizing only STOP swap libraries.
- the present disclosure teaches HTP E. coli strain improvement methods utilizing only Start/Stop Codon swap libraries.
- the present disclosure teaches HTP E. coli strain improvement methods utilizing two or more types of genetic libraries.
- the present disclosure teaches HTP E. coli strain improvement methods combining SNP swap and PRO swap libraries.
- the present disclosure teaches HTP E. coli strain improvement methods combining SNP swap and STOP swap libraries.
- the present disclosure teaches HTP E. coli strain improvement methods combining PRO swap and STOP swap libraries.
- the present disclosure teaches HTP E. coli strain improvement methods utilizing multiple types of genetic libraries (see, for example, Figure 5).
- the genetic libraries are combined to produce combination mutations (e.g., promoter/terminator combination ladders applied to one or more genes).
- the HTP E. coli strain improvement methods of the present disclosure can be combined with one or more traditional strain improvement methods.
- the HTP E. coli strain improvement methods of the present disclosure result in an improved E. coli host cell. That is, the present disclosure teaches methods of improving one or more E. coli host cell properties.
- the improved E. coli host cell property is selected from the group consisting of: volumetric productivity, specific productivity, yield or titre, of a product of interest produced by the E. coli host cell.
- the improved E. coli host cell property is volumetric productivity.
- the improved E. coli host cell property is specific productivity.
- the improved E. coli host cell property is yield.
- the HTP E. coli strain improvement methods of the present disclosure result in an an E. coli host cell that exhibits a 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 75%, 7
- the HTP E. coli strain improvement methods of the present disclosure are selected from the group consisting of SNP swap, PRO swap, STOP swap, SOLUBILITY TAG swap, DEGRADATION TAG swap, and combinations thereof.
- the SNP swap methods of the present disclosure result in an E.
- coli host cell that exhibits a 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%
- the PRO swap methods of the present disclosure result in an E. coli host cell that exhibits a 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%,
- the TERMINATOR swap methods of the present disclosure result in an E. coli host cell that exhibits a 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%,
- the SOLUBILITY TAG swap methods of the present disclosure result in an E. coli host cell that exhibits a 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%,
- the DEGRADATION TAG swap methods of the present disclosure result in an E. coli host cell that exhibits a 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 75%, 7
- the present disclosure teaches a method for generating a protein solubility tag swap E. coli strain library, comprising the steps of: a. providing a plurality of target genes endogenous to a base E. coli strain, and a solubility tag ladder, wherein said solubility tag ladder comprises a plurality of solubility tags exhibiting different solubility profiles in the base E. coli strain; and b. engineering the genome of the base E. coli strain, to thereby create an initial solubility tag swap E. coli strain library comprising a plurality of individual E. coli strains with unique genetic variations found within each strain of said plurality of individual E. coli strains, wherein each of said unique genetic variations comprises one or more of the solubility tags from the solubility tag ladder operably linked to one of the target genes endogenous to the base E. coli strain.
- the present disclosure teaches a protein solubility tag swap method for improving the phenotypic performance of a production E. coli strain, comprising the steps of: providing a plurality of target genes endogenous to a base E. coli strain, and a solubility tag ladder, wherein said solubility tag ladder comprises a plurality of solubility tags exhibiting different expression profiles in the base E. coli strain; engineering the genome of the base E. coli strain, to thereby create an initial solubility tag swap E. coli strain library comprising a plurality of individual E. coli strains with unique genetic variations found within each strain of said plurality of individual E.
- each of said unique genetic variations comprises one or more of the solubility tags from the solubility tag ladder operably linked to one of the target genes endogenous to the base E. coli strain; screening and selecting individual E. coli strains of the initial solubility tag swap E. coli strain library for phenotypic performance improvements over a reference E. coli strain, thereby identifying unique genetic variations that confer phenotypic performance improvements; providing a subsequent plurality of E. coli microbes that each comprise a combination of unique genetic variations from the genetic variations present in at least two individual E. coli strains screened in the preceding step, to thereby create a subsequent solubility tag swap E. coli strain library; screening and selecting individual E.
- the subsequent solubility tag swap E. coli strain library is a full combinatorial library of the initial solubility tag swap E. coli strain library.
- the subsequent solubility tag swap E. coli strain library is a subset of a full combinatorial library of the initial solubility tag swap E. coli strain library.
- the subsequent solubility tag swap E. coli strain library is a full combinatorial library of a preceding solubility tag swap E. coli strain library.
- the subsequent solubility tag swap E. coli strain library is a subset of a full combinatorial library of a preceding solubility tag swap E. coli strain library.
- steps d)-e) are repeated until the phenotypic performance of an E. coli strain of a subsequent solubility tag swap E. coli strain library exhibits at least a 10% increase in a measured phenotypic variable compared to the phenotypic performance of the production E. coli strain.
- steps d)-e) are repeated until the phenotypic performance of an E. coli strain of a subsequent solubility tag swap E. coli strain library exhibits at least a one-fold increase in a measured phenotypic variable compared to the phenotypic performance of the production E. coli strain.
- the improved phenotypic performance of step f) is selected from the group consisting of: volumetric productivity of a product of interest, specific productivity of a product of interest, yield of a product of interest, titer of a product of interest, and combinations thereof.
- the improved phenotypic performance of step f) is: increased or more efficient production of a product of interest, said product of interest selected from the group consisting of: a small molecule, enzyme, peptide, amino acid, organic acid, synthetic compound, fuel, alcohol, primary extracellular metabolite, secondary extracellular metabolite, intracellular component molecule, and combinations thereof.
- the present disclosure teaches a method for generating a protein degradation tag swap E. coli strain library, comprising the steps of: a. providing a plurality of target genes endogenous to a base E. coli strain, and a degradation tag ladder, wherein said degradation tag ladder comprises a plurality of degradation tags exhibiting different solubility profiles in the base E. coli strain; and b. engineering the genome of the base E. coli strain, to thereby create an initial degradation tag swap E. coli strain library comprising a plurality of individual E. coli strains with unique genetic variations found within each strain of said plurality of individual E. coli strains, wherein each of said unique genetic variations comprises one or more of the degradation tags from the degradation tag ladder operably linked to one of the target genes endogenous to the base E. coli strain.
- the present disclosure teaches a protein degradation tag swap method for improving the phenotypic performance of a production E. coli strain, comprising the steps of: providing a plurality of target genes endogenous to a base E. coli strain, and a degradation tag ladder, wherein said degradation tag ladder comprises a plurality of degradation tags exhibiting different expression profiles in the base E. coli strain; engineering the genome of the base E. coli strain, to thereby create an initial degradation tag swap E. coli strain library comprising a plurality of individual E. coli strains with unique genetic variations found within each strain of said plurality of individual E.
- each of said unique genetic variations comprises one or more of the degradation tags from the degradation tag ladder operably linked to one of the target genes endogenous to the base ?. coli strain; screening and selecting individual E. coli strains of the initial degradation tag swap E. coli strain library for phenotypic performance improvements over a reference E. coli strain, thereby identifying unique genetic variations that confer phenotypic performance improvements; providing a subsequent plurality of E. coli microbes that each comprise a combination of unique genetic variations from the genetic variations present in at least two individual E. coli strains screened in the preceding step, to thereby create a subsequent degradation tag swap E. coli strain library; screening and selecting individual E. coli strains of the subsequent degradation tag swap E.
- E. coli strain library for phenotypic performance improvements over the reference E. coli strain, thereby identifying unique combinations of genetic variation that confer additional phenotypic performance improvements; and repeating steps d)-e) one or more times, in a linear or non-linear fashion, until an E. coli strain exhibits a desired level of improved phenotypic performance compared to the phenotypic performance of the production E. coli strain, wherein each subsequent iteration creates a new degradation tag swap E. coli strain library of microbial strains, where each strain in the new library comprises genetic variations that are a combination of genetic variations selected from amongst at least two individual E. coli strains of a preceding library.
- the subsequent degradation tag swap E. coli strain library is a full combinatorial library of the initial degradation tag swap E. coli strain library.
- the subsequent degradation tag swap E. coli strain library is a subset of a full combinatorial library of the initial degradation tag swap E. coli strain library.
- the subsequent degradation tag swap E. coli strain library is a full combinatorial library of a preceding degradation tag swap E. coli strain library.
- the subsequent degradation tag swap E. coli strain library is a subset of a full combinatorial library of a preceding degradation tag swap E. coli strain library.
- steps d)-e) are repeated until the phenotypic performance of an E. coli strain of a subsequent degradation tag swap E. coli strain library exhibits at least a 10% increase in a measured phenotypic variable compared to the phenotypic performance of the production E. coli strain.
- steps d)-e) are repeated until the phenotypic performance of an E. coli strain of a subsequent degradation tag swap E. coli strain library exhibits at least a one-fold increase in a measured phenotypic variable compared to the phenotypic performance of the production E. coli strain.
- the improved phenotypic performance of step f) is selected from the group consisting of: volumetric productivity of a product of interest, specific productivity of a product of interest, yield of a product of interest, titer of a product of interest, and combinations thereof.
- the improved phenotypic performance of step f) is: increased or more efficient production of a product of interest, said product of interest selected from the group consisting of: a small molecule, enzyme, peptide, amino acid, organic acid, synthetic compound, fuel, alcohol, primary extracellular metabolite, secondary extracellular metabolite, intracellular component molecule, and combinations thereof.
- the present disclosure teaches a chimeric synthetic promoter operably linked to a heterologous gene for expression in a microbial host cell, wherein the chimeric synthetic promoter is 60-90 nucleotides in length and consists of a distal portion of lambda phage PR promoter, variable -35 and -10 regions of lambda phage PL and pR promoters that are each six nucleotides in length, core portions of lambda phage PL and pR promoters and a 5' UTR/Ribosomal Binding Site (RBS) portion of lambda phage pR promoter.
- the chimeric synthetic promoter is 60-90 nucleotides in length and consists of a distal portion of lambda phage PR promoter, variable -35 and -10 regions of lambda phage PL and pR promoters that are each six nucleotides in length, core portions of lambda phage PL and p
- nucleic acid sequences of the distal portion of the lambda phage PR promoter, the variable -35 and -10 regions of the lambda phage PL and pR promoters, the core portions of the the lambda phage PL and pR promoters and the 5' UTR/Ribosomal Binding Site (RBS) portion of the lambda phage ps. promoter are selected from the nucleic acid sequences found in Table 1.5.
- the present disclosure teaches a chimeric synthetic promoter operably linked to a heterologous gene for expression in a microbial host cell, wherein the chimeric synthetic promoter is 60-90 nucleotides in length and consists of a distal portion of lambda phage PR promoter, variable -35 and -10 regions of lambda phage pL and pR promoters that are each six nucleotides in length, core portions of lambda phage pL and pR promoters and a 5' UTR/Ribosomal Binding Site (RBS) portion of the promoter of the E. coli acs gene.
- the chimeric synthetic promoter is 60-90 nucleotides in length and consists of a distal portion of lambda phage PR promoter, variable -35 and -10 regions of lambda phage pL and pR promoters that are each six nucleotides in length, core portions of lambda phag
- nucleic acid sequences of the distal portion of the lambda phage PR promoter, the variable -35 and -10 regions of the lambda phage pL and pR promoters, the core portions of the the lambda phage pL and pR promoters and the 5' UTR/Ribosomal Binding Site (RBS) portion of the promoter of the E. coli acs gene are selected from the nucleic acid sequences found in Table 1.5.
- the chimeric synthetic promoter consists of a nucleic acid sequence selected from SEQ ID NOs. 132-152, 159-160, 162, 165, 174-175, 188, 190, 199-201 or 207.
- the chimeric synthetic promoter consists of a nucleic acid sequence selected from SEQ ID NOs. 153-158, 161 , 163-164, 166-173, 176-187, 189, 191 -198 or 202-206.
- the microbial host cell is E. coli.
- the heterologous gene encodes a protein product of interest found in Table 2.
- the heterologous gene is a gene that is part of a lysine biosynthetic pathway.
- the heterologous gene is selected from the asd gene, the ask gene, the hom gene, the dapA gene, the dapB gene, the dapD gene, the ddh gene, the argD gene, the dapE gene, the dapF gene, the lysA gene, the lysE gene, the zwf gene, the pgi gene, the ktk gene, the fbp gene, the ppc gene, the pck gene, the ddx gene, the pyc gene or the icd gene.
- the heterologous gene is a gene that is part of a lycopene biosynthetic pathway.
- the heterologous gene is selected from the dxs gene, the ispC gene, the ispE gene, the ispD gene, the ispF gene, the ispG gene, the ispH gene, the idi gene, the ispA gene, the ispB gene, the crtE gene, the crtB gene, the crtl gene, the crtY gene , the ymgA gene, the dxr gene, the elbA gene, the gdhA gene, the appY gene, the elbB gene, or the ymgB gene.
- the heterologous gene encodes a biopharmaceutical or is a gene in a pathway for generating a biopharmaceutical.
- the biopharmaceutical is selected from humulin (rh insulin), intronA (interferon alpha2b), roferon (interferon alpha2a), humatrope (somatropin rh growth hormone), neupogen (filgrastim), detaferon (interferon beta- lb), lispro (fast-acting insulin), rapilysin (reteplase), infergen (interferon alfacon-1), glucagon, beromun (tasonermin), ontak (denileukin diftitox), lantus (long-acting insulin glargine), kineret (anakinra), natrecor (nesiritide), somavert (pegvisomant), calcitonin (recombinant calcitonin salmon), lucentis (ranibizumab), schoolact (human parathyroid hormone), kyrstexxal (rh
- the present disclosure teaches a heterologous gene operably linked to a chimeric synthetic promoter with a nucleic acid sequence selected from SEQ ID NOs. 132- 207.
- the heterologous gene encodes a protein product of interest found in Table 2.
- the heterologous gene is a gene that is part of a lysine biosynthetic pathway.
- the heterologous gene is selected from the asd gene, the ask gene, the horn gene, the dapA gene, the dapB gene, the dapD gene, the ddh gene, the argD gene, the dapE gene, the dapF gene, the lysA gene, the lysE gene, the zwf gene, the pgi gene, the ktk gene, the fbp gene, the ppc gene, the pck gene, the ddx gene, the pyc gene or the icd gene.
- the heterologous gene is a gene that is part of a lycopene biosynthetic pathway.
- the heterologous gene is selected from the dxs gene, the ispC gene, the ispE gene, the ispD gene, the ispF gene, the ispG gene, the ispH gene, the idi gene, the ispA gene, the ispB gene, the crtE gene, the crtB gene, the crtl gene, the crtY gene , the ymgA gene, the dxr gene, the elbA gene, the gdhA gene, the appY gene, the elbB gene, or the ymgB gene.
- the heterologous gene encodes a biopharmaceutical or is a gene in a pathway for generating a biopharmaceutical.
- the biopharmaceutical is selected from humulin (rh insulin), intronA (interferon alpha2b), roferon (interferon alpha2a), humatrope (somatropin rh growth hormone), neupogen (filgrastim), detaferon (interferon beta- lb), lispro (fast-acting insulin), rapilysin (reteplase), infergen (interferon alfacon-1), glucagon, beromun (tasonermin), ontak (denileukin diftitox), lantus (long-acting insulin glargine), kineret (anakinra), natrecor (nesiritide), somavert (pegvisomant), calcit
- FIGURE 1 depicts a DNA recombination method of the present disclosure for increasing variation in diversity pools.
- DNA sections such as genome regions from related species, can be cut via physical or enzymatic/chemical means.
- the cut DNA regions are melted and allowed to reanneal, such that overlapping genetic regions prime polymerase extension reactions. Subsequent melting/extension reactions are carried out until products are reassembled into chimeric DNA, comprising elements from one or more starting sequences.
- FIGURE 2 outlines methods of the present disclosure for generating new host E. coli strains with selected sequence modifications (e.g., 100 SNPs to swap).
- the method comprises (1) desired DNA inserts are designed and generated by combining one or more synthesized oligos in an assembly reaction, (2) DNA inserts are cloned into transformation plasmids, (3) completed plasmids are transferred into desired production strains, where they are integrated into the host strain genome, and (4) selection markers and other unwanted DNA elements are looped out of the host strain.
- Each DNA assembly step may involve additional quality control (QC) steps, such as cloning plasmids into E. coli bacteria for amplification and sequencing.
- QC quality control
- FIGURE 3 depicts assembly of transformation plasmids of the present disclosure, and their integration into a host E. coli genome.
- the insert DNA is generated by combining one or more synthesized oligos in an assembly reaction.
- DNA inserts containing the desired sequence are flanked by regions of DNA homologous to the targeted region of the genome. These homologous regions facilitate genomic integration, and, once integrated, form direct repeat regions designed for looping out vector backbone DNA in subsequent steps.
- Assembled plasmids contain the insert DNA, and optionally, one or more selection markers.
- FIGURE 4 depicts a procedure for looping-out selected regions of DNA from host ?. coli strains. Direct repeat regions of the inserted DNA and host genome can "loop out" in a recombination event. Cells counter selected for the selection marker contain deletions of the loop DNA flanked by the direct repeat regions.
- FIGURE 5 depicts an embodiment of the E. coli strain improvement process of the present disclosure.
- Host strain sequences containing genetic modifications are tested for strain performance improvements in various strain backgrounds (Strain Build).
- Strains exhibiting beneficial mutations are analyzed (Hit ID and Analysis) and the data is stored in libraries for further analysis (e.g., SNP swap libraries, PRO swap libraries, and combinations thereof, among others).
- Selection rules of the present disclosure generate new proposed E. coli host strain sequences based on the predicted effect of combining elements from one or more libraries for additional iterative analysis.
- FIGURE 6A-B depicts the DNA assembly, transformation, and E. coli strain screening steps of one of the embodiments of the present disclosure.
- FIGURE 6A depicts the steps for building DNA fragments, cloning said DNA fragments into vectors, transforming said vectors into host E. coli strains, and looping out selection sequences through counter selection.
- FIGURE 6B depicts the steps for high-throughput culturing, screening, and evaluation of selected E. coli host strains. This figure also depicts the optional steps of culturing, screening, and evaluating selected E. coli strains in culture tanks.
- FIGURE 7 depicts one embodiment of the automated system of the present disclosure.
- the present disclosure teaches use of automated robotic systems with various modules capable of cloning, transforming, culturing, screening and/or sequencing host E. coli.
- FIGURE 8 depicts an overview of an embodiment of the E. coli strain improvement program of the present disclosure.
- FIGURE 9 is a representation of the genome of Corynebacterium glutamicum, comprising around 3.2 million base pairs.
- FIGURE 10 depicts the results of a transformation experiment of the present disclosure.
- DNA inserts ranging from 0.5kb to 5.0kb were targeted for insertion into various regions (shown as relative positions 1 -24) of the genome of Corynebacterium glutamicum. Light color indicates successful integration, while darker color indicates insertion failure.
- FIGURE 11 depicts the results of a second round HTP engineering PRO swap program.
- Top promoter: gene combinations identified during the first PRO swap round were analyzed according to the methods of the present disclosure to identify combinations of said mutations that would be likely to exhibit additive or combinatorial beneficial effects on host performance.
- Second round PRO swap mutants thus comprised pair combinations of various promoter: : gene mutations. The resulting second round mutants were screened for differences in host cell yield of a selected biomolecule. A combination pair of mutations that had been predicted to exhibit beneficial effects is emphasized with a circle.
- FIGURE 12 depicts the results of an experiment testing successful plasmid assembly for plasmids transformed into E. coli. Picking four colonies is sufficient to achieve 13% failure rate for plasmids containing 1 and 2kb insertion sequences. Larger insertions may require additional colony screening to achieve consistent results.
- FIGURE 13 depicts results of an experiment testing successful transformation of Corynebacterium glutamicum with insertion vectors. DNA insert sizes of 2 and 5 kb exhibited high transformation rates with low assembly failure rates.
- FIGURE 14 depicts results of loop out selections in Corynebacterium glutamicum. Sucrose resistance of transformed bacteria indicates loop out of sacB selection marker. DNA insert size does not appear to impact loop out efficiency.
- FIGURE 15 is a similarity matrix computed using the correlation measure.
- the matrix is a representation of the functional similarity between SNP variants.
- the consolidation of SNPs with low functional similarity is expected to have a higher likelihood of improving strain performance, as opposed to the consolidation of SNPs with higher functional similarity.
- FIGURE 16A-B depicts the results of an epistasis mapping experiment. Combination of SNPs and PRO swaps with low functional similarities yields improved strain performance.
- FIGURE 16A depicts a dendrogram clustered by functional similarity of all the SNPs/PRO swaps.
- FIGURE 16B depicts host strain performance of consolidated SNPs as measured by product yield. Greater cluster distance correlates with improved consolidation performance of the host strain.
- FIGURE 17A-B depicts SNP differences among strain variants in the diversity pool.
- FIGURE 17A depicts the relationship among the strains of this experiment.
- Strain A is the wild- type host strain.
- Strain B is an intermediate engineered strain.
- Strain C is the industrial production strain.
- FIGURE 17B is a graph identifying the number of unique and shared SNPs in each strain.
- FIGURE 18 depicts a first-round SNP swapping experiment according to the methods of the present disclosure. (1) all the SNPs from C will be individually and/or combinatorially cloned into the base A strain ("wave up" A to C). (2) all the SNPs from C will be individually and/or combinatorially removed from the commercial strain C ("wave down" C to A).
- all the SNPs from B will be individually and/or combinatorially cloned into the base A strain (wave up A to B).
- all the SNPs from B will be individually and/or combinatorially removed from the commercial strain B (wave down B to A).
- all the SNPs unique to C will be individually and/or combinatorially cloned into the commercial B strain (wave up B to C).
- all the SNPs unique to C will be individually and/or combinatorially removed from the commercial strain C (wave down C to B).
- FIGURE 19 illustrates example gene targets to be utilized in a promoter swap process.
- the 4 underlined are diverting genes that can be targeted for downregulaton, while the remaining 19 on pathway genes can be targeted for overexpression.
- FIGURE 20 illustrates an exemplary promoter library that is being utilized to conduct a promoter swap process for the identified gene targets.
- Promoters utilized in the PRO swap (i.e. promoter swap) process are Pi-Ps, the sequences and identity of which can be found in Table 1.
- FIGURE 21 illustrates the different available approaches to promoter swapping depending on whether the targeted gene comprises its own promoter, or is part of an operon.
- FIGURE 22 depicts exemplary HTP promoter swapping data showing modifications that significantly affect performance on lysine yield.
- the X-axis represents different strains within the promoter swap genetic design microbial strain library, and the Y-axis includes relative lysine yield values for each strain.
- Each letter on the graph represents a PRO swap target gene.
- Each data point represents a replicate.
- the data demonstrates that a molecular tool adapted for HTP applications, as described herein (i.e. PRO swap), is able to efficiently create and optimize microbial strain performance for the production of a compound or molecule of interest. In this case, the compound of interest was lysine; however, the taught PRO swap molecular tool can be utilized to optimize and/or increase the production of any compound of interest.
- FIGURE 23 illustrates the distribution of relative strain performances for the input data under consideration.
- a relative performance of zero indicates that the engineered strain performed equally well to the in-plate base strain.
- the processes described herein are designed to identify the strains that are likely to perform significantly above zero.
- FIGURE 24 illustrates the linear regression coefficient values, which depict the average change (increase or decrease) in relative strain performance associated with each genetic change incorporated into the depicted strains.
- FIGURE 25 illustrates the composition of changes for the top 100 predicted strain designs.
- the x-axis lists the pool of potential genetic changes (dss mutations are SNP swaps, and Peg mutations are PRO swaps), and the y-axis shows the rank order. Black cells indicate the presence of a particular change in the candidate design, while white cells indicate the absence of that change.
- all of the top 100 designs contain the changes pcg3121_pgi, pcgl860_pyc, dss_339, and pcg0007_39_lysa.
- the top candidate design contains the changes dss_034, dss_009.
- FIGURE 26 depicts the DNA assembly and transformation steps of one of the embodiments of the present disclosure.
- the flow chart depicts the steps for building DNA fragments, cloning said DNA fragments into vectors, transforming said vectors into host E. coli strains, and looping out selection sequences through counter selection.
- FIGURE 27 depicts the steps for high-throughput culturing, screening, and evaluation of selected host ?. coli strains. This figure also depicts the optional steps of culturing, screening, and evaluating selected E. coli strains in culture tanks.
- FIGURE 28 depicts expression profiles of illustrative promoters exhibiting a range of regulatory expression, according to the promoter ladders of the present disclosure.
- Promoter A expression peaks at the lag phase of bacterial cultures, while promoter B and C peak at the exponential and stationary phase, respectively.
- FIGURE 29 depicts expression profiles of illustrative promoters exhibiting a range of regulatory expression, according to the promoter ladders of the present disclosure.
- Promoter A expression peaks immediately upon addition of a selected substrate, but quickly returns to undetectable levels as the concentration of the substrate is reduced.
- Promoter B expression peaks immediately upon addition of the selected substrate and lowers slowly back to undetectable levels together with the corresponding reduction in substrate.
- Promoter C expression peaks upon addition of the selected substrate, and remains highly expressed throughout the culture, even after the substrate has dissipated.
- FIGURE 30 depicts expression profiles of illustrative promoters exhibiting a range of constitutive expression levels, according to the promoter ladders of the present disclosure.
- Promoter A exhibits the lowest expression, followed by increasing expression levels promoter B and C, respectively.
- FIGURE 31 diagrams an embodiment of LIMS system of the present disclosure for ?, coli strain improvement.
- FIGURE 32 diagrams a cloud computing implementation of embodiments of the LIMS system of the present disclosure.
- FIGURE 33 depicts an embodiment of the iterative predictive strain design workflow of the present disclosure.
- FIGURE 34 diagrams an embodiment of a computer system, according to embodiments of the present disclosure.
- FIGURE 35 depicts the workflow associated with the DNA assembly according to one embodiment of the present disclosure. This process is divided up into 4 stages: parts generation, plasmid assembly, plasmid QC, and plasmid preparation for transformation.
- parts generation oligos designed by Laboratory Information Management System (LIMS) are ordered from an oligo sequencing vendor and used to amplify the target sequences from the host organism via PCR. These PCR parts are cleaned to remove contaminants and assessed for success by fragment analysis, in silico quality control comparison of observed to theoretical fragment sizes, and DNA quantification.
- the parts are transformed into yeast along with an assembly vector and assembled into plasmids via homologous recombination. Assembled plasmids are isolated from yeast and transformed into E.
- LIMS Laboratory Information Management System
- FIGURE 36 depicts the results of an experiment characterizing the effects of Terminators T1-T8 in two media over two time points. Conditions A and C represent the two time points for the BHI media, while the B and D points represent the two time points for the HTP test media.
- FIGURE 37 depicts the results of an experiment comparing the effectiveness of traditional strain improvement approaches such as UV mutagenesis against the HTP engineering methodologies of the present disclosure.
- the vast majority of UV mutations produced no noticeable increase in host cell performance.
- PRO swap methodologies of the present disclosure produced a high proportion of mutants exhibiting 1.2 to 2 fold increases in host cell performance.
- FIGURE 38 depicts the results of a first round HTP engineering SNP swap program. 186 individual SNP mutations were identified and individually cloned onto a base strain. The resulting mutants were screened for differences in host cell yield of a selected biomolecule.
- FIGURE 39 depicts the results of a second round HTP engineering SNP swap program. 176 individual SNP mutations from a first round SNP swap program were individually cloned into a second round host cell strain containing a beneficial SNP identified during a first round SNP program. The resulting mutants thus represent the effect of two mutation combination pairs. Screening results for differences in host cell yield (Y-axis) and productivity (X-axis) for the selected biomolecule are shown.
- FIGURE 40 depicts the results of a tank fermentation validation experiment.
- the top mutation pairs from the second round of HTP SNP swap were cultured in fermentation tanks. Results for host cell yield and productivity for the selected biomolecule (i.e. lysine) are shown.
- the inventors utilized the PRO swap procedure to determine that a particular PRO swap mutant (zwf) exhibited increased yield of a selected biomolecule compared to base strain (i.e. compare base strain to base strain + zwf). Then, the inventors performed another round of genomic engineering, wherein a SNP swap procedure was used to determine beneficial SNP mutations that could affect yield of the biomolecule, when combined with said PRO swap mutant.
- FIGURE 41 depicts the results of a first round HTP engineering PRO swap program. Selected genes believed to be associated with host performance were combined with a promoter ladder to create a first round PRO swap library, according to the methods of the present disclosure. The resulting mutants were screened for differences in host cell yield of a selected biomolecule (i.e. lysine).
- a selected biomolecule i.e. lysine
- FIGURE 42 is a flowchart illustrating the consideration of epistatic effects in the selection of mutations for the design of a microbial strain, according to embodiments of the disclosure.
- FIGURE 43 depicts a Bicistronic Design (BCD) regulatory sequence, according to the present disclosure.
- BCDs can be used in place of traditional promoters in order to improve expression consistency between different promoter:: target genes combinations in PRO-swaps.
- BCDs comprise a promoter, a first ribosome binding site (SD1), a first cistronic sequence (Cisl), a second ribosome binding site (SD2), operably linked to a target gene of interest (Cis2).
- SD1 first ribosome binding site
- CD2 first cistronic sequence
- SD2 second ribosome binding site
- Cisl can be any pepti de-coding sequence. Additional information about BCD design and use is provided in later sections of the specification.
- FIGURE 44 is an illustration of pathway enzyme co-localization via recombinant DNA binding domains.
- An engineered cell encodes pathway enzymes Enzl-3 with DNA binding domains. When expressed, these enzymes bind to a scaffold DNA or other target location, which comprises DNA motifs that are recognized by the recombinant DNA binding domains fused to the pathway enzymes. When the fused DNA binding domains attach to their cognate DNA motifs on the scaffold plasmid, the enzymes are constrained close to one another in space, which can improve productivity of the pathway.
- FIGURE 45 is a schematic diagram for incorporation of nucleotide sequences encoding DNA binding domains into pathway enzymes.
- GOI encodes a pathway enzyme.
- E. coli cells are transformed with a plasmid encoding a mutant version of GOI that includes a nucleotide sequence that encodes a DNA binding domain (denoted with a star).
- the plasmid also encodes an antibiotic resistance marker (Ab) that allows for selection of loop in cells, and a counterselection marker (Counter) that allows for subsequent counterselection of loop out cells.
- Abs antibiotic resistance marker
- Counter counterselection marker
- the entire plasmid, including the mutant GOI is incorporated into the genome via homologous recombination (HR).
- HR homologous recombination
- some of the cells will revert to the native GOI sequence via HR, while others will undergo a HR event that leaves the mutant GOI in the genome.
- FIGURE 46 is a dot plot for the predicted performance vs measured performance of training data for a yield model of the present disclosure.
- the underlying model is a Kernel Ridge Regression model (with 4th order polynomial kernel).
- the model is trained on 1864 unique genetic constructs and associated phenotypic performance.
- the fitted model has an r2 value of 0.52.
- FIGURE 47 depicts the genetic makeup of candidate designs generated by the prediction algorithms of the present disclosure. These candidate designs were submitted for HTP build and analysis. Here the candidate design is defined as the combination of parent strain id and introduced mutation(s).
- FIGURE 48 is a dot plot of the predicted performance vs. measured performance of candidate designs generated by the prediction algorithms of the present disclosure, and built according the HTP build methods of the present disclosure. This figure demonstrates that the model may predict candidate strain performance within an acceptable degree of accuracy.
- FIGURE 49 is a box and whiskers plot depicting the yield percent change of candidate strains with respect to parent strains. On the y-axis, a value of 0.01 corresponds to 1%.
- strains designed by a computer model achieve measureable improvement over their corresponding parent strains. Additionally, the figure demonstrates that these model base strain improvements are comparable in magnitude to improvements achieved by human expert designed strains.
- FIGURE 50 illustrates the yield performance distribution for strains designed by the computer model (dark grey) and by a human expert (light grey). Computer-designed strains exhibited tighter distributions with higher median gains.
- FIGURE 51 is a box and whiskers plot depicting the absolute yield of candidate strains generated by the computer (light grey) or by a human expert (dark grey). Results are aggregated by parent strain.
- FIGURE 52 is a representation of the genome of Escherichia coli, comprising around 4.6 million base pairs.
- FIGURE 53 illustrates the effect of insulator and terminator parts in vector backbones on the efficiency of transformation and plasmid integration.
- FIGURE 54 illustrates the combinatorial design of synthetic promoter- 5 'UTR sequences from Table 1.4.
- FIGURE 55 depicts the plasmid map illustrating the components of the vector 1 backbone.
- FIGURE 56 depicts the plasmid map illustrating the components of the vector 2 backbone.
- FIGURE 57 depicts the plasmid map illustrating the components of the vector 3 backbone.
- FIGURE 58 depicts the plasmid map illustrating the components of the vector 4 backbone.
- FIGURE 59 depicts the E. coli lycopene biosynthetic pathway.
- FIGURE 60 depicts terminator edits at lycopene pathway targets idi and ymgA.
- the terminator TyjbE demonstrates decreased strain performance relative to the control, thus highlighting the utility of these library types for identifying critical pathway targets.
- FIGURE 61 depicts terminator edits at multiple lycopene pathway targets.
- FIGURE 62 depicts promoter (for comparison), degradation tag, and terminator swaps at lycopene pathway target dxs.
- the ssrA LAA degradation tag demonstrates improved strain performance relative to the control. This is unexpected as this strain is a combination of a PROSWP with a degradation tag at a single pathway target.
- the initial PROSWP is expected to increase protein abundance, and the degradation tag is expected to decrease protein abundance, thus demonstrating the utility of combinations of library types for tuning optimal strain performance.
- FIGURE 63 depicts solubility tag, promoter, and terminator swaps at lycopene pathway target gdhA.
- the solubility tag FH8 demonstrates improved strain performance relative to the control, but the GB1 solubility tag does not, thus demonstrating the necessity for evaluating libraries of each modification type.
- the terms "cellular organism” “microorganism” or “microbe” should be taken broadly. These terms are used interchangeably and include, but are not limited to, the two prokaryotic domains, Bacteria and Archaea, as well as certain eukaryotic fungi and protists.
- the disclosure refers to the "microorganisms” or “cellular organisms” or “microbes” of lists/tables and figures present in the disclosure. This characterization can refer to not only the identified taxonomic genera of the tables and figures, but also the identified taxonomic species, as well as the various novel and newly identified or designed strains of any organism in said tables or figures. The same characterization holds true for the recitation of these terms in other parts of the Specification, such as in the Examples.
- prokaryotes is art recognized and refers to cells which contain no nucleus or other cell organelles.
- the prokaryotes are generally classified in one of two domains, the Bacteria and the Archaea.
- the definitive difference between organisms of the Archaea and Bacteria domains is based on fundamental differences in the nucleotide base sequence in the 16S ribosomal RNA.
- the term "Archaea” refers to a categorization of organisms of the division Mendosicutes, typically found in unusual environments and distinguished from the rest of the prokaryotes by several criteria, including the number of ribosomal proteins and the lack of muramic acid in cell walls.
- the Archaea consist of two phylogenetically-distinct groups: Crenarchaeota and Euryarchaeota.
- the Archaea can be organized into three types: methanogens (prokaryotes that produce methane); extreme halophiles (prokaryotes that live at very high concentrations of salt (NaCl); and extreme (hyper) thermophilus (prokaryotes that live at very high temperatures).
- methanogens prokaryotes that produce methane
- extreme halophiles prokaryotes that live at very high concentrations of salt (NaCl)
- extreme (hyper) thermophilus prokaryotes that live at very high temperatures.
- the Crenarchaeota consists mainly of hyperthermophilic sulfur-dependent prokaryotes and the Euryarchaeota contains the methanogens and extreme halophiles.
- Bacteria refers to a domain of prokaryotic organisms. Bacteria include at least 11 distinct groups as follows: (1) Gram-positive (gram+) bacteria, of which there are two major subdivisions: (1) high G+C group (Actinomycetes, Mycobacteria, Micrococcus, others) (2) low G+C group (Bacillus, Clostridia, Lactobacillus, Staphylococci, Streptococci, Mycoplasmas); (2) Proteobacteria, e.g., Purple photosynthetic+non-photosynthetic Gram-negative bacteria (includes most "common” Gram-negative bacteria); (3) Cyanobacteria, e.g., oxygenic phototrophs; (4) Spirochetes and related species; (5) Planctomyces; (6) Bacteroides, Flavobacteria; (7) Chlamydia; (8) Green sulfur bacteria; (9) Green non-sulfur bacteria
- a "eukaryote” is any organism whose cells contain a nucleus and other organelles enclosed within membranes. Eukaryotes belong to the taxon Eukarya or Eukaryota.
- the defining feature that sets eukaryotic cells apart from prokaryotic cells is that they have membrane-bound organelles, especially the nucleus, which contains the genetic material, and is enclosed by the nuclear envelope.
- the terms "genetically modified host cell,” “recombinant host cell,” and “recombinant strain” are used interchangeably herein and refer to host cells that have been genetically modified by the cloning and transformation methods of the present disclosure.
- the terms include a host cell (e.g., bacteria, yeast cell, fungal cell, CHO, human cell, etc.) that has been genetically altered, modified, or engineered, such that it exhibits an altered, modified, or different genotype and/or phenotype (e.g., when the genetic modification affects coding nucleic acid sequences of the microorganism), as compared to the naturally-occurring organism from which it was derived. It is understood that in some embodiments, the terms refer not only to the particular recombinant host cell in question, but also to the progeny or potential progeny of such a host cell
- the term "genetically engineered” may refer to any manipulation of a host cell's genome (e.g. by insertion, deletion, mutation, or replacement of nucleic acids).
- control refers to an appropriate comparator host cell for determining the effect of a genetic modification or experimental treatment.
- the control host cell is a wild type cell.
- a control host cell is genetically identical to the genetically modified host cell, save for the genetic modification(s) differentiating the treatment host cell.
- the present disclosure teaches the use of parent strains as control host cells (e.g., the Si strain that was used as the basis for the strain improvement program).
- a host cell may be a genetically identical cell that lacks a specific promoter or SNP being tested in the treatment host cell.
- allele(s) means any of one or more alternative forms of a gene, all of which alleles relate to at least one trait or characteristic. In a diploid cell, the two alleles of a given gene occupy corresponding loci on a pair of homologous chromosomes.
- locus means a specific place or places or a site on a chromosome where for example a gene or genetic marker is found.
- the term "genetically linked” refers to two or more traits that are co- inherited at a high rate during breeding such that they are difficult to separate through crossing.
- a “recombination” or “recombination event” as used herein refers to a chromosomal crossing over or independent assortment.
- phenotype refers to the observable characteristics of an individual cell, cell culture, organism, or group of organisms which results from the interaction between that individual's genetic makeup (i.e., genotype) and the environment.
- chimeric or “recombinant” when describing a nucleic acid sequence or a protein sequence refers to a nucleic acid, or a protein sequence, that links at least two heterologous polynucleotides, or two heterologous polypeptides, into a single macromolecule, or that re-arranges one or more elements of at least one natural nucleic acid or protein sequence.
- the term “recombinant” can refer to an artificial combination of two otherwise separated segments of sequence, e.g., by chemical synthesis or by the manipulation of isolated segments of nucleic acids by genetic engineering techniques.
- a "synthetic nucleotide sequence” or “synthetic polynucleotide sequence” is a nucleotide sequence that is not known to occur in nature or that is not naturally occurring. Generally, such a synthetic nucleotide sequence will comprise at least one nucleotide difference when compared to any other naturally occurring nucleotide sequence.
- nucleic acid refers to a polymeric form of nucleotides of any length, either ribonucleotides or deoxyribonucleotides, or analogs thereof. This term refers to the primary structure of the molecule, and thus includes double- and single-stranded DNA, as well as double- and single-stranded RNA. It also includes modified nucleic acids such as methylated and/or capped nucleic acids, nucleic acids containing modified bases, backbone modifications, and the like. The terms “nucleic acid” and “nucleotide sequence” are used interchangeably.
- the term "DNA scaffold” or "nucleic acid scaffold” refers to a nucleic acid scaffold that is either artificially produced or a naturally occurring sequence that is repurposed as a scaffold.
