WO2018191666A1 - Treatment of mucopolysaccharidosis ii with recombinant human iduronate-2 sulfatase (ids) produced by human neural or glial cells - Google Patents

Treatment of mucopolysaccharidosis ii with recombinant human iduronate-2 sulfatase (ids) produced by human neural or glial cells Download PDF

Info

Publication number
WO2018191666A1
WO2018191666A1 PCT/US2018/027568 US2018027568W WO2018191666A1 WO 2018191666 A1 WO2018191666 A1 WO 2018191666A1 US 2018027568 W US2018027568 W US 2018027568W WO 2018191666 A1 WO2018191666 A1 WO 2018191666A1
Authority
WO
WIPO (PCT)
Prior art keywords
human
kda
ids
recombinant
glycosylated
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2018/027568
Other languages
English (en)
French (fr)
Inventor
Stephen YOO
Rickey Robert REINHARDT
Curran Matthew Simpson
Zhuchun WU
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Regenxbio Inc
Original Assignee
Regenxbio Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to AU2018253303A priority Critical patent/AU2018253303B2/en
Priority to IL269892A priority patent/IL269892B2/en
Priority to US16/604,427 priority patent/US11613739B2/en
Priority to EP18783760.4A priority patent/EP3609526A4/en
Priority to JP2019555865A priority patent/JP2020516291A/ja
Priority to IL307936A priority patent/IL307936A/en
Priority to BR112019021569-7A priority patent/BR112019021569A2/pt
Priority to CA3059441A priority patent/CA3059441A1/en
Priority to KR1020197033526A priority patent/KR20190139951A/ko
Application filed by Regenxbio Inc filed Critical Regenxbio Inc
Priority to KR1020247017405A priority patent/KR20240093919A/ko
Priority to SG11201909361S priority patent/SG11201909361SA/en
Publication of WO2018191666A1 publication Critical patent/WO2018191666A1/en
Anticipated expiration legal-status Critical
Priority to JP2022209169A priority patent/JP2023052096A/ja
Priority to US18/659,404 priority patent/US20250051740A1/en
Priority to AU2025200141A priority patent/AU2025200141A1/en
Priority to JP2025019080A priority patent/JP2025087702A/ja
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/66Microorganisms or materials therefrom
    • A61K35/76Viruses; Subviral particles; Bacteriophages
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/26Carbohydrates, e.g. sugar alcohols, amino sugars, nucleic acids, mono-, di- or oligo-saccharides; Derivatives thereof, e.g. polysorbates, sorbitan fatty acid esters or glycyrrhizin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • A61K48/005Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0019Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0043Nose
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0085Brain, e.g. brain implants; Spinal cord
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/52Genes encoding for enzymes or proenzymes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/16Hydrolases (3) acting on ester bonds (3.1)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y301/00Hydrolases acting on ester bonds (3.1)
    • C12Y301/06Sulfuric ester hydrolases (3.1.6)
    • C12Y301/06013Iduronate-2-sulfatase (3.1.6.13)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • A61K48/0075Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the delivery route, e.g. oral, subcutaneous
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011Details
    • C12N2750/14011Parvoviridae
    • C12N2750/14111Dependovirus, e.g. adenoassociated viruses
    • C12N2750/14121Viruses as such, e.g. new isolates, mutants or their genomic sequences
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011Details
    • C12N2750/14011Parvoviridae
    • C12N2750/14111Dependovirus, e.g. adenoassociated viruses
    • C12N2750/14132Use of virus as therapeutic agent, other than vaccine, e.g. as cytolytic agent
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011Details
    • C12N2750/14011Parvoviridae
    • C12N2750/14111Dependovirus, e.g. adenoassociated viruses
    • C12N2750/14141Use of virus, viral particle or viral elements as a vector
    • C12N2750/14143Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector

Definitions

  • CSF cerebrospinal fluid
  • CNS central nervous system
  • MPS II mucopolysaccharidosis II
  • Hunter syndrome/MPS II is a rare X-linked recessive genetic disease occurring in 0.5 to 1.3 per 100,000 male live births. This progressive and devastating disease is caused by genetic mutation in the IDS gene leading to deficiency of the lysosomal storage enzyme iduronate-2-sulfatase, an enzyme required for the lysosomal catabolism of heparan sulfate and dermatan sulfate.
  • GAGs glycosaminoglycans
  • Enzyme replacement therapy with recombinant idursulfase produced by HT1080 (fibrosarcoma) cells (Elaprase®, Shire Human Genetic Therapies) is the only approved product for the treatment of Hunter syndrome and is administered as a weekly infusion.
  • ERT as currently administered does not cross the blood brain barrier and is therefore unable to address the unmet need in patients with severe disease, i.e., MPS II with CNS/neurocognitive and behavioral involvement.
  • idursulfase (Elaprase) formulated for intrathecal administration was administered once monthly to pediatric patients using an intrathecal drug delivery device implanted into the spine (insertion of the catheter at the level of L4/L5 with implantation of the access port via an incision on the lower ribs).
  • the patients also received concurrent i.v. idursulfase once weekly. See Muenzer et al., 2016, Genetics in Med 18: 73-81, esp. p.
  • the invention involves the delivery of recombinant human iduronate-2-sulfatase (rhIDS) produced by human neuronal or glial cells to the cerebrospinal fluid (CSF) of the central nervous system (CNS) of a human subject diagnosed with mucopolysaccharidosis II (MPS II), including, but not limited to patients diagnosed with Hunter syndrome.
  • rhIDS human iduronate-2-sulfatase
  • the treatment is accomplished via gene therapy - e.g., by administering a viral vector or other DNA expression construct encoding human IDS (hIDS), or a derivative of hIDS, to the CSF of a patient (human subject) diagnosed with MPS II, so that a permanent depot of transduced neuronal and/or glial cells is generated that continuously supplies the transgene product to the CNS.
  • hIDS human IDS
  • the rhIDS secreted from the neuronal/glial cell depot into the CSF will be endocytosed by cells in the CNS, resulting in "cross-correction" of the enzymatic defect in the recipient cells.
  • the depot of transduced neural and glial cells in the CNS can deliver the recombinant enzyme to both the CNS and systemically, which may reduce or eliminate the need for systemic treatment, e.g., weekly i.v. injections of the enzyme.
  • the hIDS can be produced by human neuronal or glial cells in cell culture (e.g., bioreactors) and administered as an enzyme replacement therapy ("ERT"), e.g., by injecting the enzyme - into the CSF, directly into the CNS, and/or
  • ERT enzyme replacement therapy
  • the gene therapy approach offers several advantages over ERT since systemic delivery of the enzyme will not result in treating the CNS because the enzyme cannot cross the blood brain barrier; and, unlike the gene therapy approach of the invention, direct delivery of the enzyme to the CSF and/or CNS would require repeat injections which are not only burdensome, but pose a risk of infection.
  • the hIDS encoded by the transgene can include, but is not limited to human IDS (hIDS) having the amino acid sequence of SEQ ID NO. 1 (as shown in FIG. 1), and derivatives of hIDS having amino acid substitutions, deletions, or additions, e.g., including but not limited to amino acid substitutions selected from corresponding non-conserved residues in orthologs of IDS shown in FIG.
  • amino acid substitutions at a particular position of hIDS can be selected from among corresponding non-conserved amino acid residues found at that position in the IDS orthologs aligned in FIG. 2, with the proviso that such substitutions do not include any of the deleterious mutations shown in FIG. 3 or as reported by Sukegawa-Hayasaka et al., 2006, supra; Millat et al., 1998, supra; or Bonucelli et al., 2001, supra, each of which is incorporated by reference herein in its entirety.
  • the resulting transgene product can be tested using conventional assays in vitro, in cell culture or test animals to ensure that the mutation does not disrupt IDS function.
  • Preferred amino acid substitutions, deletions or additions selected should be those that maintain or increase enzyme activity, stability or half-life of IDS, as tested by conventional assays in vitro, in cell culture or animal models for MPS II.
  • the enzyme activity of the transgene product can be assessed using a conventional enzyme assay with, for example, 4- Methylumbelliferyl a-L-idopyranosiduronic acid 2-sulfate or 4-methylumbelliferyl sulfate as the substrate (see, e.g., Lee et al., 2015, Clin. Biochem. 48(18): 1350-1353, Dean et al., 2006, Clin. Chem.
  • the ability of the transgene product to correct MPS II phenotype can be assessed in cell culture; e.g., by transducing MPS II cells in culture with a viral vector or other DNA expression construct encoding hIDS or a derivative; by adding the transgene product or a derivative to MPS II cells in culture; or by co-culturing MPS II cells with human neuronal/glial host cells engineered to express and secrete rhIDS or a derivative, and determining correction of the defect in the MPS II cultured cells, e.g., by detecting IDS enzyme activity and/or reduction in GAG storage in the MPS II cells in culture (see, e.g., Stroncek et al., 1999, Transfusion 39(4):343-350, which is incorporated by reference herein in its entirety).
  • This IDS-knockout mouse exhibits many of the characteristics of MPS II, including skeletal abnormalities, hepatosplenomegaly, elevated urinary and tissue GAG, and brain storage lesions (Muenzer et al., 2001, Acta Paediatr Suppl 91 :98-99) and was used to assess the effect of enzyme replacement therapy in MPS II in support of clinical trials for ERT.
  • This mouse model therefore, is a relevant model for studying the effects of gene therapy delivering rIDS produced by neuronal or glial cells as a treatment for MPS II (see, e.g., Polito and Cosma, 2009, Am. J. Hum. Genet. 85(2):296-301, which is incorporated by reference herein in its entirety).
  • the hIDS transgene produced by the human neuronal/glial cells should be controlled by expression control elements that function in neurons and/or glial cells, e.g., the CB7 promoter (a chicken ⁇ -actin promoter and CMV enhancer), and can include other expression control elements that enhance expression of the transgene driven by the vector ⁇ e.g., chicken ⁇ -actin intron and rabbit ⁇ -globin poly A signal).
  • the cDNA construct for the hIDS transgene should include a coding sequence for a signal peptide that ensures proper co- and post- translational processing (glycosylation and protein sulfation) by the transduced CNS cells.
  • signal peptides used by CNS cells may include but are not limited to:
  • Oligodendrocyte-myelin glycoprotein (hOMG) signal peptide hOMG
  • V-set and transmembrane domain containing 2B (hVSTM2B) signal peptide • V-set and transmembrane domain containing 2B (hVSTM2B) signal peptide:
  • MAMVSAMSWVLYLWISACA (SEQ ID NO: 6)
  • Signal peptides may also be referred to herein as leader sequences or leader peptides.
  • the recombinant vector used for delivering the transgene should have a tropism for cells in the CNS, including but limited to neurons and/or glial cells.
  • Such vectors can include non-replicating recombinant adeno-associated virus vectors ("rAAV"), particularly those bearing an AAV9 or AAVrhlO capsid are preferred.
  • rAAV non-replicating recombinant adeno-associated virus vectors
  • AAV variant capsids can be used, including but not limited to those described by Wilson in US Patent No. 7,906, 111 which is incorporated by reference herein in its entirety, with AAV/hu.31 and AAV/hu.32 being particularly preferred; as well as AAV variant capsids described by Chatterjee in US Patent No. 8,628,966, US Patent No.
  • viral vectors including but not limited to lentiviral vectors, vaccinia viral vectors, or non-viral expression vectors referred to as "naked DNA" constructs.
  • Construct 1 can be used for delivering the transgene.
  • Construct 1 is a recombinant adeno-associated virus serotype 9 capsid containing human iduronate-2- sulfatase expression cassette wherein expression is driven by a hybrid of the cytomegalovirus (CMV) enhancer and the chicken beta actin promoter (CB7), wherein the IDS expression cassette is flanked by inverted terminal repeats (ITRs) and the transgene includes the chicken beta actin intron and a rabbit beta-globin polyadenylation (poly A) signal.