- the nucleic acid scaffold is a synthetic deoxyribonucleic acid scaffold.
- the deoxyribonucleotides of the synthetic scaffold may comprise purine and pyrimidine bases or other natural, chemically or biochemically modified, non-natural, or derivatized deoxyribonucleotide bases.
- the nucleic acid scaffold of the present invention is utilized to spatially and temporally assemble and immobilize two or more proteins involved in a biological pathway, i.e.
- the nucleic acid scaffold comprises one or more subunits, each subunit comprising two or more protein-binding sequences to accommodate the binding of two or more different chimeric biological pathway proteins.
- DNA binding sequence or “DNA binding site” refers to a specific nucleic acid sequence that is recognized and bound by a DNA-binding domain portion of a chimeric biosynthetic gene (e.g., chimeric biosynthetic enzyme) encoded by modified genes of the present disclosure.
- DNA binding sites Many DNA-binding domains and their cognate binding partner DNA recognition sites (i.e., DNA binding sites) are well known in the art. For example, numerous zinc finger binding domains and their corresponding DNA binding target sites are known in the art and suitable for use in the present invention.
- DNA binding domains include, without limitation, leucine zipper binding domains and their corresponding DNA binding sites, winged helix DNA binding domains and their corresponding DNA binding sites, winged helix-turn-helix DNA binding domains and their corresponding DNA binding sites, HMG-box DNA binding domains and their corresponding DNA binding sequences, helix-loop-helix DNA binding domains and their corresponding DNA binding sequences, and helix-turn-helix DNA binding domains and their corresponding DNA binding sequences.
- Other known DNA binding domains with known DNA binding sequences include the immunoglobulin DNA domain, B3 DNA binding domain, and TAL effector DNA binding domains.
- Nucleic acid scaffold subunits of the present invention may comprises any two or more of the aforementioned DNA binding sites.
- genes refers to any segment of DNA associated with a biological function.
- genes include, but are not limited to, coding sequences and/or the regulatory sequences required for their expression.
- Genes can also include non-expressed DNA segments that, for example, form recognition sequences for other proteins.
- Genes can be obtained from a variety of sources, including cloning from a source of interest or synthesizing from known or predicted sequence information, and may include sequences designed to have desired parameters.
- homologous or “homologue” or “ortholog” or “orthologue” is known in the art and refers to related sequences that share a common ancestor or family member and are determined based on the degree of sequence identity.
- the terms “homology,” “homologous,” “substantially similar” and “corresponding substantially” are used interchangeably herein. They refer to nucleic acid fragments wherein changes in one or more nucleotide bases do not affect the ability of the nucleic acid fragment to mediate gene expression or produce a certain phenotype.
- a functional relationship may be indicated in any one of a number of ways, including, but not limited to: (a) degree of sequence identity and/or (b) the same or similar biological function. Preferably, both (a) and (b) are indicated.
- Homology can be determined using software programs readily available in the art, such as those discussed in Current Protocols in Molecular Biology (F.M. Ausubel etal, eds., 1987) Supplement 30, section 7.718, Table 7.71. Some alignment programs are MacVector (Oxford Molecular Ltd, Oxford, U.K.), ALIGN Plus (Scientific and Educational Software, Pennsylvania) and AlignX (Vector ⁇ , Invitrogen, Carlsbad, CA). Another alignment program is Sequencher (Gene Codes, Ann Arbor, Michigan), using default parameters.
- endogenous refers to the naturally occurring gene, in the location in which it is naturally found within the host cell genome.
- operably linking a heterologous promoter to an endogenous gene means genetically inserting a heterologous promoter sequence in front of an existing gene, in the location where that gene is naturally present.
- An endogenous gene as described herein can include alleles of naturally occurring genes that have been mutated according to any of the methods of the present disclosure.
- exogenous is used interchangeably with the term “heterologous,” and refers to a substance coming from some source other than its native source.
- exogenous protein or “exogenous gene” refer to a protein or gene from a non-native source or location, and that have been artificially supplied to a biological system.
- nucleotide change refers to, e.g., nucleotide substitution, deletion, and/or insertion, as is well understood in the art. For example, mutations contain alterations that produce silent substitutions, additions, or deletions, but do not alter the properties or activities of the encoded protein or how the proteins are made.
- protein modification refers to, e.g., amino acid substitution, amino acid modification, deletion, and/or insertion, as is well understood in the art.
- the term "at least a portion" or “fragment” of a nucleic acid or polypeptide means a portion having the minimal size characteristics of such sequences, or any larger fragment of the full length molecule, up to and including the full length molecule.
- a fragment of a polynucleotide of the disclosure may encode a biologically active portion of a genetic regulatory element.
- a biologically active portion of a genetic regulatory element can be prepared by isolating a portion of one of the polynucleotides of the disclosure that comprises the genetic regulatory element and assessing activity as described herein.
- a portion of a polypeptide may be 4 amino acids, 5 amino acids, 6 amino acids, 7 amino acids, and so on, going up to the full length polypeptide.
- the length of the portion to be used will depend on the particular application.
- a portion of a nucleic acid useful as a hybridization probe may be as short as 12 nucleotides; in some embodiments, it is 20 nucleotides.
- a portion of a polypeptide useful as an epitope may be as short as 4 amino acids.
- a portion of a polypeptide that performs the function of the full-length polypeptide would generally be longer than 4 amino acids.
- Variant polynucleotides also encompass sequences derived from a mutagenic and recombinogenic procedure such as DNA shuffling.
- Strategies for such DNA shuffling are known in the art. See, for example, Stemmer (1994) PNAS 91 : 10747-10751 ; Stemmer (1994) Nature 370:389-391; Crameri et al. (1997) Nature Biotech. 15:436-438; Moore et a/. (1997) J. Mol. Biol. 272:336-347; Zhang et al.(1997) PNAS 94:4504-4509; Cramer ei t a/.(1998) Nature 391 :288-291; and U.S. Patent Nos. 5,605,793 and 5,837,458.
- oligonucleotide primers can be designed for use in PCR reactions to amplify corresponding DNA sequences from cDNA or genomic DNA extracted from any organism of interest.
- Methods for designing PCR primers and PCR cloning are generally known in the art and are disclosed in Sambrook et al. (2001) Molecular Cloning: A Laboratory Manual (3 rd ed., Cold Spring Harbor Laboratory Press, Plainview, New York). See also Innis et al., eds. (1990) PCR Protocols: A Guide to Methods and Applications (Academic Press, New York); Innis and Gelfand, eds.
- PCR PCR Strategies
- nested primers single specific primers
- degenerate primers gene-specific primers
- vector-specific primers partially-mismatched primers
- primer refers to an oligonucleotide which is capable of annealing to the amplification target allowing a DNA polymerase to attach, thereby serving as a point of initiation of DNA synthesis when placed under conditions in which synthesis of primer extension product is induced, i.e., in the presence of nucleotides and an agent for polymerization such as DNA polymerase and at a suitable temperature and pH.
- the (amplification) primer is preferably single stranded for maximum efficiency in amplification.
- the primer is an oligodeoxyribonucleotide.
- the primer must be sufficiently long to prime the synthesis of extension products in the presence of the agent for polymerization.
- a pair of bi-directional primers consists of one forward and one reverse primer as commonly used in the art of DNA amplification such as in PCR amplification.
- promoter refers to a DNA sequence capable of controlling the expression of a coding sequence or functional RNA.
- the promoter sequence consists of proximal and more distal upstream elements, the latter elements often referred to as enhancers.
- an “enhancer” is a DNA sequence that can stimulate promoter activity, and may be an innate element of the promoter or a heterologous element inserted to enhance the level or tissue specificity of a promoter. Promoters may be derived in their entirety from a native gene, or be composed of different elements derived from different promoters found in nature, or even comprise synthetic DNA segments.
- promoters may direct the expression of a gene in different tissues or cell types, or at different stages of development, or in response to different environmental conditions. It is further recognized that since in most cases the exact boundaries of regulatory sequences have not been completely defined, DNA fragments of some variation may have identical promoter activity.
- recombinant construct comprises an artificial combination of nucleic acid fragments, e.g., regulatory and coding sequences that are not found together in nature.
- a chimeric construct may comprise regulatory sequences and coding sequences that are derived from different sources, or regulatory sequences and coding sequences derived from the same source, but arranged in a manner different than that found in nature.
- Such construct may be used by itself or may be used in conjunction with a vector.
- a vector is used then the choice of vector is dependent upon the method that will be used to transform host cells as is well known to those skilled in the art.
- a plasmid vector can be used.
- the skilled artisan is well aware of the genetic elements that must be present on the vector in order to successfully transform, select and propagate host cells comprising any of the isolated nucleic acid fragments of the disclosure.
- the skilled artisan will also recognize that different independent transformation events will result in different levels and patterns of expression (Jones et al, (1985) EMBO J. 4:2411-2418; De Almeida et al, (1989) Mol. Gen. Genetics 218:78-86), and thus that multiple events must be screened in order to obtain lines displaying the desired expression level and pattern.
- Vectors can be plasmids, viruses, bacteriophages, pro-viruses, phagemids, transposons, artificial chromosomes, and the like, that replicate autonomously or can integrate into a chromosome of a host cell.
- a vector can also be a naked RNA polynucleotide, a naked DNA polynucleotide, a polynucleotide composed of both DNA and RNA within the same strand, a poly-lysine-conjugated DNA or RNA, a peptide- conjugated DNA or RNA, a liposome-conjugated DNA, or the like, that is not autonomously replicating.
- expression refers to the production of a functional end- product e.g., an mRNA or a protein (precursor or mature).
- operably linked means in this context the sequential arrangement of the promoter polynucleotide according to the disclosure with a further oligo- or polynucleotide, resulting in transcription of said further polynucleotide.
- product of interest or “biomolecule” as used herein refers to any product produced by microbes from feedstock.
- the product of interest may be a small molecule, enzyme, peptide, amino acid, organic acid, synthetic compound, fuel, alcohol, etc.
- the product of interest or biomolecule may be any primary or secondary extracellular metabolite.
- the primary metabolite may be, inter alia, ethanol, citric acid, lactic acid, glutamic acid, glutamate, lysine, threonine, tryptophan and other amino acids, vitamins, polysaccharides, etc.
- the secondary metabolite may be, inter alia, an antibiotic compound like penicillin, or an immunosuppressant like cyclosporin A, a plant hormone like gibberellin, a statin drug like lovastatin, a fungicide like griseofulvin, etc.
- the product of interest or biomolecule may also be any intracellular component produced by a microbe, such as: a microbial enzyme, including: catalase, amylase, protease, pectinase, glucose isomerase, cellulase, hemicellulase, lipase, lactase, streptokinase, and many others.
- the intracellular component may also include recombinant proteins, such as: insulin, hepatitis B vaccine, interferon, granulocyte colony-stimulating factor, streptokinase and others.
- carbon source generally refers to a substance suitable to be used as a source of carbon for cell growth.
- Carbon sources include, but are not limited to, biomass hydrolysates, starch, sucrose, cellulose, hemicellulose, xylose, and lignin, as well as monomeric components of these substrates.
- Carbon sources can comprise various organic compounds in various forms, including, but not limited to polymers, carbohydrates, acids, alcohols, aldehydes, ketones, amino acids, peptides, etc.
- photosynthetic organisms can additionally produce a carbon source as a product of photosynthesis.
- carbon sources may be selected from biomass hydrolysates and glucose.
- feedstock is defined as a raw material or mixture of raw materials supplied to a microorganism or fermentation process from which other products can be made.
- a carbon source such as biomass or the carbon compounds derived from biomass are a feedstock for a microorganism that produces a product of interest (e.g. small molecule, peptide, synthetic compound, fuel, alcohol, etc.) in a fermentation process.
- a feedstock may contain nutrients other than a carbon source.
- volumetric productivity or “production rate” is defined as the amount of product formed per volume of medium per unit of time. Volumetric productivity can be reported in gram per liter per hour (g/L/h).
- specific productivity is defined as the rate of formation of the product. Specific productivity is herein further defined as the specific productivity in gram product per gram of cell dry weight (CDW) per hour (g/g CDW/h). Using the relation of CDW to OD60o for the given microorganism specific productivity can also be expressed as gram product per liter culture medium per optical density of the culture broth at 600 nm (OD) per hour (g/L/h/OD).
- yield is defined as the amount of product obtained per unit weight of raw material and may be expressed as g product per g substrate (g/g). Yield may be expressed as a percentage of the theoretical yield. "Theoretical yield” is defined as the maximum amount of product that can be generated per a given amount of substrate as dictated by the stoichiometry of the metabolic pathway used to make the product.
- titre or "titer” is defined as the strength of a solution or the concentration of a substance in solution.
- a product of interest e.g. small molecule, peptide, synthetic compound, fuel, alcohol, etc.
- g L g of product of interest in solution per liter of fermentation broth
- total titer is defined as the sum of all product of interest produced in a process, including but not limited to the product of interest in solution, the product of interest in gas phase if applicable, and any product of interest removed from the process and recovered relative to the initial volume in the process or the operating volume in the process
- the term "HTP genetic design library” or “library” refers to collections of genetic perturbations according to the present disclosure.
- the libraries of the present invention may manifest as i) a collection of sequence information in a database or other computer file, ii) a collection of genetic constructs encoding for the aforementioned series of genetic elements, or iii) host cell strains comprising said genetic elements.
- the libraries of the present disclosure may refer to collections of individual elements (e.g., collections of promoters for PRO swap libraries, collections of terminators for STOP swap libraries, collections of protein solubility tags for SOLUBILITY TAG swap libraries, or collections of protein degradation tags for DEGRADATION TAG swap libraries).
- the libraries of the present disclosure may also refer to combinations of genetic elements, such as combinations of promotengenes, gene: terminator, or even promoter: gene terminators.
- the libraries of the present disclosure may alos refer to combinations of promoters, terminators, protein solubility tags and/or protein degradation tags.
- the libraries of the present disclosure further comprise meta data associated with the effects of applying each member of the library in host organisms.
- a library as used herein can include a collection of promoter: : gene sequence combinations, together with the resulting effect of those combinations on one or more phenotypes in a particular species, thus improving the future predictive value of using said combination in future promoter swaps.
- SNP refers to Small Nuclear Polymorphism(s).
- SNPs of the present disclosure should be construed broadly, and include single nucleotide polymorphisms, sequence insertions, deletions, inversions, and other sequence replacements.
- non-synonymous or non-synonymous SNPs refers to mutations that lead to coding changes in host cell proteins
- a "high-throughput (HTP)" method of genomic engineering may involve the utilization of at least one piece of automated equipment (e.g. a liquid handler or plate handler machine) to carry out at least one step of said method.
- automated equipment e.g. a liquid handler or plate handler machine
- Directed engineering methods of strain improvement involve the planned perturbation of a handful of genetic elements of a specific organism. These approaches are typically focused on modulating specific biosynthetic or developmental programs, and rely on prior knowledge of the genetic and metabolic factors affecting said pathways.
- directed engineering involves the transfer of a characterized trait (e.g., gene, promoter, or other genetic element capable of producing a measurable phenotype) from one organism to another organism of the same, or different species.
- Random approaches to strain engineering involve the random mutagenesis of parent strains, coupled with extensive screening designed to identify performance improvements. Approaches to generating these random mutations include exposure to ultraviolet radiation, or mutagenic chemicals such as Ethyl methanesulfonate. Though random and largely unpredictable, this traditional approach to strain improvement had several advantages compared to more directed genetic manipulations. First, many industrial organisms were (and remain) poorly characterized in terms of their genetic and metabolic repertoires, rendering alternative directed improvement approaches difficult, if not impossible.
- the present disclosure sets forth a unique HTP genomic engineering platform that is computationally driven and integrates molecular biology, automation, data analytics, and machine learning protocols.
- This integrative platform utilizes a suite of HTP molecular tool sets that are used to construct HTP genetic design libraries. These genetic design libraries will be elaborated upon below.
- Figure 8 depicts an overview of an embodiment of the E. coli strain improvement program of the present disclosure.
- the HTP platform taught herein is able to identify, characterize, and quantify the effect that individual mutations have on microbial strain performance.
- This information i.e. what effect does a given genetic change x have on host cell phenotype y (e.g., production of a compound or product of interest), is able to be generated and then stored in the microbial HTP genetic design libraries discussed below. That is, sequence information for each genetic permutation, and its effect on the host cell phenotype are stored in one or more databases, and are available for subsequent analysis (e.g., epistasis mapping, as discussed below).
- the present disclosure also teaches methods of physically saving/storing valuable genetic permutations in the form of genetic insertion constructs, or in the form of one or more host cell organisms containing said genetic permutation (e.g., see libraries discussed below.)
- the present disclosure provides a novel HTP platform and genetic design strategy for engineering microbial organisms through iterative systematic introduction and removal of genetic changes across strains.
- the platform is supported by a suite of molecular tools, which enable the creation of HTP genetic design libraries and allow for the efficient implementation of genetic alterations into a given host strain.
- the HTP genetic design libraries of the disclosure serve as sources of possible genetic alterations that may be introduced into a particular microbial strain background.
- the HTP genetic design libraries are repositories of genetic diversity, or collections of genetic perturbations, which can be applied to the initial or further engineering of a given microbial strain.
- Techniques for programming genetic designs for implementation to host strains are described in pending US Patent Application, Serial No. 15/140,296, and pending International Patent Application Serial No. PCT/US 17/29725, entitled "Microbial Strain Design System and Methods for Improved Large Scale Production of Engineered Nucleotide Sequences," each of which is incorporated by reference in its entirety herein.
- the HTP molecular tool sets utilized in this platform may include, inter alia: (1) Promoter swaps (PRO Swap), (2) SNP swaps, (3) Start/Stop codon exchanges, (4) STOP swaps, (5) Sequence optimization, (6) SOLUBILITY TAG swaps and (7) DEGRADATION TAG swaps.
- the HTP methods of the present disclosure also teach methods for directing the consolidation/combinatorial use of HTP tool sets, including (8) Epistasis mapping protocols. As aforementioned, this suite of molecular tools, either in isolation or combination, enables the creation of HTP genetic design host cell libraries.
- the present disclosure teaches that as orthogonal beneficial changes are identified across various, discrete branches of a mutagenic strain lineage, they can also be rapidly consolidated into better performing strains. These mutations can also be consolidated into strains that are not part of mutagenic lineages, such as strains with improvements gained by directed genetic engineering. [0223] In some embodiments, the present disclosure differs from known strain improvement approaches in that it analyzes the genome-wide combinatorial effect of mutations across multiple disparate genomic regions, including expressed and non-expressed genetic elements, and uses gathered information (e.g., experimental results) to predict mutation combinations expected to produce strain enhancements.
- the present disclosure teaches: i) industrial microorganisms, and other host cells amenable to improvement via the disclosed inventions, ii) generating diversity pools for downstream analysis, iii) methods and hardware for high-throughput screening and sequencing of large variant pools, iv) methods and hardware for machine learning computational analysis and prediction of synergistic effects of genome-wide mutations, and v) methods for high- throughput strain engineering.
- HTP molecular tools and libraries are discussed in terms of illustrative microbial examples. Persons having skill in the art will recognize that the HTP molecular tools of the present disclosure are compatible with any host cell, including eukaryotic cellular, and higher life forms. Furthermore, many of the illustrated embodiments are conducted in Corynebacterium; however, the same principles and process can be deployed in Escherichia coli.
- Promoter Swaps A Molecular Tool for the Derivation of Promoter Swap Microbial Strain Libraries
- the present disclosure teaches methods of selecting promoters with optimal expression properties to produce beneficial effects on overall-host strain phenotype (e.g., yield or productivity).
- the present disclosure teaches methods of identifying one or more promoters and/or generating variants of one or more promoters within a host cell, which exhibit a range of expression strengths (e.g. promoter ladders discussed infra), or superior regulatory properties (e.g., tighter regulatory control for selected genes).
- a particular combination of these identified and/or generated promoters can be grouped together as a promoter ladder, which is explained in more detail below.
- the promoter ladder in question is then associated with a given gene of interest.
- promoters Pi-Ps representing eight promoters that have been identified and/or generated to exhibit a range of expression strengths
- associates the promoter ladder with a single gene of interest in a microbe i.e. genetically engineer a microbe with a given promoter operably linked to a given target gene
- the effect of each combination of the eight promoters can be ascertained by characterizing each of the engineered strains resulting from each combinatorial effort, given that the engineered microbes have an otherwise identical genetic background except the particular promoter(s) associated with the target gene.
- the HTP genetic design library can refer to the actual physical microbial strain collection that is formed via this process, with each member strain being representative of a given promoter operably linked to a particular target gene, in an otherwise identical genetic background, said library being termed a "promoter swap microbial strain library.”
- the library can be termed a "promoter swap E. coli strain library,” but the terms can be used synonymously, as E. coli is a specific example of a microbe.
- the HTP genetic design library can refer to the collection of genetic perturbations—in this case a given promoter x operably linked to a given gene y— said collection being termed a "promoter swap library.”
- promoter ladder comprising promoters P1-P8 to engineer microbes, wherein each of the 8 promoters is operably linked to 10 different gene targets.
- the result of this procedure would be 80 microbes that are otherwise assumed genetically identical, except for the particular promoters operably linked to a target gene of interest.
- These 80 microbes could be appropriately screened and characterized and give rise to another HTP genetic design library.
- the characterization of the microbial strains in the HTP genetic design library produces information and data that can be stored in any data storage construct, including a relational database, an object-oriented database or a highly distributed NoSQL database. This data/information could be, for example, a given promoter's (e.g.
- Pi-Ps effect when operably linked to a given gene target.
- This data/information can also be the broader set of combinatorial effects that result from operably linking two or more of promoters Pi-Ps to a given gene target.
- the aforementioned examples of eight promoters and 10 target genes is merely illustrative, as the concept can be applied with any given number of promoters that have been grouped together based upon exhibition of a range of expression strengths and any given number of target genes. Persons having skill in the art will also recognize the ability to operably link two or more promoters in front of any gene target.
- the present disclosure teaches promoter swap libraries in which 1 , 2, 3 or more promoters from a promoter ladder are operably linked to one or more genes.
- utilizing various promoters to drive expression of various genes in an organism is a powerful tool to optimize a trait of interest.
- the molecular tool of promoter swapping developed by the inventors, uses a ladder of promoter sequences that have been demonstrated to vary expression of at least one locus under at least one condition. This ladder is then systematically applied to a group of genes in the organism using high-throughput genome engineering. This group of genes is determined to have a high likelihood of impacting the trait of interest based on any one of a number of methods. These could include selection based on known function, or impact on the trait of interest, or algorithmic selection based on previously determined beneficial genetic diversity.
- the selection of genes can include all the genes in a given host. In other embodiments, the selection of genes can be a subset of all genes in a given host, chosen randomly.
- the resultant HTP genetic design microbial strain library of organisms containing a promoter sequence linked to a gene is then assessed for performance in a high-throughput screening model, and promoter-gene linkages which lead to increased performance are determined and the information stored in a database.
- the collection of genetic perturbations i.e. given promoter x operably linked to a given gene y
- promoter swap library can be utilized as a source of potential genetic alterations to be utilized in microbial engineering processing.
- each library becomes more powerful as a corpus of experimentally confirmed data that can be used to more precisely and predictably design targeted changes against any background of interest.
- Metabolic Control Analysis is a method for determining, from experimental data and first principles, which enzyme or enzymes are rate limiting. MCA is limited however, because it requires extensive experimentation after each expression level change to determine the new rate limiting enzyme. Promoter swapping is advantageous in this context, because through the application of a promoter ladder to each enzyme in a pathway, the limiting enzyme is found, and the same thing can be done in subsequent rounds to find new enzymes that become rate limiting. Further, because the read-out on function is better production of the small molecule of interest, the experiment to determine which enzyme is limiting is the same as the engineering to increase production, thus shortening development time.
- the present disclosure teaches the application of PRO swap to genes encoding individual subunits of multi-unit enzymes. In yet other embodiments, the present disclosure teaches methods of applying PRO swap techniques to genes responsible for regulating individual enzymes, or whole biosynthetic pathways.
- the promoter swap tool of the present disclosure is used to identify optimum expression of a selected gene target.
- the goal of the promoter swap may be to increase expression of a target gene to reduce bottlenecks in a metabolic or genetic pathway.
- the goal o the promoter swap may be to reduce the expression of the target gene to avoid unnecessary energy expenditures in the host cell, when expression of said target gene is not required.
- promoter swapping is a multi-step process comprising:
- n genes to target.
- This set can be every open reading frame (ORF) in a genome, or a subset of ORFs.
- the subset can be chosen using annotations on ORFs related to function, by relation to previously demonstrated beneficial perturbations (previous promoter swaps or previous SNP swaps), by algorithmic selection based on epistatic interactions between previously generated perturbations, other selection criteria based on hypotheses regarding beneficial ORF to target, or through random selection.
- the "n" targeted genes can comprise non-protein coding genes, including non-coding RNAs.
- This foundational process can be extended to provide further improvements in strain performance by, inter alia: (1) Consolidating multiple beneficial perturbations into a single strain background, either one at a time in an interactive process, or as multiple changes in a single step. Multiple perturbations can be either a specific set of defined changes or a partly randomized, combinatorial library of changes.
- the set of targets is every gene in a pathway
- sequential regeneration of the library of perturbations into an improved member or members of the previous library of strains can optimize the expression level of each gene in a pathway regardless of which genes are rate limiting at any given iteration; (2) Feeding the performance data resulting from the individual and combinatorial generation of the library into an algorithm that uses that data to predict an optimum set of perturbations based on the interaction of each perturbation; and (3) Implementing a combination of the above two approaches (see Figure 20).
- the molecular tool, or technique, discussed above is characterized as promoter swapping, but is not limited to promoters and can include other sequence changes that systematically vary the expression level of a set of targets.
- Other methods for varying the expression level of a set of genes could include: a) a ladder of ribosome binding sites (or Kozak sequences in eukaryotes); b) replacing the start codon of each target with each of the other start codons (i.e start/stop codon exchanges discussed infra); c) attachment of various mRNA stabilizing or destabilizing sequences to the 5' or 3' end, or at any other location, of a transcript, d) attachment of various protein stabilizing or destabilizing sequences at any location in the protein (i.e., degradation or solubilization tag exchanges discussed infra).
- SNP swapping is not a random mutagenic approach to improving a microbial strain, but rather involves the systematic introduction or removal of individual Small Nuclear Polymorphism nucleotide mutations (i.e. SNPs) (hence the name "SNP swapping") across strains.
- SNPs Small Nuclear Polymorphism nucleotide mutations
- the HTP genetic design library can refer to the actual physical microbial strain collection that is formed via this process, with each member strain being representative of the presence or absence of a given SNP, in an otherwise identical genetic background, said library being termed a "SNP swap microbial strain library.”
- SNP swap microbial strain library In the specific context of E. coli, the library can be termed a "SNP swap E. coli strain library," but the terms can be used synonymously, as E. coli is a specific example of a microbe.
- the HTP genetic design library can refer to the collection of genetic perturbations—in this case a given SNP being present or a given SNP being absent— said collection being termed a "SNP swap library.”
- SNP swapping involves the reconstruction of host organisms with optimal combinations of target SNP "building blocks" with identified beneficial performance effects.
- SNP swapping involves consolidating multiple beneficial mutations into a single strain background, either one at a time in an iterative process, or as multiple changes in a single step. Multiple changes can be either a specific set of defined changes or a partly randomized, combinatorial library of mutations.
- SNP swapping also involves removing multiple mutations identified as detrimental from a strain, either one at a time in an iterative process, or as multiple changes in a single step. Multiple changes can be either a specific set of defined changes or a partly randomized, combinatorial library of mutations.
- the SNP swapping methods of the present disclosure include both the addition of beneficial SNPs, and removing detrimental and/or neutral mutations.
- SNP swapping is a powerful tool to identify and exploit both beneficial and detrimental mutations in a lineage of strains subjected to mutagenesis and selection for an improved trait of interest.
- SNP swapping utilizes high-throughput genome engineering techniques to systematically determine the influence of individual mutations in a mutagenic lineage. Genome sequences are determined for strains across one or more generations of a mutagenic lineage with known performance improvements. High-throughput genome engineering is then used systematically to recapitulate mutations from improved strains in earlier lineage strains, and/or revert mutations in later strains to earlier strain sequences. The performance of these strains is then evaluated and the contribution of each individual mutation on the improved phenotype of interest can be determined. As aforementioned, the microbial strains that result from this process are analyzed/characterized and form the basis for the SNP swap genetic design libraries that can inform microbial strain improvement across host strains.
- random mutagenesis and subsequent screening for performance improvements is a commonly used technique for industrial strain improvement, and many strains currently used for large scale manufacturing have been developed using this process iteratively over a period of many years, sometimes decades.
- Random approaches to generating genomic mutations such as exposure to UV radiation or chemical mutagens such as ethyl methanesulfonate were a preferred method for industrial strain improvements because: 1) industrial organisms may be poorly characterized genetically or metabolically, rendering target selection for directed improvement approaches difficult or impossible; 2) even in relatively well characterized systems, changes that result in industrial performance improvements are difficult to predict and may require perturbation of genes that have no known function, and 3) genetic tools for making directed genomic mutations in a given industrial organism may not be available or very slow and/or difficult to use.
- SNP swapping is an approach to overcome these limitations by systematically recapitulating or reverting some or all mutations observed when comparing strains within a mutagenic lineage. In this way, both beneficial ('causative') mutations can be identified and consolidated, and/or detrimental mutations can be identified and removed. This allows rapid improvements in strain performance that could not be achieved by further random mutagenesis or targeted genetic engineering.
- orthogonal beneficial changes are identified across various, discrete branches of a mutagenic strain lineage, they can be rapidly consolidated into better performing strains. These mutations can also be consolidated into strains that are not part of mutagenic lineages, such as strains with improvements gained by directed genetic engineering.
- the present disclosure teaches methods for identifying the SNP sequence diversity present among the organisms of a diversity pool.
- a diversity pool can be a given number n of microbes utilized for analysis, with said microbes' genomes representing the "diversity pool.”
- a diversity pool may be an original parent strain (Si) with a "baseline” or “reference” genetic sequence at a particular time point (SiGeni) and then any number of subsequent offspring strains (S2-n) that were derived/developed from said Si strain and that have a different genome (S2-nGen2-n), in relation to the baseline genome of Si.
- the present disclosure teaches sequencing the microbial genomes in a diversity pool to identify the SNPs present in each strain.
- the strains of the diversity pool are historical microbial production strains.
- a diversity pool of the present disclosure can include for example, an industrial reference strain, and one or more mutated industrial strains produced via traditional strain improvement programs.
- the SNPs within a diversity pool are determined with reference to a "reference strain.”
- the reference strain is a wild-type strain.
- the reference strain is an original industrial strain prior to being subjected to any mutagenesis.
- the reference strain can be defined by the practitioner and does not have to be an original wild-type strain or original industrial strain.
- the base strain is merely representative of what will be considered the "base,” "reference” or original genetic background, by which subsequent strains that were derived, or were developed from said reference strain, are to be compared.
- the present disclosure teaches methods of SNP swapping and screening methods to delineate (i.e. quantify and characterize) the effects (e.g. creation of a phenotype of interest) of SNPs individually and/or in groups.
- the SNP swapping methods of the present disclosure comprise the step of introducing one or more SNPs identified in a mutated strain (e.g., a strain from amongst S2-nGen2-n) to a reference strain (SiGeni) or wild- type strain ("wave up").
- the SNP swapping methods of the present disclosure comprise the step of removing one or more SNPs identified in a mutated strain (e.g., a strain from amongst S2- nGen2-n) ("wave down").
- each generated strain comprising one or more SNP changes is cultured and analyzed under one or more criteria of the present disclosure (e.g., production of a chemical or product of interest).
- Data from each of the analyzed host strains is associated, or correlated, with the particular SNP, or group of SNPs present in the host strain, and is recorded for future use.
- the present disclosure enables the creation of large and highly annotated HTP genetic design microbial strain libraries that are able to identify the effect of a given SNP on any number of microbial genetic or phenotypic traits of interest.
- the information stored in these HTP genetic design libraries informs the machine learning algorithms of the HTP genomic engineering platform and directs future iterations of the process, which ultimately leads to evolved microbial organisms that possess highly desirable properties/traits.
- Start/Stop Codon Exchanges A Molecular Tool for the Derivation of Start/Stop Codon Microbial Strain Libraries
- the present disclosure teaches methods of swapping start and stop codon variants.
- typical stop codons for S. cerevisiae and mammals are TAA (UAA) and TGA (UGA), respectively.
- the typical stop codon for monocotyledonous plants is TGA (UGA)
- insects and E. coli commonly use TAA (UAA) as the stop codon
- TAG UAG
- the present disclosure teaches use of the TAG (UAG) stop codons.
- the present disclosure similarly teaches swapping start codons.
- the present disclosure teaches use of the ATG (AUG) start codon utilized by most organisms (especially eukaryotes).
- the present disclosure teaches that prokaryotes use ATG (AUG) the most, followed by GTG (GUG) and TTG (UUG).
- the present invention teaches replacing ATG start codons with TTG. In some embodiments, the present invention teaches replacing ATG start codons with GTG. In some embodiments, the present invention teaches replacing GTG start codons with ATG. In some embodiments, the present invention teaches replacing GTG start codons with TTG. In some embodiments, the present invention teaches replacing TTG start codons with ATG. In some embodiments, the present invention teaches replacing TTG start codons with GTG. [0276] In other embodiments, the present invention teaches replacing TAA stop codons with TAG. In some embodiments, the present invention teaches replacing TAA stop codons with TGA.
- the present invention teaches replacing TGA stop codons with TAA. In some embodiments, the present invention teaches replacing TGA stop codons with TAG. In some embodiments, the present invention teaches replacing TAG stop codons with TAA. In some embodiments, the present invention teaches replacing TAG stop codons with TGA.
- the present disclosure teaches methods of improving host cell productivity through the optimization of cellular gene transcription.
- Gene transcription is the result of several distinct biological phenomena, including transcriptional initiation (RNAp recruitment and transcriptional complex formation), elongation (strand synthesis/extension), and transcriptional termination (RNAp detachment and termination).
- transcriptional initiation RNAp recruitment and transcriptional complex formation
- elongation strand synthesis/extension
- transcriptional termination RNAp detachment and termination
- Failed termination on a gene can impair the expression of downstream genes by reducing the accessibility of the promoter to Pol II (Greger IH. et al., 2000 "Balancing transcriptional interference and initiation on the GAL7 promoter of Saccharomyces cerevisiae.” Proc Natl Acad Sci U S A. 2000 Jul 18; 97(15): 8415-20).
- This process known as transcriptional interference, is particularly relevant in lower eukaryotes, as they often have closely spaced genes.
- Termination sequences can also affect the expression of the genes to which the sequences belong. For example, studies show that inefficient transcriptional termination in eukaryotes results in an accumulation of unspliced pre-mRNA (see West, S., and Proudfoot, N.J., 2009 "Transcriptional Termination Enhances Protein Expression in Human Cells” Mol Cell. 2009 Feb 13; 33(3-9); 354-364). Other studies have also shown that 3' end processing, can be delayed by inefficient termination (West, S et al, 2008 "Molecular dissection of mammalian RNA polymerase II transcriptional termination.” Mol Cell. 2008 Mar 14; 29(5):600-10.). Transcriptional termination can also affect mRNA stability by releasing transcripts from sites of synthesis. Further, strong termination sequences may increase mRNA stability, thus increasing protein abundance and overall pathway activity.
- Transcriptional termination in eukaryotes operates through terminator signals that are recognized by protein factors associated with the RNA polymerase II.
- the cleavage and polyadenylation specificity factor (CPSF) and cleavage stimulation factor (CstF) transfer from the carboxyl terminal domain of RNA polymerase II to the poly-A signal.
- the CPSF and CstF factors also recruit other proteins to the termination site, which then cleave the transcript and free the mRNA from the transcription complex. Termination also triggers polyadenylation of mRNA transcripts.
- Illustrative examples of validated eukaryotic termination factors, and their conserved structures are discussed in later portions of this document.
- Rho-independent termination signals do not require an extrinsic transcription-termination factor, as formation of a stem-loop structure in the RNA transcribed from these sequences along with a series of Uridine (U) residues promotes release of the RNA chain from the transcription complex.
- Rho-dependent termination requires a transcription-termination factor called Rho and cis-acting elements on the mRNA.
- Rho Rho utilization
- STOP swap Terminator Swapping
- the present disclosure teaches methods of selecting termination sequences ("terminators") with optimal expression properties to produce beneficial effects on overall-host strain productivity.
- the present disclosure teaches methods of identifying one or more terminators and/or generating variants of one or more terminators within a host cell, which exhibit a range of expression strengths (e.g. terminator ladders discussed infra).
- a range of expression strengths e.g. terminator ladders discussed infra.
- a particular combination of these identified and/or generated terminators can be grouped together as a terminator ladder, which is explained in more detail below.
- the terminator ladder in question is then associated with a given gene of interest.
- terminators T1-T8 representing eight terminators that have been identified and/or generated to exhibit a range of expression strengths when combined with one or more promoters
- associates the terminator ladder with a single gene of interest in a host cell i.e. genetically engineer a host cell with a given terminator operably linked to the 3' end of to a given target gene
- the effect of each combination of the terminators can be ascertained by characterizing each of the engineered strains resulting from each combinatorial effort, given that the engineered host cells have an otherwise identical genetic background except the particular terminator(s) associated with the target gene.
- the resultant host cells that are engineered via this process form HTP genetic design libraries.
- the HTP genetic design library can refer to the actual physical microbial strain collection that is formed via this process, with each member strain being representative of a given terminator operably linked to a particular target gene, in an otherwise identical genetic background, said library being termed a "terminator swap microbial strain library” or "STOP swap microbial strain library.”
- the library can be termed a "terminator swap E. coli strain library,” or "STOP swap E. coli strain library,” but the terms can be used synonymously, as E. coli is a specific example of a microbe.
- the HTP genetic design library can refer to the collection of genetic perturbations—in this case a given terminator x operably linked to a given gene y— said collection being termed a “terminator swap library” or "STOP swap library.”
- terminator ladder comprising terminators T1-T8 to engineer microbes, wherein each of the eight terminators is operably linked to 10 different gene targets.
- the result of this procedure would be 80 host cell strains that are otherwise assumed genetically identical, except for the particular terminators operably linked to a target gene of interest. These 80 host cell strains could be appropriately screened and characterized and give rise to another HTP genetic design library.
- the characterization of the microbial strains in the HTP genetic design library produces information and data that can be stored in any database, including without limitation, a relational database, an object-oriented database or a highly distributed NoSQL database.
- This data/information could include, for example, a given terminators' (e.g., Ti- T8) effect when operably linked to a given gene target.
- This data/information can also be the broader set of combinatorial effects that result from operably linking two or more promoters (e.g., T1-T8) to a given gene target.
- terminators and 10 target genes are merely illustrative, as the concept can be applied with any given number of terminators that have been grouped together based upon exhibition of a range of expression strengths and any given number of target genes.
- another set of terminators that can be used in the methods provided herein e.g., STOP Swapping
- STOP Swapping is the set of terminators found in Table 1.2 with nucleic acid SEQ ID Nos 225, 226, 227, 228, 229, or 230.
- utilizing various terminators to modulate expression of various genes in an organism is a powerful tool to optimize a trait of interest.
- the molecular tool of terminator swapping developed by the inventors, uses a ladder of terminator sequences that have been demonstrated to vary expression of at least one locus under at least one condition. This ladder is then systematically applied to a group of genes in the organism using high-throughput genome engineering. This group of genes is determined to have a high likelihood of impacting the trait of interest based on any one of a number of methods. These could include selection based on known function, or impact on the trait of interest, or algorithmic selection based on previously determined beneficial genetic diversity.
- the resultant HTP genetic design microbial library of organisms containing a terminator sequence linked to a gene is then assessed for performance in a high-throughput screening model, and terminator-gene linkages which lead to increased performance are determined and the information stored in a database.
- the collection of genetic perturbations i.e. given terminator x linked to a given gene y
- form a "terminator swap library” which can be utilized as a source of potential genetic alterations to be utilized in microbial engineering processing.
- each library becomes more powerful as a corpus of experimentally confirmed data that can be used to more precisely and predictably design targeted changes against any background of interest. That is in some embodiments, the present disclosures teaches introduction of one or more genetic changes into a host cell based on previous experimental results embedded within the meta data associated with any of the genetic design libraries of the invention.
- terminator swapping is a multi-step process comprising:
- n genes to target.
- This set can be every ORF in a genome, or a subset of ORFs.
- the subset can be chosen using annotations on ORFs related to function, by relation to previously demonstrated beneficial perturbations (previous promoter swaps, STOP swaps, SOLUBILITY TAG swaps, DEGRADATION TAG swaps or SNP swaps), by algorithmic selection based on epistatic interactions between previously generated perturbations, other selection criteria based on hypotheses regarding beneficial ORF to target, or through random selection.
- the "n" targeted genes can comprise non-protein coding genes, including non-coding RNAs.
- a "library” also referred to as a HTP genetic design library
- each member of the library is an instance of x terminator linked to n target, in an otherwise identical genetic context.
- combinations of terminators can be inserted, extending the range of combinatorial possibilities upon which the library is constructed.
- the set of targets is every gene in a pathway
- sequential regeneration of the library of perturbations into an improved member or members of the previous library of strains can optimize the expression level of each gene in a pathway regardless of which genes are rate limiting at any given iteration; (2) Feeding the performance data resulting from the individual and combinatorial generation of the library into an algorithm that uses that data to predict an optimum set of perturbations based on the interaction of each perturbation; and (3) Implementing a combination of the above two approaches.
- the methods of the disclosure comprise codon optimizing one or more genes expressed by the host organism.
- Methods for optimizing codons to improve expression in various hosts are known in the art and are described in the literature (see U.S. Pat. App. Pub. No. 2007/0292918, incorporated herein by reference in its entirety).
- Optimized coding sequences containing codons preferred by a particular prokaryotic or eukaryotic host can be prepared, for example, to increase the rate of translation or to produce recombinant RNA transcripts having desirable properties, such as a longer half-life, as compared with transcripts produced from a non-optimized sequence.
- Protein expression is governed by a host of factors including those that affect transcription, mRNA processing, and stability and initiation of translation. Optimization can thus address any of a number of sequence features of any particular gene.
- a rare codon induced translational pause can result in reduced protein expression.
- a rare codon induced translational pause includes the presence of codons in the polynucleotide of interest that are rarely used in the host organism may have a negative effect on protein translation due to their scarcity in the available tRNA pool.
- Alternate translational initiation also can result in reduced heterologous protein expression.
- Alternate translational initiation can include a synthetic polynucleotide sequence inadvertently containing motifs capable of functioning as a ribosome binding site (RBS). These sites can result in initiating translation of a truncated protein from a gene-internal site.
- RBS ribosome binding site
- Repeat-induced polymerase slippage can result in reduced heterologous protein expression.
- Repeat-induced polymerase slippage involves nucleotide sequence repeats that have been shown to cause slippage or stuttering of DNA polymerase which can result in frameshift mutations. Such repeats can also cause slippage of RNA polymerase.
- RNA polymerase In an organism with a high G+C content bias, there can be a higher degree of repeats composed of G or C nucleotide repeats. Therefore, one method of reducing the possibility of inducing RNA polymerase slippage, includes altering extended repeats of G or C nucleotides.
- Interfering secondary structures also can result in reduced heterologous protein expression. Secondary structures can sequester the RBS sequence or initiation codon and have been correlated to a reduction in protein expression. Stemloop structures can also be involved in transcriptional pausing and attenuation. An optimized polynucleotide sequence can contain minimal secondary structures in the RBS and gene coding regions of the nucleotide sequence to allow for improved transcription and translation.
- the optimization process can begin by identifying the desired amino acid sequence to be expressed by the host. From the amino acid sequence a candidate polynucleotide or DNA sequence can be designed. During the design of the synthetic DNA sequence, the frequency of codon usage can be compared to the codon usage of the host expression organism and rare host codons can be removed from the synthetic sequence. Additionally, the synthetic candidate DNA sequence can be modified in order to remove undesirable enzyme restriction sites and add or remove any desired signal sequences, linkers or untranslated regions. The synthetic DNA sequence can be analyzed for the presence of secondary structure that may interfere with the translation process, such as G/C repeats and stem-loop structures. 6. SOLUBILITY TAG swap: A Molecular Tool for the Derivation of SOLUBILITY TAG Swap Microbial Strain Libraries
- the present disclosure teaches methods of improving host cell productivity through the optimization of post-translational mechanisms.
- Traditional strain improvement can often be accomplished through overexpression of pathway genes that produce some molecule of interest.
- known pathway genes can be duplicated, or strong promoters can be inserted to drive expression of these genes, and thus increase mRNA transcript levels with the goal of increasing pathway protein abundance to achieve improved rate, titer, or yield from a given pathway.
- This approach can be applied systematically at the whole-genome scale to identify all genes that can improve strain performance.
- Another frequently applied approach can be deletion of potentially competing pathway genes with the goal of completely eliminating protein products that may divert carbon from the desired pathway.
- these overexpression and/or deletion strain improvement approaches known in the art can have several limitations.
- the expected effect of increased mRNA transcript levels may not necessarily result in increased protein abundance.
- Various protein products may have various rate-limiting steps in their production, and this rate- limiting step may not be mRNA transcript levels.
- this rate- limiting step may not be mRNA transcript levels.
- post-translational mechanisms may be impacting overall protein abundance.
- the presence of protein solubility tags may be used to increase the abundance of correctly folded, active protein that can contribute to production of a target molecule, whereas simply increasing mRNA transcript levels may lead only to an increase in misfolded, inactive protein. Effects exerted protein solubility tags can also be made to be tunable depending on the sequence of the solubility tag that is used, enabling precise optimization of the target phenotype.
- the present disclosure teaches methods of selecting protein solubility tag sequences ("solubility tags”) with optimal protein solubility properties to produce beneficial effects on overall-host strain productivity.
- the present disclosure teaches methods of identifying one or more protein solubility tags and/or generating variants of one or more protein solubility tags within a host cell, which exhibit a range of solubility strengths (e.g. protein solubility tags discussed infra).
- solubility strengths e.g. protein solubility tags discussed infra.
- a particular combination of these identified and/or generated protein solubility tags can be grouped together as a protein solubility tag ladder, which is explained in more detail below.
- the protein solubility tag ladder in question is then associated with a given gene of interest.
- protein solubility tags PST1-PST4 (see Table 17) representing a subset of protein solubility tags that have been identified from Costa et al., Front Microbiol. 2014; 5: 63 to enhance protein solubility and also be smaller than 100 amino acids and associates the protein solubility tag ladder with a single gene of interest in a host cell (i.e. genetically engineer a host cell with a given protein solubility tag operably linked to a given target gene to generate a target protein tagged at either the N-terminus or the C-terminus).
- the effect of each combination of the protein solubility tag can be ascertained by characterizing each of the engineered strains resulting from each combinatorial effort, given that the engineered host cells have an otherwise identical genetic background except the particular solubility tag(s) associated with the target gene.
- the resultant host cells that are engineered via this process form HTP genetic design libraries.
- the HTP genetic design library can refer to the actual physical microbial strain collection that is formed via this process, with each member strain being representative of a given protein solubility tag operably linked to a particular target protein, in an otherwise identical genetic background, said library being termed a "solubility tag swap microbial strain library” or "SOLUBILITY TAG swap microbial strain library.”
- the library can be termed a "SOLUBILITY TAG swap E. coli strain library,” or “SOLUBILITY TAG swap E. coli strain library,” but the terms can be used synonymously, as E. coli is a specific example of a microbe.
- the HTP genetic design library can refer to the collection of genetic perturbations—in this case a given protein solubility tag x operably linked to a given gene y— said collection being termed a “protein solubility tag swap library” or "SOLUBILITY TAG swap library.”
- the result of this procedure would be 40 host cell strains that are otherwise assumed genetically identical, except for the particular protein solubility tags operably linked to a target gene of interest.
- These 40 host cell strains could be appropriately screened and characterized and give rise to another HTP genetic design library.
- the characterization of the microbial strains in the HTP genetic design library produces information and data that can be stored in any database, including without limitation, a relational database, an object-oriented database or a highly distributed NoSQL database.
- This data/information could include, for example, a given protein solubility tag (e.g., PST1-PST4) effect when operably linked to a given gene target.
- This data/information can also be the broader set of combinatorial effects that result from operably linking two or more solubility tags (e.g., PST1-PST4) to a given gene target.
- utilizing various protein solubility tags to modulate solubility of various proteins in an organism is a powerful tool to optimize a trait of interest.
- the molecular tool of protein solubility tag swapping developed by the inventors, uses a ladder of protein solubility tag sequences that have been demonstrated to vary solubility (e.g., enhance) of at least one protein under at least one condition. This ladder is then systematically applied to a group of genes in the organism using high-throughput genome engineering. This group of genes is determined to have a high likelihood of impacting the trait of interest based on any one of a number of methods. These could include selection based on known function, or impact on the trait of interest, or algorithmic selection based on previously determined beneficial genetic diversity.
- the resultant HTP genetic design microbial library of organisms containing a protein solubility tag sequence linked to a gene is then assessed for performance in a high-throughput screening model, and protein solubility tag -gene linkages which lead to increased performance are determined and the information stored in a database.
- the collection of genetic perturbations i.e. given protein solubility tag x linked to a given gene y
- form a "protein solubility tag swap library” which can be utilized as a source of potential genetic alterations to be utilized in microbial engineering processing.
- each library becomes more powerful as a corpus of experimentally confirmed data that can be used to more precisely and predictably design targeted changes against any background of interest. That is in some embodiments, the present disclosures teaches introduction of one or more genetic changes into a host cell based on previous experimental results embedded within the meta data associated with any of the genetic design libraries of the invention.
- protein solubility tag swapping is a multi-step process comprising:
- a "library” also referred to as a HTP genetic design library
- each member of the library is an instance of x protein solubility tag linked to n target, in an otherwise identical genetic context.
- combinations of protein solubility tags can be inserted, extending the range of combinatorial possibilities upon which the library is constructed.
- This foundational process can be extended to provide further improvements in strain performance by, inter alia: (1) Consolidating multiple beneficial perturbations into a single strain background, either one at a time in an interactive process, or as multiple changes in a single step. Multiple perturbations can be either a specific set of defined changes or a partly randomized, combinatorial library of changes.
- the set of targets is every gene in a pathway
- sequential regeneration of the library of perturbations into an improved member or members of the previous library of strains can optimize the expression level of each gene in a pathway regardless of which genes are rate limiting at any given iteration; (2) Feeding the performance data resulting from the individual and combinatorial generation of the library into an algorithm that uses that data to predict an optimum set of perturbations based on the interaction of each perturbation; and (3) Implementing a combination of the above two approaches.
- the approach is exemplified in the present disclosure with industrial microorganisms, but is applicable to any organism where desired traits can be identified in a population of genetic mutants. For example, this could be used for improving the performance of CHO cells, yeast, insect cells, algae, as well as multi-cellular organisms, such as plants.
- DEGRADATION TAG swap A Molecular Tool for the Derivation of DEGRADATION TAG Swap Microbial Strain Libraries
- a strategy of gene deletion may also have drawbacks that can be addressed by the protein degradation tags (as well as terminators and protein solubility tags) of the present invention.
- Wholesale deletion of a gene and its corresponding protein product can in some cases impose a drastic modification to the cell.
- a more precise and tunable response may be achieved through libraries of protein degradation tags that target a protein for degradation at variable rates. This approach can also have the benefit of allowing modulation of protein products that may be essential for cell survival and would not be viable if completely deleted.
- these degradation tags also function at a post-translational level, they may be able to address scenarios where altered mRNA transcript levels do not result in altered protein levels as described above.
- the present disclosure teaches methods of selecting protein degradation tag sequences ("degradation tags”) with optimal protein degradation or protein level modulation properties to produce beneficial effects on overall-host strain productivity.
- the present disclosure teaches methods of identifying one or more protein degradation tags and/or generating variants of one or more protein degradation tags within a host cell, which exhibit a range of degradation strengths or modulate the levels of target proteins (e.g. protein degradation tags discussed infra).
- a particular combination of these identified and/or generated protein degradation tags can be grouped together as a protein degradation tag ladder, which is explained in more detail below.
- the protein degradation tag ladder in question is then associated with a given gene of interest.
- protein degradation tags PDT1-PDT8 representing a subset of protein degradation tags that have been identified from various sources as detailed in Table 18
- associates the protein degradation tag ladder with a single gene of interest in a host cell i.e. genetically engineer a host cell with a given protein degradation tag operably linked to a given target gene
- the effect of each combination of the protein degradation tag can be ascertained by characterizing each of the engineered strains resulting from each combinatorial effort, given that the engineered host cells have an otherwise identical genetic background except the particular degradation tag(s) associated with the target gene.
- the resultant host cells that are engineered via this process form HTP genetic design libraries.
- the HTP genetic design library can refer to the actual physical microbial strain collection that is formed via this process, with each member strain being representative of a given protein degradation tag operably linked to a particular target protein, in an otherwise identical genetic background, said library being termed a "degradation tag swap microbial strain library” or "DEGRADATION TAG swap microbial strain library.”
- the library can be termed a "DEGRADATION TAG swap E. coli strain library,” or "DEGRADATION TAG swap E. coli strain library,” but the terms can be used synonymously, as E. coli is a specific example of a microbe.
- the HTP genetic design library can refer to the collection of genetic perturbations—in this case a given protein degradation tag x operably linked to a given gene y— said collection being termed a “protein degradation tag swap library” or "DEGRADATION TAG swap library.”
- each of the eight protein degradation tags is operably linked to 10 different gene targets.
- the result of this procedure would be 80 host cell strains that are otherwise assumed genetically identical, except for the particular protein degradation tags operably linked to a target gene of interest. These 80 host cell strains could be appropriately screened and characterized and give rise to another HTP genetic design library.
- the characterization of the microbial strains in the HTP genetic design library produces information and data that can be stored in any database, including without limitation, a relational database, an object-oriented database or a highly distributed NoSQL database.
- This data/information could include, for example, a given protein degradation tag (e.g., PDT1-PDT8) effect when operably linked to a given gene target.
- This data/information can also be the broader set of combinatorial effects that result from operably linking two or more degradation tags (e.g., PDT1-PDT8) to a given gene target.
- utilizing various protein degradation tags to modulate degradation of various proteins in an organism is a powerful tool to optimize a trait of interest.
- the molecular tool of protein degradation tag swapping developed by the inventors, uses a ladder of protein degradation tag sequences that have been demonstrated to vary degradation (e.g., enhance) of at least one protein under at least one condition. This ladder is then systematically applied to a group of genes in the organism using high-throughput genome engineering. This group of genes is determined to have a high likelihood of impacting the trait of interest based on any one of a number of methods. These could include selection based on known function, or impact on the trait of interest, or algorithmic selection based on previously determined beneficial genetic diversity.
- the resultant HTP genetic design microbial library of organisms containing a protein degradation tag sequence linked to a gene is then assessed for performance in a high-throughput screening model, and protein degradation tag -gene linkages which lead to increased performance are determined and the information stored in a database.
- the collection of genetic perturbations i.e. given protein degradation tag x linked to a given gene y
- form a "protein degradation tag swap library” which can be utilized as a source of potential genetic alterations to be utilized in microbial engineering processing.
- each library becomes more powerful as a corpus of experimentally confirmed data that can be used to more precisely and predictably design targeted changes against any background of interest. That is in some embodiments, the present disclosures teaches introduction of one or more genetic changes into a host cell based on previous experimental results embedded within the meta data associated with any of the genetic design libraries of the invention.
- protein degradation tag swapping is a multi-step process comprising:
- a "library” also referred to as a HTP genetic design library
- each member of the library is an instance of x protein degradation tag linked to n target, in an otherwise identical genetic context.
- combinations of protein degradation tags can be inserted, extending the range of combinatorial possibilities upon which the library is constructed.
- This foundational process can be extended to provide further improvements in strain performance by, inter alia: (1) Consolidating multiple beneficial perturbations into a single strain background, either one at a time in an interactive process, or as multiple changes in a single step. Multiple perturbations can be either a specific set of defined changes or a partly randomized, combinatorial library of changes.
- the set of targets is every gene in a pathway
- sequential regeneration of the library of perturbations into an improved member or members of the previous library of strains can optimize the expression level of each gene in a pathway regardless of which genes are rate limiting at any given iteration; (2) Feeding the performance data resulting from the individual and combinatorial generation of the library into an algorithm that uses that data to predict an optimum set of perturbations based on the interaction of each perturbation; and (3) Implementing a combination of the above two approaches.
- the approach is exemplified in the present disclosure with industrial microorganisms, but is applicable to any organism where desired traits can be identified in a population of genetic mutants. For example, this could be used for improving the performance of CHO cells, yeast, insect cells, algae, as well as multi-cellular organisms, such as plants.
- the present disclosure teaches epistasis mapping methods for predicting and combining beneficial genetic alterations into a host cell.
- the genetic alterations may be created by any of the aforementioned HTP molecular tool sets (e.g., promoter swaps, SNP swaps, start/stop codon exchanges, sequence optimization, protein solubility tag swaps, protein degradation tag swaps and STOP swaps) and the effect of those genetic alterations would be known from the characterization of the derived HTP genetic design microbial strain libraries.
- the term epistasis mapping includes methods of identifying combinations of genetic alterations (e.g., beneficial SNPs or beneficial promoter/target gene associations) that are likely to yield increases in host performance.
- the epistasis mapping methods of the present disclosure are based on the idea that the combination of beneficial mutations from two different functional groups is more likely to improve host performance, as compared to a combination of mutations from the same functional group. See, e.g., Costanzo, The Genetic Landscape of a Cell, Science, Vol. 327, Issue 5964, Jan. 22, 2010, pp. 425-431 (incorporated by reference herein in its entirety).
- lysA and zwf are genes that operate in different pathways to achieve the production of lysine. Based upon the dissimilarity in the individual performance of those genes, genetic changes using those genes should result in additive consolidation effects. This was borne out in the actual measurement of the consolidated effects of the combination of lysA and zwf, as shown in Figure 16B and Example 6.
- the present disclosure teaches methods of analyzing SNP mutations to identify SNPs predicted to belong to different functional groups.
- SNP functional group similarity is determined by computing the cosine similarity of mutation interaction profiles (similar to a correlation coefficient, see Figure 16A).
- the present disclosure also illustrates comparing SNPs via a mutation similarity matrix (see Figure 15 for example analysis conducted in Corynebacterium) or dendrogram (see Figure 16A for example analysis conducted in Corynebacterium).
- the epistasis mapping procedure provides a method for grouping and/or ranking a diversity of genetic mutations applied in one or more genetic backgrounds for the purposes of efficient and effective consolidations of said mutations into one or more genetic backgrounds.
- consolidation is performed with the objective of creating novel strains which are optimized for the production of target biomolecules.
- novel strains which are optimized for the production of target biomolecules.
- the present HTP genomic engineering platform solves many of the problems associated with traditional microbial engineering approaches.
- the present HTP platform uses automation technologies to perform hundreds or thousands of genetic mutations at once.
- the disclosed HTP platform enables the parallel construction of thousands of mutants to more effectively explore large subsets of the relevant genomic space, as disclosed in U.S. Application No. 15/140,296, entitled Microbial Strain Design System And Methods For Improved Large-Scale Production Of Engineered Nucleotide Sequences, incorporated by reference herein in its entirety.
- the present HTP platform sidesteps the difficulties induced by our limited biological understanding.
- the present HTP platform faces the problem of being fundamentally limited by the combinatorial explosive size of genomic space, and the effectiveness of computational techniques to interpret the generated data sets given the complexity of genetic interactions. Techniques are needed to explore subsets of vast combinatorial spaces in ways that maximize non-random selection of combinations that yield desired outcomes.
- genomic sequence of interest on the order of 1000 bases
- the precise configuration is determined by the collective electromagnetic interactions between its constituent atomic components.
- This combination of short genomic sequence and physically constrained folding problem lends itself specifically to greedy optimization strategies. That is, it is possible to individually mutate the sequence at every residue and shuffle the resulting mutants to effectively sample local sequence space at a resolution compatible with the Sequence Activity Response modeling.
- a library of M mutations and one or more genetic backgrounds (e.g., parent bacterial strains). Neither the choice of library nor the choice of genetic backgrounds is specific to the method described here. But in a particular implementation, a library of mutations may include exclusively, or in combination: SNP swap libraries, Promoter swap libraries, or any other mutation library described herein.
- a single genetic background is provided.
- a collection of distinct genetic backgrounds (microbial mutants) will first be generated from this single background. This may be achieved by applying the primary library of mutations (or some subset thereof) to the given background for example, application of a HTP genetic design library of particular SNPs or a HTP genetic design library of particular promoters to the given genetic background, to create a population (perhaps 100's or 1,000's) of microbial mutants with an identical genetic background except for the particular genetic alteration from the given HTP genetic design library incorporated therein. As detailed below, this embodiment can lead to a combinatorial library or pairwise library.
- the number of genetic backgrounds and genetic diversity between these backgrounds is determined to maximize the effectiveness of this method.
- a genetic background may be a natural, native or wild-type strain or a mutated, engineered strain.
- N distinct background strains may be represented by a vector b.
- each mutation in a collection of M mutations mi is applied to each background within the collection of N background strains b to form a collection of M x N mutants.
- the resulting set of mutants will sometimes be referred to as a combinatorial library or a pairwise library.
- the resulting set of mutants may be referred to as a subset of a combinatorial library.
- the input interface 202 receives the mutation vector mi and the background vector b, and a specified operation such as cross product.
- Each ith row of the resulting MxN matrix represents the application of the ith mutation within mi to all the strains within background collection b.
- forming the MxN matrix may be achieved by inputting into the input interface 202 (see, Figure 31) the compound expression mi x mob0.
- the component vectors of the expression may be input directly with their elements explicitly specified, via one or more DNA specifications, or as calls to the library 206 to enable retrieval of the vectors during interpretation by interpreter 204.
- the LIMS system 200 generates the microbial strains specified by the input expression.
- the analysis equipment 214 measures phenotypic responses for each mutant within the MxN combinatorial library matrix (4202).
- the collection of responses can be construed as an M x N Response Matrix R.
- mi mo.
- the set of mutations represents a pairwise mutation library
- the resulting matrix may also be referred to as a gene interaction matrix or, more particularly, as a mutation interaction matrix.
- operations related to epistatic effects and predictive strain design may be performed entirely through automated means of the LIMS system 200, e.g., by the analysis equipment 214 (see, Figure 31), or by human implementation, or through a combination of automated and manual means.
- the elements of the LIMS system 200 e.g., analysis equipment 214
- the elements of the LIMS system 200 may, for example, receive the results of the human performance of the operations rather than generate results through its own operational capabilities.
- components of the LIMS system 200 such as the analysis equipment 214, may be implemented wholly or partially by one or more computer systems.
- the analysis equipment 214 may include not only computer hardware, software or firmware (or a combination thereof), but also equipment operated by a human operator such as that listed in Table 5 below, e.g., the equipment listed under the category of "Evaluate performance.”
- the analysis equipment 212 normalizes the response matrix. Normalization consists of a manual and/or, in this embodiment, automated processes of adjusting measured response values for the purpose of removing bias and/or isolating the relevant portions of the effect specific to this method.
- the first step 4202 may include obtaining normalized measured data.
- performance measure or “measured performance” or the like may be used to describe a metric that reflects measured data, whether raw or processed in some manner, e.g., normalized data.
- normalization may be performed by subtracting a previously measured background response from the measured response value.
- y(rrij) is the response of the engineered background strain bj within engineered collection b caused by application of primary mutation mj to parent strain b0.
- the combined performance/response of strains resulting from two mutations may be greater than, less than, or equal to the performance/response of the strain to each of the mutations individually.
- mutations from different functional groups are more likely to operate by independent mechanisms, which can lead to improved host performance by reducing redundant mutative effects, for example.
- mutations that yield dissimilar responses are more likely to combine in an additive manner than mutations that yield similar responses. This leads to the computation of similarity in the next step.
- the analysis equipment 214 measures the similarity among the responses— in the pairwise mutation example, the similarity between the effects of the ith mutation and jth (e.g., primary) mutation within the response matrix (4204).
- the ith row of R represents the performance effects of the ith mutation mi on the N background strains, each of which may be itself the result of engineered mutations as described above.
- response profiles may be clustered to determine degree of similarity.
- Clustering may be performed by use of a distance- based clustering algorithms (e.g. k-mean, hierarchical agglomerative, etc.) in conjunction with suitable distance measure (e.g. Euclidean, Hamming, etc).
- suitable distance measure e.g. Euclidean, Hamming, etc.
- clustering may be performed using similarity based clustering algorithms (e.g. spectral, min-cut, etc.) with a suitable similarity measure (e.g. cosine, correlation, etc).
- similarity measure e.g. cosine, correlation, etc.
- distance measures may be mapped to similarity measures and vice-versa via any number of standard functional operations (e.g., the exponential function).
- hierarchical agglomerative clustering may be used in conjunction absolute cosine similarity. (See Figure 16A for example analysis conducted in Corynebacterium).
- C be a clustering of mutations m i into k distinct clusters.
- C be the cluster membership matrix, where c ij is the degree to which mutation i belongs to cluster j, a value between 0 and 1.
- CixCj the dot product of the ith and jth rows of C.
- the cluster-based similarity matrix is given by CC T (that is, C times C-transpose).
- CC T that is, C times C-transpose.
- the similarity between two mutations is 1 if they belong to the same cluster and 0 if not.
- the analysis equipment 214 selects pairs of mutations that lead to dissimilar responses, e.g., their cosine similarity metric falls below a similarity threshold, or their responses fall within sufficiently separated clusters, (e.g., in Figure 15 and Figure 16A for example analyses conducted in Corynebacterium) as shown in Figure 42 (4206). Based on their dissimilarity, the selected pairs of mutations should consolidate into background strains better than similar pairs.
- the LIMS system (e.g., all of or some combination of interpreter 204, execution engine 207, order placer 208, and factory 210) may be used to design microbial strains having those selected mutations (4208).
- epistatic effects may be built into, or used in conjunction with the predictive model to weight or filter strain selection.
- the analysis equipment 214 may restrict the model to mutations having low similarity measures by, e.g., filtering the regression results to keep only sufficiently dissimilar mutations.
- the predictive model may be weighted with the similarity matrix.
- some embodiments may employ a weighted least squares regression using the similarity matrix to characterize the interdependencies of the proposed mutations.
- weighting may be performed by applying the "kernel" trick to the regression model. (To the extent that the "kernel trick" is general to many machine learning modeling approaches, this re-weighting strategy is not restricted to linear regression.)
- the kernel is a matrix having elements 1 - w * sij where 1 is an element of the identity matrix, and w is a real value between 0 and 1.
- the value of w will be tied to the accuracy (r 2 value or root mean square error (RMSE)) of the predictive model when evaluated against the pairwise combinatorial constructs and their associate effects y(mi, rrij).
- the accuracy can be assessed to determine whether model performance is improving.
- the dissimilar mutation response profiles may be used by the analysis equipment 214 to augment the score and rank associated with each hypothetical strain from the predictive model.
- This procedure may be thought of broadly as a re- weighting of scores, so as to favor candidate strains with dissimilar response profiles (e.g., strains drawn from a diversity of clusters).
- a strain may have its score reduced by the number of constituent mutations that do not satisfy the dissimilarity threshold or that are drawn from the same cluster (with suitable weighting).
- a hypothetical strain's performance estimate may be reduced by the sum of terms in the similarity matrix associated with all pairs of constituent mutations associated with the hypothetical strain (again with suitable weighting). Hypothetical strains may be re-ranked using these augmented scores. In practice, such re- weighting calculations may be performed in conjunction with the initial scoring estimation.
- hypothetical strains may be constructed at this time, or they may be passed to another computational method for subsequent analysis or use.
- epistasis mapping and iterative predictive strain design as described herein are not limited to employing only pairwise mutations, but may be expanded to the simultaneous application of many more mutations to a background strain.
- additional mutations may be applied sequentially to strains that have already been mutated using mutations selected according to the predictive methods described herein.
- epistatic effects are imputed by applying the same genetic mutation to a number of strain backgrounds that differ slightly from each other, and noting any significant differences in positive response profiles among the modified strain backgrounds.
- the disclosed HTP genomic engineering platform is exemplified with industrial microbial cell cultures (e.g., Corynebacterium), but is applicable to any host cell organism where desired traits can be identified in a population of genetic mutants.
- industrial microbial cell cultures e.g., Corynebacterium
- the current disclosure provides for a HTP genomic engineering platform to improve host cell characteristics in E. coli systems and solves many problems that have previously prevented the development of such a system in E. coli.
- microorganism should be taken broadly. It includes, but is not limited to, the two prokaryotic domains, Bacteria and Archaea, as well as certain eukaryotic fungi and protists. However, in certain aspects, "higher" eukaryotic organisms such as insects, plants, and animals can be utilized in the methods taught herein.
- Suitable host cells include, but are not limited to: bacterial cells, algal cells, plant cells, fungal cells, insect cells, and mammalian cells.
- suitable host cells include E. coli (e.g., SHuffleTM competent E. coli available from New England BioLabs in Ipswich, Mass.). The E. coli genome is 4,646,332 bp in size (see Figure 52).
- Suitable host strains of the E. coli species comprise: Enterotoxigenic E. coli (ETEC), Enteropathogenic E. coli (EPEC), Enteroinvasive E. coli (EIEC), Enterohemorrhagic E. coli (EHEC), Uropathogenic E. coli (UPEC), Verotoxin-producing E. coli, E. coli 0157:H7, E. coli O104:H4, Escherichia coli 0121, Escherichia coli O104:H21, Escherichia coli Kl, and Escherichia coli NCI 01.
- ETEC Enterotoxigenic E. coli
- EPEC Enteropathogenic E. coli
- EIEC Enteroinvasive E. coli
- EHEC Enterohemorrhagic E. coli
- UPEC Uropathogenic E. coli
- Verotoxin-producing E. coli E. coli 0157:H7, E. coli O104:H
- the present disclosure teaches genomic engineering of E. coli strains NCTC 12757, NCTC 12779, NCTC 12790, NCTC 12796, NCTC 12811, ATCC 11229, ATCC 25922, ATCC 8739, DSM 30083, BC 5849, BC 8265, BC 8267, BC 8268, BC 8270, BC 8271, BC 8272, BC 8273, BC 8276, BC 8277, BC 8278, BC 8279, BC 8312, BC 8317, BC 8319, BC 8320, BC 8321, BC 8322, BC 8326, BC 8327, BC 8331, BC 8335, BC 8338, BC 8341, BC 8344, BC 8345, BC 8346, BC 8347, BC 8348, BC 8863, and BC 8864.
- the present disclosure teaches verocytotoxigenic E. coli (VTEC), such as strains BC 4734 (026:H11), BC 4735 (0157:H-), BC 4736 , BC 4737 (n.d.), BC 4738 (0157:H7), BC 4945 (026:H-), BC 4946 (0157:H7), BC 4947 (0111 :H-), BC 4948 (0157:H), BC 4949 (05), BC 5579 (0157:H7), BC 5580 (0157:H7), BC 5582 (03 :H), BC 5643 (02:H5), BC 5644 (0128), BC 5645 (055:H-), BC 5646 (069:H-), BC 5647 (O101 :H9), BC 5648 (O103:H2), BC 5850 (022:H8), BC 5851 (055:H-), BC 5852 (048:H21), BC 5853 (026:H11), BC 5854 (0157:H7), BC 5855 (0157:H-
- the present disclosure teaches enteroinvasive E. coli (EIEC), such as strains BC 8246 (0152:K-:H-), BC 8247 (0124:K(72):H3), BC 8248 (0124), BC 8249 (0112), BC 8250 (0136:K(78):H-), BC 8251 (0124:H-), BC 8252 (0144:K-:H-), BC 8253 (0143:K:H-), BC 8254 (0143), BC 8255 (0112), BC 8256 (028a.e), BC 8257 (0124:H-), BC 8258 (0143), BC 8259 (0167:K-:H5), BC 8260 (0128a.c.:H35), BC 8261 (0164), BC 8262 (0164:K-:H-), BC 8263 (0164), and BC 8264 (0124).
- EIEC enteroinvasive E. coli
- the present disclosure teaches enterotoxigenic E. coli (ETEC),suc as strains BC 5581 (078:H11), BC 5583 (02:K1), BC 8221 (0118), BC 8222 (0148:H-), BC 8223 (0111), BC 8224 (O110:H-), BC 8225 (0148), BC 8226 (0118), BC 8227 (025:H42), BC 8229 (06), BC 8231 (0153:H45), BC 8232 (09), BC 8233 (0148), BC 8234 (0128), BC 8235 (0118), BC 8237 (0111), BC 8238 (O110:H17), BC 8240 (0148), BC 8241 (06H16), BC 8243 (0153), BC 8244 (015:H-), BC 8245 (020), BC 8269 (0125a.c:H-), BC 8313 (06:H6), BC 8315 (0153:H-), BC 8329, BC 8334 (0118:H12), and
- the present disclosure teaches enteropathogenic E. coli (EPEC), such as strains BC 7567 (086), BC 7568 (0128), BC 7571 (0114), BC 7572 (0119), BC 7573 (0125), BC 7574 (0124), BC 7576 (0127a), BC 7577 (0126), BC 7578 (0142), BC 7579 (026), BC 7580 (OK26), BC 7581 (0142), BC 7582 (055), BC 7583 (0158), BC 7584 (0-), BC 7585 (0-), BC 7586 (0-), BC 8330, BC 8550 (026), BC 8551 (055), BC 8552 (0158), BC 8553 (026), BC 8554 (0158), BC 8555 (086), BC 8556 (0128), BC 8557 (OK26), BC 8558 (055), BC 8560 (0158), BC 8561 (0158), BC 8562 (0114), BC 8563 (086), BC 8564 (0128), BC 8565 (0158), BC 8566 (0158), BC 8567 (0158), BC 8568 (0111), BC 8569 (01
- the present disclosure also teaches methods for the engineering of Shigella organisms, including Shigella flexneri, Shigella, dysenteriae, Shigella, hoydii, and Shigella sonnei.
- the methods of the present disclosure are characterized as genetic design.
- genetic design refers to the reconstruction or alteration of a host organism's genome through the identification and selection of the most optimum variants of a particular gene, portion of a gene, promoter, stop codon, 5'UTR, 3'UTR, or other DNA sequence to design and create new superior host cells.
- a first step in the genetic design methods of the present disclosure is to obtain an initial genetic diversity pool population with a plurality of sequence variations from which a new host genome may be reconstructed.
- a subsequent step in the genetic design methods taught herein is to use one or more of the aforementioned HTP molecular tool sets (e.g. SNP swapping, promoter swapping, terminator swapping, protein solubility tag swapping or protein degradation tag swapping) to construct HTP genetic design libraries, which then function as drivers of the genomic engineering process, by providing libraries of particular genomic alterations for testing in a host cell.
- HTP molecular tool sets e.g. SNP swapping, promoter swapping, terminator swapping, protein solubility tag swapping or protein degradation tag swapping
- a diversity pool can be a given number n of wild-type microbes utilized for analysis, with said microbes' genomes representing the "diversity pool.”
- the diversity pools can be the result of existing diversity present in the natural genetic variation among said wild-type microbes. This variation may result from strain variants of a given host cell or may be the result of the microbes being different species entirely. Genetic variations can include any differences in the genetic sequence of the strains, whether naturally occurring or not. In some embodiments, genetic variations can include SNPs swaps, PRO swaps, Start/Stop Codon swaps, SOLUBILITY TAG swaps, DEGRADATION TAG swaps or STOP swaps, among others.
- diversity pools are strain variants created during traditional strain improvement processes (e.g., one or more host organism strains generated via random mutation and selected for improved yields over the years).
- the diversity pool or host organisms can comprise a collection of historical production strains.
- a diversity pool may be an original parent microbial strain (Si) with a "baseline" genetic sequence at a particular time point (SiGeni) and then any number of subsequent offspring strains (S 2 , S3, S 4 , S5, etc., generalizable to S 2 -n) that were derived/developed from said Si strain and that have a different genome (S 2 -nGen 2 -n), in relation to the baseline genome of Si.
- the present disclosure teaches sequencing the microbial genomes in a diversity pool to identify the SNP's present in each strain.
- the strains of the diversity pool are historical microbial production strains.
- a diversity pool of the present disclosure can include for example, an industrial base strain, and one or more mutated industrial strains produced via traditional strain improvement programs.
- an initial step in the taught platform can be to obtain an initial genetic diversity pool population with a plurality of sequence variations, e.g. SNPs.
- a subsequent step in the taught platform can be to use one or more of the aforementioned HTP molecular tool sets (e.g. SNP swapping) to construct HTP genetic design libraries, which then function as drivers of the genomic engineering process, by providing libraries of particular genomic alterations for testing in a microbe.
- the SNP swapping methods of the present disclosure comprise the step of introducing one or more SNPs identified in a mutated strain (e.g., a strain from amongst S2-nGen2-n) to a base strain (SiGem) or wild-type strain.
- a mutated strain e.g., a strain from amongst S2-nGen2-n
- SiGem base strain
- the SNP swapping methods of the present disclosure comprise the step of removing one or more SNPs identified in a mutated strain (e.g., a strain from amongst S2- «Gen2-n).
- the mutations of interest in a given diversity pool population of cells can be artificially generated by any means for mutating strains, including mutagenic chemicals, or radiation.
- mutagenizing is used herein to refer to a method for inducing one or more genetic modifications in cellular nucleic acid material.
- the term "genetic modification” refers to any alteration of DNA. Representative gene modifications include nucleotide insertions, deletions, substitutions, and combinations thereof, and can be as small as a single base or as large as tens of thousands of bases. Thus, the term “genetic modification” encompasses inversions of a nucleotide sequence and other chromosomal rearrangements, whereby the position or orientation of DNA comprising a region of a chromosome is altered.
- a chromosomal rearrangement can comprise an intrachromosomal rearrangement or an interchromosomal rearrangement.
- the mutagenizing methods employed in the presently claimed subject matter are substantially random such that a genetic modification can occur at any available nucleotide position within the nucleic acid material to be mutagenized. Stated another way, in one embodiment, the mutagenizing does not show a preference or increased frequency of occurrence at particular nucleotide sequences.
- mutagenizing also encompasses a method for altering (e.g., by targeted mutation) or modulating a cell function, to thereby enhance a rate, quality, or extent of mutagenesis.
- a cell can be altered or modulated to thereby be dysfunctional or deficient in DNA repair, mutagen metabolism, mutagen sensitivity, genomic stability, or combinations thereof.
- disruption of gene functions that normally maintain genomic stability can be used to enhance mutagenesis.
- Representative targets of disruption include, but are not limited to DNA ligase I (Bentley et al, 2002) and casein kinase I (U.S. Pat. No. 6,060,296).
- site-specific mutagenesis e.g., primer-directed mutagenesis using a commercially available kit such as the Transformer Site Directed mutagenesis kit (Clontech)
- a commercially available kit such as the Transformer Site Directed mutagenesis kit (Clontech)
- Transformer Site Directed mutagenesis kit (Clontech)
- site-specific mutagenesis is used to make a plurality of changes throughout a nucleic acid sequence in order to generate nucleic acid encoding a cleavage enzyme of the present disclosure.
- the frequency of genetic modification upon exposure to one or more mutagenic agents can be modulated by varying dose and/or repetition of treatment, and can be tailored for a particular application.
- mutagenesis comprises all techniques known in the art for inducing mutations, including error-prone PCR mutagenesis, oligonucleoti de-directed mutagenesis, site-directed mutagenesis, and iterative sequence recombination by any of the techniques described herein.
- the present disclosure teaches mutating cell populations by introducing, deleting, or replacing selected portions of genomic DNA.