  • CMV cytomegalovirus
  • CB7 chicken beta actin promoter
  • IDS expression cassette is flanked by inverted terminal repeats (ITRs) and the transgene includes the chicken beta actin intron and a rabbit beta-globin polyadenylation (poly A) signal.
  • ITRs inverted terminal repeats
  • compositions suitable for administration to the CSF comprise a suspension of the rhIDS vector in a formulation buffer comprising a physiologically compatible aqueous buffer, a surfactant and optional excipients.
  • the pharmaceutical compositions are suitable for intrathecal administration.
  • the pharmaceutical compositions are suitable for intrathecal administration.
  • compositions are suitable for intraci sternal administration (injection into the cisterna magna). In certain embodiments, the pharmaceutical compositions are suitable for injection into the subarachnoid space via a CI -2 puncture. In certain embodiments, the pharmaceutical compositions are suitable for intracerebroventricular administration. In certain embodiments, the pharmaceutical compositions are suitable for administration via lumbar puncture.
  • Therapeutically effective doses of the recombinant vector should be administered to the CSF via intrathecal administration (i.e., injection into the subarachnoid space so that the recombinant vectors distribute through the CSF and transduce cells in the CNS). This can be accomplished in a number of ways - e.g., by intracranial (cisternal or ventricular) injection , or injection into the lumbar cistern.
  • intraci sternal (IC) injection into the cisterna magna
  • IC intraci sternal
  • injection into the subarachnoid space can be performed via a CI -2 puncture when feasible for the patient; or lumbar puncture (typically diagnostic procedures performed in order to collect a sample of CSF) can be used to access the CSF.
  • intracerebroventricular (ICV) administration a more invasive technique used for the introduction of antiinfective or anticancer drugs that do not penetrate the blood-brain barrier
  • intranasal administration may be used to deliver the recombinant vector to the CNS.
  • CSF concentrations can be monitored by directly measuring the concentration of rhIDS in the CSF fluid obtained from occipital or lumbar punctures, or estimated by
  • human IDS is translated as a 550 amino acid polypeptide that contains eight potential N-glycosylation sites (N 31 , N 115 , N 144 , N 246 , N 280 , N 325 , N 513 and N 537 ) depicted in FIG. l and includes a 25 amino acid signal sequence which is cleaved during processing.
  • An initial 76 kDa intracellular precursor is converted into a phosphorylated 90 kDa precursor after modification of its oligosaccharide chains in the Golgi apparatus. This precursor is processed by glycosylation modifications and proteolytic cleavage through various
  • proteolytic processing involves N-terminal proteolytic cleavage downstream of N 31 removing a propeptide of eight amino acids (residues 26-33), and C-terminal proteolytic cleavage upstream of N 513 which releases an 18 kDa polypeptide and produces a 62 kDa intermediate that is converted to a 55 kDa mature form. Further proteolytic cleavage yields a 45 kDa mature form located in the lysosomal compartment. ⁇ See FIG.
  • a formylglycine modification of C 84 (shown in bold in FIG. 1) required for enzyme activity probably occurs as an early post-translational or co-translational event, most probably in the endoplasmic reticulum. ⁇ See, Millat 1997a, citing Schmidt et al., 1995, Cell 82: 271-278). Post-translational processing continues in the Golgi to include addition of complex sialic acid- containing glycans and acquisition of mannose-6-phosphate residues which tag the enzyme for delivery to the lysosomal compartment. ⁇ See, Clarke, 2008, Expert Opin Pharmacother 9: 311- 317 for a concise review which is incorporated by reference herein in its entirety).
  • glycosylation at position N 280 is important for cellular internalization and lysosomal targeting via the mannose-6-phosphate (M6P) receptor.
  • M6P mannose-6-phosphate
  • the invention is based, in part, on the following principles:
  • Neuronal and glial cells in the CNS are secretory cells that possess the cellular machinery for post-translational processing of secreted proteins - including glycosylation, mannose-6-phosphorylation, and tyrosine-O-sulfation - robust processes in the CNS.
  • secreted proteins including glycosylation, mannose-6-phosphorylation, and tyrosine-O-sulfation - robust processes in the CNS.
  • the human brain produces multiple isoforms of natural/native IDS.
  • N-terminal sequencing of human brain mannose-6-phosphorylated glycoproteins revealed that the N-terminal sequence of the mature 42 kDa chain of hIDS varies in the brain, starting at positions 34 or 36 as follows: T 34 DALNVLLI; and A 36 LNVLLIIV.
  • T 34 DALNVLLI and A 36 LNVLLIIV.
  • Two of the eight N-linked glycosylation sites, namely N 280 and N 116 were found to be mannose-6-phophorylated in IDS obtained from human brain.
  • recombinant IDS produced by neuronal and glial cells may be endocytosed by recipient CNS cells more avidly than recombinant IDS produced by other cells such as kidney.
  • Daniele 2002 Biochimica et Biophysica Acta 1588(3):203-9) demonstrated M6P-receptor mediated endocytosis of recombinant IDS from conditioned media of transduced neuronal and glial cell cultures by a recipient population of non-transduced neuronal and glial cells which properly processed the precursor to the 45 kDa mature active form.
  • Uptake of the recombinant IDS produced by the neuronal and glial cell lines (74% endocytosis) far exceeded uptake of the enzyme produced by a kidney cell line (5.6%
  • the gene therapy approach described herein should result in the continuous secretion of an hIDS glycoprotein precursor of about 90 kDa as measured by polyacrylamide gel electrophoresis (depending on the assay used) that is enzymatically active.
  • the enzyme responsible for the formylglycine modification of C 84 which is required for IDS activity—the FGly-Generating Enzyme (FGE, aka SUMF1)— is expressed in the cerebral cortex of the human brain (gene expression data for SUMF1 may be found, for example, at GeneCards, accessible at http://www.genecards.org).
  • FGE FGly-Generating Enzyme
  • glycosylated/phosphorylated rIDS produced by transduced neurons and glial cells in situ should be taken up and correctly processed by untransduced neural and glial cells in the CNS.
  • secreted rhIDS precursor produced in situ by gene therapy may be more avidly endocytosed by recipient cells in the CNS than would traditional recombinant enzymes used for ERT if administered to the CNS.
  • Elaprase ® (made in HT1080, a fibrosarcoma cell line) is a purified protein reported to have a molecular weight of about 76 kDa - not the 90 kDa species secreted by neuronal and glial cells that appears to be more heavily phosphorylated. While the eight N-linked glycosylation sites are reported to be fully occupied in Elaprase ® and contain two bis-mannose-6- phosphate terminated glycans as well as complex highly sialylated glycans, the post-translational modification of C 84 to FGly, which is an absolute requirement for enzyme activity, is only about 50%.
  • the extracellular IDS efficacy in vivo depends on uptake (cell and lysosome internalization) through M6P and its active site formylglycine (FGly), which is converted from C 84 through post-translational modification by formylglycine- generating enzyme.
  • uptake cell and lysosome internalization
  • FGly active site formylglycine
  • brain cells neuro and glial cells
  • the resultant five-fold increase in activity can likely be attributed to the efficient uptake of IDS (See Daniele 2002, Tables 2 and 4).
  • IDS which are generated by CHO cells or HT-1080 cells, have a FGly content of about about 50% to 70%, which determines the enzyme activity. However, neuronal and glial cells may improve upon this activity, due to improvement of IDS uptake.
  • IDS lysosomal proteins
  • M6P The cellular and subcellular trafficking/uptake of lysosomal proteins, including IDS, is through M6P.
  • IDS from brain cells may contain higher M6P content, as reported in Daniele 2002, and in Sleat, Proteomics, 2005 (indicating that the human brain contains more (in both a quantitative and qualitative sense) Man6-P glycoproteins than other tissues.). It is possible to measure the M6P content of an IDS precursor, as done in Daniele 2002.
  • the uptake of IDS precursor generated by non-neuronal or non-glial cells is predicted to decrease to levels close to that of the control cells, as was shown in Daniele 2002.
  • the uptake of IDS precursor generated by brain cells is predicted to remain at a high level, as was shown in Daniele 2002, where the uptake was four times higher than control cells and comparable to the level of IDS activity (or uptake) of IDS precursor generated by genetically engineered kidney cells without the presence of inhibitory M6P.
  • This assay allows for a way to predict the M6P content in IDS precursor generated by brain cells, and, in particular, to compare the M6P content in IDS precursors generated by different types of cells.
  • the gene therapy approach described herein should result in the continuous secretion of an hIDS precursor that may be taken up into neuronal and glial cells at a high level in the presence of inhibitory M6P in such an assay.
  • the M6P content and uptake of IDS precursor may also be demonstrated by 90 kDa and 76 kDa gel bands (e.g., SDS-PAGE gel bands).
  • the 90 kDa is reported to be highly glycosylated/phosphorylated and contains M6P, while 76 kDa is not.
  • the gene therapy approach described herein should result in the continuous secretion of an hIDS precursor that differs from the IDS precursor gel band generated from genetically engineered kidney cells.
  • the M6P content of commercial IDS precursor is 2 to 2.5 mol/mol, majority of which is present in a form of di-phosphorylated glycans. Although in average, every IDS precursor is phosphorylated, a normal distribution of glycans will have some IDS precursor with 2, 1 and 0 of di-phosphorylated M6P glycans assuming multiple phosphorylation sites. Uptake rate should be significant higher with multiple phosphorylation.
  • the glycosylation of hIDS by human cells of the CNS will result in the addition of glycans that can improve stability, half-life and reduce unwanted aggregation of the transgene product.
  • the glycans that are added to hIDS of the invention include 2,6-sialic acid, incorporating Neu5 Ac (“NANA”) but not its hydroxylated derivative, NeuGc (N-Glycolylneuraminic acid, i.e., "NGNA” or "Neu5Gc”).
  • Such glycans are not present in recombinant IDS products, such as Hunterase ® , made in CHO cells because CHO cells do not have the 2,6- sialyltransferase required to make this post-translational modification; nor do CHO cells produce bisecting GlcNAc, although they do add Neu5Gc (NGNA) as sialic acid not typical (and potentially immunogenic) to humans instead of Neu5Ac (NANA).
  • NGNA Neu5Gc
  • NANA Neu5Ac
  • Electrophor 19:2612-2630 ("[t]he CHO cell line is considered 'phenotypically restricted,' in terms of glycosylation, due to the lack of an a2,6-sialyl-transferase").
  • CHO cells can also produce an immunogenic glycan, the a-Gal antigen, which reacts with anti- a-Gal antibodies present in most individuals, and at high concentrations can trigger anaphylaxis. See, e.g., Bosques, 2010, Nat Biotech 28: 1153-1156.
  • the human glycosylation pattern of the rhIDS of the invention should reduce immunogenicity of the transgene product and improve efficacy.
  • Immunogenicity of a transgene product could be induced by various factors, including the immune condition of the patient, the structure and characteristics of the infused protein drug, the administration route, and the duration of treatment.
  • Process-related impurities such as host cell protein (HCP), host cell DNA, and chemical residuals
  • product-related impurities such as protein degradants and structural characteristics, such as glycosylation, oxidation and aggregation (sub- visible particles)
  • product-related impurities such as protein degradants and structural characteristics, such as glycosylation, oxidation and aggregation (sub- visible particles)
  • the amounts of process-related and product-related impurities can be affected by the manufacturing process: cell culture, purification, formulation, storage and handling, which can affect commercially manufactured IDS products.
  • proteins are produced in vivo, such that process- related impurities are not present and protein products are not likely to contain product-related impurities/degradants associated with proteins produced by recombinant technologies, such as protein aggregation and protein oxidation.
  • Aggregation for example, is associated with protein production and storage due to high protein concentration, surface interaction with manufacturing equipment and containers, and the purification process with certain buffer systems. But these conditions that promote aggregation are not present when a transgene is expressed in vivo. Oxidation, such as methionine, tryptophan and histidine oxidation, is also associated with protein production and storage, caused, for example, by stressed cell culture conditions, metal and air contact, and impurities in buffers and excipients. The proteins expressed in vivo may also oxidize in a stressed condition, but humans, like many organisms, are equipped with an antioxidation defense system, which not only reduces the oxidation stress, but can also repairs and/or reverses the oxidation.
  • Oxidation such as methionine, tryptophan and histidine oxidation
  • hIDS tyrosine sulfation site
  • P S SEK Y 165 ENTKTCRGPD tyrosine sulfation site
  • Molecules 20:2138-2164 esp. at p. 2154 which is incorporated by reference in its entirety for the analysis of amino acids surrounding tyrosine residues subjected to protein tyrosine sulfation.
  • the "rules" can be summarized as follows: Y residues with E or D within +5 to -5 position of Y, and where position -1 of Y is a neutral or acidic charged amino acid - but not a basic amino acid, e.g., R, K, or H that abolishes sulfation). While not intending to be bound by any theory, sulfation of this site in hIDS may improve stability of the enzyme and binding affinity for substrate.
  • Tyrosine-sulfation of hIDS - a robust post-translational process in human CNS cells - should result in improved processing and activity of transgene products.
  • the significance of tyrosine-sulfation of lysosomal proteins has not been elucidated; but in other proteins it has been shown to increase avidity of protein- protein interactions (antibodies and receptors), and to promote proteolytic processing (peptide hormone). (See, Moore, 2003, J Biol. Chem. 278: 24243-46; and Bundegaard et al., 1995, The EMBO J 14: 3073-79).
  • TPST1 The tyrosylprotein sulfotransferase responsible for tyrosine-sulfation (which may occur as a final step in IDS processing) is apparently expressed at higher levels (based on mRNA) in the brain (gene expression data for TPST1 may be found, for example, at the EMBL-EBI Expression Atlas, accessible at http://www.ebi.ac.uk/gxa/home).
  • Such post-translational modification at best, is under-represented in CHO cell products.
  • CHO cells are not secretory cells and have a limited capacity for post-translational tyrosine-sulfation. ⁇ See, e.g., Mikkelsen & Ezban, 1991, Biochemistry 30: 1533-1537, esp. discussion at p. 1537).
  • rhIDS human neuronal and/or glial cells
  • a viral vector or other DNA expression construct encoding rhIDS to the CSF of a patient (human subject) diagnosed with an MPS II disease (including but not limited to Hunter) to create a permanent depot in the CNS that continuously supplies a fully human-glycosylated, mannose-6-phosphorylated, sulfated transgene product secreted by the transduced CNS cells.
  • the hIDS transgene product secreted from the depot into the CSF will be endocytosed by cells in the CNS, resulting in "cross-correction" of the enzymatic defect in the MPS II recipient cells.
  • every rhIDS molecule produced either in the gene therapy or protein therapy approach be fully glycosylated, phosphorylated, and sulfated. Rather, the population of glycoproteins produced should have sufficient glycosylation (including 2,6- sialylation and mannose-6-phophorylation) and sulfation to demonstrate efficacy.
  • the goal of gene therapy treatment of the invention is to slow or arrest the progression of disease. Efficacy may be monitored by measuring cognitive function ⁇ e.g., prevention or decrease in
  • neurocognitive decline reductions in biomarkers of disease (such as GAG) in CSF and or serum; and/or increase in IDS enzyme activity in CSF and/or serum. Signs of inflammation and other safety events may also be monitored.
  • the rhIDS glycoprotein can be produced in human neural or glial cell lines by recombinant DNA technology and the glycoprotein can be administered to patients diagnosed with MPS II systemically and/or into the CSF for ERT).
  • Human cell lines that can be used for such recombinant glycoprotein production include but are not limited to HT-22, SK-N-MC, HCN-1 A, HCN-2, NT2, SH-SY5y, hNSCl 1, or ReNcell VM (see, e.g., Dumont et al., 2016, Critical Rev in Biotech 36(6): 1110-1122 "Human cell lines for biopharmaceutical manufacturing: history, status, and future perspectives" which is incorporated by reference in its entirety for a review of the human cell lines that could be used for the recombinant production of the rHuGlylDS glycoprotein). To ensure complete, HT-22, SK-N-MC, HCN-1 A, HCN-2, NT2, SH-SY5y, hNSCl 1, or ReNcell VM (see, e.g., Dumont et al., 2016, Critical Rev in Biotech 36(6): 1110-1122 "Human cell lines for biopharmaceutical manufacturing: history, status, and future perspectives
  • the cell line used for production can be enhanced by engineering the host cells to co-express a-2,6-sialyltransferase (or both a-2,3- and a-2,6-sialyltransferases) and/or TPST-1 and TPST-2 enzymes responsible for tyrosine-O- sulfation.
  • a-2,6-sialyltransferase or both a-2,3- and a-2,6-sialyltransferases
  • TPST-1 and TPST-2 enzymes responsible for tyrosine-O- sulfation responsible for tyrosine-O- sulfation.
  • Immune suppression therapies involving a regimen of tacrolimus or rapamycin (sirolimus) in combination with mycophenolic acid, or other immune suppression regimens used in tissue transplantation procedures can be employed.
  • Such immune suppression treatment may be administered during the course of gene therapy, and in certain embodiments, pre-treatment with immune suppression therapy may be preferred.
  • Immune suppression therapy can be continued subsequent to the gene therapy treatment, based on the judgment of the treating physician, and may thereafter be withdrawn when immune tolerance is induced; e.g., after 180 days.
  • Combinations of delivery of the rhIDS to the CSF accompanied by delivery of other available treatments are encompassed by the methods of the invention.
  • the additional treatments may be administered before, concurrently or subsequent to the gene therapy treatment.
  • MPS II Available treatments for MPS II that could be combined with the gene therapy of the invention include but are not limited to enzyme replacement therapy using Elaprase ® administered systemically or to the CSF; and/or HSCT therapy.
  • glycosylated recombinant human IDS precursor of paragraph 1 which is about 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa, 90 kDa, 91 kDa, 92 kDa, 93 kDa, 94 kDa, or 95 kDa) as measured by polyacrylamide gel electrophoresis.
  • 90 kDa e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa
  • 90 kDa e.g., 85 kDa, 86 kDa, 87 kDa
  • glycosylated recombinant human IDS precursor of paragraph 4 in which the depot is formed in a human subject's brain.
  • glycosylated recombinant human IDS precursor comprises the amino acid sequence of SEQ ID NO. 1.
  • a recombinant nucleotide expression vector encoding human IDS wherein said recombinant nucleotide expression vector when used to transduce a primary human neuronal cell in culture directs the expression of a secreted glycosylated human IDS precursor that is about 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa, 90 kDa, 91 kDa, 92 kDa, 93 kDa, 94 kDa, or 95 kDa) as measured by polyacrylamide gel electrophoresis, contains a formylglycine, is a2,6- sialylated, does not contain detectable NeuGc, does not contain detectable a-Gal antigen, and/or is mannose-6-phosphorylated.
  • a secreted glycosylated human IDS precursor that is about 90 kDa (e.g
  • a recombinant nucleotide expression vector encoding human IDS which recombinant nucleotide expression vector is suitable for administration to the cerebrospinal fluid (CSF) of human brain, so that a depot is formed in the human central nervous system that secretes a glycosylated human IDS precursor that is about 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa, 90 kDa, 91 kDa, 92 kDa, 93 kDa, 94 kDa, or 95 kDa) as measured by polyacrylamide gel electrophoresis, contains a formylglycine, is a2,6-sialylated, does not contain detectable NeuGc, does not contain detectable a-Gal antigen, and/or is mannose-6- phosphorylated.
  • CSF cerebrospinal fluid
  • the recombinant nucleotide expression vector of paragraph 15 or 16 which is an AAV9 or AAVrhlO vector.
  • a formulation comprising a recombinant nucleotide expression vector encoding human IDS, wherein the formulation is suitable for administration to the CSF of human brain, so that a depot is formed in the human central nervous system that secretes a glycosylated human IDS precursor that is about 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa, 90 kDa, 91 kDa, 92 kDa, 93 kDa, 94 kDa, or 95 kDa) as measured by polyacrylamide gel electrophoresis, contains a formylglycine, is a2,6-sialylated, does not contain detectable NeuGc, does not contain detectable a-Gal antigen, and/or is mannose-6-phosphorylated.
  • a glycosylated human IDS precursor that is about 90 kDa (e.g.
  • a kit comprising a recombinant nucleotide expression vector encoding human IDS and a pharmaceutically acceptable carrier, wherein the recombinant nucleotide expression vector is suitable for administration to the cerebrospinal fluid (CSF) of human brain, so that a depot is formed in the human central nervous system that secretes a glycosylated human IDS precursor that is about 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa, 90 kDa, 91 kDa, 92 kDa, 93 kDa, 94 kDa, or 95 kDa) as measured by polyacrylamide gel electrophoresis, contains a formylglycine, is a2,6-sialylated, does not contain detectable NeuGc, does not contain detectable a-Gal antigen, and/or is mannose-6-phosphorylated.
  • a kit comprising a formulation comprising a recombinant nucleotide expression vector encoding human IDS, wherein the formulation is suitable for administration to the CSF of human brain, so that a depot is formed in the human central nervous system that secretes a glycosylated human IDS precursor that is about 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa, 90 kDa, 91 kDa, 92 kDa, 93 kDa, 94 kDa, or 95 kDa) as measured by polyacrylamide gel electrophoresis, contains a formylglycine, is a2,6-sialylated, does not contain detectable NeuGc, does not contain detectable a-Gal antigen, and/or is mannose-6-phosphorylated.
  • a glycosylated human IDS precursor that is about 90 kDa
  • Glycosylated recombinant human iduronate-2-sulfatase (IDS) precursor for use in the treatment of a human subject diagnosed with mucopolysaccharidosis type II (MPS II), wherein the glycosylated recombinant human IDS precursor is produced by human neuronal or human glial cells, and wherein the treatment comprises delivering to the cerebrospinal fluid (CSF) of said human subject a therapeutically effective amount of the glycosylated recombinant human IDS precursor.
  • CSF cerebrospinal fluid
  • glycosylated recombinant human IDS precursor for use of paragraph 1, wherein the glycosylated recombinant human IDS precursor is about 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa, 90 kDa, 91 kDa, 92 kDa, 93 kDa, 94 kDa, or 95 kDa) as measured by polyacrylamide gel electrophoresis.
  • the glycosylated recombinant human IDS precursor is about 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa, 90 kDa, 91 kDa, 92 kDa, 93 kDa, 94 kDa, or 95 kDa) as measured by polyacrylamide gel electrophoresis
  • glycosylated recombinant human IDS precursor for use of paragraph 1, wherein the glycosylated recombinant human IDS precursor is about 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa, 90 kDa, 91 kDa, 92 kDa, 93 kDa, 94 kDa, or 95 kDa) as measured by polyacrylamide gel electrophoresis, contains a formylglycine, is a2,6-sialylated, does not contain detectable NeuGc, does not contain detectable a-Gal antigen, and/or is mannose-6- phosphorylated.
  • the glycosylated recombinant human IDS precursor is about 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89
  • glycosylated recombinant human IDS precursor for use of any one of paragraphs 1 to 3, wherein the glycosylated recombinant human IDS precursor is secreted from a depot of cells in the central nervous system genetically engineered to secrete said glycosylated recombinant human IDS precursor.