- the present disclosure teaches methods for targeting mutations to a specific locus.
- the present disclosure teaches the use of gene editing technologies such as ZFNs, TALENS, Lambda Red or CRISPR, to selectively edit target DNA regions.
- the present disclosure teaches mutating selected DNA regions outside of the host organism, and then inserting the mutated sequence back into the host organism.
- the present disclosure teaches mutating native or synthetic promoters to produce a range of promoter variants with various expression properties (see promoter ladder infra).
- the present disclosure is compatible with single gene optimization techniques, such as ProSAR (Fox et al. 2007. "Improving catalytic function by ProSAR-driven enzyme evolution.” Nature Biotechnology Vol 25 (3) 338-343, incorporated by reference herein).
- the selected regions of DNA are produced in vitro via gene shuffling of natural variants, or shuffling with synthetic oligos, plasmid-plasmid recombination, virus plasmid recombination, virus-virus recombination.
- the genomic regions are produced via error-prone PCR.
- generating mutations in selected genetic regions is accomplished by "reassembly PCR.”
- oligonucleotide primers oligos
- PCR amplification of segments of a nucleic acid sequence of interest such that the sequences of the oligonucleotides overlap the junctions of two segments.
- the overlap region is typically about 10 to 100 nucleotides in length.
- Each of the segments is amplified with a set of such primers.
- the PCR products are then "reassembled” according to assembly protocols. In brief, in an assembly protocol, the PCR products are first purified away from the primers, by, for example, gel electrophoresis or size exclusion chromatography.
- Purified products are mixed together and subjected to about 1-10 cycles of denaturing, reannealing, and extension in the presence of polymerase and deoxynucleoside triphosphates (dNTP's) and appropriate buffer salts in the absence of additional primers ("self-priming"). Subsequent PCR with primers flanking the gene are used to amplify the yield of the fully reassembled and shuffled genes.
- dNTP's deoxynucleoside triphosphates
- self-priming additional primers
- mutated DNA regions are enriched for mutant sequences so that the multiple mutant spectrum, i.e. possible combinations of mutations, is more efficiently sampled.
- mutated sequences are identified via a mutS protein affinity matrix (Wagner et al, Nucleic Acids Res. 23(19):3944- 3948 (1995); Su et al, Proc. Natl. Acad. Sci. (U.S.A.), 83:5057-5061(1986)) with a preferred step of amplifying the affinity-purified material in vitro prior to an assembly reaction. This amplified material is then put into an assembly or reassembly PCR reaction as described in later portions of this application.
- Promoters regulate the rate at which genes are transcribed and can influence transcription in a variety of ways. Constitutive promoters, for example, direct the transcription of their associated genes at a constant rate regardless of the internal or external cellular conditions, while regulatable promoters increase or decrease the rate at which a gene is transcribed depending on the internal and/or the external cellular conditions, e.g. growth rate, temperature, responses to specific environmental chemicals, and the like. Promoters can be isolated from their normal cellular contexts and engineered to regulate the expression of virtually any gene, enabling the effective modification of cellular growth, product yield and/or other phenotypes of interest.
- the present disclosure teaches methods for producing promoter ladder libraries for use in downstream genetic design methods. For example, in some embodiments, the present disclosure teaches methods of identifying one or more promoters and/or generating variants of one or more promoters within a host cell, which exhibit a range of expression strengths, or superior regulatory properties. A particular combination of these identified and/or generated promoters can be grouped together as a promoter ladder, which is explained in more detail below.
- the present disclosure teaches the use of promoter ladders.
- the promoter ladders of the present disclosure comprise promoters exhibiting a continuous range of expression profiles.
- promoter ladders are created by: identifying natural, native, or wild-type promoters that exhibit a range of expression strengths in response to a stimuli, or through constitutive expression (see e.g., Figure 20 and Figures 28-30). These identified promoters can be grouped together as a promoter ladder.
- the present disclosure teaches the creation of promoter ladders exhibiting a range of expression profiles across different conditions.
- the present disclosure teaches creating a ladder of promoters with expression peaks spread throughout the different stages of a fermentation (see e.g., Figure 28).
- the present disclosure teaches creating a ladder of promoters with different expression peak dynamics in response to a specific stimulus (see e.g., Figure 29).
- the regulatory promoter ladders of the present disclosure can be representative of any one or more regulatory profiles.
- the promoter ladders of the present disclosure are designed to perturb gene expression in a predictable manner across a continuous range of responses.
- the continuous nature of a promoter ladder confers strain improvement programs with additional predictive power.
- swapping promoters or termination sequences of a selected metabolic pathway can produce a host cell performance curve, which identifies the most optimum expression ratio or profile; producing a strain in which the targeted gene is no longer a limiting factor for a particular reaction or genetic cascade, while also avoiding unnecessary over expression or misexpression under inappropriate circumstances.
- promoter ladders are created by: identifying natural, native, or wild-type promoters exhibiting the desired profiles.
- the promoter ladders are created by mutating naturally occurring promoters to derive multiple mutated promoter sequences. Each of these mutated promoters is tested for effect on target gene expression.
- the edited promoters are tested for expression activity across a variety of conditions, such that each promoter variant's activity is documented/characterized/annotated and stored in a database. The resulting edited promoter variants are subsequently organized into promoter ladders arranged based on the strength of their expression (e.g., with highly expressing variants near the top, and attenuated expression near the bottom, therefore leading to the term "ladder"). Examples of synthetic promoters for use in the methods provided herein can be found in Table 1.4.
- the present disclosure teaches promoter ladders that are a combination of identified naturally occurring promoters and mutated variant promoters.
- the present disclosure teaches methods of identifying natural, native, or wild- type promoters that satisfied both of the following criteria: 1) represented a ladder of constitutive promoters; and 2) could be encoded by short DNA sequences, ideally less than 100 base pairs.
- constitutive promoters of the present disclosure exhibit constant gene expression across two selected growth conditions (typically compared among conditions experienced during industrial cultivation). An example of examining gene expression using different promoters provided herein can be found in Example 12.
- the promoters of the present disclosure will consist of a -60 base pair core promoter, and a 5' UTR between 26- and 40 base pairs in length.
- Native promoters for inclusion in promoter ladders for use in the PROSWP methods provided herein can be selected based on said native promoter showing minimal variation in an associated gene's expression. Further, the native promoters can be 60-90 bps in length, and can consist of sequence that is located 50 bp in front of a putative transcription start site, and, optionally, the sequence up to but not including a putative start codon. Examples of native promoters for use in the methods provided herein can be found in Table 1.4. In particular, the native promoters for use in the methods provided herein can be selected from nucleic acid SEQ ID NOs 71-131 from Table 1.4.
- one or more of the aforementioned identified naturally occurring promoter sequences are chosen for gene editing.
- the natural promoters are edited via any of the mutation methods described supra.
- the promoters of the present disclosure are edited by synthesizing new promoter variants with the desired sequence.
- Synthetic promoters for inclusion in promoter ladders for use in the PROSWP methods provided herein can be chimeric sequences 60-90 bps in length.
- the synthetic promoter libraries for use herein can comprise a set or plurality of synthetic promoters that can be designed and constructed such that they are likely to express constitutively and/or represent a range of expression strengths in comparison to one another. Further, the synthetic promoters can be designed and constructed such that they are unlikely to bind any regulatory elements present in E. coli and therefore drive gene expression constitutively.
- the chimeric synthetic promoters can comprise all or a combination of the elements found in Table 1.5.
- the synthetic promoters can comprise or consist of a distal region, a -35 region, a core region, a - 10 region and a 5'UTR/ribosomal binding site (RBS) region , as shown in Figure 54.
- the distal region can be located just upstream of the -35 region, while the core region can be located between the -35 and -10 regions as shown Figure 54. Both the distal and the core regions can be important for binding regulatory elements (see Cox et al, Mol Syst Biol. 2007; 3: 145).
- the lambda phage pR promoter is expected to drive expression constitutively, distal and core regions from this promoter can be used in the design strategy.
- the core region of the lambda phage PL promoter also be included for the same reason, as well as to add additional variety to the library.
- the -35 and -10 regions can be included because they are known to be particularly important in prokaryotes for binding the RNA polymerase and can therefore be critical for modulating the degree of expression.
- the -35 and - 10 regions from the lambda phage pR promoter and PL promoter are used.
- the -35 and -10 regions from pR and PL can be used since they are expected to drive strong expression.
- -35 and -10 regions found in many native E. coli promoters can be used, whereby said -35 and -10 regions represent small variations to pR and PL and can be expected to decrease the promoter strength in comparison with pR and PL.
- the variable 6 bp sequence constituting the -35 and -10 regions can be selected from the -35 and -10 seqeunces found in Table 1.5.
- the chimeric synthetic promoters can comprise a 5' untranslated region (5'-UTR) that includes a ribosome binding site (RBS), which can be particularly important in prokaryotes for binding the ribosome and thus be critical to modulating the degree of protein expression.
- 5'-UTR 5' untranslated region
- RBS ribosome binding site
- the 5'-UTR/RBS from the native E. coli gene acs can be used to add additional variety to the library.
- the 5'UTR/RBS from the lambda phage PR promoter can be used.
- Examples of synthetic promoters for use in the methods provided herein can be found in Table 1.4.
- the synthetic promoters for use in the methods provided herein can be selected from nucleic acid SEQ ID NOs 132-207 from Table 1.4.
- each of the promoter sequences can be referred to as a heterologous promoter or heterologous promoter polynucleotide.
- the promoters of the present disclosure exhibit at least 100%, 99%, 98%, 97%, 96%, 95%, 94%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, 85%, 84%, 83%, 82%, 81%, 80%, 79%, 78%, 77%, 76%, or 75% sequence identity with a promoter from Table 1 and/or Table 1.4.
- the methods of the present disclosure overcome these aforementioned challenges via the use of bicistronic design regulatory sequences.
- Bicistronic designs of the present disclosure can, in some embodiments, greatly reduce the context dependent variability in expression strength of a given promoter for a variety of coding genes (Mutalik, et al. "Precise and reliable gene expression via standard transcription and translation initiation elements” Nat. Biotechnol. Vol 10 (4) pp 354-368 (2013)).
- a bicistronic design is a nucleotide sequence in which a promoter drives the expression of two coding sequences, where the first coding sequence (Cistron 1) terminates and the second coding sequences initiates at the same nucleotide base (Cistron 2/target gene).
- the promoters of the present disclosure are compound regulatory sequences following the bicistronic design.
- the promoters in the promoter ladders of the present disclosure are larger regulatory sequences comprising i) a promoter operably linked to ii) a first ribosome binding site (SD1), which is operably linked to iii) a first cistronic sequence (Cisl), wherein the Cisl overlaps with iv) a second ribosome binding site (SD2), that is then operably linked to v) a target gene coding sequence (Cis2) (See Figure 43).
- the present disclosure refers to the combination of elements i)-iv) as a "bicistronic design” or “bicistronic design regulatory sequence” (BCDs).
- the BCDs of the present disclosure can be operably linked to any target gene.
- the BCDs of the present disclosure can be used in place of traditional promoters.
- the present disclosure teaches that using BCDs in the PRO swap toolbox increases the consistency with which expressed transcripts are translated. Without wishing to be bound by any one theory, the present inventors believe that the presence of an SD1 and Cisl leader sequences operably linked to the target gene recruit active ribosomal complexes, which are then able to consistenly reinitiate translation of the target gene via the SD2 ribosomal binding site.
- the present disclosure teaches that the BCD of Mutalik et al., could not be used to effectively engineer multiple target genes in a single organism. That is, in some embodiments, the present disclosure teaches against the multiple integration of the Mutalik BCD into the genome of a host cell. Without wishing to be bound by any one theory, the present inventors believe that repeated use of the Mutalik et al, BCD would result in increasing rates of undesired homologous recombination (HR) triggered by the presence of highly homologous sequences throughout the genome.
- HR homologous recombination
- the present disclosure solves this problem by describing novel BCDs with non-identical nucleotide sequences.
- novel BCDs can be used for HTP genome engineering in E. coli to provide predictable changes in expression of multiple genes within a single genome, independent of the coding sequences of these genes, without inducing undesirable homologous recombination.
- the present disclosure teaches methods of expressing two target gene proteins in a host organism at relatively similar levels.
- the present disclosure teaches expression of two or more target gene proteins within 0.2, 0.4, 0.6, 0.8, 1, 1.2, 1.4, 1.6, 1.8, 2, 2.2, 2.4, 2.6, 2.8, or 3-fold of each other.
- the present disclosure teaches methods of expressing two target gene proteins in a host organism at similar levels, while reducing the risk of undesirable homologous recombination (HR) events triggered by the use of identical regulatory sequences.
- HR homologous recombination
- the present disclosure teaches methods of varying BCD sequence in a way that maintains expression levels, while reducing the risk of HR. That is, in some embodiments, the present disclosure teaches expression of two or more genes encoding for proteins via BCDs that are identical save for their Cisl sequences.
- the BCDs of the present disclosure comprise a promoter sequence.
- the promoters comprised in BCDs can be any promoter capable of expressing in the host cell.
- the promoters can be any promoter disclosed in the specification.
- the promoter can be any promoter known to function in E. coli.
- the promoters can be any promoter disclosed in Table 1 and/or Table 1.4.
- the BCDs of the present disclosure comprise a first and second ribosomal binding site, referred to as SDl and SD2, respectively.
- SDl and SD2 can be the same. In other embodiments the sequences of SDl and SD2 can be different.
- the SD sequences can be any known ribosomal binding site functional in the host undering the HTP genomic engineering.
- the present disclosure teaches an SD sequence of NNNGGAN N, wherein N refers to any nucleotide.
- the present disclosure teaches SD sequences selected from the sequences disclosed in Table 1.1. Table 1.1- Non-limiting list of Ribosomal Binding Sites, amenable for SDl and SD2 use.
- the present disclosure teaches that varying individual SD sequences in the BCD will affect the overall expression of the BCD. Some SD sequences may serve to increase or decrease overall expression potential of the BCD. It is expected however, that each BCD will exhibit consistent expression results when combined over different target gene Cis2 sequences.
- the SD2 sequence is entirely embedded within the coding sequence of the first cistronic sequence. That is, in some embodiments, the SD2 sequence is integrated into the coding sequences of Cis2.
- the present inventors believe that BCD arrangements in which the ribosomal binding site of the target gene (SD2) is entirely embedded in the coding sequence of the upstream gene (Cisl) results in the coupling of the translations of the Cisl and Cis2 peptides. More specifically, the present inventors hypothesize that the intrinsic helicase activity of ribosomes arriving at the stop codon of an upstream Cisl sequence eliminate inhibitory RNA structures that would otherwise disrupt translation initiation of the downstream Cis2 target gene.
- the first cistronic sequence Cisl of the present disclosure can be any sequence encoding a continuous peptide.
- the Cisl sequence encodes for a peptide that is 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, or more amino acids long, including any ranges and subranges therein.
- Cisl does not need to encode a functional peptide.
- the Cisl sequence encodes a 16-amino-acid leader peptide.
- the Cisl nucleotide sequence is:
- the present disclosure teaches that the Cisl sequence can be 5'- ATGNNNNNNNNNNNNN ⁇
- the present disclosure teaches that the stop codon of Cisl and the start codon of Cis2 must be in close proximity or overlapping.
- the stop codon of Cisl must be within 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50 nucleotides of the start codon of Cis2, including all ranges and subranges therein.
- the Cisl sequence overlaps with the Cis2 sequence by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 100 or more nucleotides, including all ranges and subranges therein.
- the BCD of the present disclosure is designed such that the Cisl sequence overlaps by 1 nucleotide with the Cis2 target gene coding sequence, such that the last few nucleotides encode for both a stop and start codon via a -1 frame shift (see Figure 43).
- the Cisl and Cis 2 sequences must be coded on different open reading frames so as to prevent the formation of a chimeric protein combining the sequences of Cisl and Cis2.
- the present disclosure teaches that the start codon of the Cisl sequence can be any functional start codon.
- the present disclosure teaches that prokaryotes use ATG (AUG) at the most common start codon, followed by GTG (GUG) and TTG (UUG).
- the present disclosure teaches that the Cisl sequence does not have any premature stop codons. In other embodiments, the present disclosure teaches that rare codons in the Cisl sequence can reduce the translation efficiency of Cis2. Thus, in some embodiments, Cisl will encode for a peptide without any rare codons to achieve maximum expression. In other embodiments, Cisl will encode for a peptide with one or more rare codons in order to modulate the expression of Cis2.
- Cisl will encode for a peptide without any codon repeats to achieve maximum expression. In other embodiments, Cisl will encode for a peptide with one or more codon repeats in order to modulate the expression of Cis2.
- the present disclosure teaches that the BCDs of the present disclosure are operably linked to a Cis2 target gene sequence, in much the same way in which the promoters of the PRO-swap libraries are operably linked to target sequences. That is, in some embodiments, the BCDs of the present disclosure can take the place of traditional promoters in the PRO-swap libraries and methods of the present disclosure.
- the Cis2 sequences can in some embodiments, be any sequence of interest.
- target genes encoding for a polypeptide will be more effectively regulated by BCDs than by a promoter. That is, in some embodiments, BCDs will not modulate the expression of non-coding RNA more than would be possible by a promoter.
- the present disclosure teaches methods of improving genetically engineered host strains by providing one or more transcriptional termination sequences at a position 3' to the end of the RNA encoding element.
- the present disclosure teaches that the addition of termination sequences improves the efficiency of RNA transcription of a selected gene in the genetically engineered host.
- the present disclosure teaches that the addition of termination sequences reduces the efficiency of RNA transcription of a selected gene in the genetically engineered host.
- the terminator ladders of the present disclosure comprises a series of terminator sequences exhibiting a range of transcription efficiencies (e.g., one weak terminator, one average terminator, and one strong promoter).
- a transcriptional termination sequence may be any nucleotide sequence, which when placed transcriptionally downstream of a nucleotide sequence encoding an open reading frame, causes the end of transcription of the open reading frame.
- Such sequences are known in the art and may be of prokaryotic, eukaryotic or phage origin.
- terminator sequences include, but are not limited to, PTH-terminator, pET-T7 terminator, ⁇ 3- ⁇ terminator, pBR322-P4 terminator, vesicular stomatitus virus terminator, rrnB-Tl terminator, rrnC terminator, TTadc transcriptional terminator, and yeast-recognized termination sequences, such as Mata (a-factor) transcription terminator, native ⁇ -factor transcription termination sequence, ADRl transcription termination sequence, ADH2transcription termination sequence, and GAPD transcription termination sequence.
- Mata (a-factor) transcription terminator native ⁇ -factor transcription termination sequence
- ADRl transcription termination sequence ADH2transcription termination sequence
- GAPD transcription termination sequence a non- exhaustive listing of transcriptional terminator sequences may be found in the iGEM registry, which is available at: http://partsregistry.org/Terminators/Catalog.
- transcriptional termination sequences may be polymerase-specific or nonspecific, however, transcriptional terminators selected for use in the present embodiments should form a 'functional combination' with the selected promoter, meaning that the terminator sequence should be capable of terminating transcription by the type of RNA polymerase initiating at the promoter.
- the present disclosure teaches a eukaryotic RNA pol II promoter and eukaryotic RNA pol II terminators, a T7 promoter and T7 terminators, a T3 promoter and T3 terminators, a yeast-recognized promoter and yeast-recognized termination sequences, etc., would generally form a functional combination.
- the identity of the transcriptional termination sequences used may also be selected based on the efficiency with which transcription is terminated from a given promoter.
- a heterologous transcriptional terminator sequence may be provided transcriptionally downstream of the RNA encoding element to achieve a termination efficiency of at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% from a given promoter.
- efficiency of RNA transcription from the engineered expression construct can be improved by providing nucleic acid sequence forms a secondary structure comprising two or more hairpins at a position 3' to the end of the RNA encoding element.
- the secondary structure destabilizes the transcription elongation complex and leads to the polymerase becoming dissociated from the DNA template, thereby minimizing unproductive transcription of non-functional sequence and increasing transcription of the desired RNA.
- a termination sequence may be provided that forms a secondary structure comprising two or more adjacent hairpins.
- a hairpin can be formed by a palindromic nucleotide sequence that can fold back on itself to form a paired stem region whose arms are connected by a single stranded loop.
- the termination sequence comprises 2, 3, 4, 5, 6, 7, 8, 9, 10 or more adjacent hairpins.
- the adjacent hairpins are separated by 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 unpaired nucleotides.
- a hairpin stem comprises 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30 or more base pairs in length.
- a hairpin stem is 12 to 30 base pairs in length.
- the termination sequence comprises two or more medium-sized hairpins having stem region comprising about 9 to 25 base pairs.
- the hairpin comprises a loop-forming region of 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 nucleotides.
- the loop-forming region comprises 4-8 nucleotides.
- the G/C content of a hairpin- forming palindromic nucleotide sequence can be at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90% or more. In some embodiments, the G/C content of a hairpin-forming palindromic nucleotide sequence is at least 80%.
- the termination sequence is derived from one or more transcriptional terminator sequences of prokaryotic, eukaryotic or phage origin. In some embodiments, a nucleotide sequence encoding a series of 4, 5, 6, 7, 8, 9, 10 or more adenines (A) are provided 3' to the termination sequence.
- the present disclosure teaches the use of a series of tandem termination sequences.
- the first transcriptional terminator sequence of a series of 2, 3, 4, 5, 6, 7, or more may be placed directly 3' to the final nucleotide of the dsRNA encoding element or at a distance of at least 1-5, 5-10, 10-15, 15-20, 20-25, 25-30, 30-35, 35-40, 40-45, 45-50, 50-100, 100-150, 150-200, 200-300, 300-400, 400-500, 500-1,000 or more nucleotides 3' to the final nucleotide of the dsRNA encoding element.
- transcriptional terminator sequences may be separated by 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 10-15, 15-20, 20-25, 25- 30, 30-35, 35-40, 40-45, 45-50 or more nucleotides.
- the transcriptional terminator sequences may be selected based on their predicted secondary structure as determined by a structure prediction algorithm.
- Structural prediction programs are well known in the art and include, for example, CLC Main Workbench.
- the present disclosure teaches use of annotated Corynebacterium glutamicum terminators as disclosed in from Pfeifer-Sancar et al. 2013. "Comprehensive analysis of the Corynebacterium glutamicum transcriptome using an improved RNAseq technique" Pfeifer-Sancar et al. BMC Genomics 2013, 14:888).
- the present disclosure teaches use of transcriptional terminator sequences found in the iGEM registry, which is available at: http://partsregistry.org/Terminators/Catalog. A non- exhaustive listing of transcriptional terminator sequences of the present disclosure is provided in Table 1.2 below.
- the present disclosure teaches methods of improving genetically engineered host strains by providing one or more protein solubility tag sequences operably linked with a target protein derived from a target gene.
- the solubility tags can be fusion partners operably linked with the target protein on either the N-terminus or the C-terminus of the target protein.
- the present disclosure teaches that the addition of solubility tag sequences improves the solubility of a protein translated from a selected gene in the genetically engineered host.
- the solubility tags may also be used to assist in the purification of the target protein.
- Effective tags for use in protein solubility tag ladders of the present disclosure can be any solubility tags known in the art that form independent, well-folded domains, highly soluble domains. These domains may contribute to the solubility of their target protein through an additive effect, or when used as an N-terminal tag may quickly fold after emerging from the ribosome and sterically block the emerging amino acid chain of the target protein from interacting with other cellular components which may cause misfolding. Further, solubility tags for inclusion in solubility tag ladders may have properties in common such as being small, tightly-folded domains or being leader sequences of proteins known to be highly soluble.
- solubility tag sequences can be any such tags known in the art such as, for example, the any of the tags found in Costa et al, Front Microbiol. 2014; 5: 63, the contents of which are hereby incorporated by reference in its entirety.
- solubility tag sequences include the tags found in Table 17.
- the protein solubility tag is a fusion partner.
- the fusion partner coding gene can be present in any of the vectors (e.g., shuttle vectors) provided herein such that integration of the gene for a target protein in the vector operably links the fusion partner coding gene to the target gene.
- E. coli expression vectors comprising solubility tags for use herein can comprise a protease recognition sequence between the solubility tag fusion partner coding gene and the target protein coding gene that can allows for the tag removal as necessary.
- the choice of a fusion partner for use in the solubility swap methods provided herein can depend on:
- target proteins may require larger or smaller tags depending on their application. Larger tags can present a major diversity in the amino acid content, and may impose a metabolic burden in the host cell different from that imposed by small tags.
- N-terminal tags may often be advantageous over C- terminal tags because: (1) they provide a reliable context for efficient translation initiation, in which fusion proteins take advantage of efficient translation initiation sites on the tag; (2) they can be removed leaving none or few additional residues at the native N-terminal sequence of the target protein, since most of endoproteases cleave at or near the C-terminus of their recognition sites.
- the present disclosure teaches methods of improving genetically engineered host strains by providing one or more protein degradation tag sequences operably linked with a target protein derived from a target gene.
- the addition of a degradation tag sequence using the methods provided herien can mark the target protein for degradation. Marking the target protein for degradation may reduce or modulate the target protein abundance within a cell. By reducing or modulating the target protein levels or abundance in the cell, the addition of degradation tag sequences to a target protein may ulitmatley impact the overall phenotype of resultant strains.
- Effective tags for use in protein degradation tag ladders of the present disclosure can be any degradation tags known in the art that are part of a known degradation pathway in the host organism (e.g., E. coli).
- known degradation pathways in E. coli can include the clpXP/clpAP system, the HflB system, the ftsH System and the Ion system.
- degradation tags for use in the degradation tag swap methods provided herein can include any tags known to function in any of these E. coli protein degradation systems.
- the degradation tags can be mutated in such a manner as to confer the ability of the resultant mutant tag to have its activity tuned.
- the ssrA class of tags can be mutated such that the mutated ssrA degradation tags mark a tagged protein for degradation via the ClpXP degradation pathway with different degrees of efficiency.
- the ssrA tags can contain a single amino acid mutations in the last three residues of the AANDENYALAA consensus sequence such that target proteins comprising a C-terminal mutated ssrA tag can be degraded at varying levels of efficiency by certai intracellular tail specific proteases (e.g., Tsp protease) depending on which amino acid has been mutated in the last three residues of the ssrA tag consensus sequence (see Keiler K C, Sauer R T.
- mutated ssrA tags for use in the methods provided herein can be the DAS tags found in McGinness et al., "Engineering Controllable Protein Degradation” Mol. Cell, Vol 22(5), June 2006, the contents of which are hereby incorporated by reference in it's entirety.
- DAS tags two residues in the ssrA tag were replaced resulting in mutated ssrA tags that exhibited weakened ClpX binding without diminishing SspB recognition.
- target proteins bearing the DAS tags can be degraded efficiently by ClpXP only when SspB is present, allowing intracellular degradation to be regulated by controlling SspB levels.
- the degradation tags can be fusion partners operably linked with the target protein on either the N-terminus or the C-terminus of the target protein.
- the fusion partner coding gene can be present in any of the vectors (e.g., shuttle vectors) provided herein such that integration of the gene for a target protein in the vector operably links the fusion partner coding gene to the target gene such that translation of the construct generates a fusion protein with the degradation tag present on either the N-terminus or C-terminus of the target protein as desired.
- placement of the degradation tags (or mutants thereof) at the N-terminus or C-terminus of a target protein can depend on the tag used.
- degradation tags (or mutants thereof) associated with the clpXP/clpAP system, the HflB system, the ftsH System or the sul20 tag of the Ion system can be operably linked to a target protein at the C-terminus
- ⁇ 20 degradation tags (or mutants thereof) of the the Ion system can be operably linked to a target protein at the N-terminus or internally.
- the degradation tag is the N-degron tag (Ntag) for E. coli as found in Sekar K, Gentile AM, Bostick JW, Tyo KEJ (2016) N-Terminal-Based Targeted, Inducible Protein Degradation in Escherichia coli.
- the Ntag can be placed on the N-terminus of a target protein of interest and can serve to mark the target protein of interest for degradation in the E. coli host cell via the clpXP/clpAP system.
- the degradation tag is the RepA tag which can be located at the N-terminus of a target protein as described in Butz et al. , Biochemistry, 201 1, 50 (40), pp 8594-8602, which is hereby incorporated by reference in its entirety.
- the N- terminal RepA tag can serve to mark the target protein of interest for degradation in the E. coli host cell via the clpXP/clpAP system.
- the present disclosure teaches that the HTP genomic engineering methods of the present disclosure do not require prior genetic knowledge in order to achieve significant gains in host cell performance. Indeed, the present disclosure teaches methods of generating diversity pools (e.g., Figure 1) via several functionally agnostic approaches, including random mutagenesis, and identification of genetic diversity among pre-existing host cell variants (e.g., such as the comparison between a wild type host cell and an industrial variant).
- the present disclosure also teaches hypothesis-driven methods of designing genetic diversity mutations that will be used for downstream HTP engineering. That is, in some embodiments, the present disclosure teaches the directed design of selected mutations. In some embodiments, the directed mutations are incorporated into the engineering libraries of the present disclosure (e.g., SNP swap, PRO swap, STOP swap, SOLUBILITY TAG swap, or DEGRADATION TAG swap).
- the directed mutations are incorporated into the engineering libraries of the present disclosure (e.g., SNP swap, PRO swap, STOP swap, SOLUBILITY TAG swap, or DEGRADATION TAG swap).
- the present disclosure teaches the creation of directed mutations based on gene annotation, hypothesized (or confirmed) gene function, or location within a genome.
- the diversity pools of the present disclosure may include mutations in genes hypothesized to be involved in a specific metabolic or genetic pathway associated in the literature with increased performance of a host cell.
- the diversity pool of the present disclosure may also include mutations to genes present in an operon associated with improved host performance.
- the diversity pool of the present disclosure may also include mutations to genes based on algorithmic predicted function, or other gene annotation.
- the present disclosure teaches a "shell" based approach for prioritizing the targets of hypothesis-driven mutations.
- the shell metaphor for target prioritization is based on the hypothesis that only a handful of primary genes are responsible for most of a particular aspect of a host cell's performance (e.g., production of a single biomolecule). These primary genes are located at the core of the shell, followed by secondary effect genes in the second layer, tertiary effects in the third shell, and... etc.
- the core of the shell might comprise genes encoding critical biosynthetic enzymes within a selected metabolic pathway (e.g., production of citric acid).
- Genes located on the second shell might comprise genes encoding for other enzymes within the biosynthetic pathway responsible for product diversion or feedback signaling.
- Third tier genes under this illustrative metaphor would likely comprise regulatory genes responsible for modulating expression of the biosynthetic pathway, or for regulating general carbon flux within the host cell.
- the present disclosure also teaches "hill climb” methods for optimizing performance gains from every identified mutation.
- random, natural, or hypothesis-driven mutations in HTP diversity libraries can result in the identification of genes associated with host cell performance.
- the present methods may identify one or more beneficial SNPs located on, or near, a gene coding sequence. This gene might be associated with host cell performance, and its identification can be analogized to the discovery of a performance "hill” in the combinatorial genetic mutation space of an organism.
- the present disclosure teaches methods of exploring the combinatorial space around the identified hill embodied in the SNP mutation. That is, in some embodiments, the present disclosure teaches the perturbation of the identified gene and associated regulatory sequences in order to optimize performance gains obtained from that gene node (i.e., hill climbing).
- a gene might first be identified in a diversity library sourced from random mutagenesis, but might be later improved for use in the strain improvement program through the directed mutation of another sequence within the same gene.
- a mutation in a specific gene might reveal the importance of a particular metabolic or genetic pathway to host cell performance.
- the discovery that a mutation in a single RNA degradation gene resulted in significant host performance gains could be used as a basis for mutating related RNA degradation genes as a means for extracting additional performance gains from the host organism.
- Persons having skill in the art will recognize variants of the above described shell and hill climb approaches to directed genetic design.
- the present disclosure teaches that the productivity of some bioindustrial processes is limited by the random diffusion of substrates, intermediates, and biosynthetic enzymes within a host cell. In some embodiments, the present disclosure teaches that productivity of host cell cultures can be increased by co-localizing biosynthetic enzymes in a pathway. Thus, in some embodiments, the present disclosure teaches tethering biosynthetic enzymes to a scaffold, such as a DNA or protein scaffold.
- co-localization is achieved by recombinant fusions of DNA binding domains to the biosynthetic enzymes in the pathway, which then bind to a DNA scaffold region, thus constraining the pathway enzymes close to one another in the cell.
- co-localization is achieved by recombinant fusions of protein beinding domains to the biosynthetic enzymes in the pathway, which then bind to a protein scaffold region, thus constraining the pathway enzymes close to one another in the cell.
- co-localization increases the rate of production and decreases the concentration of pathway intermediates in the cell (see Figure 44).
- the present disclosure teaches a high-throughput method for engineering the genome of Escherichia coli, wherein nucleotide sequences encoding DNA binding or protein binding domains are inserted into genes encoding enzymes in a biosynthetic pathway, and a DNA scaffold plasmid or a scaffold protein is introduced into the cell.
- nucleotide sequences encoding DNA binding or protein binding domains are inserted into genes encoding enzymes in a biosynthetic pathway, and a DNA scaffold plasmid or a scaffold protein is introduced into the cell.
- the DNA or protein binding domains tethered to the biosynthetic genes will localize the recombinant pathway enzymes together onto the scaffold plasmid or peptide, thus leading to improved productivity of the target product.
- this invention solves the problem of diffusion-limited productivity of small molecules in E. coli cells with genomes engineered via high-throughput methods.
- DNA scaffolding to localize biosynthetic enzymes have been low throughput processes in which the recombinant pathway enzymes are encoded on plasmids (Lee, et al. "Improved Production of L-Threonine in Escherichia coli by Use of a DNA Scaffold System" App. And Environ. Microbiol. Vol 79(3), pp. 774-782 (2013)).
- the current invention provides a means to incorporate DNA binding domains into pathway enzymes that are chromosomally-encoded, in a high-throughput manner.
- the present disclosure teaches chimeric biosynthetic enzymes and scaffold DNAs and proteins. The various aspects of this technology are discussed in more detail below.
- the present disclosure teaches chimeric proteins comprising selected biosynthetic enzymes that are tethered to DNA binding domain.
- the chimeric biosynthetic enzymes will be recruited to a DNA scaffold by their DNA binding domains, thereby concentrating the various biosynthetic activities to an area of the host cell.
- the biosynthetic enzymes and the DNA binding domains are covalently linked.
- the biosynthetic enzymes are translationally fused to the DNA binding domains.
- the chimeric biosynthetic enzymes are formed by coupling the DNA binding domain to the amino terminus, the carboxy terminus, or to an internal site within the biosynthetic pathway protein. Persons having skill in the art will recognize the need to ensure that the addition of the DNA binding domain does not substantially reduce the activity of the biosynthetic enzyme.
- the biosynthetic enzyme is coupled to its DNA-binding domain via a short polypeptide linker sequence.
- Suitable linkers include peptides of between about 6 and about 40 amino acids in length.
- Preferred linker sequences include glycine- nch (e.g. G3-5), serine-rich (e.g. GSG, GSGS (SEQ ID NO. 18), GSGSG(SEQ ID NO. 19), GSNG (SEQ ID NO. 20), or alanine rich (e.g., TSAAA (SEQ ID NO. 21)) linker sequences.
- Linkers may have virtually any sequence that results in a generally flexible chimeric biological pathway protein.
- the methods of the present disclosure are compatible with any DNA binding domain capable of function in cis with the biosynthetic enzyme.
- the DNA binding domains are preferably exogenous to the host organism.
- the present disclosure teaches selection of DNA binding domains which are sufficiently selective to avoid excessive binding outside of the designed scaffold DNA.
- Various DNA-binding domains are known in the art along with their corresponding nucleotide recognition sites in DNA (i.e., DNA binding sites) and are suitable for use in the system and methods of the present invention.
- the DNA binding portion of a chimeric biological pathway protein comprises a leucine zipper DNA binding domain wherein the scaffold comprises the corresponding leucine zipper DNA binding sequence.
- the DNA binding portion of a chimeric biological pathway protein comprises a helix-loop-helix DNA binding domain wherein the scaffold comprises the corresponding helix-loop-helix DNA binding sequence.
- the DNA binding portion of a chimeric biological pathway protein comprises a winged helix DNA binding domain wherein the scaffold comprises the corresponding winged helix DNA binding sequence.
- the DNA binding portion of a chimeric biological pathway protein comprises a winged helix-turn- helix DNA binding domain wherein the scaffold comprises the corresponding winged helix-turn- helix DNA binding sequence.
- the DNA binding portion of a chimeric biological pathway protein comprises a helix-turn-helix DNA binding wherein the scaffold comprises the corresponding helix-turn-helix DNA binding sequence.
- the DNA binding portion of the chimeric biological pathway protein comprises a HMG- box DNA binding domain wherein the scaffold comprises the corresponding HMG-box DNA binding sequence.
- the DNA binding portion of the chimeric biological pathway protein comprises a custom designed TALE DNA binding domain wherein the scaffold comprises the corresponding designed TALE DNA binding sequence.
- the DNA binding portion of a chimeric biological pathway protein comprises a zinc finger DNA binding domain wherein the scaffold comprises the corresponding zinc finger DNA binding sequence.
- Exemplary zinc finger DNA binding domain sequences and corresponding DNA binding sites are provided in Table 1.3.
- Other zinc finger DNA binding domains and their corresponding target DNA binding sequences known in the art are also suitable for use in the present invention (see e.g., Greisman H A and Pabo C O, "A General Strategy for Selecting High- Affinity Zinc Finger Proteins for Diverse DNA Target Sites," Science 275:657-661 (1997), Rebar E J and Pabo C O, "Zinc Finger Phage: Affinity Selection of Fingers with New DNA-Binding Specificities," Science 263:671-673 (1994); Maeder et al., “Rapid “Open-Source” Engineering of Customized Zinc-Finger Nucleases for Highly Efficient Gene Modification," Mol.
- the present disclosure teaches a DNA scaffold comprising one or more of the DNA binding sequences corresponding to the DNA binding domains contained within the chimeric biosynthetic enzymes.
- the DNA scaffold is an extrachromosomal plasmid or other vector.
- the DNA scaffold is encoded within the genome of a host cell.
- Suitable nucleic acid vectors include, without limitation, plasmids, baculovirus vectors, bacteriophage vectors, phagemids, cosmids, fosmids, bacterial artificial chromosomes, viral vectors (for example, viral vectors based on vaccinia virus, poliovirus, adenovirus, adeno- associated virus, S V40, herpes simplex virus, and the like), artificial chromosomes, yeast plasmids, yeast artificial chromosomes, and other vectors.
- vectors suitable for use in prokaryotic host cells are preferred.
- exemplary vectors for use in prokaryotes include, but are not limited to, pACYC184, pBeloBacll, pBR332, pBAD33, pBBRlMCS and its derivatives, pSClOl, SuperCos (cosmid), pWE15 (cosmid), pTrc99A, pBAD24, vectors containing a ColEl origin of replication and its derivatives, pUC, pBluescnpt, pGEM, On_Plsmd27 (SEQ ID NO. 213), vector backbone 1 (SEQ ID NO. 214), vector backbone 2 (SEQ ID NO. 215), vector backbone 3 (SEQ ID NO. 216), vector backbone 4 (SEQ ID NO. 217), and pTZ vectors.
- a nucleic acid scaffold subunit may comprise 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, or more different DNA binding sites coupled together to facilitate the binding and immobilization of 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, or more different biosynthetic pathway proteins.
- the present disclosure teaches that the DNA scaffolds have a single DNA binding site for each corresponding chimeric biosynthetic protein.
- the nucleic acid scaffold may comprise two or more copies of the same DNA binding site. This architecture allows for optimizing the biological protein stiochiometry to be achieved.
- the same DNA binding sites may be coupled together to create enzymatic centers for a particular chemical reaction.
- the DNA scaffold comprises groups of multiple DNA binding sites, each group corresponding to a specific chimeric biosynthetic gene/enzyme.