  • glycosylated recombinant human IDS precursor for use of paragraph 4 in which the depot is formed in a human subject' s brain.
  • glycosylated recombinant human IDS precursor for use of any one of paragraphs 1 to 5, in which the human subject is deficient in IDS activity.
  • glycosylated recombinant human IDS precursor for use of any one of paragraphs 1 to 6, in which the glycosylated recombinant human IDS precursor comprises the amino acid sequence of SEQ ID NO. 1.
  • human IDS comprises the amino acid sequence of SEQ ID NO. 1.
  • the recombinant nucleotide expression vector comprises a neuron-specific promoter that controls the expression of the glycosylated human IDS precursor in human neuronal cells or a glial cell-specific promoter that controls the expression of the glycosylated human IDS precursor in human glial cells.
  • the recombinant nucleotide expression vector encodes a leader peptide that ensures proper co- and post-translational processing of the glycosylated human IDS precursor in human neuronal cells or human glial cells.
  • the recombinant nucleotide expression vector is an AAV vector.
  • the recombinant nucleotide expression vector is delivered to the CSF of the human subject by intrathecal, intracerebroventricular, lumbar puncture or intranasal administration.
  • a formulation for use in the treatment of a human subject diagnosed with MPS II which comprises a recombinant nucleotide expression vector encoding human IDS, wherein the formulation is suitable for administration to the CSF of human brain, so that a depot is formed in the human central nervous system that secretes a glycosylated human IDS precursor that is about 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa, 90 kDa, 91 kDa, 92 kDa, 93 kDa, 94 kDa, or 95 kDa) as measured by polyacrylamide gel electrophoresis, contains a formylglycine, is a2,6-sialylated, does not contain detectable NeuGc, does not contain detectable a-Gal antigen, and/or is mannose-6-phosphorylated.
  • a glycosylated recombinant human iduronate-2-sulfatase (IDS) precursor for the manufacture of a medicament for the treatment of a human subject diagnosed with mucopolysaccharidosis type II (MPS II), wherein the glycosylated recombinant human IDS precursor is produced by human neuronal or human glial cells, and wherein the treatment comprises delivering to the cerebrospinal fluid (CSF) of said human subject a therapeutically effective amount of the glycosylated recombinant human IDS precursor.
  • CSF cerebrospinal fluid
  • glycosylated recombinant human IDS precursor is about 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa, 90 kDa, 91 kDa, 92 kDa, 93 kDa, 94 kDa, or 95 kDa) as measured by polyacrylamide gel electrophoresis. 3.
  • the glycosylated recombinant human IDS precursor is about 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa, 90 kDa, 91 kDa, 92 kDa, 93 kDa, 94 kDa, or 95 kDa) as measured by polyacrylamide gel electrophoresis. 3.
  • glycosylated recombinant human IDS precursor is about 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa, 90 kDa, 91 kDa, 92 kDa, 93 kDa, 94 kDa, or 95 kDa) as measured by polyacrylamide gel electrophoresis, contains a formylglycine, is a2,6-sialylated, does not contain detectable NeuGc, does not contain detectable a-Gal antigen, and/or is mannose-6-phosphorylated.
  • a recombinant nucleotide expression vector encoding human IDS for the manufacture of a medicament for the treatment of a human subject diagnosed with MPS II, wherein said recombinant nucleotide expression vector when used to transduce a primary human neuronal cell in culture directs the expression of a secreted glycosylated human IDS precursor that is about 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa, 90 kDa, 91 kDa, 92 kDa, 93 kDa, 94 kDa, or 95 kDa) as measured by polyacrylamide gel electrophoresis, contains a formylglycine, is a2,6-sialylated, does not contain detectable NeuGc, does not contain detectable a-Gal antigen, and/or is mannose-6-phosphorylated, and wherein
  • a recombinant nucleotide expression vector encoding human IDS for the manufacture of a medicament for the treatment of a human subject diagnosed with MPS II, wherein the recombinant nucleotide expression vector is suitable for administration to the cerebrospinal fluid of human brain, so that a depot is formed in the human central nervous system that secretes a glycosylated human IDS precursor that is about 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa, 90 kDa, 91 kDa, 92 kDa, 93 kDa, 94 kDa, or 95 kDa) as measured by polyacrylamide gel electrophoresis, contains a formylglycine, is a2,6-sialylated, does not contain detectable NeuGc, does not contain detectable a-Gal antigen, and/or is man
  • the recombinant nucleotide expression vector comprises a neuron-specific promoter that controls the expression of the glycosylated human IDS precursor in human neuronal cells or a glial cell-specific promoter that controls the expression of the glycosylated human IDS precursor in human glial cells.
  • a formulation for the manufacture of a medicament for the treatment of a human subject diagnosed with MPS II wherein the formulation comprises a recombinant nucleotide expression vector encoding human IDS, and wherein the formulation is suitable for administration to the CSF of human brain, so that a depot is formed in the human central nervous system that secretes a glycosylated human IDS precursor that is about 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa, 90 kDa, 91 kDa, 92 kDa, 93 kDa, 94 kDa, or 95 kDa) as measured by polyacrylamide gel electrophoresis, contains a formylglycine, is a2,6-sialylated, does not contain detectable NeuGc, does not contain detectable a-Gal antigen, and/or is mannose-6-
  • a method for treating a human subject diagnosed with mucopolysaccharidosis type II comprising delivering to the cerebrospinal fluid (CSF) of said human subject a therapeutically effective amount of a glycosylated recombinant human iduronate-2-sulfatase (IDS) precursor produced by human neuronal or human glial cells.
  • CSF cerebrospinal fluid
  • IDS insulin-derived glycosylated recombinant human iduronate-2-sulfatase
  • glycosylated recombinant human IDS precursor is about 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa, 90 kDa, 91 kDa, 92 kDa, 93 kDa, 94 kDa, or 95 kDa) as measured by polyacrylamide gel electrophoresis.
  • the glycosylated recombinant human IDS precursor is about 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa, 90 kDa, 91 kDa, 92 kDa, 93 kDa, 94 kDa, or 95 kDa) as measured by polyacrylamide gel electrophoresis.
  • glycosylated recombinant human IDS precursor is about 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa, 90 kDa, 91 kDa, 92 kDa, 93 kDa, 94 kDa, or 95 kDa) as measured by polyacrylamide gel electrophoresis, contains a formylglycine, is a2,6-sialylated, does not contain detectable NeuGc, does not contain detectable a-Gal antigen, and/or is mannose-6-phosphorylated.
  • the glycosylated recombinant human IDS precursor is about 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa, 90 kDa, 91 kDa, 92 kD
  • glycosylated recombinant human IDS precursor comprises the amino acid sequence of SEQ ID NO. 1.
  • a method for treating a human subject diagnosed with MPS II comprising administering to the CSF of said human subject a recombinant nucleotide expression vector encoding human IDS, wherein said recombinant nucleotide expression vector when used to transduce a primary human neuronal cell in culture directs the expression of a secreted glycosylated human IDS precursor that is about 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa, 90 kDa, 91 kDa, 92 kDa, 93 kDa, 94 kDa, or 95 kDa) as measured by polyacrylamide gel electrophoresis, contains a formylglycine, is a2,6-sialylated, does not contain detectable NeuGc, does not contain detectable a-Gal antigen, and/or is mannose-6-phosphorylated
  • a method for treating a human subject diagnosed with MPS II comprising administering to the CSF of said human subject a recombinant nucleotide expression vector encoding human IDS, so that a depot is formed in the human central nervous system that secretes a glycosylated human IDS precursor that is about 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa, 90 kDa, 91 kDa, 92 kDa, 93 kDa, 94 kDa, or 95 kDa) as measured by polyacrylamide gel electrophoresis, contains a formylglycine, is a2,6-sialylated, does not contain detectable NeuGc, does not contain detectable a-Gal antigen, and/or is mannose-6-phosphorylated.
  • a glycosylated human IDS precursor that is about 90 kDa
  • the recombinant nucleotide expression vector comprises a neuron-specific promoter that controls the expression of the glycosylated human IDS precursor in human neuronal cells or a glial cell-specific promoter that controls the expression of the glycosylated human IDS precursor in human glial cells.
  • a method for treating a human subject diagnosed with MPS II comprising administering to the CSF of said human subject a formulation comprising a recombinant nucleotide expression vector encoding human IDS, wherein the formulation is suitable for administration to the CSF of human brain, so that a depot is formed in the human central nervous system that secretes a glycosylated human IDS precursor that is about 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa, 90 kDa, 91 kDa, 92 kDa, 93 kDa, 94 kDa, or 95 kDa) as measured by polyacrylamide gel electrophoresis, contains a formylglycine, is a2,6-sialylated, does not contain detectable NeuGc, does not contain detectable a-Gal antigen, and/or is mannose-6- phosphoract
  • a method for treating a human subject diagnosed with mucopolysaccharidosis type II comprising delivering to the cerebrospinal fluid (CSF) of said human subject a therapeutically effective amount of a glycosylated recombinant human iduronate-2-sulfatase (IDS) precursor produced by human neuronal or human glial cells.
  • CSF cerebrospinal fluid
  • IDS human iduronate-2-sulfatase
  • formylglycine residue at C 84 (Fig. 1), is a2,6-sialylated, does not contain detectable NeuGc, and is mannose-6-phosphorylated.
  • a method of treating a human subject diagnosed with mucopolysaccharidosis type II comprising:
  • formylglycine residue at C 84 (Fig. 1), is a2,6-sialylated, does not contain detectable NeuGc and/or a-Gal antigen, and is mannose-6-phosphorylated.
  • the glycosylated recombinant human IDS precursor comprises the amino acid sequence of SEQ ID NO. 1.
  • a method of treating a human subject diagnosed with mucopolysaccharidosis type II comprising:
  • a recombinant nucleotide expression vector encoding human IDS so that a depot is formed in the subject's central nervous system that secretes a glycosylated human IDS precursor that is a2,6-sialylated and mannose-6-phosphorylated.
  • a method of treating a human subject diagnosed with mucopolysaccharidosis type II comprising: administering to the cerebrospinal fluid of the brain of said human subject, a therapeutically effective amount of a recombinant nucleotide expression vector encoding human IDS, so that a depot is formed that secretes a glycosylated human IDS precursor containing a a2,6-sialylated glycan;
  • said recombinant nucleotide expression vector when used to transduce human neuronal cells in culture results in secretion of said glycosylated human IDS precursor containing a a2,6-sialylated glycan in said cell culture.
  • a method of treating a human subject diagnosed with mucopolysaccharidosis type II comprising:
  • a recombinant nucleotide expression vector encoding human IDS so that a depot is formed that secretes a glycosylated human IDS precursor that contains a mannose-6-phosphate;
  • said recombinant nucleotide expression vector when used to transduce human neuronal cells in culture results in secretion of said glycosylated human IDS precursor that is mannose-6-phosphorylated in said cell culture.
  • a method of treating a human subject diagnosed with mucopolysaccharidosis type II comprising:
  • a recombinant nucleotide expression vector encoding human IDS so that a depot is formed that secretes a glycosylated human IDS precursor that contains a formylglycine;
  • said recombinant nucleotide expression vector when used to transduce human neuronal cells in culture results in secretion of said glycosylated human IDS precursor that contains a formylglycine in said cell culture.
  • FIG. 1 The amino acid sequence of human IDS. A post-translational
  • N linked glycosylation sites (N 31 , N 115 , N 144 , N 246 , N 280 , N 325 , N 513 and N 537 ) are bold and boxed.
  • One tyrosine-O-sulfation site (Y) is bold and the full sulfation site sequence
  • FIG. 2 Multiple sequence alignment of hIDS with known orthologs.
  • the names of the species and protein IDs are as follows: SP
  • K6ZGI9_PANTR [Pan troglodytes (Chimpanzee)]; TR
  • TRF7EJG2 CALJA Callithrix jacchus (White-tufted-ear marmoset)]; TR
  • UPI0000D9F625 [Macaca mulatta (Rhesus macaque)]; UPI000274358B [Pan paniscus (Pygmy chimpanzee; Bonobo)]; UPI00027F6FC5 [Papio Anubis (Olive baboon)]; UPI00027FAE03
  • FIG. 3 MPS II mutations in hIDS and corresponding disease phenotypes, mild, intermediate or severe, (from Uniprot).
  • FIG. 4 Human IDS processing as reported in Millat et al., 1997, Exp. Cell. Res. 230: 362-367, at Fig.7.
  • FIG. 5 Schematic Representation of Construct 1.
  • the invention involves the delivery of recombinant human iduronate-2-sulfatase (rhIDS) produced by human neuronal or glial cells to the cerebrospinal fluid (CSF) of the central nervous system (CNS) of a human subject diagnosed with mucopolysaccharidosis II (MPS II), including, but not limited to patients diagnosed with Hunter syndrome.
  • CSF cerebrospinal fluid
  • CNS II central nervous system
  • MPS II mucopolysaccharidosis II
  • the treatment is accomplished via gene therapy - e.g., by administering a viral vector or other DNA expression construct encoding human IDS (hIDS), or a derivative of hIDS, to the CSF of a patient (human subject) diagnosed with MPS II, so that a permanent depot of transduced neuronal and/or glial cells is generated that continuously supplies the transgene product to the CNS.
  • hIDS human IDS
  • the rhIDS secreted from the neuronal/glial cell depot into the CSF will be endocytosed by cells in the CNS, resulting in "cross-correction" of the enzymatic defect in the recipient cells.
  • the depot of transduced neural and glial cells in the CNS can deliver the recombinant enzyme to both the CNS and systemically, which may reduce or eliminate the need for systemic treatment, e.g., weekly i.v. injections of the enzyme.
  • the hIDS can be produced by human neuronal or glial cells in cell culture (e.g., bioreactors) and administered as an enzyme replacement therapy ("ERT"), e.g., by injecting the enzyme - into the CSF, directly into the CNS, and/or
  • ERT enzyme replacement therapy
  • the gene therapy approach offers several advantages over ERT since systemic delivery of the enzyme will not result in treating the CNS because the enzyme cannot cross the blood brain barrier; and, unlike the gene therapy approach of the invention, direct delivery of the enzyme to the CSF and/or CNS would require repeat injections which are not only burdensome, but pose a risk of infection.
  • the hIDS encoded by the transgene can include, but is not limited to human IDS (hIDS) having the amino acid sequence of SEQ ID NO. 1 (as shown in FIG. 1), and derivatives of hIDS having amino acid substitutions, deletions, or additions, e.g., including but not limited to amino acid substitutions selected from corresponding non-conserved residues in orthologs of IDS shown in FIG.
  • amino acid substitutions at a particular position of hIDS can be selected from among corresponding non-conserved amino acid residues found at that position in the IDS orthologs aligned in FIG. 2, with the proviso that such substitutions do not include any of the deleterious mutations shown in FIG. 3 or as reported by Sukegawa-Hayasaka et al., 2006, supra; Millat et al., 1998, supra; or Bonucelli et al., 2001, supra, each of which is incorporated by reference herein in its entirety.
  • the resulting transgene product can be tested using conventional assays in vitro, in cell culture or test animals to ensure that the mutation does not disrupt IDS function.
  • Preferred amino acid substitutions, deletions or additions selected should be those that maintain or increase enzyme activity, stability or half-life of IDS, as tested by conventional assays in vitro, in cell culture or animal models for MPS II.
  • the enzyme activity of the transgene product can be assessed using a conventional enzyme assay with, for example, 4- Methylumbelliferyl a-L-idopyranosiduronic acid 2-sulfate or 4-methylumbelliferyl sulfate as the substrate (see, e.g., Lee et al., 2015, Clin. Biochem. 48(18): 1350-1353, Dean et al., 2006, Clin. Chem.
  • the ability of the transgene product to correct MPS II phenotype can be assessed in cell culture; e.g., by transducing MPS II cells in culture with a viral vector or other DNA expression construct encoding hIDS or a derivative; by adding the transgene product or a derivative to MPS II cells in culture; or by co-culturing MPS II cells with human neuronal/glial host cells engineered to express and secrete rhIDS or a derivative, and determining correction of the defect in the MPS II cultured cells, e.g., by detecting IDS enzyme activity and/or reduction in GAG storage in the MPS II cells in culture (see, e.g., Stroncek et al., 1999, Transfusion 39(4):343-350, which is incorporated by reference herein in its entirety).
  • This IDS-knockout mouse exhibits many of the characteristics of MPS II, including skeletal abnormalities, hepatosplenomegaly, elevated urinary and tissue GAG, and brain storage lesions (Muenzer et al., 2001, Acta Paediatr Suppl 91 :98-99) and was used to assess the effect of enzyme replacement therapy in MPS II in support of clinical trials for ERT.
  • This mouse model therefore, is a relevant model for studying the effects of gene therapy delivering rIDS produced by neuronal or glial cells as a treatment for MPS II (see, e.g., Polito and Cosma, 2009, Am. J. Hum. Genet. 85(2):296-301, which is incorporated by reference herein in its entirety).
  • the hIDS transgene produced by the human neuronal/glial cells should be controlled by expression control elements that function in neurons and/or glial cells, e.g., the CB7 promoter (a chicken ⁇ -actin promoter and CMV enhancer), and can include other expression control elements that enhance expression of the transgene driven by the vector (e.g., chicken ⁇ -actin intron and rabbit ⁇ -globin poly A signal).
  • the cDNA construct for the hIDS transgene should include a coding sequence for a signal peptide that ensures proper co- and post- translational processing (glycosylation and protein sulfation) by the transduced CNS cells.
  • signal peptides used by CNS cells may include but are not limited to:
  • Oligodendrocyte-myelin glycoprotein (hOMG) signal peptide hOMG
  • V-set and transmembrane domain containing 2B (hVSTM2B) signal peptide • V-set and transmembrane domain containing 2B (hVSTM2B) signal peptide:
  • MAMVSAMSWVLYLWISACA (SEQ ID NO: 6)
  • Signal peptides may also be referred to herein as leader sequences or leader peptides.
  • the recombinant vector used for delivering the transgene should have a tropism for cells in the CNS, including but limited to neurons and/or glial cells.
  • Such vectors can include non-replicating recombinant adeno-associated virus vectors ("rAAV"), particularly those bearing an AAV9 or AAVrhlO capsid are preferred.
  • rAAV non-replicating recombinant adeno-associated virus vectors
  • AAV variant capsids can be used, including but not limited to those described by Wilson in US Patent No. 7,906, 1 1 1 which is incorporated by reference herein in its entirety, with AAV/hu.31 and AAV/hu.32 being particularly preferred; as well as AAV variant capsids described by Chatterjee in US Patent No. 8,628,966, US Patent No.
  • viral vectors including but not limited to lentiviral vectors, vaccinia viral vectors, or non-viral expression vectors referred to as "naked DNA" constructs.
  • compositions suitable for administration to the CSF comprise a suspension of the rhIDS vector in a formulation buffer comprising a physiologically compatible aqueous buffer, a surfactant and optional excipients.
  • the pharmaceutical compositions are suitable for intrathecal administration.
  • the pharmaceutical compositions are suitable for intrathecal administration.
  • compositions are suitable for intraci sternal administration (injection into the cisterna magna). In certain embodiments, the pharmaceutical compositions are suitable for injection into the subarachnoid space via a CI -2 puncture. In certain embodiments, the pharmaceutical compositions are suitable for intracerebroventricular administration. In certain embodiments, the pharmaceutical compositions are suitable for administration via lumbar puncture.
  • Therapeutically effective doses of the recombinant vector should be administered to the CSF via intrathecal administration (i.e., injection into the subarachnoid space so that the recombinant vectors distribute through the CSF and transduce cells in the CNS). This can be accomplished in a number of ways - e.g., by intracranial (cisternal or ventricular) injection , or injection into the lumbar cistern.
  • intraci sternal (IC) injection into the cisterna magna
  • IC intraci sternal
  • injection into the subarachnoid space can be performed via a CI -2 puncture when feasible for the patient
  • lumbar puncture typically diagnostic procedures performed in order to collect a sample of CSF
  • intracerebroventricular (ICV) administration a more invasive technique used for the introduction of antiinfective or anticancer drugs that do not penetrate the blood-brain barrier
  • intranasal administration may be used to deliver the recombinant vector to the CNS.
  • AAV9.hIDS administered IC depends on the assumed brain mass across different age strata. For brain mass by age for the study subjects see, eg., (AS Dekaban, Ann Neurol, 1978 Oct; 4(4): 345-56.
  • CSF concentrations can be monitored by directly measuring the concentration of rhIDS in the CSF fluid obtained from occipital or lumbar punctures, or estimated by
  • human IDS is translated as a 550 amino acid polypeptide that contains eight potential N-glycosylation sites (N 31 , N 115 , N 144 , N 246 , N 280 , N 325 , N 513 and N 537 ) depicted in FIG. l and includes a 25 amino acid signal sequence which is cleaved during processing.
  • An initial 76 kDa intracellular precursor is converted into a phosphorylated 90 kDa precursor after modification of its oligosaccharide chains in the Golgi apparatus. This precursor is processed by glycosylation modifications and proteolytic cleavage through various intracellular intermediates to a major 55 kDa form.
  • proteolytic processing involves N-terminal proteolytic cleavage downstream of N 31 removing a propeptide of eight amino acids (residues 26-33), and C-terminal proteolytic cleavage upstream of N 513 which releases an 18 kDa polypeptide and produces a 62 kDa intermediate that is converted to a 55 kDa mature form. Further proteolytic cleavage yields a 45 kDa mature form located in the lysosomal compartment.
  • FIG. 4 for diagram reproduced from Millat et al., 1997, Exp Cell Res 230: 362-367 ("Millat 1997”); Millat et al. 1997, Biochem J. 326: 243-247 (“Millat 1997a”); and Froissart et al., 1995, Biochem J. 309:425-430, each of which is incorporated by reference herein in its entirety).
  • a formylglycine modification of C 84 (shown in bold in FIG. 1) required for enzyme activity probably occurs as an early post-translational or co-translational event, most probably in the endoplasmic reticulum.
  • Post-translational processing continues in the Golgi to include addition of complex sialic acid- containing glycans and acquisition of mannose-6-phosphate residues which tag the enzyme for delivery to the lysosomal compartment.
  • glycosylation at position N 280 is important for cellular internalization and lysosomal targeting via the mannose-6-phosphate (M6P) receptor.
  • M6P mannose-6-phosphate
  • the invention is based, in part, on the following principles:
  • Neuronal and glial cells in the CNS are secretory cells that possess the cellular
  • the human brain produces multiple isoforms of natural/native IDS.
  • N- terminal sequencing of human brain mannose-6-phosphorylated glycoproteins revealed that the N-terminal sequence of the mature 42 kDa chain of hIDS varies in the brain, starting at positions 34 or 36 as follows: T 34 DALNVLLI; and
  • recombinant IDS produced by neuronal and glial cells may be endocytosed by recipient CNS cells more avidly than recombinant IDS produced by other cells such as kidney.
  • Daniele 2002 demonstrated M6P -receptor mediated endocytosis of recombinant IDS from conditioned media of transduced neuronal and glial cell cultures by a recipient population of non-transduced neuronal and glial cells which properly processed the precursor to the 45 kDa mature active form.
  • Uptake of the recombinant IDS produced by the neuronal and glial cell lines (74% endocytosis) far exceeded uptake of the enzyme produced by a kidney cell line (5.6% endocytosis).