- the method of assembling a synthetic biological pathway involves immobilizing at least a first chimeric biosynthetic gene (e.g., enzyme) and a second chimeric biosynthetic enzyme onto nucleic acid scaffold.
- the first chimeric biosynthetic enzyme produces a first product that is a substrate for the second chimeric biological pathway protein.
- the second chimeric biosynthetic enzyme is immobilized onto the scaffold construct such that it is positioned adjacent to or very close to the first chimeric biosynthetic enzyme. In this way, the effective concentration of the first product is high, and the second chimeric biosynthetic enzyme can act efficiently on the first product.
- a synthetic nucleic acid scaffold has immobilized thereon, in order from 3' ⁇ 5' or 5' ⁇ 3' of the scaffold construct a) the first chimeric biosynthetic enzyme, and b) the second chimeric biosynthetic enzyme to form a "scaffold subunit."
- the scaffold subunit can be repeated two or more times within the synthetic nucleic acid scaffold.
- two or more copies e.g., two, three, four, five, six, seven, eight, nine, ten, or more molecules
- each chimeric biosynthetic enzyme can be immobilized onto a scaffold subunit.
- a scaffold subunit has immobilized thereon, a) one molecule (copy) of the first chimeric biosynthetic enzyme and b) one molecule of the second chimeric biosynthetic enzyme.
- a scaffold subunit has immobilized thereon, a) one molecule of the first chimeric biosynthetic enzyme and b) two or more molecules (e.g., two, three, four, five, six, or more molecules) of the second chimeric biosynthetic enzyme.
- the ratio of any given protein in a biological pathway to any other protein in the pathway can be varied.
- the ratio of a first chimeric biological pathway protein to a second chimeric biological pathway protein can be varied from about 0.1 : 10 to about 10: 0.1 , e. g.
- At least three chimeric biosynthetic enzymes are immobilized onto the synthetic nucleic acid scaffold to comprise a scaffold subunit.
- the first chimeric biosynthetic enzyme produces a first product that is a substrate for the second chimeric biosynthetic enzyme
- the second chimeric biological pathway protein produces a second product that is a substrate for the third chimeric biosynthetic enzyme.
- a scaffold subunit has immobilized thereon, in order from 3' ⁇ 5' or 5' ⁇ 3' of the scaffold a) the first chimeric biosynthetic enzyme, b) the second chimeric biosynthetic enzyme, and c) the third biosynthetic enzyme.
- the scaffold unit can be repeated two or more times in the nucleic acid construct as described supra.
- At least four chimeric biosynthetic enzymes are immobilized onto the nucleic acid scaffold.
- at least five chimeric biosynthetic enzymes are immobilized onto the nucleic acid scaffold. It will be apparent from these examples that a sixth, seventh, eighth, ninth, tenth, etc., chimeric biosynthetic enzymes can be immobilized onto the nucleic acid scaffold, that the chimeric proteins are immobilized spatially in the order in which they function in a pathway, and that each protein can be immobilized onto the scaffold in one two, three, four, five, six, seven, eight, nine, ten, or more copies (or molecules).
- the present disclosure teaches spacing of each DNA binding site within the scaffold nucleic acid.
- the two or more DNA binding sites are located adjacent to each other within a scaffold subunit, coupled to each other in tandem or separated by at least one spacer nucleotide.
- the two or more DNA binding sites may separated from each other by 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, or more spacer nucleotides.
- the spacing between different DNA binding sites can vary within one scaffold unit (i.e., the spacing between a first and second DNA binding site may differ from the spacing between the second and third DNA binding site).
- Optimal spacing between different DNA binding sites within a scaffold subunit will vary depending on the biosynthetic enzyme requirements and the biological pathway being reconstructed, and should be optimized to achieve optimal biological pathway productivity.
- the scaffolding methods of the present disclosure can also be applied to protein/structural scaffolds within the cell.
- the present disclosure teaches application of methods disclosed in U.S. Published Patent Application No. 20110008829, which is hereby incorporated by reference in its entirety
- the present disclosure teaches chimeric proteins comprising selected biosynthetic enzymes that are tethered to one or more protein binding domain(s) capable of binding to a recruitment peptide.
- the chimeric biosynthetic enzymes will be recruited to a scaffold peptide by interacting with recruitment peptides contained within the scaffold peptide.
- the biosynthetic enzymes and the protein binding domains are covalently linked.
- the biosynthetic enzymes are translationally fused to the protein binding domains.
- the chimeric biosynthetic enzymes are formed by coupling the protein binding domain to the amino terminus, the carboxy terminus, or to an internal site within the biosynthetic pathway protein. Persons having skill in the art will recognize the need to ensure that the addition of the protein binding domain does not substantially reduce the activity of the biosynthetic enzyme.
- the biosynthetic enzyme is coupled to its protein-binding domain via a short polypeptide linker sequence as described in earlier portions of this disclosure.
- PBD protein-binding domains
- Suitable PBDs include SH3 domains.
- SH3 domains include Class I SH3 domains; Class II SH3 domains; and unconventional SH3 domains.
- Amino acid sequences of SH3 domains are known in the art. See, for example, amino acids 136-189 of the amino acid sequence provided in GenBank Accession No. NP. sub.—058431 (Homo sapiens Crk protein); amino acids 136-189 of the amino acid sequence provided in GenBank Accession No. AAH31149 (Mus musculus Crk protein); and amino acids 4-77 of the amino acid sequence provided in GenBank Accession No. P27986 (Homo sapiens p85 subunit of phosphatidylinositol 3-kinase).
- an SH3 domain is a Class I SH3 domain and comprises an amino acid sequence having at least about 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% amino acid sequence similarity to amino acid sequence: EGYQYRA LYDYKKEREE DIDLHLGDIL TVNKGSLVAL GFSDGQEARP EEIGWLNGYN ETTGERGDFP GTYVEYI (SEQ ID NO. 44), including all ranges and subranges there between.
- an SH3 domain is a Class II SH3 domain and comprises an amino acid sequence having at least about 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% amino acid sequence similarity to amino acid sequence:
- an SH3 domain comprises the amino acid sequence: MAEYVRALFDFNGNDEEDLPFKKGDILMRDKPEEQWWNAEDSEGKRGMIPVPYVEKY
- An SH3 domain binds proline-rich peptides that form a left-handed poly-proline type II helix, where such peptides comprise the minimal consensus sequence Pro-X-X-Pro.
- each Pro is preceded by an aliphatic residue.
- a recruitment peptide is an SH3 domain ligand.
- An SH3 domain binds proline-rich peptides that form a left- handed poly-proline type II helix, where such peptides comprise the minimal consensus sequence Pro-X-X-Pro.
- each Pro is preceded by an aliphatic residue.
- amino acid sequences of peptides comprising SH3 domain ligands include: RPLPVAP (SEQ ID NO. 47; bound by a Class I SH3 domain); PPPALPPKRRRPG (SEQ ID NO. 48); and PPPALPPKKR (SEQ ID NO. 49; bound by a Class II SH3 domain).
- Suitable PBD include PDZ domains.
- Amino acid sequences of PDZ domains are known in the art. See, for example, amino acids 108-191, amino acids 201-287, and amino acids 354-434 of the amino acid sequence provided in Gen Bank Accession No. AAC52113 (Homo sapiens post- synaptic density protein 95); and amino acids 80-161 of the amino acid sequence provided in GenBank Accession No. NP 033254 (Mus musculus syntrophin).
- a suitable PDZ domain comprises an amino acid sequence having at least about 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% amino acid sequence similarity to amino acid sequence: EITLERGNSGLGFSIAGGTDNPfflGDDPSIFIT KIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYV (SEQ ID NO. 50), including all ranges and subranges there between.
- a suitable PDZ domain comprises an amino acid sequence having at least about 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% amino acid sequence similarity to amino acid sequence: VMEIKLIKGPKGLGF SI AGGVGNQHIPGDN SI YVTKIIEGGAAHKD GRLQ IGDKILAVNSVGLEDVMHEDAVAALKNTYDWYLKVA
- a suitable PDZ domain comprises an amino acid sequence having at least about 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% amino acid sequence similarity to amino acid sequence: RIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPA DLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQ (SEQ ID NO. 52), including all ranges and subranges there between.
- a suitable PDZ domain comprises an amino acid sequence having at least about 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% amino acid sequence similarity to amino acid sequence: RRVTVRKADAGGLGISIKGGRENKMPILISK IFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEWLEVK (SEQ ID NO. 53), including all ranges and sub ranges there between.
- a PDZ domain can comprise the amino acid sequence
- a recruitment peptide is a PDZ domain ligand.
- a PDZ domain binds to the C-terminal 4-5 residues of target proteins.
- a consensus PDZ domain ligand comprises a hydrophobic residue, e.g., Val or He, at the carboxyl terminus.
- Exemplary, non- limiting examples of amino acid sequences of peptides comprising PDZ domain ligands include: IESDV (SEQ ID NO. 55); VKESLV (SEQ ID NO. 56); GVKESLV (SEQ ID NO. 57); GVKQSLL (SEQ ID NO. 58); GVKESGA (SEQ ID NO. 59); YVKESLV (SEQ ID NO. 60); and VETDV (SEQ ID NO. 61).
- Suitable PBD include GTPase-binding domains (GBD), also referred to in the art as CRIB (Cdc42/Rac-interactive binding) motifs.
- GBD GTPase-binding domains
- CRIB Cdc42/Rac-interactive binding
- a GBD binds a Cdc42p-like and/or a Rho-like small GTPase.
- Amino acid sequences of GBD are known in the art. See, e.g., amino acids 198-240 of the amino acid sequence provided in GenBank Accession No. NP.sub.-- 001 103835 (Rattus norvegicus Wiskott-Aldrich syndrome-like protein (WASP)); amino acids 69- 112 of the amino acid sequence provided in GenBank Accession No.
- a suitable GBD comprises an amino acid sequence having at least about 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% amino acid sequence similarity to amino acid sequence: ADI GTPSNFQfflG HVGWDPNTGF DLNNLDPELK NLFDMCGISE (SEQ ID NO. 62), and all ranges and sub ranges there between.
- a suitable GBD comprises an amino acid sequence having at least about 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% amino acid sequence similarity to amino acid sequence: KERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWAR (SEQ ID NO. 63), and all ranges and sub ranges there between.
- a suitable GBD comprises an amino acid sequence having at least about 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% amino acid sequence similarity to amino acid sequence: MTKADIGTPSNFQfflGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIY DFIEK TGGVEAVKNELRRQAP (SEQ ID NO. 64), and all ranges and subranges there between.
- an recruitment peptide is a GBD ligand.
- An exemplary, non-limiting GBD ligand comprises the amino acid sequence
- Suitable PBD include leucine zipper peptides.
- leucine zipper peptides are peptides that interact via a coiled-coil domain. Amino acid sequences of leucine zipper domains are known in the art.
- Leucine zipper peptides include an EE12RR345L leucine zipper peptide; an RR12EE354L leucine zipper peptide; and the like.
- An example of an amino acid sequence of a leucine zipper peptide is an EE12RR345L leucine zipper of the amino acid sequence: LEIEAAFLERENTALETRVAELRQRVQRLR NRVS Q YRTRYGPLGGGK (SEQ ID NO. 66).
- a leucine zipper peptide comprises an amino acid sequence having at least about 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% amino acid sequence similarity to amino acid sequence: LEIEAA
- FLERENT ALETRVAELRQRVQRLRNRVSQYRTRYGPLGGGK SEQ ID NO. 67
- Such a leucine zipper peptide can serve as a PBD or as a recruitment peptide.
- an amino acid sequence of a leucine zipper peptide is an RR12EE345L leucine zipper peptide of the amino acid sequence: LEIRAAFLRQRNTALRT EVAELEQEVQRLENE VS Q YETRYGPLGGGK (SEQ ID NO. 68).
- chimeric biosynthetic proteins comprising a protein binding domain designed to target (bind to) one or more recruitment peptides located on a scaffold polypeptide.
- the present disclosure teaches the production of chimeric biosynthetic proteins comprising recruitment peptides targeted by protein binding domains located on a scaffold polypeptide.
- the protein binding domain and recruitment peptides are each incorporated into two or more chimeric biosynthetic proteins, such that the chimeric proteins form complexes (e.g., dimers or heterodimers).
- complex formation is the use of compatible leucine zipper domains placed on chimeric biosynthetic proteins, such that two or more chimeric biosynthetic proteins are able to form a complex via the leucine zipper domains.
- the present disclosure teaches a scaffold polypeptide that organizes biosynthetic pathway enzymes into a functional complex.
- the scaffold polypeptides of the present disclosure comprise two or more recruitment peptides. That is, in some embodiments, the scaffold polypeptides of the present disclosure are capable of recruiting two more more chimeric biosynthetic proteins.
- the scaffold polypeptide of the present disclosure is an exogenous peptide introduced into a host cell (e.g., by the transformation of a DNA sequence encoding for the scaffold polypeptide, or direct introduction of the peptide).
- the scaffold polypeptide is a naturally occurring structure within the host cell. That is, in some embodiments, the scaffold polypeptide is an organelle or membrane (e.g., the endoplasmid reticulum, or the golgi apartus).
- the scaffold polypeptide of the presente disclosure includes host-cell structures composed of more than one peptide sequence.
- the recruitment peptide sequences within the scaffold polypeptide are organized so as to optimize target biosynthetic pathways whose enzymes are being recruited.
- the organization of the scaffold polypeptide is similar to that described for DNA scaffolds above.
- scaffold polypeptides contain groupings of recruitment peptides to regulate the order and ratios of various chimeric biosynthetic proteins.
- Cells of the present disclosure can be cultured in conventional nutrient media modified as appropriate for any desired biosynthetic reactions or selections.
- the present disclosure teaches culture in inducing media for activating promoters.
- the present disclosure teaches media with selection agents, including selection agents of transformants (e.g., antibiotics), or selection of organisms suited to grow under inhibiting conditions (e.g., high ethanol conditions).
- selection agents including selection agents of transformants (e.g., antibiotics), or selection of organisms suited to grow under inhibiting conditions (e.g., high ethanol conditions).
- the present disclosure teaches growing cell cultures in media optimized for cell growth.
- the present disclosure teaches growing cell cultures in media optimized for product yield.
- the present disclosure teaches growing cultures in media capable of inducing cell growth and also contains the necessary precursors for final product production (e.g., high levels of sugars for ethanol production).
- Culture conditions such as temperature, pH and the like, are those suitable for use with the host cell selected for expression, and will be apparent to those skilled in the art.
- many references are available for the culture and production of many cells, including cells of bacterial, plant, animal (including mammalian) and archaebacterial origin.
- the culture medium to be used must in a suitable manner satisfy the demands of the respective strains. Descriptions of culture media for various microorganisms are present in the "Manual of Methods for General Bacteriology" of the American Society for Bacteriology (Washington D.C., USA, 1981).
- the present disclosure furthermore provides a process for fermentative preparation of a product of interest, comprising the steps of: a) culturing a microorganism according to the present disclosure in a suitable medium, resulting in a fermentation broth; and b) concentrating the product of interest in the fermentation broth of a) and/or in the cells of the microorganism.
- the present disclosure teaches that the microorganisms produced may be cultured continuously— as described, for example, in WO 05/021772— or discontinuously in a batch process (batch cultivation) or in a fed-batch or repeated fed-batch process for the purpose of producing the desired organic-chemical compound.
- a summary of a general nature about known cultivation methods is available in the textbook by Chmiel (BioprozeBtechnik. 1 : Einfiihrung in die Biovonstechnik (Gustav Fischer Verlag, Stuttgart, 1991)) or in the textbook by Storhas (Bioreaktoren and periphere bamboo (Vieweg Verlag, Braunschweig/Wiesbaden, 1994)).
- the cells of the present disclosure are grown under batch or continuous fermentations conditions.
- Classical batch fermentation is a closed system, wherein the compositions of the medium is set at the beginning of the fermentation and is not subject to artificial alternations during the fermentation.
- a variation of the batch system is a fed-batch fermentation which also finds use in the present disclosure. In this variation, the substrate is added in increments as the fermentation progresses.
- Fed-batch systems are useful when catabolite repression is likely to inhibit the metabolism of the cells and where it is desirable to have limited amounts of substrate in the medium. Batch and fed-batch fermentations are common and well known in the art.
- Continuous fermentation is a system where a defined fermentation medium is added continuously to a bioreactor and an equal amount of conditioned medium is removed simultaneously for processing and harvesting of desired biomolecule products of interest.
- continuous fermentation generally maintains the cultures at a constant high density where cells are primarily in log phase growth.
- continuous fermentation generally maintains the cultures at a stationary or late log/stationary, phase growth. Continuous fermentation systems strive to maintain steady state growth conditions.
- a non-limiting list of carbon sources for the cultures of the present disclosure include, sugars and carbohydrates such as, for example, glucose, sucrose, lactose, fructose, maltose, molasses, sucrose-containing solutions from sugar beet or sugar cane processing, starch, starch hydrolysate, and cellulose; oils and fats such as, for example, soybean oil, sunflower oil, groundnut oil and coconut fat; fatty acids such as, for example, palmitic acid, stearic acid, and linoleic acid; alcohols such as, for example, glycerol, methanol, and ethanol; and organic acids such as, for example, acetic acid or lactic acid.
- sugars and carbohydrates such as, for example, glucose, sucrose, lactose, fructose, maltose, molasses, sucrose-containing solutions from sugar beet or sugar cane processing, starch, starch hydrolysate, and cellulose
- oils and fats such as, for example, soybean
- a non-limiting list of the nitrogen sources for the cultures of the present disclosure include, organic nitrogen-containing compounds such as peptones, yeast extract, meat extract, malt extract, corn steep liquor, soybean flour, and urea; or inorganic compounds such as ammonium sulfate, ammonium chloride, ammonium phosphate, ammonium carbonate, and ammonium nitrate.
- organic nitrogen-containing compounds such as peptones, yeast extract, meat extract, malt extract, corn steep liquor, soybean flour, and urea
- inorganic compounds such as ammonium sulfate, ammonium chloride, ammonium phosphate, ammonium carbonate, and ammonium nitrate.
- the nitrogen sources can be used individually or as a mixture.
- a non-limiting list of the possible phosphorus sources for the cultures of the present disclosure include, phosphoric acid, potassium dihydrogen phosphate or dipotassium hydrogen phosphate or the corresponding sodium-containing salts.
- the culture medium may additionally comprise salts, for example in the form of chlorides or sulfates of metals such as, for example, sodium, potassium, magnesium, calcium and iron, such as, for example, magnesium sulfate or iron sulfate, which are necessary for growth.
- salts for example in the form of chlorides or sulfates of metals such as, for example, sodium, potassium, magnesium, calcium and iron, such as, for example, magnesium sulfate or iron sulfate, which are necessary for growth.
- essential growth factors such as amino acids, for example homoserine and vitamins, for example thiamine, biotin or pantothenic acid, may be employed in addition to the abovementioned substances.
- the pH of the culture can be controlled by any acid or base, or buffer salt, including, but not limited to sodium hydroxide, potassium hydroxide, ammonia, or aqueous ammonia; or acidic compounds such as phosphoric acid or sulfuric acid in a suitable manner.
- the pH is generally adjusted to a value of from 6.0 to 8.5, preferably 6.5 to 8.
- the cultures of the present disclosure may include an anti-foaming agent such as, for example, fatty acid polyglycol esters.
- an anti-foaming agent such as, for example, fatty acid polyglycol esters.
- the cultures of the present disclosure are modified to stabilize the plasmids of the cultures by adding suitable selective substances such as, for example, antibiotics.
- the culture is carried out under aerobic conditions.
- oxygen or oxygen-containing gas mixtures such as, for example, air are introduced into the culture.
- liquids enriched with hydrogen peroxide are introduced into the culture.
- the fermentation is carried out, where appropriate, at elevated pressure, for example at an elevated pressure of from 0.03 to 0.2 MPa.
- the temperature of the culture is normally from 20°C to 45°C and preferably from 25°C to 40°C, particularly preferably from 30°C to 37°C.
- the cultivation is preferably continued until an amount of the desired product of interest (e.g. an organic-chemical compound) sufficient for being recovered has formed. This aim can normally be achieved within 10 hours to 160 hours. In continuous processes, longer cultivation times are possible.
- the activity of the microorganisms results in a concentration (accumulation) of the product of interest in the fermentation medium and/or in the cells of said microorganisms.
- the culture is carried out under anaerobic conditions.
- the present disclosure teaches high-throughput initial screenings. In other embodiments, the present disclosure also teaches robust tank-based validations of performance data (see Figure 6B).
- the high-throughput screening process is designed to predict performance of strains in bioreactors.
- culture conditions are selected to be suitable for the organism and reflective of bioreactor conditions. Individual colonies are picked and transferred into 96 well plates and incubated for a suitable amount of time. Cells are subsequently transferred to new 96 well plates for additional seed cultures, or to production cultures. Cultures are incubated for varying lengths of time, where multiple measurements may be made. These may include measurements of product, biomass or other characteristics that predict performance of strains in bioreactors. High-throughput culture results are used to predict bioreactor performance.
- the tank-based performance validation is used to confirm performance of strains isolated by high-throughput screening.
- Candidate strains are screened using bench scale fermentation reactors (e.g., reactors disclosed in Table 5 of the present disclosure) for relevant strain performance characteristics such as productivity or yield.
- the present disclosure teaches methods of improving strains designed to produce non-secreted intracellular products.
- the present disclosure teaches methods of improving the robustness, yield, efficiency, or overall desirability of cell cultures producing intracellular enzymes, oils, pharmaceuticals, or other valuable small molecules or peptides.
- the recovery or isolation of non-secreted intracellular products can be achieved by lysis and recovery techniques that are well known in the art, including those described herein.
- cells of the present disclosure can be harvested by centrifugation, filtration, settling, or other method.
- Harvested cells are then disrupted by any convenient method, including freeze-thaw cycling, sonication, mechanical disruption, or use of cell lysing agents, or other methods, which are well known to those skilled in the art.
- the resulting product of interest e.g. a polypeptide
- a product polypeptide may be isolated from the nutrient medium by conventional procedures including, but not limited to: centrifugation, filtration, extraction, spray-drying, evaporation, chromatography (e.g., ion exchange, affinity, hydrophobic interaction, chromatofocusing, and size exclusion), or precipitation.
- chromatography e.g., ion exchange, affinity, hydrophobic interaction, chromatofocusing, and size exclusion
- HPLC high performance liquid chromatography
- the present disclosure teaches the methods of improving strains designed to produce secreted products. For example, the present disclosure teaches methods of improving the robustness, yield, efficiency, or overall desirability of cell cultures producing valuable small molecules or peptides.
- immunological methods may be used to detect and/or purify secreted or non-secreted products produced by the cells of the present disclosure.
- antibody raised against a product molecule e.g., against an insulin polypeptide or an immunogenic fragment thereof
- the present disclosure teaches the use of enzyme-linked immunosorbent assays (ELISA).
- immunochromatography is used, as disclosed in U.S. Pat. No. 5,591,645, U.S. Pat. No. 4,855,240, U.S. Pat. No. 4,435,504, U.S. Pat. No. 4,980,298, and Se- Hwan Paek, et al, "Development of rapid One-Step Immunochromatographic assay, Methods", 22, 53-60, 2000), each of which are incorporated by reference herein.
- a general immunochromatography detects a specimen by using two antibodies. A first antibody exists in a test solution or at a portion at an end of a test piece in an approximately rectangular shape made from a porous membrane, where the test solution is dropped.
- This antibody is labeled with latex particles or gold colloidal particles (this antibody will be called as a labeled antibody hereinafter).
- the labeled antibody recognizes the specimen so as to be bonded with the specimen.
- a complex of the specimen and labeled antibody flows by capillarity toward an absorber, which is made from a filter paper and attached to an end opposite to the end having included the labeled antibody.
- the complex of the specimen and labeled antibody is recognized and caught by a second antibody (it will be called as a tapping antibody hereinafter) existing at the middle of the porous membrane and, as a result of this, the complex appears at a detection part on the porous membrane as a visible signal and is detected.
- the screening methods of the present disclosure are based on photometric detection techniques (absorption, fluorescence).
- detection may be based on the presence of a fluorophore detector such as GFP bound to an antibody.
- the photometric detection may be based on the accumulation on the desired product from the cell culture.
- the product may be detectable via UV of the culture or extracts from said culture.
- Table 2 A non-limiting list of the host cells and products of interest of the present disclosure.
- provided herein are methods for expressing heterogolous genes in a microbial host cell.
- the heterogolous gene can be introduced into the microbial host cell using the methods provided herein and/or known in the art such that the microbial host cell uses the heterogolous gene to produce a product of interest.
- the microbial host cell is a strain of E. coli.
- the strain of E. coli can be any strain of E. coli known in the art and/or provided herein.
- the heterologous gene can be a wild-type verison of said gene or a mutant thereof.
- the heterologous gene can be operably linked to a promoter, terminator, protein solubility tag, protein degradation tag, or any combination thereof. Operably linking the heterologous gene to the promoter, terminator, protein solubility tag or protein degradation tag can be accomplished using the promoter swap, terminator swap, solubility tag swap and/or degradation swap methods provided throughout this disclosure.
- the heterologous gene is operably linked to a promoter selected from Table 1.
- the heterologous gene is operably linked to a 60-90 bp chimeric synthetic promoter sequence, wherein the chimeric synthetic promoter consists of a distal portion of the lambda phage pR promoter, variable -35 and -10 regions of the lambda phage PL and pR promoters, core portions of the the lambda phage PL and pR promoters and either a 5' UTR/Ribosomal Binding Site (RBS) portion of the lambda phage pR promoter or a 5' UTR/Ribosomal Binding Site (RBS) portion of the promoter of the E.
- RBS 5' UTR/Ribosomal Binding Site
- the heterologous gene can be operably linked to a chimeric synthetic promoter that has a nucleic acid sequence selected from SEQ ID NOs. 132-207 found in Table 1.4.
- the heterologous gene is operably linked to a terminator selected from Table 1.2. In another embodiment, the heterologous gene is operably linked to a terminator sequence selected from Table 19.
- the heterologous gene is operably linked to a solubulity tag selected from Table 17.
- the heterologous gene is operably linked to a degradation tag sequence selected from Table 18.
- the heterologous gene can be any of the genes required to generate the products of interest found in Table 2 or any gene known in the art that can be expressed as a heterologous gene in the microbial host cell (e.g., E. coli) to produce a product of interest.
- the heterogolous gene is a gene that is part of the lysine biosynthetic pathway as illustrated in Figure 19.
- the heterologous gene can be selected from the asd gene, the ask gene, the horn gene, the dapA gene, the dapB gene, the dapD gene, the ddh gene, the argD gene, the dapE gene, the dapF gene, the lysA gene, the lysE gene, the zwf gene, the pgi gene, the ktk gene, the fbp gene, the ppc gene, the pck gene, the ddx gene, the pyc gene or the icd gene.
- a heterologous gene that is part of the lysine pathway as provided herein is operably linked to a chimeric synthetic promoter with a nucleic acid sequence selected from SEQ ID NOs. 132-207.
- the heterogolous gene is a gene that is part of the lycopene biosynthetic pathway as illustrated, for example, in Figure 59.
- the heterologous gene can be selected from the dxs gene, the ispC gene, the ispE gene, the ispD gene, the ispF gene, the ispG gene, the ispH gene, the idi gene, the ispA gene, the ispB gene, the crtE gene, the crtB gene, the crtl gene, the crtY gene , the ymgA gene, the dxr gene, the elbA gene, the gdhA gene, the appY gene, the elbB gene, or the ymgB gene.
- a heterologous gene that is part of the lycopene pathway as provided herein is operably linked to a chimeric synthetic promoter with a nucleic acid sequence selected from SEQ ID NOs. 132-207.
- the heterogolous gene is a gene that encodes a biopharmaceutical or a gene in pathway for generating a biopharmaceutical.
- the microbial host cell is E. coli and the biopharmaceutical is any biopharmaceutical that has been shown to be produced in E. coli.
- the biopharmaceutical can be selected from humulin (rh insulin), intronA (interferon alpha2b), roferon (interferon alpha2a), humatrope (somatropin rh growth hormone), neupogen (filgrastim), detaferon (interferon beta- lb), lispro (fast-acting insulin), rapilysin (reteplase), infergen (interferon alfacon-1), glucagon, beromun (tasonermin), ontak (denileukin diftitox), lantus (long-acting insulin glargine), kineret (anakinra), natrecor (nesiritide), somavert (pegvisomant), calcitonin (recombinant calcitonin salmon), lucentis (ranibizumab), schoolact (human parathyroid hormone), kyrstexxal (rh urate oxidas
- a heterologous gene that encodes a biopharmaceutical or a gene in a pathway that generates a biopharmaceutical as provided herein is operably linked to a chimeric synthetic promoter with a nucleic acid sequence selected from SEQ ID NOs. 132-207.
- the selection criteria applied to the methods of the present disclosure will vary with the specific goals of the strain improvement program.
- the present disclosure may be adapted to meet any program goals.
- the program goal may be to maximize single batch yields of reactions with no immediate time limits.
- the program goal may be to rebalance biosynthetic yields to produce a specific product, or to produce a particular ratio of products.
- the program goal may be to modify the chemical structure of a product, such as lengthening the carbon chain of a polymer.
- the program goal may be to improve performance characteristics such as yield, titer, productivity, by-product elimination, tolerance to process excursions, optimal growth temperature and growth rate.
- the program goal is improved host performance as measured by volumetric productivity, specific productivity, yield or titre, of a product of interest produced by a microbe.
- the program goal may be to optimize synthesis efficiency of a commercial strain in terms of final product yield per quantity of inputs (e.g., total amount of ethanol produced per pound of sucrose).
- the program goal may be to optimize synthesis speed, as measured for example in terms of batch completion rates, or yield rates in continuous culturing systems.
- the program goal may be to increase strain resistance to a particular phage, or otherwise increase strain vigor/robustness under culture conditions.
- strain improvement projects may be subject to more than one goal.
- the goal of the strain project may hinge on quality, reliability, or overall profitability.
- the present disclosure teaches methods of associated selected mutations or groups of mutations with one or more of the strain properties described above.
- strain selection criteria to meet the particular project goal. For example, selections of a strain's single batch max yield at reaction saturation may be appropriate for identifying strains with high single batch yields. Selection based on consistency in yield across a range of temperatures and conditions may be appropriate for identifying strains with increased robustness and reliability.
- the selection criteria for the initial high-throughput phase and the tank-based validation will be identical.
- tank-based selection may operate under additional and/or different selection criteria.
- high- throughput strain selection might be based on single batch reaction completion yields, while tank- based selection may be expanded to include selections based on yields for reaction speed.
- the present disclosure teaches whole-genome sequencing of the organisms described herein. In other embodiments, the present disclosure also teaches sequencing of plasmids, PCR products, and other oligos as quality controls to the methods of the present disclosure. Sequencing methods for large and small projects are well known to those in the art.
- any high-throughput technique for sequencing nucleic acids can be used in the methods of the disclosure.
- the present disclosure teaches whole genome sequencing.
- the present disclosure teaches amplicon sequencing ultra deep sequencing to identify genetic variations.
- the present disclosure also teaches novel methods for library preparation, including tagmentation (see WO/2017/073690).
- DNA sequencing techniques include classic dideoxy sequencing reactions (Sanger method) using labeled terminators or primers and gel separation in slab or capillary; sequencing by synthesis using reversibly terminated labeled nucleotides, pyrosequencing; 454 sequencing; allele specific hybridization to a library of labeled oligonucleotide probes; sequencing by synthesis using allele specific hybridization to a library of labeled clones that is followed by ligation; real time monitoring of the incorporation of labeled nucleotides during a polymerization step; polony sequencing; and SOLiD sequencing.
- high-throughput methods of sequencing are employed that comprise a step of spatially isolating individual molecules on a solid surface where they are sequenced in parallel.
- solid surfaces may include nonporous surfaces (such as in Solexa sequencing, e.g. Bentley et al, Nature, 456: 53-59 (2008) or Complete Genomics sequencing, e.g. Drmanac et al, Science, 327: 78-81 (2010)), arrays of wells, which may include bead- or particle-bound templates (such as with 454, e.g. Margulies et al, Nature, 437: 376- 380 (2005) or Ion Torrent sequencing, U.S.
- micromachined membranes such as with SMRT sequencing, e.g. Eid et al, Science, 323: 133-138 (2009)
- bead arrays as with SOLiD sequencing or polony sequencing, e.g. Kim et al, Science, 316: 1481-1414 (2007).
- the methods of the present disclosure comprise amplifying the isolated molecules either before or after they are spatially isolated on a solid surface.
- Prior amplification may comprise emulsion-based amplification, such as emulsion PCR, or rolling circle amplification.
- Solexa-based sequencing where individual template molecules are spatially isolated on a solid surface, after which they are amplified in parallel by bridge PCR to form separate clonal populations, or clusters, and then sequenced, as described in Bentley et al (cited above) and in manufacturer's instructions (e.g. TruSeqTM Sample Preparation Kit and Data Sheet, Illumina, Inc., San Diego, Calif, 2010); and further in the following references: U.S. Pat. Nos. 6,090,592; 6,300,070; 7,115,400; and EP0972081B1 ; which are incorporated by reference.
- individual molecules disposed and amplified on a solid surface form clusters in a density of at least 10 5 clusters per cm 2 ; or in a density of at least 5* 10 5 per cm 2 ; or in a density of at least 10 6 clusters per cm 2 .
- sequencing chemistries are employed having relatively high error rates.
- the average quality scores produced by such chemistries are monotonically declining functions of sequence read lengths. In one embodiment, such decline corresponds to 0.5 percent of sequence reads have at least one error in positions 1 -75; 1 percent of sequence reads have at least one error in positions 76-100; and 2 percent of sequence reads have at least one error in positions 101 -125.
- the present disclosure teaches methods of predicting the effects of particular genetic alterations being incorporated into a given host strain.
- the disclosure provides methods for generating proposed genetic alterations that should be incorporated into a given host strain, in order for said host to possess a particular phenotypic trait or strain parameter.
- the disclosure provides predictive models that can be utilized to design novel host strains.
- the present disclosure teaches methods of analyzing the performance results of each round of screening and methods for generating new proposed genome- wide sequence modifications predicted to enhance strain performance in the following round of screening.
- the present disclosure teaches that the system generates proposed sequence modifications to host strains based on previous screening results.
- the recommendations of the present system are based on the results from the immediately preceding screening. In other embodiments, the recommendations of the present system are based on the cumulative results of one or more of the preceding screenings. [0588] In some embodiments, the recommendations of the present system are based on previously developed HTP genetic design libraries. For example, in some embodiments, the present system is designed to save results from previous screenings, and apply those results to a different project, in the same or different host organisms.
- the recommendations of the present system are based on scientific insights.
- the recommendations are based on known properties of genes (from sources such as annotated gene databases and the relevant literature), codon optimization, transcriptional slippage, uORFs, or other hypothesis driven sequence and host optimizations.
- the proposed sequence modifications to a host strain recommended by the system, or predictive model are carried out by the utilization of one or more of the disclosed molecular tools sets comprising: (1) Promoter swaps, (2) SNP swaps, (3) Start/Stop codon exchanges, (4) Sequence optimization, (5) Stop swaps, (6) Solubility Tag swaps, (7) Degradation Tag swaps and (8) Epistasis mapping.
- the HTP genetic engineering platform described herein is agnostic with respect to any particular microbe or phenotypic trait (e.g. production of a particular compound). That is, the platform and methods taught herein can be utilized with any host cell to engineer said host cell to have any desired phenotypic trait. Furthermore, the lessons learned from a given HTP genetic engineering process used to create one novel host cell, can be applied to any number of other host cells, as a result of the storage, characterization, and analysis of a myriad of process parameters that occurs during the taught methods.
- Described herein is an approach for predictive strain design, including: methods of describing genetic changes and strain performance, predicting strain performance based on the composition of changes in the strain, recommending candidate designs with high predicted performance, and filtering predictions to optimize for second-order considerations, e.g. similarity to existing strains, epistasis, or confidence in predictions.
- input data may comprise two components: (1) sets of genetic changes and (2) relative strain performance.
- sets of genetic changes and (2) relative strain performance.
- input parameters independent variables
- process parameters e.g., environmental conditions, handling equipment, modification techniques, etc.
- the sets of genetic changes can come from the previously discussed collections of genetic perturbations termed HTP genetic design libraries.
- the relative strain performance can be assessed based upon any given parameter or phenotypic trait of interest (e.g. production of a compound, small molecule, or product of interest).
- Cell types can be specified in general categories such as prokaryotic and eukaryotic systems, genus, species, strain, tissue cultures (vs. disperse cells), etc.
- Process parameters that can be adjusted include temperature, pressure, reactor configuration, and medium composition.
- reactor configuration include the volume of the reactor, whether the process is a batch or continuous, and, if continuous, the volumetric flow rate, etc.
- medium composition include the concentrations of electrolytes, nutrients, waste products, acids, pH, and the like.
- strain 7000051473 has a total of 7 changes.
- "Last change” means the change in this strain represents the most recent modification in this strain lineage.
- comparing this strain's performance to the performance of its parent represents a data point concerning the performance of the "last change" mutation.
- strain performance is computed relative to a common reference strain, by first calculating the median performance per strain, per assay plate. Relative performance is then computed as the difference in average performance between an engineered strain and the common reference strain within the same plate. Restricting the calculations to within-plate comparisons ensures that the samples under consideration all received the same experimental conditions.
- Figure 23 shows the distribution of relative strain performances of Corynebacterium for the input data under consideration.
- a relative performance of zero indicates that the engineered strain performed equally well to the in-plate base or "reference" strain.
- Of interest is the ability of the predictive model to identify the strains that are likely to perform significantly above zero. Further, and more generally, of interest is whether any given strain outperforms its parent by some criteria. In practice, the criteria can be a product titer meeting or exceeding some threshold above the parent level, though having a statistically significant difference from the parent in the desired direction could also be used instead or in addition.
- the role of the base or "reference" strain is simply to serve as an added normalization factor for making comparisons within or between plates.
- the parent strain is the background that was used for a current round of mutagenesis.
- the reference strain is a control strain run in every plate to facilitate comparisons, especially between plates, and is typically the "base strain” as referenced above. But since the base strain (e.g., the wild-type or industrial strain being used to benchmark overall performance) is not necessarily a "base” in the sense of being a mutagenesis target in a given round of strain improvement, a more descriptive term is "reference strain.”
- a base/reference strain is used to benchmark the performance of built strains, generally, while the parent strain is used to benchmark the performance of a specific genetic change in the relevant genetic background.
- the goal of the disclosed model is to rank the performance of built strains, by describing relative strain performance, as a function of the composition of genetic changes introduced into the built strains.
- the various HTP genetic design libraries provide the repertoire of possible genetic changes (e.g., genetic perturbations/alterations) that are introduced into the engineered strains. Linear regression is the basis for the currently described exemplary predictive model.
- the below table (i.e., Table 4) contains example input for regression-based modeling.
- the strain performances are ranked relative to a common base strain, as a function of the composition of the genetic changes contained in the strain.
- Each column heading represents a genetic change, a "1" represents the presence of the change, whereas a “0” represents the absence of a change.
- DSS refers to SNP swaps from a particular library (first 3 columns after relative _perf). The last 3 columns are promoter swaps, where the pcgXXXX denotes the particular promoter, and the last 3 letters represent the gene the promoter is being applied to. The genes are related to central metabolism. The promoters are from Corynebacterium glutamicum (hence the "eg” notation). Further information on the utilized promoters can be found in Table 1, listing promoters P1 -P8, and the sequence listing of the present application.
- Linear regression is an attractive method for the described HTP genomic engineering platform, because of the ease of implementation and interpretation.
- the resulting regression coefficients can be interpreted as the average increase or decrease in relative strain performance attributable to the presence of each genetic change.
- the taught method therefore uses linear regression models to describe/characterize and rank built strains, which have various genetic perturbations introduced into their genomes from the various taught libraries.
- the linear regression model described above which utilized data from constructed strains, can be used to make performance predictions for strains that haven't yet been built.
- the procedure can be summarized as follows: generate in silico all possible configurations of genetic changes ⁇ use the regression model to predict relative strain performance ⁇ order the candidate strain designs by performance.