  • the gene therapy approach described herein should result in the continuous secretion of an hIDS glycoprotein precursor of about 90 kDa as measured by polyacrylamide gel electrophoresis (depending on the assay used) that is enzymatically active.
  • the enzyme responsible for the formylglycine modification of C 84 which is required for IDS activity—the FGly-Generating Enzyme (FGE, aka SUMF1)— is expressed in the cerebral cortex of the human brain (gene expression data for SUMF1 may be found, for example, at GeneCards, accessible at http://www.genecards.org).
  • the secreted glycosylated/phosphorylated rIDS produced by transduced neurons and glial cells in situ should be taken up and correctly processed by untransduced neural and glial cells in the CNS.
  • the secreted rhIDS precursor produced in situ by gene therapy may be more avidly endocytosed by recipient cells in the CNS than would traditional recombinant enzymes used for ERT if administered to the CNS.
  • Elaprase ® (made in HT1080, a fibrosarcoma cell line) is a purified protein reported to have a molecular weight of about 76 kDa - not the 90 kDa species secreted by neuronal and glial cells that appears to be more heavily phosphorylated. While the eight N-linked
  • glycosylation sites are reported to be fully occupied in Elaprase ® and contain two bis- mannose-6-phosphate terminated glycans as well as complex highly sialylated glycans, the post-translational modification of C 84 to FGly, which is an absolute requirement for enzyme activity, is only about 50%.
  • Another recombinant product, Hunterase ® is made in CHO cells. While reported to have higher FGly and activity than Elaprase ® , mannose-6-phosphorylation and uptake did not differ. (Chung, 2014, Glycoconj J 31 : 309-315).
  • the extracellular IDS efficacy in vivo depends on uptake (cell and lysosome internalization) through mannose-6-phosphate (M6P) and its active site formylglycine (FGly), which is converted from C 84 through post-translational modification by formylgly cine-generating enzyme.
  • M6P mannose-6-phosphate
  • FGly active site formylglycine
  • brain cells neuronal and glial cells
  • the resultant five-fold increase in activity can likely be attributed to the efficient uptake of IDS (See Daniele 2002, Tables 2 and 4).
  • IDS which are generated by CHO cells or HT-1080 cells, have a FGly content of about 50% to 70%, which determines the enzyme activity. However, neuronal and glial cells may improve upon this activity, due to improvement of IDS uptake.
  • IDS lysosomal proteins
  • M6P The cellular and subcellular trafficking/uptake of lysosomal proteins, including IDS, is through M6P.
  • IDS from brain cells may contain higher M6P content, as reported in Daniele 2002, and in Sleat, Proteomics, 2005 (indicating that the human brain contains more (in both a quantitative and qualitative sense) Man6-P glycoproteins than other tissues.). It is possible to measure the M6P content of an IDS precursor, as done in Daniele 2002.
  • the uptake of IDS precursor generated by non-neuronal or non-glial cells is predicted to decrease to levels close to that of the control cells, as was shown in Daniele 2002.
  • the uptake of IDS precursor generated by brain cells is predicted to remain at a high level, as was shown in Daniele 2002, where the uptake was four times higher than control cells and comparable to the level of IDS activity (or uptake) of IDS precursor generated by genetically engineered kidney cells without the presence of inhibitory M6P.
  • This assay allows for a way to predict the M6P content in IDS precursor generated by brain cells, and, in particular, to compare the M6P content in IDS precursors generated by different types of cells.
  • the gene therapy approach described herein should result in the continuous secretion of an hIDS precursor that may be taken up into neuronal and glial cells at a high level in the presence of inhibitory M6P in such an assay.
  • the M6P content and uptake of IDS precursor may also be demonstrated by 90 kDa and 76 kDa gel bands (e.g., SDS-PAGE gel bands).
  • the 90 kDa is reported to be highly glycosylated/phosphorylated and contains M6P, while 76 kDa is not.
  • the gene therapy approach described herein should result in the continuous secretion of an hIDS precursor that differs from the IDS precursor gel band generated from genetically engineered kidney cells.
  • the M6P content of commercial IDS precursor is 2 to 2.5 mol/mol, majority of which is present in a form of di-phosphorylated glycans. Although in average, every IDS precursor is phosphorylated, a normal distribution of glycans will have some IDS precursor with 2, 1 and 0 of di-phosphorylated M6P glycans assuming multiple phosphorylation sites. Uptake rate should be significant higher with multiple phosphorylation.
  • glycans that can improve stability, half-life and reduce unwanted aggregation of the transgene product.
  • the glycans that are added to hIDS of the invention include 2,6-sialic acid, incorporating Neu5 Ac (“NANA”) but not its hydroxylated derivative, NeuGc (N-Glycolylneuraminic acid, i.e., "NGNA” or "Neu5Gc”).
  • Such glycans are not present in recombinant IDS products, such as Hunterase ® , made in CHO cells because CHO cells do not have the 2,6-sialyltransferase required to make this post-translational modification; nor do CHO cells produce bisecting GlcNAc, although they do add Neu5Gc (NGNA) as sialic acid not typical (and potentially immunogenic) to humans instead of Neu5Ac (NANA).
  • NGNA Neu5Gc
  • NANA Neu5Ac
  • Electrophor 19:2612-2630 ("[t]he CHO cell line is considered 'phenotypically restricted,' in terms of glycosylation, due to the lack of an a2,6- sialyl-transferase").
  • CHO cells can also produce an immunogenic glycan, the a-Gal antigen, which reacts with anti-a-Gal antibodies present in most individuals, and at high concentrations can trigger anaphylaxis. See, e.g., Bosques, 2010, Nat Biotech 28: 1153-1156.
  • the human glycosylation pattern of the rhIDS of the invention should reduce immunogenicity of the transgene product and improve efficacy.
  • Immunogenicity of a transgene product could be induced by various factors, including the immune condition of the patient, the structure and characteristics of the infused protein drug, the administration route, and the duration of treatment.
  • Process- related impurities such as host cell protein (HCP), host cell DNA, and chemical residuals
  • product-related impurities such as protein degradants and structural characteristics, such as glycosylation, oxidation and aggregation (sub-visible particles)
  • product-related impurities such as protein degradants and structural characteristics, such as glycosylation, oxidation and aggregation (sub-visible particles) may also increase immunogenicity by serving as an adjuvant that enhances the immune response.
  • the amounts of process-related and product-related impurities can be affected by the manufacturing process: cell culture, purification, formulation, storage and handling, which can affect commercially manufactured IDS products.
  • proteins are produced in vivo, such that process-related impurities are not present and protein products are not likely to contain product-related
  • Aggregation for example, is associated with protein production and storage due to high protein concentration, surface interaction with manufacturing equipment and containers, and the purification process with certain buffer systems. But these conditions that promote aggregation are not present when a transgene is expressed in vivo.
  • Oxidation such as methionine, tryptophan and histidine oxidation, is also associated with protein production and storage, caused, for example, by stressed cell culture conditions, metal and air contact, and impurities in buffers and excipients.
  • the proteins expressed in vivo may also oxidize in a stressed condition, but humans, like many organisms, are equipped with an antioxidation defense system, which not only reduces the oxidation stress, but can also repairs and/or reverses the oxidation. Thus, proteins produced in vivo are not likely to be in an oxidized form. Both aggregation and oxidation could affect the potency, pharmacokinetics (clearance) and can increase immunogenicity concerns.
  • the gene therapy approach described herein should result in the continuous secretion of an hIDS precursor with a reduced immunogenicity compared to commercially manufactured products.
  • hIDS contains a tyrosine ("Y") sulfation site (PSSEKY 165 ENTKTCRGPD).
  • Y tyrosine
  • PSSEKY 165 ENTKTCRGPD tyrosine sulfation site
  • Y residues with E or D within +5 to -5 position of Y and where position -1 of Y is a neutral or acidic charged amino acid - but not a basic amino acid, e.g., R, K, or H that abolishes sulfation). While not intending to be bound by any theory, sulfation of this site in hIDS may improve stability of the enzyme and binding affinity for substrate. Tyrosine-sulfation of hIDS - a robust post-translational process in human CNS cells - should result in improved processing and activity of transgene products.
  • TPSTl The tyrosylprotein sulfotransferase responsible for tyrosine-sulfation (which may occur as a final step in IDS processing) is apparently expressed at higher levels (based on mRNA) in the brain (gene expression data for TPST1 may be found, for example, at the EMBL-EBI Expression Atlas, accessible at http://www.ebi.ac.uk/gxa/home).
  • Such post-translational modification at best, is under-represented in CHO cell products.
  • CHO cells are not secretory cells and have a limited capacity for post-translational tyrosine-sulfation. ⁇ See, e.g., Mikkelsen & Ezban, 1991, Biochemistry 30: 1533-1537, esp. discussion at p. 1537).
  • rhIDS human neuronal and/or glial cells
  • a viral vector or other DNA expression construct encoding rhIDS to the CSF of a patient (human subject) diagnosed with an MPS II disease (including but not limited to Hunter) to create a permanent depot in the CNS that continuously supplies a fully human-glycosylated, mannose-6-phosphorylated, sulfated transgene product secreted by the transduced CNS cells.
  • the hIDS transgene product secreted from the depot into the CSF will be endocytosed by cells in the CNS, resulting in "cross-correction" of the enzymatic defect in the MPS II recipient cells.
  • every rhIDS molecule produced either in the gene therapy or protein therapy approach be fully glycosylated, phosphorylated, and sulfated. Rather, the population of glycoproteins produced should have sufficient glycosylation (including 2,6- sialylation and mannose-6-phosphorylation) and sulfation to demonstrate efficacy.
  • the goal of gene therapy treatment of the invention is to slow or arrest the progression of disease. Efficacy may be monitored by measuring cognitive function ⁇ e.g., prevention or decrease in
  • neurocognitive decline reductions in biomarkers of disease (such as GAG) in CSF and or serum; and/or increase in IDS enzyme activity in CSF and/or serum. Signs of inflammation and other safety events may also be monitored.
  • the rhIDS glycoprotein can be produced in human neural or glial cell lines by recombinant DNA technology and the glycoprotein can be administered to patients diagnosed with MPS II systemically and/or into the CSF for ERT).
  • Human cell lines that can be used for such recombinant glycoprotein production include but are not limited to HT-22, SK-N-MC, HCN-1 A, HCN-2, NT2, SH-SY5y, hNSCl 1, or ReNcell VM (see, e.g., Dumont et al., 2016, Critical Rev in Biotech 36(6): 1110-1122 "Human cell lines for biopharmaceutical manufacturing: history, status, and future perspectives" which is incorporated by reference in its entirety for a review of the human cell lines that could be used for the recombinant production of the rHuGlylDS glycoprotein). To ensure complete, HT-22, SK-N-MC, HCN-1 A, HCN-2, NT2, SH-SY5y, hNSCl 1, or ReNcell VM (see, e.g., Dumont et al., 2016, Critical Rev in Biotech 36(6): 1110-1122 "Human cell lines for biopharmaceutical manufacturing: history, status, and future perspectives
  • the cell line used for production can be enhanced by engineering the host cells to co-express a-2,6-sialyltransferase (or both a-2,3- and a-2,6-sialyltransferases) and/or TPST-1 and TPST-2 enzymes responsible for tyrosine-O- sulfation.
  • a-2,6-sialyltransferase or both a-2,3- and a-2,6-sialyltransferases
  • TPST-1 and TPST-2 enzymes responsible for tyrosine-O- sulfation responsible for tyrosine-O- sulfation.
  • Immune suppression therapies involving a regimen of tacrolimus or rapamycin (sirolimus) in combination with mycophenolic acid, or other immune suppression regimens used in tissue transplantation procedures can be employed.