- the first step is to produce a sequence of design candidates. This is done by fixing the total number of genetic changes in the strain, and then defining all possible combinations of genetic changes. For example, one can set the total number of potential genetic changes/perturbations to 29 (e.g. 29 possible SNPs, or 29 different promoters, or any combination thereof as long as the universe of genetic perturbations is 29) and then decide to design all possible 3 -member combinations of the 29 potential genetic changes, which will result in 3,654 candidate strain designs.
- 29 e.g. 29 possible SNPs, or 29 different promoters, or any combination thereof as long as the universe of genetic perturbations is 29
- Figure 25 summarizes the composition of changes for the top 100 predicted strain designs for Corynebacterium.
- the x-axis lists the pool of potential genetic changes (29 possible genetic changes), and the y-axis shows the rank order. Black cells indicate the presence of a particular change in the candidate design, while white cells indicate the absence of that change.
- all of the top 100 designs contain the changes pcg3121_pgi, pcgl 860_pyc, dss_339, and pcg0007_39_lysa.
- the top candidate design contains the changes dss_034, dss_009.
- Predictive accuracy should increase over time as new observations are used to iteratively retrain and refit the model.
- Results from a study by the inventors illustrate the methods by which the predictive model can be iteratively retrained and improved.
- Figure 46 compares model predictions with observed measurement values. The quality of model predictions can be assessed through several methods, including a correlation coefficient indicating the strength of association between the predicted and observed values, or the root-mean-square error, which is a measure of the average model error. Using a chosen metric for model evaluation, the system may define rules for when the model should be retrained.
- a couple of unstated assumptions to the above model include: (1) there are no epistatic interactions; and (2) the genetic changes/perturbations utilized to build the predictive model (e.g. from built strain data as illustrated in Figure 24, or whatever data set is used as the reference to construct the model) were all made in the same Corynebacterium background, as the proposed combinations of genetic changes (e.g. as illustrated in Figure 25).
- the above illustrative example focused on linear regression predictions based on predicted host cell performance.
- the present linear regression methods can also be applied to non-biomolecule factors, such as saturation biomass, resistance, or other measurable host cell features.
- non-biomolecule factors such as saturation biomass, resistance, or other measurable host cell features.
- top 100 strain designs contain the changes pcg3121_pgi, pcgl 860_pyc, dss_339, and pcg0007_39_lysa. Additionally, the top candidate strain design contains the changes dss_034, dss_009.
- the order placement engine 208 places a factory order to the factory 210 to manufacture microbial strains incorporating the top candidate mutations.
- the results may be analyzed by the analysis equipment 214 to determine which microbes exhibit desired phenotypic properties (314).
- the modified strain cultures are evaluated to determine their performance, i.e., their expression of desired phenotypic properties, including the ability to be produced at industrial scale.
- the analysis phase uses, among other things, image data of plates to measure microbial colony growth as an indicator of colony health.
- the analysis equipment 214 is used to correlate genetic changes with phenotypic performance, and save the resulting genotype-phenotype correlation data in libraries, which may be stored in library 206, to inform future microbial production.
- the candidate changes that actually result in sufficiently high measured performance may be added as rows in the database to tables such as Table 4 above.
- the best performing mutations are added to the predictive strain design model in a supervised machine learning fashion.
- LIMS iterates the design/build/test/analyze cycle based on the correlations developed from previous factory runs.
- the analysis equipment 214 alone, or in conjunction with human operators, may select the best candidates as base strains for input back into input interface 202, using the correlation data to fine tune genetic modifications to achieve better phenotypic performance with finer granularity.
- the laboratory information management system of embodiments of the disclosure implements a quality improvement feedback loop.
- the analysis equipment 214 may fix the number of genetic changes to be made to a background strain, in the form of combinations of changes. To represent these changes, the analysis equipment 214 may provide to the interpreter 204 one or more DNA specification expressions representing those combinations of changes. (These genetic changes or the microbial strains incorporating those changes may be referred to as "test inputs.") The interpreter 204 interprets the one or more DNA specifications, and the execution engine 207 executes the DNA specifications to populate the DNA specification with resolved outputs representing the individual candidate design strains for those changes.
- the analysis equipment 214 selects a limited number of candidate designs, e.g., 100, with highest predicted performance (3310).
- the analysis equipment 214 may account for second-order effects such as epistasis, by, e.g., filtering top designs for epistatic effects, or factoring epistasis into the predictive model.
- the analysis equipment 214 measures the actual performance of the selected strains, selects a limited number of those selected strains based upon their superior actual performance (3314), and adds the design changes and their resulting performance to the predictive model (3316). In the linear regression example, add the sets of design changes and their associated performance as new rows in Table 4.
- the analysis equipment 214 then iterates back to generation of new design candidate strains (3306), and continues iterating until a stop condition is satisfied.
- the stop condition may comprise, for example, the measured performance of at least one microbial strain satisfying a performance metric, such as yield, growth rate, or titer.
- the iterative optimization of strain design employs feedback and linear regression to implement machine learning.
- machine learning may be described as the optimization of performance criteria, e.g., parameters, techniques or other features, in the performance of an informational task (such as classification or regression) using a limited number of examples of labeled data, and then performing the same task on unknown data.
- performance criteria e.g., parameters, techniques or other features
- an informational task such as classification or regression
- the machine e.g., a computing device
- learns for example, by identifying patterns, categories, statistical relationships, or other attributes, exhibited by training data. The result of the learning is then used to predict whether new data will exhibit the same patterns, categories, statistical relationships or other attributes.
- Embodiments of the disclosure may employ other supervised machine learning techniques when training data is available. In the absence of training data, embodiments may employ unsupervised machine learning. Alternatively, embodiments may employ semi-supervised machine learning, using a small amount of labeled data and a large amount of unlabeled data. Embodiments may also employ feature selection to select the subset of the most relevant features to optimize performance of the machine learning model. Depending upon the type of machine learning approach selected, as alternatives or in addition to linear regression, embodiments may employ for example, logistic regression, neural networks, support vector machines (SVMs), decision trees, hidden Markov models, Bayesian networks, Gram Schmidt, reinforcement-based learning, cluster-based learning including hierarchical clustering, genetic algorithms, and any other suitable learning machines known in the art.
- SVMs support vector machines
- reinforcement-based learning cluster-based learning including hierarchical clustering, genetic algorithms, and any other suitable learning machines known in the art.
- embodiments may employ logistic regression to provide probabilities of classification (e.g., classification of genes into different functional groups) along with the classifications themselves.
- probabilities of classification e.g., classification of genes into different functional groups
- Shevade A simple and efficient algorithm for gene selection using sparse logistic regression, Bioinformatics, Vol. 19, No. 17 2003, pp. 2246-2253, Leng, et al, Classification using functional data analysis for temporal gene expression data, Bioinformatics, Vol. 22, No. 1, Oxford University Press (2006), pp. 68-76, all of which are incorporated by reference in their entirety herein.
- Embodiments may employ graphics processing unit (GPU) accelerated architectures that have found increasing popularity in performing machine learning tasks, particularly in the form known as deep neural networks (DNN).
- Embodiments of the disclosure may employ GPU-based machine learning, such as that described in GPU-Based Deep Learning Inference: A Performance and Power Analysis, NVidia Whitepaper, November 2015, Dahl, et al., Multi-task Neural Networks for QSAR Predictions, Dept. of Computer Science, Univ. of Toronto, June 2014 (arXiv: 1406.1231 [stat.ML]), all of which are incorporated by reference in their entirety herein.
- Machine learning techniques applicable to embodiments of the disclosure may also be found in, among other references, Libbrecht, et al, Machine learning applications in genetics and genomics, Nature Reviews: Genetics, Vol. 16, June 2015, Kashyap, et al., Big Data Analytics in Bioinformatics: A Machine Learning Perspective, Journal of Latex Class Files, Vol. 13, No. 9, Sept. 2014, Prompramote, et al., Machine Learning in Bioinformatics, Chapter 5 of Bioinformatics Technologies, pp. 117-153, Springer Berlin Heidelberg 2005, all of which are incorporated by reference in their entirety herein.
- the implementation used a generalized linear model (Kernel Ridge Regression with 4th order polynomial kernel).
- the implementation models two distinct phenotypes (yield and productivity). These phenotypes were combined as weighted sum to obtain a single score for ranking, as shown below.
- Various model parameters e.g. regularization factor, were tuned via k-fold cross validation over the designated training data.
- the implementation does not incorporate any explicit analysis of interaction effects as described in the Epistasis Mapping section above. However, as those skilled in the art would understand, the implemented generalized linear model may capture interaction effects implicitly through the second, third and fourth order terms of the kernel.
- the model was trained against the training set.
- the fitted model has an R 2 value (coefficient of determination) of 0.52 with respect to yield and an R 2 value of 0.67 with respect to productivity.
- Figure 46 demonstrates a significant quality fitting of the yield model to the training data.
- Candidate strains were generated. This example includes a serial build constraint associated with the introduction of new genetic changes to a parent strain (in this example, only one new mutation was engineered into a strain at a time). Here, candidates are not considered simply as a function of the desired number of changes. Instead, the analysis equipment 214 selected, as a starting point, a collection of previously designed strains known to have high performance metrics ("seed strains"). The analysis equipment 214 individually applied genetic changes to each of the seed strains. The introduced genetic changes did not include those already present in the seed strain. For various technical, biological or other reasons, certain mutations were explicitly required, e.g., opca_4, or explicitly excluded, e.g., dss_422. Using 166 available seed strains and the 336 changes characterized by the model, 6239 novel candidate strains were designed.
- the analysis equipment 214 predicted the performance of candidate strain designs.
- the analysis equipment 214 ranked candidates from “best” to “worst” based on predicted performance with respect to two phenotypes of interest (yield and productivity). Specifically, the analysis equipment 214 used a weighted sum to score a candidate strain:
- yield represents predicted yield for the candidate strain
- prod represents productivity for the candidate strain
- max(prods) represents the maximum yield over all candidate strains.
- the analysis equipment 214 generated a final set of recommendations from the ranked list of candidates by imposing both capacity constraints and operational constraints.
- the capacity limit was set at 48 computer-generated candidate design strains. Due to operational constraints, in this example only one seed strain was used per column of a 96-well plate. This means that after a seed strain was chosen, up to 8 changes to that strain could be built, but only 6 seed strains could be chosen in any given week.
- the trained model (described above) was used to predict the expected performance (for yield and productivity) of each candidate strain.
- the analysis equipment 214 ranked the candidate strains using the scoring function given above. Capacity and operational constraints were applied to yield a filtered set of 48 candidate strains. This set of filtered candidate strains is depicted in Figure 47.
- Filtered candidate strains were built (at the factory 210) based on a factory order generated by the order placement engine 208 (3312). The order was based upon DNA specifications corresponding to the candidate strains.
- the build process has an expected failure rate whereby a random set of strains is not built. For this build cycle, roughly 20% of the candidate strains failed build, resulting in 37 built strains.
- the analysis equipment 214 was used to measure the actual yield and productivity performance of the selected strains.
- the analysis equipment 214 evaluated the model and recommended strains based on three criteria: model accuracy; improvement in strain performance; and equivalence (or improvement) to human expert-generated designs.
- the analysis equipment 214 computed percentage performance change from the parent strain for each of the recommended strains. This data is shown in Figure 49 (in light gray). The inventors found that many of the predicted strains in fact exhibited the expected performance gains with respect to their immediate parents. In particular, the best predicted strain showed a 6% improvement in yield with respect to its immediate parent.
- Table 4.1 Measured performance statistics for strains designed by the predictive model and by a human expert reference.
- model evaluation the inventors focused on measuring predictive accuracy by comparing model predictions with experimental measurements. Predictive accuracy can be assessed through several methods, including a correlation coefficient indicating the strength of association between the predicted and observed values, or the root-mean-square error, which is a measure of the average model error.
- model predictions may drift, and new genetic changes may be added to the training inputs to improve predictive accuracy.
- design changes and their resulting performance were added to the predictive model (3316).
- the LIMS system software 3210 of Figure 32 may be implemented in a cloud computing system 3202 of Figure 32, to enable multiple users to design and build microbial strains according to embodiments of the present disclosure.
- Figure 32 illustrates a cloud computing environment 3204 according to embodiments of the present disclosure.
- Client computers 3206 such as those illustrated in Figure 32, access the LIMS system via a network 3208, such as the Internet.
- the LIMS system application software 3210 resides in the cloud computing system 3202.
- the LIMS system may employ one or more computing systems using one or more processors, of the type illustrated in Figure 32.
- the cloud computing system itself includes a network interface 3212 to interface the LIMS system applications 3210 to the client computers 3206 via the network 3208.
- the network interface 3212 may include an application programming interface (API) to enable client applications at the client computers 3206 to access the LIMS system software 3210.
- client computers 3206 may access components of the LIMS system 200, including without limitation the software running the input interface 202, the interpreter 204, the execution engine 207, the order placement engine 208, the factory 210, as well as test equipment 212 and analysis equipment 214.
- a software as a service (SaaS) software module 3214 offers the LIMS system software 3210 as a service to the client computers 3206.
- SaaS software as a service
- a cloud management module 3216 manages access to the LIMS system 3210 by the client computers 3206.
- the cloud management module 3216 may enable a cloud architecture that employs multitenant applications, virtualization or other architectures known in the art to serve multiple users.
- Automation of the methods of the present disclosure enables high-throughput phenotypic screening and identification of target products from multiple test strain variants simultaneously.
- the aforementioned genomic engineering predictive modeling platform is premised upon the fact that hundreds and thousands of mutant strains are constructed in a high-throughput fashion.
- the robotic and computer systems described below are the structural mechanisms by which such a high-throughput process can be carried out.
- the present disclosure teaches methods of improving host cell productivities, or rehabilitating industrial strains. As part of this process, the present disclosure teaches methods of assembling DNA, building new strains, screening cultures in plates, and screening cultures in models for tank fermentation. In some embodiments, the present disclosure teaches that one or more of the aforementioned methods of creating and testing new host strains is aided by automated robotics.
- the present disclosure teaches a high-throughput strain engineering platform as depicted in Figure 6A-B or Figure 26.
- the automated methods of the disclosure comprise a robotic system.
- the systems outlined herein are generally directed to the use of 96- or 384- well microtiter plates, but as will be appreciated by those in the art, any number of different plates or configurations may be used.
- any or all of the steps outlined herein may be automated; thus, for example, the systems may be completely or partially automated.
- the automated systems of the present disclosure comprise one or more work modules.
- the automated system of the present disclosure comprises a DNA synthesis module, a vector cloning module, a strain transformation module, a screening module, and a sequencing module (see Figure 7).
- an automated system can include a wide variety of components, including, but not limited to: liquid handlers; one or more robotic arms; plate handlers for the positioning of microplates; plate sealers, plate piercers, automated lid handlers to remove and replace lids for wells on non-cross contamination plates; disposable tip assemblies for sample distribution with disposable tips; washable tip assemblies for sample distribution; 96 well loading blocks; integrated thermal cyclers; cooled reagent racks; microtiter plate pipette positions (optionally cooled); stacking towers for plates and tips; magnetic bead processing stations; filtrations systems; plate shakers; barcode readers and applicators; and computer systems.
- the robotic systems of the present disclosure include automated liquid and particle handling enabling high-throughput pipetting to perform all the steps in the process of gene targeting and recombination applications.
- This includes liquid and particle manipulations such as aspiration, dispensing, mixing, diluting, washing, accurate volumetric transfers; retrieving and discarding of pipette tips; and repetitive pipetting of identical volumes for multiple deliveries from a single sample aspiration.
- These manipulations are cross-contamination- free liquid, particle, cell, and organism transfers.
- the instruments perform automated replication of microplate samples to filters, membranes, and/or daughter plates, high-density transfers, full- plate serial dilutions, and high capacity operation.
- the customized automated liquid handling system of the disclosure is a TEC AN machine (e.g. a customized TEC AN Freedom Evo).
- the automated systems of the present disclosure are compatible with platforms for multi-well plates, deep-well plates, square well plates, reagent troughs, test tubes, mini tubes, microfuge tubes, cryovials, filters, micro array chips, optic fibers, beads, agarose and acrylamide gels, and other solid-phase matrices or platforms are accommodated on an upgradeable modular deck.
- the automated systems of the present disclosure contain at least one modular deck for multi-position work surfaces for placing source and output samples, reagents, sample and reagent dilution, assay plates, sample and reagent reservoirs, pipette tips, and an active tip-washing station.
- the automated systems of the present disclosure include high- throughput electroporation systems.
- the high-throughput electroporation systems are capable of transforming cells in 96 or 384- well plates.
- the high-throughput electroporation systems include VWR® High-throughput Electroporation Systems, BTXTM, Bio-Rad® Gene Pulser MXcellTM or other multi-well electroporation system.
- the integrated thermal cycler and/or thermal regulators are used for stabilizing the temperature of heat exchangers such as controlled blocks or platforms to provide accurate temperature control of incubating samples from 0°C to 100°C.
- the automated systems of the present disclosure are compatible with interchangeable machine-heads (single or multi-channel) with single or multiple magnetic probes, affinity probes, replicators or pipetters, capable of robotically manipulating liquid, particles, cells, and multi-cellular organisms.
- Multi-well or multi-tube magnetic separators and filtration stations manipulate liquid, particles, cells, and organisms in single or multiple sample formats.
- the automated systems of the present disclosure are compatible with camera vision and/or spectrometer systems.
- the automated systems of the present disclosure are capable of detecting and logging color and absorption changes in ongoing cellular cultures.
- the automated system of the present disclosure is designed to be flexible and adaptable with multiple hardware add-ons to allow the system to carry out multiple applications.
- the software program modules allow creation, modification, and running of methods.
- the system's diagnostic modules allow setup, instrument alignment, and motor operations.
- the customized tools, labware, and liquid and particle transfer patterns allow different applications to be programmed and performed.
- the database allows method and parameter storage. Robotic and computer interfaces allow communication between instruments.
- the present disclosure teaches a high-throughput strain engineering platform, as depicted in Figure 26.
- Figure 34 illustrates an example of a computer system 800 that may be used to execute program code stored in a non-transitory computer readable medium (e.g., memory) in accordance with embodiments of the disclosure.
- the computer system includes an input/output subsystem 802, which may be used to interface with human users and/or other computer systems depending upon the application.
- the I/O subsystem 802 may include, e.g., a keyboard, mouse, graphical user interface, touchscreen, or other interfaces for input, and, e.g., an LED or other flat screen display, or other interfaces for output, including application program interfaces (APIs).
- APIs application program interfaces
- Other elements of embodiments of the disclosure such as the components of the LIMS system, may be implemented with a computer system like that of computer system 800.
- Program code may be stored in non-transitory media such as persistent storage in secondary memory 810 or main memory 808 or both.
- Main memory 808 may include volatile memory such as random access memory (RAM) or non-volatile memory such as read only memory (ROM), as well as different levels of cache memory for faster access to instructions and data.
- Secondary memory may include persistent storage such as solid state drives, hard disk drives or optical disks.
- processors 804 reads program code from one or more non-transitory media and executes the code to enable the computer system to accomplish the methods performed by the embodiments herein. Those skilled in the art will understand that the processor(s) may ingest source code, and interpret or compile the source code into machine code that is understandable at the hardware gate level of the processor(s) 804.
- the processor(s) 804 may include graphics processing units (GPUs) for handling computationally intensive tasks. Particularly in machine learning, one or more CPUs 804 may offload the processing of large quantities of data to one or more GPUs 804.
- GPUs graphics processing
- the processor(s) 804 may communicate with external networks via one or more communications interfaces 807, such as a network interface card, WiFi transceiver, etc.
- a bus 805 communicatively couples the I/O subsystem 802, the processor(s) 804, peripheral devices 806, communications interfaces 807, memory 808, and persistent storage 810.
- Embodiments of the disclosure are not limited to this representative architecture. Alternative embodiments may employ different arrangements and types of components, e.g., separate buses for input-output components and memory subsystems.
- component in this context refers broadly to software, hardware, or firmware (or any combination thereof) component.
- Components are typically functional components that can generate useful data or other output using specified input(s).
- a component may or may not be self- contained.
- An application program also called an "application”
- An application may include one or more components, or a component can include one or more application programs.
- Some embodiments include some, all, or none of the components along with other modules or application components. Still yet, various embodiments may incorporate two or more of these components into a single module and/or associate a portion of the functionality of one or more of these components with a different component.
- memory can be any device or mechanism used for storing information.
- memory is intended to encompass any type of, but is not limited to: volatile memory, nonvolatile memory, and dynamic memory.
- memory can be random access memory, memory storage devices, optical memory devices, magnetic media, floppy disks, magnetic tapes, hard drives, SIMMs, SDRAM, DIMMs, RDRAM, DDR RAM, SODIMMS, erasable programmable read-only memories (EPROMs), electrically erasable programmable read-only memories (EEPROMs), compact disks, DVDs, and/or the like.
- memory may include one or more disk drives, flash drives, databases, local cache memories, processor cache memories, relational databases, flat databases, servers, cloud based platforms, and/or the like.
- disk drives flash drives
- databases local cache memories
- processor cache memories relational databases
- flat databases flat databases
- servers cloud based platforms, and/or the like.
- memory may include one or more disk drives, flash drives, databases, local cache memories, processor cache memories, relational databases, flat databases, servers, cloud based platforms, and/or the like.
- Memory may be used to store instructions for running one or more applications or modules on a processor.
- memory could be used in some embodiments to house all or some of the instructions needed to execute the functionality of one or more of the modules and/or applications disclosed in this application.
- the present disclosure teaches the directed engineering of new host organisms based on the recommendations of the computational analysis systems of the present disclosure.
- the present disclosure is compatible with all genetic design and cloning methods. That is, in some embodiments, the present disclosure teaches the use of traditional cloning techniques such as polymerase chain reaction, restriction enzyme digestions, ligation, homologous recombination, RT PCR, and others generally known in the art and are disclosed in for example: Sambrook et al. (2001) Molecular Cloning: A Laboratory Manual (3 rd ed., Cold Spring Harbor Laboratory Press, Plainview, New York), incorporated herein by reference.
- the cloned sequences can include possibilities from any of the HTP genetic design libraries taught herein, for example: promoters from a promoter swap library, SNPs from a SNP swap library, start or stop codons from a start/stop codon exchange library, terminators from a STOP swap library, protein solubility tags from a SOLUBILITY TAG swap library, protein degradation tags from a DEGRADATION TAG swap library or sequence optimizations from a sequence optimization library. [0677] Further, the exact sequence combinations that should be included in a particular construct can be informed by the epistatic mapping function.
- the cloned sequences can also include sequences based on rational design (hypothesis-driven) and/or sequences based on other sources, such as scientific publications.
- the present disclosure teaches methods of directed engineering, including the steps of i) generating custom-made SNP-specific DNA, ii) assembling SNP-specific plasmids, iii) transforming target host cells with SNP-specific DNA, and iv) looping out any selection markers (See Figure 2).
- Figure 6A depicts the general workflow of the strain engineering methods of the present disclosure, including acquiring and assembling DNA, assembling vectors, transforming host cells and removing selection markers.
- the present disclosure teaches inserting and/or replacing and/or altering and/or deleting a DNA segment of the host cell organism.
- the methods taught herein involve building an oligonucleotide of interest (i.e. a target DNA segment), that will be incorporated into the genome of a host organism.
- the target DNA segments of the present disclosure can be obtained via any method known in the art, including: copying or cutting from a known template, mutation, or DNA synthesis.
- the present disclosure is compatible with commercially available gene synthesis products for producing target DNA sequences (e.g., GeneArtTM, GeneMakerTM, GenScriptTM, AnagenTM, Blue HeronTM, EntelechonTM, GeNOsys, Inc., or QiagenTM).
- target DNA sequences e.g., GeneArtTM, GeneMakerTM, GenScriptTM, AnagenTM, Blue HeronTM, EntelechonTM, GeNOsys, Inc., or QiagenTM.
- the target DNA segment is designed to incorporate a SNP into a selected DNA region of the host organism (e.g., adding a beneficial SNP).
- the DNA segment is designed to remove a SNP from the DNA of the host organisms (e.g., removing a detrimental or neutral SNP).
- the oligonucleotides used in the inventive methods can be synthesized using any of the methods of enzymatic or chemical synthesis known in the art.
- the oligonucleotides may be synthesized on solid supports such as controlled pore glass (CPG), polystyrene beads, or membranes composed of thermoplastic polymers that may contain CPG.
- CPG controlled pore glass
- Oligonucleotides can also be synthesized on arrays, on a parallel microscale using microfluidics (Tian et al, Mol. BioSyst., 5, 714-722 (2009)), or known technologies that offer combinations of both (see Jacobsen et al, U.S. Pat. App. No. 2011/0172127).
- Synthesis on arrays or through microfluidics offers an advantage over conventional solid support synthesis by reducing costs through lower reagent use.
- the scale required for gene synthesis is low, so the scale of oligonucleotide product synthesized from arrays or through microfluidics is acceptable.
- the synthesized oligonucleotides are of lesser quality than when using solid support synthesis (See Tian infra.; see also Staehler et al, U.S. Pat. App. No. 2010/0216648).
- the resulting oligonucleotides may then form the smaller building blocks for longer oligonucleotides.
- smaller oligonucleotides can be joined together using protocols known in the art, such as polymerase chain assembly (PCA), ligase chain reaction (LCR), and thermodynamically balanced inside-out synthesis (TBIO) (see Czar et al. Trends in Biotechnology, 27, 63-71 (2009)).
- PCA polymerase chain assembly
- LCR ligase chain reaction
- TBIO thermodynamically balanced inside-out synthesis
- LCR uses ligase enzyme to join two oligonucleotides that are both annealed to a third oligonucleotide.
- TBIO synthesis starts at the center of the desired product and is progressively extended in both directions by using overlapping oligonucleotides that are homologous to the forward strand at the 5' end of the gene and against the reverse strand at the 3' end of the gene.
- Another method of synthesizing a larger double stranded DNA fragment is to combine smaller oligonucleotides through top-strand PCR (TSP).
- TSP top-strand PCR
- a plurality of oligonucleotides spans the entire length of a desired product and contain overlapping regions to the adjacent oligonucleotide(s).
- Amplification can be performed with universal forward and reverse primers, and through multiple cycles of amplification a full-length double stranded DNA product is formed. This product can then undergo optional error correction and further amplification that results in the desired double stranded DNA fragment end product.
- the set of smaller oligonucleotides that will be combined to form the full-length desired product are between 40-200 bases long and overlap each other by at least about 15-20 bases.
- the overlap region should be at a minimum long enough to ensure specific annealing of oligonucleotides and have a high enough melting temperature (T m ) to anneal at the reaction temperature employed.
- T m melting temperature
- the overlap can extend to the point where a given oligonucleotide is completely overlapped by adjacent oligonucleotides. The amount of overlap does not seem to have any effect on the quality of the final product.
- the first and last oligonucleotide building block in the assembly should contain binding sites for forward and reverse amplification primers.
- the terminal end sequence of the first and last oligonucleotide contain the same sequence of complementarity to allow for the use of universal primers.
- the present disclosure teaches methods for constructing vectors capable of inserting desired target DNA sections (e.g. containing a particular SNP) into the genome of host organisms.
- desired target DNA sections e.g. containing a particular SNP
- the present disclosure teaches methods of cloning vectors comprising the target DNA, homology arms, and at least one selection marker (see Figure 3).
- the present disclosure is compatible with any vector suited for transformation into the host organism.
- the present disclosure teaches use of shuttle vectors compatible with a host cell.
- a shuttle vector for use in the methods provided herein is a shuttle vector compatible with an E. coli and/or Corynebacterium host cell.
- Shuttle vectors for use in the methods provided herein can comprise markers for selection and/or counter-selection as described herein.
- the markers can be any markers known in the art and/or provided herein.
- the shuttle vectors can further comprise any regulatory sequencers) and/or sequences useful in the assembly of said shuttle vectors as known in the art.
- the shuttle vectors can further comprise any origins of replication that may be needed for propagation in a host cell as provided herein such as, for example, E. coli or C. glutamicum.
- the regulatory sequence can be any regulatory sequence known in the art or provided herein such as, for example, a promoter, start, stop, insulator, signal, secretion and/or termination sequence used by the genetic machinery of the host cell.
- the target DNA can be inserted into vectors, constructs or plasmids obtainable from any repository or catalogue product, such as a commercial vector (see e.g., DNA2.0 custom or GATEWAY® vectors).
- the target DNA can be inserted into vectors, constructs or plasmids obtainable from any repository or catalogue product, such as a commercial vector (see e.g., DNA2.0 custom or GATEWAY® vectors).
- the assembly /cloning methods of the present disclosure may employ at least one of the following assembly strategies: i) type II conventional cloning, ii) type II S- mediated or "Golden Gate” cloning (see, e.g., Engler, C, R. Kandzia, and S. Marillonnet. 2008 "A one pot, one step, precision cloning method with high-throughput capability". PLos One 3:e3647; Kotera, L, and T. Nagai.
- the present disclosure teaches cloning vectors with at least one selection marker.
- selection marker genes are known in the art often encoding antibiotic resistance function for selection in prokaryotic (e.g., against ampicillin, kanamycin, tetracycline, chloramphenicol, zeocin, spectinomycin/streptomycin) or eukaryotic cells (e.g. geneticin, neomycin, hygromycin, puromycin, blasticidin, zeocin) under selective pressure.
- marker systems allow for screening and identification of wanted or unwanted cells such as the well-known blue/white screening system used in bacteria to select positive clones in the presence of X-gal or fluorescent reporters such as green or red fluorescent proteins expressed in successfully transduced host cells.
- Another class of selection markers most of which are only functional in prokaryotic systems relates to counter selectable marker genes often also referred to as "death genes" which express toxic gene products that kill producer cells. Examples of such genes include sacB, rpsL(strA), tetAR, pheS, thy A, gata-1 , or ccdB, the function of which is described in (Reyrat et al. 1998 "Counterselectable Markers: Untapped Tools for Bacterial Genetics and Pathogenesis.” Infect Immun. 66(9): 4011-4017).
- the present disclosure teaches HTP genomic engineering steps specific for E. coli. In some embodiments, the present disclosure thus teaches methods of constructing and amplifying constructs in E. coli, as well as methods of engineering E. coli.
- the DNA vectors of the present disclosure comrpsie i) a conditional replication ori (R6K), ii) an antibiotic resistance gene, iii) one or more counter-selection gene(s) (e.g. sacb and/or PheS) and iv) a replication ori for S. cerevisiae.
- the present disclosure teaches methods of assembling DNA constructs in auxotrophic S. cerevisiae.
- the vectors of the present disclosure comprise a replication origin for S. cerevisiae. This permits the vector to replicate in S. cerevisiae during assembly.
- the present disclosure teaches methods of propagating assembled DNA occurs in E. coli containing pir protein.
- the vectors of the present disclosure comprise an R6K origin of replication.
- the R6K replication origin is conditional on the presence of the pir protein. That is, in some embodiments, the presently disclosed vectors comprising the R6K replication origin will only be amplified in host cells comprising the pir gene. This allows researchers to amplify the vectors of the present disclosure during the vector construction and amplification steps, while also preventing extra chromosomal expression of the vectors during the host cell engineering steps.
- the vectors of the present disclosure comprise a PheS gene.
- Escherichia coli phenylalanyl-tRNA synthetase can be useful as a counterselection marker, since its A294G variant misincorporates 4-chloro-phenylalanine (4CP) into cellular proteins during translation, thereby causing cell death.
- the PheS gene is designed to temporarily incorporate into the genome of the host cell.
- the present disclosure teaches counterselection methods comprising growing the host cells in minimal media with 4CP. Cells which still comprise the vector will incorporate 4CP into proteins and die. Cells which have looped out the PheS sequence survive.
- the present disclosure teaches methods of constructing, assembling and integrating vectors into host cells.
- the present disclosure teaches that the homology arms (homL and homR) are amplified by PCR.
- the desired genetic change black bar between homL and homR
- the forward primer of homL and the reverse primer of homR have sequence homology to the backbone plasmid. Further illustrations of the loop-in and loop-out process are depicted in Figure 45.
- the vectors of the present disclosure comprise one or more insulator sequences.
- the insulator sequence can be any insulator sequence known in the art.
- the insulator nucleic acid sequence is the insulatorl sequence (SEQ ID NO. 218), insulator 2 sequence (SEQ ID NO. 219) or both the insulator 1 and 2 sequences provided herein.
- the vectors of the present disclosure comprise insulator sequences flanking homology arms (homL and homR).
- the vectors of the present disclosure comprise insulator sequences flanking homology arms (homL and homR) and terminator sequence(s). The insulator sequences can be generated to be free of restriction endonuclease sequences.
- the vectors of the present disclosure comprise a combination of elements provided herein.
- a vector for use in the methods provided herein can comprise an R6K origin of replication, a SacB gene, a PheS gene as a counterselection marker and a URA3 yeast auxotrophic marker such as, for example, vector 1 (see Figure 55), which has the nucleic acid sequence of SEQ ID NO. 214.
- a vector for use in the methods provided herein can be an altered version of vector 1 , such as, for example, vector 2 (see Figure 56), which has the nucleic acid sequence of SEQ ID NO. 215.
- vector 2 can further comprise the elements found in Table 15.
- vectors for use in the methods provided herein include vector 3 (nucleic acid SEQ ID NO. 216; Figure 57) and vector 4 (nucleic acid SEQ ID NO. 217; Figure 58). Both vectors 3 and 4 were built off of the vector 2 background. However, in vector 3, the promoter sequence of sacB was replaced with a promoter containing the P2-MCD2 promoter (see Mutalik et al, Nat Methods. 2013 Apr; 10(4): 354- 60) and a codon optimized version of the native pheS gene containing the T251A/A294G mutations (see Miyazaki, K. Biotechniques. 2015 Feb l ;58(2):86-8), while vector 4 comprises the vector 3 background with the URA3 selection marker being replaced with the TRPl marker. Table 15. Select Sequence Elements of Vector 2
- DNA assembly among the backbone and the inserts is performed in yeast via yeast gap repair recombination.
- auxotrophic marker TRP or URA
- TRP or URA auxotrophic marker
- the extracted plasmids are next transformed into an E. coli strain containing pir gene to propagate the desired plasmids for the following transformation of the strain of interest.
- the transformants are selected for resistance to the given antibiotics.
- the transformants will be picked for sequencing to select the correctly assembled plasmid of interest.
- the present disclosure teaches loop-out methods of removing the backbone of the plasmid from the genome of the host.
- the present disclosure teaches that subsequent selection on counter-selective media (sucrose) and/or 4CP can be used to isolate the clones that do not contain the backbone part of the plasmid.
- isolated host cells comprising the correct integrant are inoculated in LB media and the culture is plated on LB agar plate containing sucrose and 4-p-chloro-phenylalanine (LB+SUC+4CP).
- the colonies formed onto LB+suc+4CP agar plate are expected to have either the mutant or the wild-type of the gene of interest.
- PCR amplification of the target nucleotide(s) and sequencing of the PCR product allows us to isolate the new clones with the desired genome modification.
- the resulting clones are sequenced to find the clones with the desired nucleotide change(s). In some embodiments, all the process above can be performed with the liquid handler. Transformation of Host Cells
- the vectors of the present disclosure may be introduced into the host cells using any of a variety of techniques, including transformation, transfection, transduction, viral infection, gene guns, or Ti-mediated gene transfer (see Christie, P.J., and Gordon, J.E., 2014 "The Agrobacterium Ti Plasmids” Microbiol SPectr. 2014; 2(6); 10.1128).
- Particular methods include calcium phosphate transfection, DEAE-Dextran mediated transfection, lipofection, or electroporation (Davis, L., Dibner, M., Battey, I, 1986 "Basic Methods in Molecular Biology”).
- transformed host cells are referred to as recombinant host strains.
- the present disclosure teaches high-throughput transformation of cells using the 96-well plate robotics platform and liquid handling machines of the present disclosure.
- the present disclosure teaches screening transformed cells with one or more selection markers as described above.
- cells transformed with a vector comprising a kanamycin resistance marker (KanR) are plated on media containing effective amounts of the kanamycin antibiotic. Colony forming units visible on kanamycin-laced media are presumed to have incorporated the vector cassette into their genome. Insertion of the desired sequences can be confirmed via PCR, restriction enzyme analysis, and/or sequencing of the relevant insertion site.
- KanR kanamycin resistance marker
- the present disclosure teaches methods of looping out selected regions of DNA from the host organisms.
- the looping out method can be as described in Nakashima et al. 2014 "Bacterial Cellular Engineering by Genome Editing and Gene Silencing.” Int. J. Mol. Sci. 15(2), 2773-2793.
- the present disclosure teaches looping out selection markers from positive transformants. Looping out deletion techniques are known in the art, and are described in (Tear et al. 2014 "Excision of Unstable Artificial Gene-Specific inverted Repeats Mediates Scar-Free Gene Deletions in Escherichia coli.” Appl. Biochem. Biotech. 175: 1858-1867).
- looping out methods used in the methods provided herein can be performed using single-crossover homologous recombination or double-crossover homologous recombination.
- looping out of selected regions as described herein can entail using single-crossover homologous recombination as described herein.
- loop out vectors are inserted into selected target regions within the genome of the host organism (e.g., via homologous recombination, CRISPR, lambda red-mediated recombineering or other gene editing technique).
- single-crossover homologous recombination is used between a circular plasmid or vector and the host cell genome in order to loop-in the circular plasmid or vector such as depicted in Figure 3.
- the inserted vector can be designed with a sequence which is a direct repeat of an existing or introduced nearby host sequence, such that the direct repeats flank the region of DNA slated for looping and deletion.
- cells containing the loop out plasmid or vector can be counter selected for deletion of the selection region (e.g., see Figure 4; lack of resistance to the selection gene). Further illustrations of the loop-in and loop-out process are depicted in Figure 45.
- loopout procedure represents but one illustrative method for deleting unwanted regions from a genome. Indeed the methods of the present disclosure are compatible with any method for genome deletions, including but not limited to gene editing via lambda red, CRISPR, TALENS, FOK, or other endonucleases. Persons skilled in the art will also recognize the ability to replace unwanted regions of the genome via homologous recombination techniques.
- gene editing as described herein can be performed using Lambda Red- mediated homologous recombination as described by Datsenko and Wanner, PNAS USA 97:6640- 6645 (2000), the contents of which are hereby incorporated by reference in their entirety.
- the lambda red system is derived from the lambda red bacteriophage and its use as a genetic engineering tool can be called recombineering - short for homologous recombination- mediated genetic engineering. It can be used to make an assortment of modifications: insertion and deletion of selectable and non-selectable sequences, point mutations or other small base pair changes, and the addition of protein tags. It also has the flexibility to modify the E. coli chromosome, plasmid DNA or BAC DNA. To use the lambda red recombineering system to modify target DNA, a linear donor DNA substrate (either dsDNA or ssDNA - see below) can be electroporated into E.
- a linear donor DNA substrate either dsDNA or ssDNA - see below
- coli expressing the lambda red enzymes. These enzymes then catalyze the homologous recombination of the substrate with the target DNA sequence. This means cloning occurs in vivo, as compared to restriction enzyme cloning where the genetic changes occur in a test tube.
- the donor DNA substrate only requires -50 nucleotides of homology to the target site for recombination.
- the lambda red recombineering system has three components: 1) Exo, 2) Beta, and 3) Gam. All three are required for recombineering with a dsDNA substrate; however, only Beta is required when generating a modification with an ssDNA substrate.
- Exo is a 5' ⁇ 3' dsDNA-dependent exonuclease. Exo can degrade linear dsDNA starting from the 5' end and generate 2 possible products: 1) a partially dsDNA duplex with single- stranded 3' overhangs or 2) if the dsDNA was short enough, a ssDNA whose entire complementary strand was degraded.
- Beta can protect the ssDNA created by Exo and promote its annealing to a complementary ssDNA target in the cell. Only Beta expression is required for recombineering with an ssDNA oligo substrate.
- a lambda red recombineering method can entail designing and generating substrate DNA; expressing lambda red recombination genes; transforming (e.g., electroporating) substrate DNA; growing transformants; and selecting and confirming recombinant clones.
- dsDNA substrate may be best for insertions or deletions greater than approximately 20 nucleotides, while ssDNA substrate may be best for point mutations or changes of only a few base pairs.
- dsDNA inserts can be made by PCR using primers that amplify the DNA sequence of interest and flank it with 50 base pairs of homology to the targeted insert site.
- the primers can be -70 nucleotides long (20 nucleotides that anneal to the DNA sequence of interest and 50 nucleotides of homology to regions flanking the target site).
- the dsDNA inserts can include: large insertions or deletions, including selectable DNA fragments, such as antibiotic resistance genes, as well as non-selectable DNA fragments, such as gene replacements and tags.
- ssDNA substrates can be synthetic oligonucleotides or short PCR products. Either way, the substrate should be -70-100 nucleotides long with the desired alteration(s) located in the center of the sequence. Since lambda red has a higher recombination frequency when the lagging strand of DNA is targeted, it's best to determine the direction of replication through a target region of interest and design an oligo that is complementary to the lagging strand. In some cases, oligos that target both strands are designed. One of the two oligos will recombine with a higher efficiency than the other which can aid in identifying the lagging strand.
- ssDNA substrate can be more efficient than dsDNA with a recombination frequency between 0.1% to 1%, and can be increased to as high as 25-50% by designing oligos that avoid activating the methyl -directed mismatch repair (MMR) system.
- MMR's job is to correct DNA mismatches that occur during DNA replication.
- Activation of MMR can be avoided by: 1) using a strain of bacteria that has key MMR proteins knocked out or 2) specially design ssDNA oligos to avoid MMR: 1) E. coli with inactivated MMR: Using E. coli with inactive MMR is definitely the easier of the two options, but these cells are prone to mutations and can have more unintended changes to their genomes.
- ssDNA oligos that avoid MMR activation:
- a C/C mismatch at or within 6 base pairs of the edit site is introduced.
- the desired change is flanked with 4-5 silent changes in the wobble codons, i.e. make changes to the third base pair of the adjacent 4-5 codons that alter the nucleotide sequence but not the amino acid sequence of the translated protein. These changes can be 5' or 3' of the desired change.
- the lambda red recombineering system can be expressed in a host cell by: 1) From a bacteria with integrated defective prophage 2) from a plasmid, 3) from mini- ⁇ or 4) from the lambda red phage itself. Controlling expression of Red proteins is critical for minimizing the toxic effects of Gam expression and to limit spontaneous mutations that occur when Red is constitutively expressed. Which recombination system you use depends on what type of DNA you want to edit; however, BAC DNA can be modified with any of the below described approaches.
- E. coli strains that stably express lambda red recombineering genes due to integration of a defective lambda red phage.
- One such strain is DY380, which is derived from the DHIOB E. coli strain.
- Several other bacterial strains commonly used for recombineering can be found in Thomason et al (Recombineering: Genetic Engineering in Bacteria Using Homologous Recombination. Current Protocols in Molecular Biology. 106: V: l .16: 1.16.1-1.16.39) and Sharan et al (Recombineering: A Homologous Recombination-Based Method of Genetic Engineering. Nature protocols. 2009;4(2):206-223).
- exo, beta and gam are tightly regulated by the endogenous phage promoter pL and repressor CI.
- a temperature sensitive version of the repressor gene, CI857 is used. This mutant repressor prevents expression of the recombination genes at low temperatures (30-34°C). Shifting bacteria to 42°C for 15 minutes quickly inactivates the repressor and allows for expression of the recombination genes. After this, lowering the temperature allows the repressor to re-nature and again repress expression of exo, beta and gam.
- a major advantage of using this method for lambda red expression is that it doesn't require antibiotic selection to maintain expression of the recombineering system.
- This setup can be also be used to modify chromosomal genes. After the initial editing event, the defective prophage can be removed from the chromosome of the host E. coli by a second lambda red recombination event. Alternatively, if the modified allele is selectable, it can be transferred to a different genetic background via PI transduction.
- Promoters commonly used to control expression of Red include the IPTG-inducible lac promoter, the arabinose- inducible pBAD promoter and the endogenous phage pL promoter. Plasmids that also express the repressors associated with these promoters (lacl, araC, cI857) can be used in some cases in order to limit leaky expression of the Red system.
- a plasmid to express the lambda recombineering system can be used for editing bacterial chromosomal DNA because it is easy to remove the recombineering system once recombinant clones are generated.
- a simple way to do this is to express lambda red genes from a plasmid with a heat sensitive origin of replication. Once the recombineering system is no longer needed, bacteria can be "cured" by growing them at 42°C.
- a hybrid between using a plasmid and stable integration of a defective prophage is to use mini- ⁇ , a defective non-replicating, circular piece of phage DNA, that when introduced into bacteria, integrates into the genome.
- Mini- ⁇ uses the endogenous red promoter pL and the cI857 repressor to regulate expression.
- An antibiotic can be used to select for positive clones but, because mini- ⁇ stably integrates, drug selection is not required for maintenance.
- a temperature shift to 42°C not only allows for activation of the red genes needed for recombineering, but also leads to expression of the int and xis genes which are responsible for excision of mini- ⁇ from the host's chromosome. After this, mini- ⁇ can readily be purified from bacteria just like a plasmid.
- Another option for expressing the Red system can be to use a lambda red phage, TetR, that carries the tetracycline resistance gene and the lambda red repressor cI857. Once introduced, the prophage is stable and no longer requires drug selection.
- One drawback to this approach is that it requires the generation of bacteriophage, which is not a common molecular biology technique.
- an advantage of this method is that you can stably integrate the Red system into yoa strain of interest and PI transduction could be used to move the modification into a different background, if needed. This approach is best suited for modifying plasmids or BACs because it results in stable integration of the phage into the E. coli genome.
- recombinants can first be selected via antibiotic resistance, but all clones should be further tested to confirm the presence of the desired modification.
- Colony PCR can be used to screen for positive clones in most cases, and restriction enzyme digest can be used to screen plasmids for the appropriate mutations. Point mutations and other subtle changes can be confirmed by sequencing, which can also be used for confirmation for all clones, regardless of what type of DNA is being targeted for modification: the E. coli chromosome, a plasmid, or a BAC.
- the genome of a host cell can be modified by CRISPR.
- An exemplary embodiment for utilizing the CRISPR/Cas9 system for gene editing in E. coli can be found in Examples 18 and 19.
- the CRISPR/Cas system is a prokaryotic immune system that confers resistance to foreign genetic elements such as those present within plasmids and phages and that provides a form of acquired immunity.
- CRISPR stands for Clustered Regularly Interspaced Short Palindromic Repeat
- cas stands for CRISPR-associated system, and refers to the small cas genes associated with the CRISPR complex.
- CRISPR-Cas systems are most broadly characterized as either Class 1 or Class 2 systems.
- the main distinguishing feature between these two systems is the nature of the Cas-effector module.
- Class 1 systems require assembly of multiple Cas proteins in a complex (referred to as a "Cascade complex") to mediate interference, while Class 2 systems use a large single Cas enzyme to mediate interference.
- Each of the Class 1 and Class 2 systems are further divided into multiple CRISPR-Cas types based on the presence of a specific Cas protein.
- Type 1 systems which contain the Cas3 protein
- Type III systems which contain the Cas 10 protein
- Type IV systems which contain the Csfl protein, a Cas8-like protein.
- Class 2 systems are generally less common than Class 1 systems and are further divided into the following three types: Type II systems, which contain the Cas9 protein; Type V systems, which contain Cas 12a protein (previously known as Cpfl, and referred to as Cpfl herein), Cas 12b (previously known as C2cl), Cas 12c (previously known as C2c3), Cas 12d (previously known as CasY), and Casl2e (previously known as CasX); and Type VI systems, which contain Casl3a (previously known as C2c2), Casl3b, and Casl3c. Pyzocha et ah, ACS Chemical Biology, Vol. 13 (2), pgs. 347-356.
- the CRISPR-Cas system for use in the methods provided herein is a Class 2 system. In one embodiment, the CRISPR-Cas system for use in the methods provided herein is a Type II, Type V or Type VI Class 2 system. In one embodiment, the CRISPR-Cas system for use in the methods provided herein is selected from Cas9, Cas 12a, Cas 12b, Cas 12c, Cas 12d, Casl2e, Cas 13a, Cas 13b, Cas 13c or homologs, orthologs or paralogs thereof
- CRISPR systems used in methods disclosed herein comprise a Cas effector module comprising one or more nucleic acid guided CRISPR-associated (Cas) nucleases, referred to herein as Cas effector proteins.
- the Cas proteins can comprise one or multiple nuclease domains.
- a Cas effector protein can target single stranded or double stranded nucleic acid molecules (e.g. DNA or RNA nucleic acids) and can generate double strand or single strand breaks.
- the Cas effector proteins are wild-type or naturally occurring Cas proteins.
- the Cas effector proteins are mutant Cas proteins, wherein one or more mutations, insertions, or deletions are made in a WT or naturally occurring Cas protein (e.g., a parental Cas protein) to produce a Cas protein with one or more altered characteristics compared to the parental Cas protein.
- a WT or naturally occurring Cas protein e.g., a parental Cas protein
- the Cas protein is a wild-type (WT) nuclease.
- suitable Cas proteins for use in the present disclosure include C2cl, C2c2, C2c3, Casl, Cas IB, Cas2, Cas3, Cas4, Cas5, Cas6, Cas7, Cas8, Cas9 (also known as Csnl and Csxl2), CaslO, Cpfl, Csyl, Csy2, Csy3, Csel, Cse2, Cscl, Csc2, Csa5, Csn2, Csml, Csm2, Csm3, Csm4, Csm5, Csm6, Cmrl, Cmr3, Cmr4, Cmr5, Cmr6, Csbl, Csb2, Csb3, Csxl7, Csxl4, CsxlOO, Csxl6, CsaX, Csx3, Csxl, Csxl 5, Cs
- Suitable nucleic acid guided nucleases can be from an organism from a genus, which includes but is not limited to: Thiomicrospira, S ccinivibrio, Candidatus, Porphyromonas, Acidomonococcus, Prevotella, Smithella, Moraxella, Synergistes, Francisella, Leptospira, Catenibacterium, Kandleria, Clostridium, Dorea, Coprococcus, Enter ococcus, Fructobacillus, Weissella, Pediococcus, Corynebacter, Sutterella, Legionella, Treponema, Roseburia, Filifactor, Eubacterium, Streptococcus, Lactobacillus, Mycoplasma, Bacteroides, Flaviivola, Flavobacterium, Sphaerochaeta, Azospirillum, Gluconacetobacter, Neisseria, Roseburia, Parvibacul
- Suitable nucleic acid guided nucleases can be from an organism from a phylum, which includes but is not limited to: Firmicute, Actinobacteria, Bacteroidetes, Proteobacteria, Spirochates, and Tenericutes.
- Suitable nucleic acid guided nucleases can be from an organism from a class, which includes but is not limited to: Erysipelotrichia, Clostridia, Bacilli, Actinobacteria, Bacteroidetes, Flavobacteria, Alphaproteobacteria, Betaproteobacteria, Gammaproteobacteria, Deltaproteobacteria, Epsilonproteobacteria, Spirochaetes, and Mollicutes.
- Suitable nucleic acid guided nucleases can be from an organism from an order, which includes but is not limited to: Clostridiales, Lactobacillales, Actinomycetales, Bacteroidales, Flavobacteriales, Rhizobiales, Rhodospirillales, Burkholderiales, Neisseriales, Legionellales, Nautiliales, Campylobacterales, Spirochaetales, Mycoplasmatales, and Thiotrichales.
- Suitable nucleic acid guided nucleases can be from an organism from within a family, which includes but is not limited to: Lachnospiraceae, Enterococcaceae, Leuconostocaceae, Lactobacillaceae, Streptococcaceae, Peptostreptococcaceae, Staphylococcaceae, Eubacteriaceae, Corynebacterineae, Bacteroidaceae, Flavobacterium, Cryomoorphaceae, Rhodobiaceae, Rhodospirillaceae, Acetobacteraceae, Sutterellaceae, Neisseriaceae, Legionellaceae, Nautiliaceae, Campylobacteraceae, Spirochaetaceae, Mycoplasmataceae, and Francisellaceae.
- nucleic acid guided nucleases suitable for use in the methods, systems, and compositions of the present disclosure include those derived from an organism such as, but not limited to: Thiomicrospira sp. XS5, Eubacterium rectale, Succinivibrio dextrinosolvens, Candidatus Methanoplasma termitum, Candidatus Methanomethylophilus alvus, Porphyromonas crevioricanis, Flavobacterium branchiophilum, Acidomonococcus sp., Lachnospiraceae bacterium COE1, Prevotella brevis ATCC 19188, Smithella sp.
- Cas9 nucleic acid guided nucleases
- SCADC Moraxella bovoculi, Synergistes jonesii, Bacteroidetes oral taxon 274, Francisella tularensis, Leptospira inadai serovar Lyme str. 10, Acidomonococcus sp. crystal structure (5B43) S. mutans, S. agalactiae, S. equisimilis, S. sanguinis, S. pneumonia; C. jejuni, C. coli; N. salsuginis, N. tergarcus; S. auricularis, S. carnosus; N. meningitides, N. gonorrhoeae; L. monocytogenes, L. ivanovii; C.
- Lachnospiraceae bacterium MA2020 Lachnospiraceae bacterium MA2020, Candidatus Methanoplasma termitum, Eubacterium eligens, Moraxella bovoculi 237, Leptospira inadai, Lachnospiraceae bacterium ND2006, Porphyromonas crevioricanis 3, Prevotella disiens, Porphyromonas macacae, Catenibacterium sp.
- a Cas effector protein comprises one or more of the following activities:
- nickase activity i.e., the ability to cleave a single strand of a nucleic acid molecule
- a double stranded nuclease activity i.e., the ability to cleave both strands of a double stranded nucleic acid and create a double stranded break
- a helicase activity i.e., the ability to unwind the helical structure of a double stranded nucleic acid.
- guide nucleic acid refers to a polynucleotide comprising 1) a guide sequence capable of hybridizing to a target sequence (referred to herein as a "targeting segment”) and 2) a scaffold sequence capable of interacting with (either alone or in combination with a tracrRNA molecule) a nucleic acid guided nuclease as described herein (referred to herein as a "scaffold segment").
- a guide nucleic acid can be DNA.
- a guide nucleic acid can be RNA.
- a guide nucleic acid can comprise both DNA and RNA.
- a guide nucleic acid can comprise modified non-naturally occurring nucleotides.
- the RNA guide nucleic acid can be encoded by a DNA sequence on a polynucleotide molecule such as a plasmid, linear construct, or editing cassette as disclosed herein.
- the guide nucleic acids described herein are RNA guide nucleic acids ("guide RNAs" or "gRNAs") and comprise a targeting segment and a scaffold segment.
- guide RNAs or "gRNAs”
- the scaffold segment of a gRNA is comprised in one RNA molecule and the targeting segment is comprised in another separate RNA molecule.
- gRNA double-molecule gRNAs
- two-molecule gRNA two-molecule gRNA
- gRNA dual gRNAs
- the gRNA is a single RNA molecule and is referred to herein as a "single-guide RNA” or an "sgRNA.”
- guide RNA or “gRNA” is inclusive, referring both to two- molecule guide RNAs and sgRNAs.
- the DNA-targeting segment of a gRNA comprises a nucleotide sequence that is complementary to a sequence in a target nucleic acid sequence.
- the targeting segment of a gRNA interacts with a target nucleic acid in a sequence-specific manner via hybridization (i.e., base pairing), and the nucleotide sequence of the targeting segment determines the location within the target DNA that the gRNA will bind.
- the degree of complementarity between a guide sequence and its corresponding target sequence when optimally aligned using a suitable alignment algorithm, is about or more than about 50%, 60%, 75%, 80%, 85%, 90%, 95%, 97.5%, 99%, or more.
- Optimal alignment may be determined with the use of any suitable algorithm for aligning sequences.
- a guide sequence is about or more than about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 45, 50, 75, or more nucleotides in length.
- a guide sequence is less than about 75, 50, 45, 40, 35, 30, 25, 20 nucleotides in length.
- the guide sequence is 10-30 nucleotides long.
- the guide sequence can be 15-20 nucleotides in length.
- the guide sequence can be 15 nucleotides in length.
- the guide sequence can be 16 nucleotides in length.
- the guide sequence can be 17 nucleotides in length.
- the guide sequence can be 18 nucleotides in length.
- the guide sequence can be 19 nucleotides in length.
- the guide sequence can be 20 nucleotides in length.
- the scaffold segment of a guide RNA interacts with a one or more Cas effector proteins to form a ribonucleoprotein complex (referred to herein as a CRISPR-RNP or a RNP-complex).
- the guide RNA directs the bound polypeptide to a specific nucleotide sequence within a target nucleic acid sequence via the above-described targeting segment.
- the scaffold segment of a guide RNA comprises two stretches of nucleotides that are complementary to one another and which form a double stranded RNA duplex.
- Sufficient sequence within the scaffold sequence to promote formation of a targetable nuclease complex may include a degree of complementarity along the length of two sequence regions within the scaffold sequence, such as one or two sequence regions involved in forming a secondary structure.
- the one or two sequence regions are comprised or encoded on the same polynucleotide.
- the one or two sequence regions are comprised or encoded on separate polynucleotides.
- Optimal alignment may be determined by any suitable alignment algorithm, and may further account for secondary structures, such as self- complementarity within either the one or two sequence regions.
- the degree of complementarity between the one or two sequence regions along the length of the shorter of the two when optimally aligned is about or more than about 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 97.5%, 99%, or higher. In some embodiments, at least one of the two sequence regions is about or more than about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 40, 50, or more nucleotides in length.
- a scaffold sequence of a subject gRNA can comprise a secondary structure.
- a secondary structure can comprise a pseudoknot region or stem-loop structure.
- the compatibility of a guide nucleic acid and nucleic acid guided nuclease is at least partially determined by sequence within or adjacent to the secondary structure region of the guide RNA.
- binding kinetics of a guide nucleic acid to a nucleic acid guided nuclease is determined in part by secondary structures within the scaffold sequence.
- binding kinetics of a guide nucleic acid to a nucleic acid guided nuclease is determined in part by nucleic acid sequence with the scaffold sequence.
- a compatible scaffold sequence for a gRNA-Cas effector protein combination can be found by scanning sequences adjacent to a native Cas nuclease loci.
- native Cas nucleases can be encoded on a genome within proximity to a corresponding compatible guide nucleic acid or scaffold sequence.
- Nucleic acid guided nucleases can be compatible with guide nucleic acids that are not found within the nucleases endogenous host. Such orthogonal guide nucleic acids can be determined by empirical testing. Orthogonal guide nucleic acids can come from different bacterial species or be synthetic or otherwise engineered to be non-naturally occurring. Orthogonal guide nucleic acids that are compatible with a common nucleic acid-guided nuclease can comprise one or more common features. Common features can include sequence outside a pseudoknot region. Common features can include a pseudoknot region. Common features can include a primary sequence or secondary structure
- a guide nucleic acid can be engineered to target a desired target sequence by altering the guide sequence such that the guide sequence is complementary to the target sequence, thereby allowing hybridization between the guide sequence and the target sequence.
- a guide nucleic acid with an engineered guide sequence can be referred to as an engineered guide nucleic acid.
- Engineered guide nucleic acids are often non-naturally occurring and are not found in nature.
- the present disclosure provides a polynucleotide encoding a gRNA.
- a gRNA-encoding nucleic acid is comprised in an expression vector, e.g., a recombinant expression vector.
- the present disclosure provides a polynucleotide encoding a site-directed modifying polypeptide.
- the polynucleotide encoding a site-directed modifying polypeptide is comprised in an expression vector, e.g., a recombinant expression vector.
- Examples 1-9 are demonstrations of the HTP genomic engineering platform in Coynebacterium. However, similar procedures have been customized for ?, coli and are being successfully carried out by the inventors.
- This example illustrates embodiments of the HTP genetic engineering methods of the present disclosure.
- Host cells are transformed with a variety of SNP sequences of different sizes, all targeting different areas of the genome.
- the results demonstrate that the methods of the present disclosure are able to generate rapid genetic changes of any kind, across the entire genome of a host cell.
- SNPs were chosen at random from Corynebacterium glutamicum (ATCC21300) and were cloned into Corynebacterium cloning vectors using yeast homologous recombination cloning techniques to assemble a vector in which each SNP was flanked by direct repeat regions, as described supra in the "Assembling/Cloning Custom Plasmids" section, and as illustrated in Figure 3.
- the SNP cassettes for this example were designed to include a range of homology direct repeat arm lengths ranging from 0.5Kb, 1Kb, 2Kb, and 5Kb. Moreover, SNP cassettes were designed for homologous recombination targeted to various distinct regions of the genome, as described in more detail below.
- the C. glutamicum genome is 3,282,708 bp in size (see Figure 9).
- the genome was arbitrarily divided into 24 equal-sized genetic regions, and SNP cassettes were designed to target each of the 24 regions.
- SNP cassettes were designed to target each of the 24 regions.
- a total of 96 distinct plasmids were cloned for this Example (4 different insert sizes x 24 distinct genomic regions).
- Each DNA insert was produced by PCR amplification of homologous regions using commercially sourced oligos and the host strain genomic DNA described above as template.
- the SNP to be introduced into the genome was encoded in the oligo tails.
- PCR fragments were assembled into the vector backbone using homologous recombination in yeast.
- Vectors were initially transformed into E. coli using standard heat shock transformation techniques in order to identify correctly assembled clones, and to amplify vector DNA for Corynebacterium transformation.
- transformed E. coli bacteria were tested for assembly success.
- CFUs Colony Forming Units
- Genomic integration efficiency was also analyzed with respect to the targeted genome location in C. glutamicum transformants. Genomic positions 1 and 2 exhibited slightly lowered integration efficiency compared to the rest of the genome (see Figure 10).
- Table 7 below provides a quantitative assessment of the efficiencies of the HTP genome engineering methods of the present invention.
- Construct assembly rates for yeast homology methodologies yielded expected DNA constructs in nearly 9 out of 10 tested colonies.
- Coryne transformations of SNP constructs with 2kb homology arms yielded an average of 51 colony forming units per micro gram of DNA (CFU ⁇ g), with 98% of said colonies exhibiting correctly integrated SNP inserts (targeting efficiency).
- Loop out efficiencies remained at .2% of cells becoming resistant when exposed to sucrose, with 13% of these exhibiting correctly looped out sequences.
- This example illustrates several aspects of the SNP swap libraries of the HTP strain improvement programs of the present disclosure. Specifically, the example illustrates several envisioned approaches for rehabilitating currently existing industrial strains. This example describes the wave up and wave down approaches to exploring the phenotypic solution space created by the multiple genetic differences that may be present between "base,” “intermediate,” and industrial strains.
- An exemplary strain improvement program using the methods of the present disclosure was conducted on an industrial production microbial strain, herein referred to as "C.”
- the diversity pool strains for this program are represented by A, B, and C.
- Strain A represented the original production host strain, prior to any mutagenesis.
- Strain C represented the current industrial strain, which has undergone many years of mutagenesis and selection via traditional strain improvement programs.
- Strain B represented a "middle ground” strain, which had undergone some mutagenesis, and had been the predecessor of strain C. (see Figure 17A).
- Strains A, B, and C were sequenced and their genomes were analyzed for genetic differences between strains. A total of 332 non- synonymous SNPs were identified. Of these, 133 SNPs were unique to C, 153 were additionally shared by B and C, and 46 were unique to strain B (see Figure 17B). These SNPs will be used as the diversity pool for downstream strain improvement cycles. B. SNP Swapping Analysis
- SNPs identified from the diversity pool in Part A of Example 2 will be analyzed to determine their effect on host cell performance.
- the initial "learning" round of the strain performance will be broken down into six steps as described below, and diagramed in Figure 18.
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Genetics & Genomics (AREA)
- Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Chemical & Material Sciences (AREA)
- Wood Science & Technology (AREA)
- Organic Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biomedical Technology (AREA)
- Zoology (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Plant Pathology (AREA)
- Molecular Biology (AREA)
- Microbiology (AREA)
- Physics & Mathematics (AREA)
- Biophysics (AREA)
- Bioinformatics & Computational Biology (AREA)
- Crystallography & Structural Chemistry (AREA)
- Virology (AREA)
- Ecology (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Priority Applications (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2019567283A JP2020524490A (ja) | 2017-06-06 | 2018-06-06 | Escherichia Coliを改良するためのHTPゲノム操作プラットフォーム |
| CN201880047657.XA CN110945125A (zh) | 2017-06-06 | 2018-06-06 | 用于改进大肠杆菌的htp基因工程改造平台 |
| ES18734715T ES2875579T3 (es) | 2017-06-06 | 2018-06-06 | Plataforma de ingeniería genómica de HTP para mejorar Escherichia coli |
| KR1020207000237A KR20200026874A (ko) | 2017-06-06 | 2018-06-06 | 대장균 개량을 위한 htp 게놈 공학 플랫폼 |
| CA3064612A CA3064612A1 (en) | 2017-06-06 | 2018-06-06 | A htp genomic engineering platform for improving escherichia coli |
| US16/620,069 US20200370058A1 (en) | 2017-06-06 | 2018-06-06 | A htp genomic engineering platform for improving escherichia coli |
| EP21162339.2A EP3878961A1 (en) | 2017-06-06 | 2018-06-06 | A htp genomic engineering platform for improving escherichia coli |
| EP18734715.8A EP3485013B1 (en) | 2017-06-06 | 2018-06-06 | A htp genomic engineering platform for improving escherichia coli |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201762515870P | 2017-06-06 | 2017-06-06 | |
| US62/515,870 | 2017-06-06 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2018226880A1 true WO2018226880A1 (en) | 2018-12-13 |
Family
ID=62751581
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2018/036333 Ceased WO2018226880A1 (en) | 2017-06-06 | 2018-06-06 | A htp genomic engineering platform for improving escherichia coli |
Country Status (8)
| Country | Link |
|---|---|
| US (1) | US20200370058A1 (https=) |
| EP (2) | EP3485013B1 (https=) |
| JP (1) | JP2020524490A (https=) |
| KR (1) | KR20200026874A (https=) |
| CN (1) | CN110945125A (https=) |
| CA (1) | CA3064612A1 (https=) |
| ES (1) | ES2875579T3 (https=) |
| WO (1) | WO2018226880A1 (https=) |
Cited By (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2020185590A1 (en) * | 2019-03-08 | 2020-09-17 | Zymergen Inc. | Iterative genome editing in microbes |
| CN111700075A (zh) * | 2020-06-05 | 2020-09-25 | 茂名市瑜丰沉香创意产业有限公司 | 人工结香沉香、沉香精油富集液、沉香香皂及其生产方法 |
| US11053515B2 (en) | 2019-03-08 | 2021-07-06 | Zymergen Inc. | Pooled genome editing in microbes |
| US11066663B2 (en) | 2018-10-31 | 2021-07-20 | Zymergen Inc. | Multiplexed deterministic assembly of DNA libraries |
| WO2021152301A1 (en) * | 2020-01-29 | 2021-08-05 | Imperial College Innovations Ltd | Gene switches and circuits for use in mycoplasma species |
| CN114008202A (zh) * | 2019-06-21 | 2022-02-01 | 格礼卡姆股份公司 | 用于体外和体内基因表达的包含5’utr茎环的核酸构建体 |
| CN117238380A (zh) * | 2023-11-15 | 2023-12-15 | 中国医学科学院北京协和医院 | 宏基因组病原识别的ai推荐方法、装置、设备及介质 |
Families Citing this family (19)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN111615557B (zh) * | 2017-11-22 | 2025-04-18 | 国立大学法人神户大学 | 稳定且副作用少的基因组编辑用复合物和编码该复合物的核酸 |
| US11526705B2 (en) * | 2019-04-01 | 2022-12-13 | Lg Electronics Inc. | Method of classificating outlier in object recognition and device and robot of classifying thereof |
| CN110272907B (zh) * | 2019-08-12 | 2021-04-23 | 华中农业大学 | 一种调控番茄茎杆发育的基因sd1及其应用 |
| CN111612133B (zh) * | 2020-05-20 | 2021-10-19 | 广州华见智能科技有限公司 | 基于人脸图像多阶段关系学习的内脏器官特征编码方法 |
| JPWO2022124302A1 (https=) * | 2020-12-08 | 2022-06-16 | ||
| CN112941058B (zh) * | 2021-04-02 | 2023-12-05 | 重庆科润生物医药研发有限公司 | 一种重组溶组织梭菌ii型胶原酶及其制备方法和应用 |
| CN113265412A (zh) * | 2021-05-20 | 2021-08-17 | 北京化工大学 | 多酶偶联定位体系及其构建方法和应用 |
| CN113393900B (zh) * | 2021-06-09 | 2022-08-02 | 吉林大学 | 基于改进Transformer模型的RNA状态推断研究方法 |
| US11530406B1 (en) | 2021-08-30 | 2022-12-20 | Sachi Bioworks Inc. | System and method for producing a therapeutic oligomer |
| US12037621B2 (en) | 2021-09-15 | 2024-07-16 | Archer-Daniels-Midland Company | Threonine production strain having attenuated expression of the yafV gene |
| CN114672505A (zh) * | 2022-03-15 | 2022-06-28 | 江苏省中国科学院植物研究所 | 一种功能性表达细胞色素p450酶的方法及其应用 |
| CN114921463B (zh) * | 2022-04-11 | 2023-12-01 | 中国农业科学院生物技术研究所 | 一种调控萜类化合物合成产量的人工非编码RNA分子CsiY及其应用 |
| CN115074410B (zh) * | 2022-06-30 | 2025-08-19 | 武汉合生科技有限公司 | 一种生物合成虾青素的方法及载体 |
| CN115992160A (zh) * | 2022-09-30 | 2023-04-21 | 倍生生物科技(深圳)有限公司 | 一种穿梭载体及其构建方法和应用 |
| CN115820703A (zh) * | 2022-12-20 | 2023-03-21 | 山东乾肽生物科技有限公司 | 利用rna环化技术制备寡肽的方法及寡肽的表达dna |
| CN116013407B (zh) * | 2022-12-26 | 2025-06-27 | 杭州智科慧创科技有限公司 | 一种基于语言模型的性质解耦蛋白质生成方法 |
| CN116504313A (zh) * | 2023-05-08 | 2023-07-28 | 暨南大学 | 基因终止子查询方法、装置、设备及可读存储介质 |
| CN117275590B (zh) * | 2023-11-10 | 2024-03-26 | 华东师范大学 | 有机固废体系中大分子的降解功能基因数据库与分析平台 |
| KR20250069469A (ko) * | 2023-11-10 | 2025-05-19 | 한국과학기술원 | TdT(Terminal deoxynucleotidyl transferase) 및 dNTP를 이용한 비번역영역 (untranslated region) 라이브러리 합성 방법 |
Citations (58)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4435504A (en) | 1982-07-15 | 1984-03-06 | Syva Company | Immunochromatographic assay with support having bound "MIP" and second enzyme |
| US4855240A (en) | 1987-05-13 | 1989-08-08 | Becton Dickinson And Company | Solid phase assay employing capillary flow |
| US4980298A (en) | 1984-03-15 | 1990-12-25 | Unilever Patent Holdings B.V. | Devices for carrying out chemical and clinical tests, and their use |
| US5591645A (en) | 1987-03-27 | 1997-01-07 | Becton, Dickinson & Co. | Solid phase chromatographic immunoassay |
| US5605793A (en) | 1994-02-17 | 1997-02-25 | Affymax Technologies N.V. | Methods for in vitro recombination |
| WO1997020078A1 (en) * | 1995-11-30 | 1997-06-05 | Maxygen, Inc. | Methods for generating polynucleotides having desired characteristics by iterative selection and recombination |
| WO1997035966A1 (en) * | 1996-03-25 | 1997-10-02 | Maxygen, Inc. | Methods and compositions for cellular and metabolic engineering |
| WO1998031837A1 (en) * | 1997-01-17 | 1998-07-23 | Maxygen, Inc. | Evolution of whole cells and organisms by recursive sequence recombination |
| US5789538A (en) | 1995-02-03 | 1998-08-04 | Massachusetts Institute Of Technology | Zinc finger proteins with high affinity new DNA binding specificities |
| WO2000004190A1 (en) * | 1998-07-15 | 2000-01-27 | Maxygen, Inc. | Evolution of whole cells and organisms by recursive sequence recombination |
| US6040439A (en) | 1997-09-05 | 2000-03-21 | Japan Science And Technology Corporation | Method for chemical synthesis of oligonucleotides |
| US6060296A (en) | 1991-07-03 | 2000-05-09 | The Salk Institute For Biological Studies | Protein kinases |
| US6090592A (en) | 1994-08-03 | 2000-07-18 | Mosaic Technologies, Inc. | Method for performing amplification of nucleic acid on supports |
| US6140081A (en) | 1998-10-16 | 2000-10-31 | The Scripps Research Institute | Zinc finger binding domains for GNN |
| US6205404B1 (en) | 1998-02-20 | 2001-03-20 | George S. Michaels | DNA-binding proteins of the zinc-finger class |
| US6300070B1 (en) | 1999-06-04 | 2001-10-09 | Mosaic Technologies, Inc. | Solid phase methods for amplifying multiple nucleic acids |
| WO2002029032A2 (en) * | 2000-09-30 | 2002-04-11 | Diversa Corporation | Whole cell engineering by mutagenizing a substantial portion of a starting genome, combining mutations, and optionally repeating |
| US6410248B1 (en) | 1998-01-30 | 2002-06-25 | Massachusetts Institute Of Technology | General strategy for selecting high-affinity zinc finger proteins for diverse DNA target sites |
| WO2005021772A1 (en) | 2003-08-29 | 2005-03-10 | Degussa Ag | Process for the preparation of l-lysine |
| US7067617B2 (en) | 2001-02-21 | 2006-06-27 | The Scripps Research Institute | Zinc finger binding domains for nucleotide sequence ANN |
| US20060141578A1 (en) * | 2000-05-09 | 2006-06-29 | Korea Research Instituted Of Bioscience And Biotechnology | Method of protein synthesis |
| US7115400B1 (en) | 1998-09-30 | 2006-10-03 | Solexa Ltd. | Methods of nucleic acid amplification and sequencing |
| EP0972081B1 (en) | 1997-04-01 | 2007-06-13 | Solexa Ltd. | Method of nucleic acid amplification |
| US20070178454A1 (en) | 2002-10-21 | 2007-08-02 | Joung J K | Context sensitive paralell optimization of zinc finger dna binding domains |
| US20070292918A1 (en) | 2006-05-30 | 2007-12-20 | Stelman Steven J | Codon optimization method |
| US7605140B2 (en) | 2000-12-07 | 2009-10-20 | Sangamo Biosciences, Inc. | Regulation of angiogenesis with zinc finger proteins |
| WO2010002966A2 (en) * | 2008-07-03 | 2010-01-07 | Dow Global Technologies Inc. | High throughput screening method and use thereof to identify a production platform for a multifunctional binding protein |