  • Such immune suppression treatment may be administered during the course of gene therapy, and in certain embodiments, pre-treatment with immune suppression therapy may be preferred.
  • Immune suppression therapy can be continued subsequent to the gene therapy treatment, based on the judgment of the treating physician, and may thereafter be withdrawn when immune tolerance is induced; e.g., after 180 days.
  • Combinations of delivery of the rhIDS to the CSF accompanied by delivery of other available treatments are encompassed by the methods of the invention.
  • the additional treatments may be administered before, concurrently or subsequent to the gene therapy treatment.
  • MPS II Available treatments for MPS II that could be combined with the gene therapy of the invention include but are not limited to enzyme replacement therapy using Elaprase ® administered systemically or to the CSF; and/or HSCT therapy.
  • MPS II mucopolysaccharidosis type II
  • CSF cerebrospinal fluid
  • IDS human iduronate-2-sulfatase
  • MPS II mucopolysaccharidosis type II
  • CSF cerebrospinal fluid
  • a therapeutically effective amount of a recombinant human iduronate-2-sulfatase (IDS) glycoprotein precursor that is about 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa, 90 kDa, 91 kDa, 92 kDa, 93 kDa, 94 kDa, or 95 kDa) as measured by polyacrylamide gel electrophoresis, has a formylglycine residue at C 84 (Fig. 1), is a2,6-sialylated, does not contain detectable NeuGc, and is mannose-6-phosphorylated.
  • IDS human iduronate-2-sulfatase glycoprotein precursor that is about 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa,
  • MPS II mucopolysaccharidosis type II
  • CSF cerebrospinal fluid
  • a therapeutically effective amount of a recombinant human iduronate-2-sulfatase (IDS) glycoprotein precursor that is about 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa, 90 kDa, 91 kDa, 92 kDa, 93 kDa, 94 kDa, or 95 kDa) as measured by polyacrylamide gel electrophoresis, has a formylglycine residue at C 84 (Fig. 1), is a2,6-sialylated, does not contain detectable NeuGc and/or a-Gal antigen, and is mannose- 6-phosphorylated.
  • IDS human iduronate-2-sulfatase glycoprotein precursor that is about 90 kDa (e.g., 85 kDa, 86 kD
  • the human IDS precursor is delivered to the CSF from a depot of cells in the central nervous system genetically engineered to secrete said IDS precursor into the CSF.
  • the depot is formed in the subject' s brain.
  • the human subject is deficient in IDS activity.
  • the human IDS comprises the amino acid sequence of SEQ ID NO. 1.
  • a method of treating a human subject diagnosed with mucopolysaccharidosis type II comprising administering to the cerebrospinal fluid (CSF) of said human subject a recombinant nucleotide expression vector encoding human iduronate-2-sulfatase (IDS), wherein said expression vector when used to transduce a primary human neuronal cell in culture directs the expression of a secreted human IDS glycoprotein precursor that is about 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa, 90 kDa, 91 kDa, 92 kDa, 93 kDa, 94 kDa, or 95 kDa) as measured by polyacrylamide gel electrophoresis, has a formylglycine residue at C 84 (Fig. 1), is a
  • a method of treating a human subject diagnosed with mucopolysaccharidosis type II comprising administering to the cerebrospinal fluid of the brain of said human subject, a therapeutically effective amount of a recombinant nucleotide expression vector encoding human IDS, so that a depot is formed in the subject's central nervous system that secretes a recombinant human IDS glycoprotein precursor that is a2,6-sialylated and mannose-6-phosphorylated.
  • secretion of said recombinant human IDS glycoprotein precursor that is a2,6-sialylated is confirmed by transducing a human neuronal cell line with said recombinant nucleotide expression vector in cell culture.
  • secretion of said recombinant human IDS glycoprotein precursor that is mannose-6-phosphorylated is confirmed by transducing a human neuronal cell line with said recombinant nucleotide expression vector in cell culture.
  • the secretion is confirmed in the presence and absence of mannose-6-phosphate.
  • a method of treating a human subject diagnosed with mucopolysaccharidosis type II comprising administering to the cerebrospinal fluid of the brain of said human subject, a therapeutically effective amount of a recombinant nucleotide expression vector encoding human IDS, so that a depot is formed that secretes a glycosylated IDS precursor containing a a2,6-sialylated glycan; wherein said recombinant vector, when used to transduce human neuronal cells in culture results in secretion of said glycosylated IDS precursor containing a a2,6-sialylated glycan in said cell culture.
  • MPS II mucopolysaccharidosis type II
  • a method of treating a human subject diagnosed with mucopolysaccharidosis type II comprising administering to the cerebrospinal fluid of the brain of said human subject, a therapeutically effective amount of a recombinant nucleotide expression vector encoding human IDS, so that a depot is formed that secretes a glycosylated IDS precursor that contains a mannose-6-phosphate; wherein said recombinant vector, when used to transduce human neuronal cells in culture results in secretion of said glycosylated IDS precursor that is mannose-6-phosphorylated in said cell culture.
  • MPS II mucopolysaccharidosis type II
  • a method of treating a human subject diagnosed with mucopolysaccharidosis type II comprising administering to the cerebrospinal fluid of the brain of said human subject, a therapeutically effective amount of a recombinant nucleotide expression vector encoding human IDS, so that a depot is formed that secretes a glycosylated IDS precursor that contains a formylglycine; wherein said recombinant vector, when used to transduce human neuronal cells in culture results in secretion of said glycosylated IDS precursor that contains a formylglycine in said cell culture.
  • MPS II mucopolysaccharidosis type II
  • the human IDS comprises the amino acid sequence of SEQ ID NO. 1.
  • the IDS transgene encodes a leader peptide.
  • the expression vector is a replication defective AAV vector.
  • the expression vector is delivered to the CSF of the subject by intrathecal (e.g., intracisternal, CI -2 puncture if feasible for the patient, or lumbar puncture),
  • intracerebroventricular, or intranasal administration In certain embodiments, the human subject is deficient in IDS activity.
  • the glycosylated IDS does not contain detectable NeuGc and/or a-Gal.
  • detectable NeuGc and/or a-Gal used herein means NeuGc and/or a- Gal moieties detectable by standard assay methods known in the art.
  • NeuGc may be detected by UPLC according to Hara et al, 1989, "Highly Sensitive Determination of N- Acetyl-and N-Glycolylneuraminic Acids in Human Serum and Urine and Rat Serum by
  • NeuGc may be detected by mass spectrometry.
  • the a-Gal may be detected using an ELISA, see, for example, Galili et al., 1998, "A sensitive assay for measuring alpha-Gal epitope expression on cells by a monoclonal anti-Gal antibody.” Transplantation.
  • Human IDS includes a 25 amino acid signal sequence which is cleaved during processing.
  • An initial 76 kDa intracellular IDS precursor is converted into a phosphorylated 90 kDa IDS precursor after modification of its oligosaccharide chains in the Golgi apparatus. This precursor is processed by glycosylation modifications and proteolytic cleavage through various intracellular intermediates to a major 55 kDa form.
  • proteolytic processing involves N-terminal proteolytic cleavage downstream of N 31 removing a propeptide of eight amino acids (residues 26-33), and C-terminal proteolytic cleavage upstream of N 513 which releases an 18 kDa polypeptide and produces a 62 kDa intermediate that is converted to a 55 kDa mature form. Further proteolytic cleavage yields a 45 kDa mature form located in the lysosomal compartment.
  • FIG. 4 for diagram reproduced from Millat et al., 1997, Exp Cell Res 230: 362-367 ("Millat 1997”); Millat et al. 1997, Biochem J. 326: 243-247 (“Millat 1997a”); and Froissart et al., 1995, Biochem J. 309:425-430, each of which is incorporated by reference herein in its entirety).
  • a formylglycine modification of C 84 (shown in bold in FIG. 1) required for enzyme activity probably occurs as an early post-translational or co-translational event, most probably in the endoplasmic reticulum. ⁇ See, Millat 1997a, citing Schmidt et al., 1995, Cell 82: 271-278). Post-translational processing continues in the Golgi to include addition of complex sialic acid- containing glycans and acquisition of mannose-6-phosphate residues which tag the enzyme for delivery to the lysosomal compartment. ⁇ See, Clarke, 2008, Expert Opin Pharmacother 9: 311- 317 for a concise review which is incorporated by reference herein in its entirety).
  • HuGlylDS used in accordance with the methods described herein when expressed in a neuronal or glial cell, in vivo or in vitro, can be the 90 kDa ⁇ e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa, 90 kDa, 91 kDa, 92 kDa, 93 kDa, 94 kDa, or 95 kDa) mannose-6-phosphorylated form of the enzyme.
  • IDS produced from neuronal and glial cells may contain higher M6P content, as reported in Daniele 2002, and in Sleat, Proteomics, 2005 (indicating that the human brain contains more (in both a quantitative and qualitative sense) M6P glycoproteins than other tissues.). It is possible to measure the M6P content of an IDS precursor, as done in Daniele 2002.
  • HuGlylDS used in accordance with the methods described herein when expressed in a neuronal or glial cell, in vivo or in vitro, is mannose-6-phosphorylated at a higher level than IDS expressed in a non-neuronal or glial cell.
  • HuGlylDS used in accordance with the methods described herein when expressed in a neuronal or glial cell, in vivo or in vitro, is mannose-6-phosphorylated at a higher level than IDS expressed in a HT1080 or CHO cell.
  • the mannose-6- phosphorylation level of the expresssed IDS is measured by uptake of the IDS by a human neuronal cell in the presence of M6P (e.g., 5 mM M6P).
  • M6P e.g., 5 mM M6P
  • 10% - 20%, 20% - 30%, 30% - 40%, 40% - 50%, 50% - 60%, 60% - 70%, 70% - 80%, 80% - 90%, or 90% - 100% of HuGlylDS molecules used in accordance with the methods described herein are mannose-6-phosphorylated.
  • Neuronal and glial cells in the CNS are secretory cells that possess the cellular machinery for post-translational processing of secreted proteins - including glycosylation and tyrosine-O-sulfation.
  • hIDS has eight asparaginal ("N") glycosylation sites identified in FIG. 1 (N 31 ST; N 115 FS; N 144 HT; N 246 IT; N 280 IS; N 325 ST; N 513 FS; N 537 DS).
  • Two of the eight N-linked glycosylation sites, namely N 280 and N 116 are mannose-6-phophorylated in IDS obtained from human brain.
  • HuGlylDS used in accordance with the methods described herein when expressed in a neuronal or glial cell, in vivo or in vitro, could be glycosylated at 100%) of its N-glycosylation sites.
  • HuGlylDS used in accordance with the methods described herein, when expressed in a neuronal or glial cell, in vivo or in vitro, could be glycosylated at 100%) of its N-glycosylation sites.
  • N-glycosylation site of HuGlylDS need be N-glycosylated in order for benefits of glycosylation to be attained. Rather, benefits of glycosylation can be realized when only a percentage of N- glycosylation sites are glycosylated, and/or when only a percentage of expressed IDS molecules are glycosylated.
  • HuGlylDS used in accordance with the methods described herein when expressed in a neuronal or glial cell, in vivo or in vitro, is glycosylated at 10% - 20%, 20% - 30%, 30% - 40%, 40% - 50%, 50% - 60%, 60% - 70%, 70% - 80%, 80% - 90%., or 90% - 100%. of its available N-glycosylation sites.
  • 10% - 20%, 20% - 30%, 30% - 40% 40% - 50%, 50% - 60%, 60% - 70%, 70% - 80%, 80% - 90%, or 90% - 100% of
  • HuGlylDS molecules used in accordance with the methods described herein are glycosylated at least one of their available N-glycosylation sites.