| US20100137143A1 (en) | 2008-10-22 | 2010-06-03 | Ion Torrent Systems Incorporated | Methods and apparatus for measuring analytes |
| US20100216648A1 (en) | 2009-02-20 | 2010-08-26 | Febit Holding Gmbh | Synthesis of sequence-verified nucleic acids |
| US20100304982A1 (en) | 2009-05-29 | 2010-12-02 | Ion Torrent Systems, Inc. | Scaffolded nucleic acid polymer particles and methods of making and using |
| US20110172127A1 (en) | 2008-08-27 | 2011-07-14 | Westemd Asset Clearinghouse Company, LLC | Methods and Devices for High Fidelity Polynucleotide Synthesis |
| WO2011154147A1 (en) | 2010-06-11 | 2011-12-15 | Icon Genetics Gmbh | System and method of modular cloning |
| WO2012142591A2 (en) * | 2011-04-14 | 2012-10-18 | The Regents Of The University Of Colorado | Compositions, methods and uses for multiplex protein sequence activity relationship mapping |
| WO2012149470A1 (en) * | 2011-04-27 | 2012-11-01 | Amyris, Inc. | Methods for genomic modification |
| EP2657250A2 (en) * | 2010-12-21 | 2013-10-30 | CJ CheilJedang Corporation | Variant polypeptide having homoserine acetyltransferase activity and microorganism expressing same |
| US20140068797A1 (en) | 2012-05-25 | 2014-03-06 | University Of Vienna | Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription |
| US8697359B1 (en) | 2012-12-12 | 2014-04-15 | The Broad Institute, Inc. | CRISPR-Cas systems and methods for altering expression of gene products |
| US8795965B2 (en) | 2012-12-12 | 2014-08-05 | The Broad Institute, Inc. | CRISPR-Cas component systems, methods and compositions for sequence manipulation |
| US8865406B2 (en) | 2012-12-12 | 2014-10-21 | The Broad Institute Inc. | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
| US8889356B2 (en) | 2012-12-12 | 2014-11-18 | The Broad Institute Inc. | CRISPR-Cas nickase systems, methods and compositions for sequence manipulation in eukaryotes |
| US8906616B2 (en) | 2012-12-12 | 2014-12-09 | The Broad Institute Inc. | Engineering of systems, methods and optimized guide compositions for sequence manipulation |
| US8993233B2 (en) | 2012-12-12 | 2015-03-31 | The Broad Institute Inc. | Engineering and optimization of systems, methods and compositions for sequence manipulation with functional domains |
| US9023649B2 (en) | 2012-12-17 | 2015-05-05 | President And Fellows Of Harvard College | RNA-guided human genome engineering |
| US20150240261A1 (en) | 2012-03-20 | 2015-08-27 | Vilnius University | RNA-DIRECTED DNA CLEAVAGE BY THE Cas9-crRNA COMPLEX |
| WO2016073690A1 (en) | 2014-11-05 | 2016-05-12 | Illumina, Inc. | Transposase compositions for reduction of insertion bias |
| US9502126B1 (en) | 2015-09-10 | 2016-11-22 | SK Hynix Inc. | Memory system and operating method thereof |
| US9580701B2 (en) | 2015-01-28 | 2017-02-28 | Pioneer Hi-Bred International, Inc. | CRISPR hybrid DNA/RNA polynucleotides and methods of use |
| US9605480B2 (en) | 2009-01-15 | 2017-03-28 | Schlumberger Technology Corporation | Directional drilling control devices and methods |
| US20170159045A1 (en) * | 2015-12-07 | 2017-06-08 | Zymergen, Inc. | Microbial strain improvement by a htp genomic engineering platform |
| US9677090B2 (en) | 2015-10-23 | 2017-06-13 | Caribou Biosciences, Inc. | Engineered nucleic-acid targeting nucleic acids |
| WO2017100376A2 (en) * | 2015-12-07 | 2017-06-15 | Zymergen, Inc. | Promoters from corynebacterium glutamicum |
| WO2017100377A1 (en) * | 2015-12-07 | 2017-06-15 | Zymergen, Inc. | Microbial strain improvement by a htp genomic engineering platform |
| US9738687B2 (en) | 2015-04-10 | 2017-08-22 | Feldan Bio Inc. | Polypeptide-based shuttle agents for improving the transduction efficiency of polypeptide cargos to the cytosol of target eukaryotic cells, uses thereof, methods and kits relating to same |
| US9790490B2 (en) | 2015-06-18 | 2017-10-17 | The Broad Institute Inc. | CRISPR enzymes and systems |
| WO2017189784A1 (en) * | 2016-04-27 | 2017-11-02 | Zymergen Inc. | Methods and systems for generating factory order forms to control production of nucleotide sequences |
| US9834791B2 (en) | 2013-11-07 | 2017-12-05 | Editas Medicine, Inc. | CRISPR-related methods and compositions with governing gRNAS |
| US20170369879A1 (en) | 2012-10-09 | 2017-12-28 | Regulus Therapeutics Inc. | Methods for treatment of alport syndrome |
| US9896696B2 (en) | 2016-02-15 | 2018-02-20 | Benson Hill Biosystems, Inc. | Compositions and methods for modifying genomes |
Family Cites Families (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US72197A (en) | 1867-12-17 | Jesse h | ||
| US824A (en) | 1838-07-09 | Construction of steam-engines | ||
| US6927046B1 (en) * | 1999-12-30 | 2005-08-09 | Archer-Daniels-Midland Company | Increased lysine production by gene amplification using coryneform bacteria |
| CN101177454B (zh) * | 2007-05-09 | 2010-09-22 | 郑骏年 | Il-18突变体多肽及制备及用途 |
| US8765403B2 (en) | 2008-02-28 | 2014-07-01 | The Regents Of The University Of California | Use of synthetic scaffolds for the production of biosynthetic pathway products |
| CN102352337B (zh) * | 2011-08-03 | 2014-04-23 | 中国人民解放军军事医学科学院生物工程研究所 | 利用异源启动子控制大肠杆菌基因组n-乙酰基转移酶表达重组菌及应用 |
-
2018
- 2018-06-06 WO PCT/US2018/036333 patent/WO2018226880A1/en not_active Ceased
- 2018-06-06 JP JP2019567283A patent/JP2020524490A/ja active Pending
- 2018-06-06 US US16/620,069 patent/US20200370058A1/en not_active Abandoned
- 2018-06-06 ES ES18734715T patent/ES2875579T3/es active Active
- 2018-06-06 EP EP18734715.8A patent/EP3485013B1/en active Active
- 2018-06-06 EP EP21162339.2A patent/EP3878961A1/en not_active Withdrawn
- 2018-06-06 KR KR1020207000237A patent/KR20200026874A/ko not_active Withdrawn
- 2018-06-06 CA CA3064612A patent/CA3064612A1/en not_active Abandoned
- 2018-06-06 CN CN201880047657.XA patent/CN110945125A/zh active Pending
Patent Citations (73)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4435504A (en) | 1982-07-15 | 1984-03-06 | Syva Company | Immunochromatographic assay with support having bound "MIP" and second enzyme |
| US4980298A (en) | 1984-03-15 | 1990-12-25 | Unilever Patent Holdings B.V. | Devices for carrying out chemical and clinical tests, and their use |
| US5591645A (en) | 1987-03-27 | 1997-01-07 | Becton, Dickinson & Co. | Solid phase chromatographic immunoassay |
| US4855240A (en) | 1987-05-13 | 1989-08-08 | Becton Dickinson And Company | Solid phase assay employing capillary flow |
| US6060296A (en) | 1991-07-03 | 2000-05-09 | The Salk Institute For Biological Studies | Protein kinases |
| US5837458A (en) | 1994-02-17 | 1998-11-17 | Maxygen, Inc. | Methods and compositions for cellular and metabolic engineering |
| US5605793A (en) | 1994-02-17 | 1997-02-25 | Affymax Technologies N.V. | Methods for in vitro recombination |
| US6090592A (en) | 1994-08-03 | 2000-07-18 | Mosaic Technologies, Inc. | Method for performing amplification of nucleic acid on supports |
| US5789538A (en) | 1995-02-03 | 1998-08-04 | Massachusetts Institute Of Technology | Zinc finger proteins with high affinity new DNA binding specificities |
| WO1997020078A1 (en) * | 1995-11-30 | 1997-06-05 | Maxygen, Inc. | Methods for generating polynucleotides having desired characteristics by iterative selection and recombination |
| WO1997035966A1 (en) * | 1996-03-25 | 1997-10-02 | Maxygen, Inc. | Methods and compositions for cellular and metabolic engineering |
| WO1998031837A1 (en) * | 1997-01-17 | 1998-07-23 | Maxygen, Inc. | Evolution of whole cells and organisms by recursive sequence recombination |
| EP0972081B1 (en) | 1997-04-01 | 2007-06-13 | Solexa Ltd. | Method of nucleic acid amplification |
| US6040439A (en) | 1997-09-05 | 2000-03-21 | Japan Science And Technology Corporation | Method for chemical synthesis of oligonucleotides |
| US6410248B1 (en) | 1998-01-30 | 2002-06-25 | Massachusetts Institute Of Technology | General strategy for selecting high-affinity zinc finger proteins for diverse DNA target sites |
| US6205404B1 (en) | 1998-02-20 | 2001-03-20 | George S. Michaels | DNA-binding proteins of the zinc-finger class |
| WO2000004190A1 (en) * | 1998-07-15 | 2000-01-27 | Maxygen, Inc. | Evolution of whole cells and organisms by recursive sequence recombination |
| US7115400B1 (en) | 1998-09-30 | 2006-10-03 | Solexa Ltd. | Methods of nucleic acid amplification and sequencing |
| US6140081A (en) | 1998-10-16 | 2000-10-31 | The Scripps Research Institute | Zinc finger binding domains for GNN |
| US6300070B1 (en) | 1999-06-04 | 2001-10-09 | Mosaic Technologies, Inc. | Solid phase methods for amplifying multiple nucleic acids |
| US20060141578A1 (en) * | 2000-05-09 | 2006-06-29 | Korea Research Instituted Of Bioscience And Biotechnology | Method of protein synthesis |
| WO2002029032A2 (en) * | 2000-09-30 | 2002-04-11 | Diversa Corporation | Whole cell engineering by mutagenizing a substantial portion of a starting genome, combining mutations, and optionally repeating |
| US7605140B2 (en) | 2000-12-07 | 2009-10-20 | Sangamo Biosciences, Inc. | Regulation of angiogenesis with zinc finger proteins |
| US7067617B2 (en) | 2001-02-21 | 2006-06-27 | The Scripps Research Institute | Zinc finger binding domains for nucleotide sequence ANN |
| US20070178454A1 (en) | 2002-10-21 | 2007-08-02 | Joung J K | Context sensitive paralell optimization of zinc finger dna binding domains |
| WO2005021772A1 (en) | 2003-08-29 | 2005-03-10 | Degussa Ag | Process for the preparation of l-lysine |
| US20070292918A1 (en) | 2006-05-30 | 2007-12-20 | Stelman Steven J | Codon optimization method |
| WO2010002966A2 (en) * | 2008-07-03 | 2010-01-07 | Dow Global Technologies Inc. | High throughput screening method and use thereof to identify a production platform for a multifunctional binding protein |
| US20110172127A1 (en) | 2008-08-27 | 2011-07-14 | Westemd Asset Clearinghouse Company, LLC | Methods and Devices for High Fidelity Polynucleotide Synthesis |
| US20100137143A1 (en) | 2008-10-22 | 2010-06-03 | Ion Torrent Systems Incorporated | Methods and apparatus for measuring analytes |
| US9605480B2 (en) | 2009-01-15 | 2017-03-28 | Schlumberger Technology Corporation | Directional drilling control devices and methods |
| US20100216648A1 (en) | 2009-02-20 | 2010-08-26 | Febit Holding Gmbh | Synthesis of sequence-verified nucleic acids |
| US20100304982A1 (en) | 2009-05-29 | 2010-12-02 | Ion Torrent Systems, Inc. | Scaffolded nucleic acid polymer particles and methods of making and using |
| WO2011154147A1 (en) | 2010-06-11 | 2011-12-15 | Icon Genetics Gmbh | System and method of modular cloning |
| EP2657250A2 (en) * | 2010-12-21 | 2013-10-30 | CJ CheilJedang Corporation | Variant polypeptide having homoserine acetyltransferase activity and microorganism expressing same |
| WO2012142591A2 (en) * | 2011-04-14 | 2012-10-18 | The Regents Of The University Of Colorado | Compositions, methods and uses for multiplex protein sequence activity relationship mapping |
| WO2012149470A1 (en) * | 2011-04-27 | 2012-11-01 | Amyris, Inc. | Methods for genomic modification |
| US20150240261A1 (en) | 2012-03-20 | 2015-08-27 | Vilnius University | RNA-DIRECTED DNA CLEAVAGE BY THE Cas9-crRNA COMPLEX |
| US9637739B2 (en) | 2012-03-20 | 2017-05-02 | Vilnius University | RNA-directed DNA cleavage by the Cas9-crRNA complex |
| US20150291961A1 (en) | 2012-03-20 | 2015-10-15 | Vilnius University | RNA-DIRECTED DNA CLEAVAGE BY THE Cas9-crRNA COMPLEX |
| US20140068797A1 (en) | 2012-05-25 | 2014-03-06 | University Of Vienna | Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription |
| US20170369879A1 (en) | 2012-10-09 | 2017-12-28 | Regulus Therapeutics Inc. | Methods for treatment of alport syndrome |
| US8993233B2 (en) | 2012-12-12 | 2015-03-31 | The Broad Institute Inc. | Engineering and optimization of systems, methods and compositions for sequence manipulation with functional domains |
| US8871445B2 (en) | 2012-12-12 | 2014-10-28 | The Broad Institute Inc. | CRISPR-Cas component systems, methods and compositions for sequence manipulation |
| US8906616B2 (en) | 2012-12-12 | 2014-12-09 | The Broad Institute Inc. | Engineering of systems, methods and optimized guide compositions for sequence manipulation |
| US8932814B2 (en) | 2012-12-12 | 2015-01-13 | The Broad Institute Inc. | CRISPR-Cas nickase systems, methods and compositions for sequence manipulation in eukaryotes |
| US8945839B2 (en) | 2012-12-12 | 2015-02-03 | The Broad Institute Inc. | CRISPR-Cas systems and methods for altering expression of gene products |
| US8771945B1 (en) | 2012-12-12 | 2014-07-08 | The Broad Institute, Inc. | CRISPR-Cas systems and methods for altering expression of gene products |
| US8999641B2 (en) | 2012-12-12 | 2015-04-07 | The Broad Institute Inc. | Engineering and optimization of systems, methods and compositions for sequence manipulation with functional domains |
| US8895308B1 (en) | 2012-12-12 | 2014-11-25 | The Broad Institute Inc. | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
| US8865406B2 (en) | 2012-12-12 | 2014-10-21 | The Broad Institute Inc. | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
| US8795965B2 (en) | 2012-12-12 | 2014-08-05 | The Broad Institute, Inc. | CRISPR-Cas component systems, methods and compositions for sequence manipulation |
| US8889356B2 (en) | 2012-12-12 | 2014-11-18 | The Broad Institute Inc. | CRISPR-Cas nickase systems, methods and compositions for sequence manipulation in eukaryotes |
| US9840713B2 (en) | 2012-12-12 | 2017-12-12 | The Broad Institute Inc. | CRISPR-Cas component systems, methods and compositions for sequence manipulation |
| US9822372B2 (en) | 2012-12-12 | 2017-11-21 | The Broad Institute Inc. | CRISPR-Cas component systems, methods and compositions for sequence manipulation |
| US8697359B1 (en) | 2012-12-12 | 2014-04-15 | The Broad Institute, Inc. | CRISPR-Cas systems and methods for altering expression of gene products |
| US9023649B2 (en) | 2012-12-17 | 2015-05-05 | President And Fellows Of Harvard College | RNA-guided human genome engineering |
| US9260723B2 (en) | 2012-12-17 | 2016-02-16 | President And Fellows Of Harvard College | RNA-guided human genome engineering |
| US9834791B2 (en) | 2013-11-07 | 2017-12-05 | Editas Medicine, Inc. | CRISPR-related methods and compositions with governing gRNAS |
| WO2016073690A1 (en) | 2014-11-05 | 2016-05-12 | Illumina, Inc. | Transposase compositions for reduction of insertion bias |
| US9580701B2 (en) | 2015-01-28 | 2017-02-28 | Pioneer Hi-Bred International, Inc. | CRISPR hybrid DNA/RNA polynucleotides and methods of use |
| US9688972B2 (en) | 2015-01-28 | 2017-06-27 | Pioneer Hi-Bred International, Inc. | CRISPR hybrid DNA/RNA polynucleotides and methods of use |
| US9738687B2 (en) | 2015-04-10 | 2017-08-22 | Feldan Bio Inc. | Polypeptide-based shuttle agents for improving the transduction efficiency of polypeptide cargos to the cytosol of target eukaryotic cells, uses thereof, methods and kits relating to same |
| US9790490B2 (en) | 2015-06-18 | 2017-10-17 | The Broad Institute Inc. | CRISPR enzymes and systems |
| US9502126B1 (en) | 2015-09-10 | 2016-11-22 | SK Hynix Inc. | Memory system and operating method thereof |
| US9745562B2 (en) | 2015-10-23 | 2017-08-29 | Caribou Biosciences, Inc. | Methods of using engineered nucleic-acid targeting nucleic acids |
| US9816081B1 (en) | 2015-10-23 | 2017-11-14 | Caribou Biosciences, Inc. | Engineered nucleic-acid targeting nucleic acids |
| US9677090B2 (en) | 2015-10-23 | 2017-06-13 | Caribou Biosciences, Inc. | Engineered nucleic-acid targeting nucleic acids |
| WO2017100377A1 (en) * | 2015-12-07 | 2017-06-15 | Zymergen, Inc. | Microbial strain improvement by a htp genomic engineering platform |
| WO2017100376A2 (en) * | 2015-12-07 | 2017-06-15 | Zymergen, Inc. | Promoters from corynebacterium glutamicum |
| US20170159045A1 (en) * | 2015-12-07 | 2017-06-08 | Zymergen, Inc. | Microbial strain improvement by a htp genomic engineering platform |
| US9896696B2 (en) | 2016-02-15 | 2018-02-20 | Benson Hill Biosystems, Inc. | Compositions and methods for modifying genomes |
| WO2017189784A1 (en) * | 2016-04-27 | 2017-11-02 | Zymergen Inc. | Methods and systems for generating factory order forms to control production of nucleotide sequences |
Non-Patent Citations (136)
| Title |
|---|
| "Current Protocols in Molecular Biology", 1987, OXFORD MOLECULAR LTD, article "Some alignment programs are MacVector" |
| "Fundamental Methods Springer Lab Manual", 1995, SPRINGER-VERLAG, article "Plant Cell, Tissue and Organ Culture" |
| "GenBank", Database accession no. 001103835 |
| "GenBank", Database accession no. Q13177 |
| "Life Science Research Cell Culture Catalogue", SIGMA-ALDRICH, INC |
| "Manual of Methods for General Bacteriology", 1981, AMERICAN SOCIETY FOR BACTERIOLOGY |
| "NVidia Whitepaper", November 2015, article "GPU-Based Deep Learning Inference: A Performance and Power Analysis" |
| "PCR Methods Manual", 1999, ACADEMIC PRESS |
| "PCR Protocols: A Guide to Methods and Applications", 1990, ACADEMIC PRESS |
| "PCR Strategies", 1995, ACADEMIC PRESS |
| "Plant Gene Transfer and Expression Protocols", 1984, HUMANA PRESS |
| "Plant Molecular Biology", 1993, BIOS SCIENTIFIC PUBLISHERS |
| "The Handbook of Microbiological Media", 1993, CRC PRESS |
| "The Plant Culture Catalogue", SIGMA-ALDRICH, INC |
| ALPER HAL ET AL: "Characterization of lycopene-overproducing E. coli strains by combining systematic and combinatorial gene knockout targets", NATURE BIOTECHNOLOGY MAY 2005, vol. 72, no. 5, October 2006 (2006-10-01), pages 612 - 616, XP002783819, ISSN: 0175-7598 * |
| ALPER HAL ET AL: "Tuning genetic control through promoter engineering", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, NATIONAL ACADEMY OF SCIENCES, US, vol. 102, no. 36, 6 September 2005 (2005-09-06), pages 12678 - 12683, XP002428722, ISSN: 0027-8424, DOI: 10.1073/PNAS.0504604102 * |
| ASLANIDIS; DE JONG: "Ligation-independent cloning of PCR products (LIC-PCR", NUCLEIC ACIDS RESEARCH, vol. 18, no. 20, 1990, pages 6069 |
| AZHAYEV ET AL., TETRAHEDRON, vol. 57, 2001, pages 4977 - 4986 |
| BECKER; GUARENTE, METHODS IN ENZYMOLOGY, vol. 194, 1991, pages 182 - 187 |
| BENTLEY ET AL., NATURE, vol. 456, 2008, pages 53 - 59 |
| BERGER: "Guide to Molecular Cloning Techniques, Methods in Enzymology", vol. 152, ACADEMIC PRESS, INC. |
| BIOINFORMATICS, vol. 19, no. 17, 2003, pages 2246 - 2253 |
| BISHOP; HALL, BIOCHEM. J., vol. 348, 2000, pages 241 |
| BOLLAG ET AL.: "Protein Methods", 1996, WILEY-LISS |
| BULYK ET AL.: "Exploring the DNA-binding Specificities of Zinc Fingers with DNA Microarrays", PROC. NAT'L ACAD. SCI. U.S.A, vol. 98, no. 13, 2001, pages 7158 - 63, XP002174591, DOI: doi:10.1073/pnas.111163698 |
| BUTZ ET AL., BIOCHEMISTRY, vol. 50, no. 40, 2011, pages 8594 - 8602 |
| CHMIEL: "BioprozeBtechnik. 1: Einfiihrung in die Bioverfahrenstechnik", 1991, GUSTAV FISCHER VERLAG |
| CHRISTIE, P.J.; GORDON, J.E.: "The Agrobacterium Ti Plasmids", MICROBIOL SPECTR., vol. 2, no. 6, 2014, pages 10.1128 |
| COSTA ET AL., FRONT MICROBIOL., vol. 5, 2014, pages 63 |
| COSTANZO: "The Genetic Landscape of a Cell", SCIENCE, vol. 327, no. 5964, 22 January 2010 (2010-01-22), pages 425 - 431 |
| COX ET AL., MOL SYST BIOL., vol. 3, 2007, pages 145 |
| CRAMEN ET AL., NATURE BIOTECH., vol. 15, 1997, pages 436 - 438 |
| CRAMEN ET AL., NATURE, vol. 391, 1998, pages 288 - 291 |
| CRAMER P. ET AL.: "Functional association between promoter structure and transcript alternative splicing", PROC NATL ACAD SCI USA, vol. 94, no. 21, 14 October 1997 (1997-10-14), pages 11456 - 60 |
| CRAMERI ET AL., NATURE BIOTECHNOLOGY, vol. 14, 1996, pages 315 - 319 |
| CRAMERI ET AL., NATURE MEDICINE, vol. 2, no. 1, 1996, pages 1 - 3 |
| CZAR ET AL., TRENDS IN BIOTECHNOLOGY, vol. 27, 2009, pages 63 - 71 |
| DAHL ET AL.: "Multi-task Neural Networks for QSAR Predictions", June 2014, DEPT. OF COMPUTER SCIENCE, UNIV. OF TORONTO |
| DALPHIN ET AL., NUCL. ACIDS RES., vol. 24, 1996, pages 216 - 218 |
| DAMHA ET AL., NAR, vol. 18, 1990, pages 3813 - 3821 |
| DATSENKO; WANNER, PNAS USA, vol. 97, 2000, pages 6640 - 6645 |
| DAVIS, L.; DIBNER, M.; BATTEY, I., BASIC METHODS IN MOLECULAR BIOLOGY, 1986 |
| DE ALMEIDA ET AL., MOL. GEN. GENETICS, vol. 218, 1989, pages 78 - 86 |
| DOYLE; GRIFFITHS: "Mammalian Cell Culture: Essential Techniques", 1997, JOHN WILEY AND SONS |
| DRMANAC ET AL., SCIENCE, vol. 327, 2010, pages 78 - 81 |
| EID ET AL., SCIENCE, vol. 323, 2009, pages 133 - 138 |
| ENGLER, C.; R. KANDZIA; S. MARILLONNET: "A one pot, one step, precision cloning method with high-throughput capability", PLOS ONE, vol. 3, 2008, pages e3647 |
| ESPOSITO; CHATTERJEE, CURR OPIN BIOTECHNOL., vol. 17, no. 4, August 2006 (2006-08-01), pages 353 - 8 |
| FOTINI A TRIKKA ET AL: "Iterative carotenogenic screens identify combinations of yeast gene deletions that enhance sclareol production", MICROBIAL CELL FACTORIES,, vol. 14, no. 1, 24 April 2015 (2015-04-24), pages 60, XP021214826, ISSN: 1475-2859, DOI: 10.1186/S12934-015-0246-0 * |
| FOX ET AL.: "Improving catalytic function by ProSAR-driven enzyme evolution", NATURE BIOTECHNOLOGY, vol. 25, no. 3, 2007, pages 338 - 343, XP002566179, DOI: doi:10.1038/nbt1286 |
| FRESHNEY: "Culture of Animal Cells, a Manual of Basic Technique", 1994, WILEY-LISS |
| GARRARD ET AL., EMBO J., vol. 22, 2003, pages 1125 |
| GIBSON ET AL.: "Enzymatic assembly of DNA molecules up to several hundred kilobases", NATURE METHODS, vol. 6, 2009, pages 343 - 345, XP055224105, DOI: doi:10.1038/nmeth.1318 |
| GIETZ ET AL., NUCLEIC ACIDS RES., vol. 27, 1992, pages 69 - 74 |
| GREGER IH. ET AL.: "Balancing transcriptional interference and initiation on the GAL7 promoter of Saccharomyces cerevisiae", PROC NATL ACAD SCI USA, vol. 97, no. 15, 18 July 2000 (2000-07-18), pages 8415 - 20 |
| GREISMAN H A; PABO C O: "A General Strategy for Selecting High-Affinity Zinc Finger Proteins for Diverse DNA Target Sites", SCIENCE, vol. 275, 1997, pages 657 - 661, XP002167950, DOI: doi:10.1126/science.275.5300.657 |
| GUEGUEN ERWAN ET AL: "Promoter swapping unveils the role of the Citrobacter rodentium CTS1 type VI secretion system in interbacterial competition.", APPLIED AND ENVIRONMENTAL MICROBIOLOGY JAN 2013, vol. 79, no. 1, January 2013 (2013-01-01), pages 32 - 38, XP002786203, ISSN: 1098-5336 * |
| HARRIS; ANGAL: "Protein Purification Applications: A Practical Approach", 1990, IRL PRESS AT OXFORD |
| HARRIS; ANGAL: "Protein Purification Methods: A Practical Approach", IRL PRESS AT OXFORD |
| HONG ET AL., APPL. MICROBIOL. BIOTECHNOL., vol. 73, 2007, pages 1331 |
| HUMASON: "Animal Tissue Techniques", 1979, W.H. FREEMAN AND COMPANY |
| HURT ET AL.: "Highly Specific Zinc Finger Proteins Obtained by Directed Domain Shuffling and Cell-based Selection", PROC. NAT'L ACAD. SCI. U.S.A., vol. 100, no. 21, 2003, pages 12271 - 6, XP055143168, DOI: doi:10.1073/pnas.2135381100 |
| ITO ET AL., J. BACTEROL., vol. 153, 1983, pages 163 - 168 |
| JANSON; RYDEN: "Protein Purification: Principles, High Resolution Methods and Applications", 1998, WILEY-VCH |
| JONES ET AL., EMBO J., vol. 4, 1985, pages 2411 - 2418 |
| KADONAGA, JT.: "Regulation of RNA polymerase II transcription by sequence-specific DNA binding factors", CELL, vol. 116, no. 2, 23 January 2004 (2004-01-23), pages 247 - 57 |
| KASHYAP ET AL.: "Big Data Analytics in Bioinformatics: A Machine Learning Perspective", JOURNAL OF LATEX CLASS FILES, vol. 13, no. 9, September 2014 (2014-09-01) |
| KEILER K C; SAUER R T: "Sequence determinants of C-terminal substrate recognition by the Tsp protease", J BIOL CHEM., vol. 271, 1996, pages 2589 - 2593 |
| KIM ET AL., SCIENCE, vol. 316, 2007, pages 1481 - 1414 |
| KINACADE; DEHASETH, GENE, vol. 97, no. 1, 2 January 1991 (1991-01-02), pages 7 - 12 |
| KINCADE J M ET AL: "Bacteriophage lambda promoters pL and pR sequence determinants of in vivo activity and of sensitivity to the DNA gyrase inhibitor, coumermycin", GENE, ELSEVIER, AMSTERDAM, NL, vol. 97, no. 1, 1 January 1991 (1991-01-01), pages 7 - 12, XP023545045, ISSN: 0378-1119, [retrieved on 19910101], DOI: 10.1016/0378-1119(91)90003-T * |
| KOTERA, I.; T. NAGAI.: "A high-throughput and single-tube recombination of crude PCR products using a DNA polymerase inhibitor and type IIS restriction enzyme", J BIOTECHNOL, vol. 137, 2008, pages 1 - 7, XP025471499, DOI: doi:10.1016/j.jbiotec.2008.07.1816 |
| KOZLOV ET AL., NUCLEOSIDES, NUCLEOTIDES, AND NUCLEIC ACIDS, vol. 24, no. 5-7, 2005, pages 1037 - 1041 |
| LEE ET AL.: "Improved Production of L-Threonine in Escherichia coli by Use of a DNA Scaffold System", APP. AND ENVIRON. MICROBIOL., vol. 79, no. 3, 2013, pages 774 - 782 |
| LEE MICHAEL E ET AL: "A Highly Characterized Yeast Toolkit for Modular, Multipart Assembly.", ACS SYNTHETIC BIOLOGY 18 SEP 2015, vol. 4, no. 9, 18 September 2015 (2015-09-18), pages 975 - 986, XP002786200, ISSN: 2161-5063 * |
| LEE S Y ET AL: "Systems biotechnology for strain improvement", TRENDS IN BIOTECHNOLOGY, ELSEVIER PUBLICATIONS, CAMBRIDGE, GB, vol. 23, no. 7, 1 July 2005 (2005-07-01), pages 349 - 358, XP027778087, ISSN: 0167-7799, [retrieved on 20050701] * |
| LENG ET AL.: "Bioinformatics", vol. 22, 2006, OXFORD UNIVERSITY PRESS, article "Classification using functional data analysis for temporal gene expression data", pages: 68 - 76 |
| LEWIS ET AL., MOL SYST BIOL., vol. 6, 2010, pages 390 |
| LIBBRECHT ET AL.: "Machine learning applications in genetics and genomics", NATURE REVIEWS: GENETICS, vol. 16, June 2015 (2015-06-01) |
| MAEDER ET AL.: "Rapid ''Open-Source'' Engineering of Customized Zinc-Finger Nucleases for Highly Efficient Gene Modification", MOL. CELL, vol. 31, 2008, pages 294 - 301, XP055143755, DOI: doi:10.1016/j.molcel.2008.06.016 |
| MAMIE Z LI ET AL: "MAGIC, an in vivo genetic method for the rapid construction of recombinant DNA molecules", NATURE GENETICS., vol. 37, no. 3, 30 January 2005 (2005-01-30), NEW YORK, US, pages 311 - 319, XP055410043, ISSN: 1061-4036, DOI: 10.1038/ng1505 * |
| MARGULIES ET AL., NATURE, vol. 437, 2005, pages 376 - 380 |
| MASATO IKEDA ET AL: "A genome-based approach to create a minimally mutated Corynebacterium glutamicum strain for efficient l-lysine production", JOURNAL OF INDUSTRIAL MICROBIOLOGY & BIOTECHNOLOGY ; OFFICIAL JOURNAL OF THE SOCIETY FOR INDUSTRIAL MICROBIOLOGY, SPRINGER, BERLIN, DE, vol. 33, no. 7, 28 February 2006 (2006-02-28), pages 610 - 615, XP019388133, ISSN: 1476-5535, DOI: 10.1007/S10295-006-0104-5 * |
| MCGINNESS ET AL.: "Engineering Controllable Protein Degradation", MOL. CELL, vol. 22, no. 5, June 2006 (2006-06-01), XP055434804, DOI: doi:10.1016/j.molcel.2006.04.027 |
| MIYAZAKI, K., BIOTECHNIQUES, vol. 58, no. 2, 1 February 2015 (2015-02-01), pages 86 - 8 |
| MOORE ET AL., J. MOL. BIOL., vol. 272, 1997, pages 336 - 347 |
| MURRAY ET AL., NUCL. ACIDS RES., vol. 17, 1989, pages 477 - 508 |
| MUTALIK ET AL., NAT METHODS, vol. 10, no. 4, April 2013 (2013-04-01), pages 354 - 60 |
| MUTALIK ET AL., NAT METHODS, vol. lO, no. 4, April 2013 (2013-04-01), pages 354 - 60 |
| MUTALIK ET AL.: "Precise and reliable gene expression via standard transcription and translation initiation elements", NAT. BIOTECHNOL., vol. 10, no. 4, 2013, pages 354 - 368 |
| NAKASHIMA ET AL.: "Bacterial Cellular Engineering by Genome Editing and Gene Silencing", INT. J. MOL. SCI., vol. 15, no. 2, 2014, pages 2773 - 2793, XP055376889, DOI: doi:10.3390/ijms15022773 |
| OHNISHI J ET AL: "A novel methodology employing Corynebacterium glutamicum genome information to generate a new L-lysine-producing mutant", APPLIED MICROBIOLOGY AND BIOTECHNOLOGY, SPRINGER, DE, vol. 58, no. 2, 1 February 2002 (2002-02-01), pages 217 - 223, XP002289984, ISSN: 0175-7598, DOI: 10.1007/S00253-001-0883-6 * |
| OROSZ ET AL., EUR J BIOCHEM., vol. 201, no. 3, 1 November 1991 (1991-11-01), pages 653 - 9 |
| PARRY ET AL., BIOCHEM. J., vol. 353, 2001, pages 117 |
| PAYNE ET AL.: "Plant Cell and Tissue Culture in Liquid Systems", 1992, JOHN WILEY & SONS, INC. |
| PENGFEI GU ET AL: "One-step of tryptophan attenuator inactivation and promoter swapping to improve the production of L-tryptophan in Escherichia coli", MICROBIAL CELL FACTORIES,, vol. 11, no. 1, 2 March 2012 (2012-03-02), pages 30, XP021118480, ISSN: 1475-2859, DOI: 10.1186/1475-2859-11-30 * |
| PFEIFER-SANCAR ET AL., BMC GENOMICS, vol. 14, 2013, pages 888 |
| PFEIFER-SANCAR ET AL., COMPREHENSIVE ANALYSIS OF THE CORYNEBACTERIUM GLUTAMICUM TRANSCRIPTOME USING AN IMPROVED RNASEQ TECHNIQUE, 2013 |
| PROMPRAMOTE ET AL.: "Bioinformatics Technologies", 2005, SPRINGER, article "Machine Learning in Bioinformatics", pages: 117 - 153 |
| PYZOCHA ET AL., ACS CHEMICAL BIOLOGY, vol. 13, no. 2, pages 347 - 356 |
| RAINER KNAUS ET AL: "PL of coliphage lambda: an alternative solution for an efficient promoter", THE EMBO JOURNAL,, vol. 7, no. 9, 25 August 1988 (1988-08-25), pages 2919 - 2923, XP001317078 * |
| REBAR E J; PABO C O: "Zinc Finger Phage: Affinity Selection of Fingers with New DNA-Binding Specificities", SCIENCE, vol. 263, 1994, pages 671 - 673, XP002514655, DOI: doi:10.1126/science.8303274 |
| REYRAT ET AL.: "Counterselectable Markers: Untapped Tools for Bacterial Genetics and Pathogenesis", INFECT IMMUN., vol. 66, no. 9, 1998, pages 4011 - 4017, XP002364446 |
| RICCIARDELLE ET AL., IN VITRO CELL DEV. BIOL., vol. 25, 1989, pages 1016 - 1024 |
| RICE CHRISTOPHER D ET AL: "Employment of a promoter-swapping technique shows that PhoU modulates the activity of the PstSCAB2 ABC transporter in Escherichia coli.", APPLIED AND ENVIRONMENTAL MICROBIOLOGY FEB 2009, vol. 75, no. 3, February 2009 (2009-02-01), pages 573 - 582, XP002786202, ISSN: 1098-5336 * |
| SALIS, H.M. ET AL.: "Automated design of synthetic ribosome binding sites to control protein expression", NAT. BIOTECHNOL., vol. 27, 2009, pages 946 - 950, XP055062298, DOI: doi:10.1038/nbt.1568 |
| SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 2001, COLD SPRING HARBOR LABORATORY PRESS |
| SANDANA: "Bioseparation of Proteins", 1997, ACADEMIC PRESS, INC. |
| SANDER ET AL.: "Selection-Free Zinc-Finger-Nuclease Engineering by Context-Dependent Assembly (CoDA", NAT. METHODS, vol. 8, 2011, pages 67 - 69 |
| SCOPES: "Protein Purification: Principles and Practice", 1993, SPRINGER VERLAG |
| SE-HWAN PAEK ET AL., DEVELOPMENT OF RAPID ONE-STEP IMMUNOCHROMATOGRAPHIC ASSAY, METHODS, vol. 22, 2000, pages 53 - 60 |
| SEKAR K; GENTILE AM; BOSTICK JW; TYO KEJ: "N-Terminal-Based Targeted, Inducible Protein Degradation in Escherichia coli", PLOS ONE, vol. 11, no. 2, 2016, pages e0149746 |
| SHARAN ET AL.: "Recombineering: A Homologous Recombination-Based Method of Genetic Engineering", NATURE PROTOCOLS, vol. 4, no. 2, 2009, pages 206 - 223, XP001525689, DOI: doi:10.1038/nprot.2008.227 |
| SIERZCHALA ET AL., J. AM. CHEM. SOC., vol. 125, 2003, pages 13427 - 13441 |
| SNITKIN EVAN S ET AL: "Epistatic interaction maps relative to multiple metabolic phenotypes.", PLOS GENETICS 10 FEB 2011, vol. 7, no. 2, E1001294, 10 February 2011 (2011-02-10), pages 1 - 15, XP002786201, ISSN: 1553-7404 * |
| STEMMER ET AL., GENE, vol. l64, 1995, pages 49 - 53 |
| STEMMER, BIO/TECHNOLOGY, vol. 13, 1995, pages 549 - 553 |
| STEMMER, NATURE, vol. 370, 1994, pages 389 - 391 |
| STEMMER, PNAS, vol. 91, 1994, pages 10747 - 10751 |
| STEMMER, PROC. NATL. ACAD. SCI. U.S.A., vol. 91, 1994, pages 10747 - 10751 |
| STEMMER, SCIENCE, vol. 270, 1995, pages 1510 |
| STORHAS: "Bioreaktoren and periphere Einrichtungen", 1994, VIEWEG VERLAG |
| SU ET AL., PROC. NATL. ACAD. SCI. (U.S.A., vol. 83, 1986, pages 5057 - 5061 |
| TEAR ET AL.: "Excision of Unstable Artificial Gene-Specific inverted Repeats Mediates Scar-Free Gene Deletions in Escherichia coli", APPL. BIOCHEM. BIOTECH., vol. 175, 2014, pages 1858 - 1867, XP035446907, DOI: doi:10.1007/s12010-014-1402-4 |
| THOMASON ET AL.: "Recombineering: Genetic Engineering in Bacteria Using Homologous Recombination", CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, vol. 106, pages 1.16.1 - 1.16.39 |
| TIAN ET AL., MOL. BIOSYST., vol. 5, 2009, pages 714 - 722 |
| WAGNER ET AL., NUCLEIC ACIDS RES., vol. 23, no. 19, 1995, pages 3944 - 3948 |
| WALKER: "Protein Protocols on CD-ROM", 1998, HUMANA PRESS |
| WALKER: "The Protein Protocols Handbook", 1996, HUMANA PRESS |
| WANG HARRIS H ET AL: "Programming cells by multiplex genome engineering and accelerated evolution.", NATURE 13 AUG 2009, vol. 460, no. 7257, 13 August 2009 (2009-08-13), pages 894 - 898, XP055111854, ISSN: 1476-4687 * |
| WEBER, E.; R. GRUETZNER; S. WERNER; C. ENGLER; S. MARILLONNET: "Assembly of Designer TAL Effectors by Golden Gate Cloning", PLOS ONE, vol. 6, 2011, pages el 9722 |
| WEST, S ET AL.: "Molecular dissection of mammalian RNA polymerase II transcriptional termination", MOL CELL, vol. 29, no. 5, 14 March 2008 (2008-03-14), pages 600 - 10, XP002540638, DOI: doi:10.1016/j.molcel.2007.12.019 |
| WEST, S.; PROUDFOOT, N.J.: "Transcriptional Termination Enhances Protein Expression in Human Cells", MOL CELL, vol. 33, no. 3-9, 13 February 2009 (2009-02-13), pages 354 - 364, XP002540647, DOI: doi:10.1016/j.molcel.2009.01.008 |
| WILLIAM R MCCLEARY: "Application of promoter swapping techniques to control expression of chromosomal genes", APPLIED MICROBIOLOGY AND BIOTECHNOLOGY, SPRINGER, BERLIN, DE, vol. 84, no. 4, 25 July 2009 (2009-07-25), pages 641 - 648, XP019737788, ISSN: 1432-0614, DOI: 10.1007/S00253-009-2137-Y * |
| ZHANG ET AL., PNAS, vol. 94, 1997, pages 4504 - 4509 |
| ZHANG Y-X ET AL: "Genome shuffling leads to rapid phenotypic improvement in bacteria", NATURE, MACMILLAN JOURNALS LTD, LONDON, GB, vol. 415, no. 6872, 1 January 2002 (2002-01-01), pages 644 - 646, XP002228258, ISSN: 0028-0836, DOI: 10.1038/415644A * |
Cited By (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11066663B2 (en) | 2018-10-31 | 2021-07-20 | Zymergen Inc. | Multiplexed deterministic assembly of DNA libraries |
| WO2020185590A1 (en) * | 2019-03-08 | 2020-09-17 | Zymergen Inc. | Iterative genome editing in microbes |
| US11053506B2 (en) | 2019-03-08 | 2021-07-06 | Zymergen Inc. | Iterative genome editing in microbes |
| US11053515B2 (en) | 2019-03-08 | 2021-07-06 | Zymergen Inc. | Pooled genome editing in microbes |
| CN113728106A (zh) * | 2019-03-08 | 2021-11-30 | 齐默尔根公司 | 微生物中的迭代基因组编辑 |
| US11279940B2 (en) | 2019-03-08 | 2022-03-22 | Zymergen Inc. | Iterative genome editing in microbes |
| CN114008202A (zh) * | 2019-06-21 | 2022-02-01 | 格礼卡姆股份公司 | 用于体外和体内基因表达的包含5’utr茎环的核酸构建体 |
| WO2021152301A1 (en) * | 2020-01-29 | 2021-08-05 | Imperial College Innovations Ltd | Gene switches and circuits for use in mycoplasma species |
| CN111700075A (zh) * | 2020-06-05 | 2020-09-25 | 茂名市瑜丰沉香创意产业有限公司 | 人工结香沉香、沉香精油富集液、沉香香皂及其生产方法 |
| CN117238380A (zh) * | 2023-11-15 | 2023-12-15 | 中国医学科学院北京协和医院 | 宏基因组病原识别的ai推荐方法、装置、设备及介质 |
Also Published As
| Publication number | Publication date |
|---|---|
| CA3064612A1 (en) | 2018-12-13 |
| CN110945125A (zh) | 2020-03-31 |
| ES2875579T3 (es) | 2021-11-10 |
| JP2020524490A (ja) | 2020-08-20 |
| EP3485013B1 (en) | 2021-03-24 |
| EP3485013A1 (en) | 2019-05-22 |
| US20200370058A1 (en) | 2020-11-26 |
| EP3878961A1 (en) | 2021-09-15 |
| KR20200026874A (ko) | 2020-03-11 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP3485013B1 (en) | A htp genomic engineering platform for improving escherichia coli | |
| US11352621B2 (en) | HTP genomic engineering platform | |
| CA3007840C (en) | Microbial strain improvement by a htp genomic engineering platform | |
| US11208649B2 (en) | HTP genomic engineering platform | |
| US20200102554A1 (en) | High throughput transposon mutagenesis |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18734715 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2018734715 Country of ref document: EP Effective date: 20190212 |
|
| ENP | Entry into the national phase |
Ref document number: 3064612 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2019567283 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 20207000237 Country of ref document: KR Kind code of ref document: A |