  • At least 10%, 20% 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%), 90%), 95%), or 99% of the N-glycosylation sites present in HuGlylDS used in accordance with the methods described herein are glycosylated at an Asn residue (or other relevant residue) present in an N-glycosylation site, when the HuGlylDS is expressed in a neuronal or glial cell, in vivo or in vitro. That is, at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% of the N- glycosylation sites of the resultant HuGlylDS are glycosylated.
  • At least 10%, 20% 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% of the N-glycosylation sites present in a HuGlylDS molecule used in accordance with the methods described herein are glycosylated with an identical attached glycan linked to the Asn residue (or other relevant residue) present in an N-glycosylation site, when the HuGlylDS is expressed in a neuronal or glial cell, in vivo or in vitro. That is, at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% of the N-glycosylation sites of the resultant HuGlylDS have an identical attached glycan.
  • the IDS proteins used in accordance with the methods described herein are expressed in neuronal or glial cells, the need for in vitro production in prokaryotic host cells (e.g., E. coli) or eukaryotic host cells (e.g., CHO cells) is circumvented.
  • prokaryotic host cells e.g., E. coli
  • eukaryotic host cells e.g., CHO cells
  • N- glycosylation sites of the IDS proteins are advantageously decorated with glycans relevant to and beneficial to treatment of humans, and, in particular, at the target location of treatment.
  • Such an advantage is unattainable when CHO cells or s, coli are utilized in protein production, because e.g., CHO cells (1) do not express 2,6 sialyltransferase and thus cannot add 2,6 sialic acid during N-glycosylation and (2) can add Neu5Gc as sialic acid instead of Neu5Ac; and because E. coli does not naturally contain components needed for N-glycosylation. Furthermore, such an advantage may be unattainable when human cells that are not neuronal or glial cells are utilized in protein production.
  • an IDS protein expressed in a neuronal or glial cell to give rise to a HuGlylDS used in the methods of treatment described herein is glycosylated in the manner in which a protein is N-glycosylated in human neuronal or glial cells, but is not glycosylated in the manner in which proteins are glycosylated in CHO cells.
  • an IDS protein expressed in a neuronal or glial cell to give rise to a HuGlylDS used in the methods of treatment described herein is glycosylated in the manner in which a protein is N-glycosylated in a neuronal or glial cells, wherein such glycosylation is not naturally possible using a prokaryotic host cell, e.g., using E. coli.
  • an IDS protein expressed in a human neuronal or glial cell to give rise to a HuGlylDS used in the methods of treatment described herein is glycosylated in the manner in which a protein is N- glycosylated in human neuronal or glial cells, but is not glycosylated in the manner in which proteins are glycosylated in human cells which are not neuronal or glial cells.
  • Assays for determining the glycosylation pattern of proteins are known in the art.
  • hydrazinolysis can be used to analyze glycans.
  • polysaccharides are released from their associated protein by incubation with hydrazine (the Ludger Liberate Hydrazinolysis Glycan Release Kit, Oxfordshire, UK can be used).
  • the nucleophile hydrazine attacks the glycosidic bond between the polysaccharide and the carrier protein and allows release of the attached glycans.
  • N-acetyl groups are lost during this treatment and have to be reconstituted by re-N-acetylation.
  • the free glycans can be purified on carbon columns and subsequently labeled at the reducing end with the fluorophor 2-amino benzamide.
  • the labeled polysaccharides can be separated on a GlycoSep-N column (GL Sciences) according to the HPLC protocol of Royle et al, Anal Biochem 2002, 304(l):70-90.
  • the resulting fluorescence chromatogram indicates the polysaccharide length and number of repeating units.
  • Structural information can be gathered by collecting individual peaks and subsequently performing MS/MS analysis. Thereby the monosaccharide composition and sequence of the repeating unit can be confirmed and additionally in homogeneity of the polysaccharide composition can be identified.
  • peaks of low molecular weight can be analyzed by MALDI-MS/MS and the result used to confirm the glycan sequence.
  • Each peak corresponds to a polymer consisting of a certain number of repeat units and fragments thereof.
  • the chromatogram thus allows measurement of the polymer length distribution.
  • the elution time is an indication for polymer length, while fluorescence intensity correlates with molar abundance for the respective polymer.
  • Homogeneity of the glycan patterns associated with proteins can be assessed using methods known in the art, e.g., methods that measure glycan length and hydrodynamic radius. Size exclusion-HPLC allows the measurement of the hydrodynamic radius. Higher numbers of glycosylation sites in a protein lead to higher variation in hydrodynamic radius compared to a carrier with less glycosylation sites. However, when single glycan chains are analyzed, they may be more homogenous due to the more controlled length. Glycan length can measured by hydrazinolysis, SDS PAGE, and capillary gel electrophoresis. In addition, homogeneity can also mean that certain glycosylation site usage patterns change to a broader/narrower range. These factors can be measured by Glycopeptide LC-MS/MS.
  • N-glycosylation confers numerous benefits on the HuGlylDS used in the methods described herein. Such benefits are unattainable by production of proteins in E. coli, because E. coli does not naturally possess components needed for N-glycosylation. Further, some benefits are unattainable through protein production in, e.g., CHO cells, because CHO cells lack components needed for addition of certain glycans (e.g., 2,6 sialic acid) and because CHO cells can add glycans, e.g., Neu5Gc not typical to humans, and the a-Gal antigen which is
  • IDS immunogenic in most individuals and at high concentrations can trigger anaphylaxis. Even further, some benefits are unattainable through protein production in human cells that are not neuronal or glial cells.
  • the expression of IDS in human neuronal or glial cells results in the production of HuGlylDS comprising beneficial glycans that otherwise would not be associated with the protein if produced in CHO cells, in E. coli, or in human cells which are not neuronal or glial cells.
  • hIDS contains a tyrosine ("Y") sulfation site (PSSEKY 165 ENTKTCRGPD).
  • Y tyrosine
  • PSSEKY 165 ENTKTCRGPD tyrosine sulfation site
  • tyrosine-sulfated proteins cannot be produced in E. coli, which naturally does not possess the enzymes required for tyrosine-sulfation.
  • CHO cells are deficient for tyrosine sulfation-they are not secretory cells and have a limited capacity for post- translational tyrosine-sulfation. See, e.g., Mikkelsen & Ezban, 1991, Biochemistry 30: 1533- 1537.
  • the methods provided herein call for expression of IDS, e.g., HuGlylDS, in neurons or glial cells, which are secretory and do have capacity for tyrosine sulfation.
  • Assays for detection tyrosine sulfation are known in the art. See, e.g., Yang et al., 2015, Molecules 20:2138-2164.
  • Tyrosine-sulfation of hIDS - a robust post-translational process in human CNS cells - should result in improved processing and activity of transgene products.
  • the significance of tyrosine-sulfation of lysosomal proteins has not been elucidated; but in other proteins it has been shown to increase avidity of protein-protein interactions (antibodies and receptors), and to promote proteolytic processing (peptide hormone). (See, Moore, 2003, J Biol. Chem. 278:24243- 46; and Bundegaard et al., 1995, The EMBO J 14: 3073-79).
  • TPST1 The tyrosylprotein sulfotransferase (TPST1) responsible for tyrosine-sulfation (which may occur as a final step in IDS processing) is apparently expressed at higher levels (based on mRNA) in the brain (gene expression data for TPST1 may be found, for example, at the EMBL-EBI Expression Atlas, accessible at http://www.ebi.ac.uk/gxa/home).
  • viral vectors or other DNA expression constructs encoding iduronate-2-sulfatase (IDS), e.g., human IDS (hIDS).
  • IDS iduronate-2-sulfatase
  • hIDS human IDS
  • the viral vectors and other DNA expression constructs provided herein include any suitable method for delivery of a transgene to the cerebrospinal fluid (CSF).
  • the means of delivery of a transgene include viral vectors, liposomes, other lipid-containing complexes, other macromolecular complexes, synthetic modified mRNA, unmodified mRNA, small molecules, non-biologically active molecules (e.g., gold particles), polymerized molecules (e.g., dendrimers), naked DNA, plasmids, phages, transposons, cosmids, or episomes.
  • the vector is a targeted vector, e.g., a vector targeted to neuronal cells.
  • the disclosure provides for a nucleic acid for use, wherein the nucleic acid encodes an IDS, e.g., hIDS, operatively linked to a promoter selected from the group consisting of: cytomegalovirus (CMV) promoter, Rous sarcoma virus (RSV) promoter, MMT promoter, EF-1 alpha promoter, UB6 promoter, chicken beta-actin promoter, CAG promoter, RPE65 promoter and opsin promoter.
  • CMV cytomegalovirus
  • RSV Rous sarcoma virus
  • MMT Rous sarcoma virus
  • EF-1 alpha promoter e.g., UB6 promoter
  • UB6 promoter EF-1 alpha promoter
  • UB6 promoter EF-1 alpha promoter
  • UB6 promoter EF-1 alpha promoter
  • UB6 promoter EF-1 alpha promoter
  • UB6 promoter EF-1 alpha promoter
  • the nucleic acids may comprise DNA, RNA, or a combination of DNA and RNA.
  • the DNA comprises one or more of the sequences selected from the group consisting of promoter sequences, the sequence of the gene of interest (the transgene, e.g., IDS), untranslated regions, and termination sequences.
  • viral vectors provided herein comprise a promoter operably linked to the gene of interest.
  • nucleic acids e.g., polynucleotides
  • nucleic acid sequences disclosed herein may be codon-optimized, for example, via any codon-optimization technique known to one of skill in the art (see, e.g., review by Quax et al., 2015, Mol Cell 59: 149-161).
  • the disclosure provides for a formulation comprising a recombinant nucleotide expression vector encoding human IDS, wherein the formulation is suitable for administration to the cerebrospinal fluid of human brain, so that a depot is formed in the human central nervous system that secretes a recombinant human IDS glycoprotein precursor that is about 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa, 90 kDa, 91 kDa, 92 kDa, 93 kDa, 94 kDa, or 95 kDa) as measured by polyacrylamide gel electrophoresis, contains a
  • the formulation may contain buffer (such as, a buffer having a particular pH, or a buffer containing a particular ingredient) that makes it suitable for administration to the cerebrospinal fluid of human brain, so that a depot is formed in the human central nervous system that secretes a recombinant human IDS
  • the glycoprotein precursor that is about 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa, 90 kDa, 91 kDa, 92 kDa, 93 kDa, 94 kDa, or 95 kDa) as measured by polyacrylamide gel electrophoresis, contains a formylglycine, is a2,6-sialylated, does not contain detectable NeuGc, does not contain a-Gal antigen, and/or is mannose-6-phosphorylated.
  • the buffer comprises a physiologically compatible aqueous buffer, a surfactant and optional excipients.
  • the disclosure provides for a kit comprising a recombinant nucleotide expression vector encoding human IDS and a pharmaceutically acceptable carrier, wherein the recombinant nucleotide expression vector is suitable for administration to the cerebrospinal fluid (CSF) of human brain, so that a depot is formed in the human central nervous system that secretes a recombinant human IDS glycoprotein precursor that is about 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa, 90 kDa, 91 kDa, 92 kDa, 93 kDa, 94 kDa, or 95 kDa) as measured by polyacrylamide gel electrophoresis, contains a formylglycine, is a2,6-sialylated, does not contain detectable NeuGc, does not contain detectable a-Gal anti
  • the disclosure provides for a kit comprising a formulation comprising a recombinant nucleotide expression vector encoding human IDS, wherein the formulation is suitable for administration to the CSF of human brain, so that a depot is formed in the human central nervous system that secretes a recombinant human IDS glycoprotein precursor that is about 90 kDa (e.g., 85 kDa, 86 kDa, 87 kDa, 88 kDa, 89 kDa, 90 kDa, 91 kDa, 92 kDa, 93 kDa, 94 kDa, or 95 kDa) as measured by polyacrylamide gel electrophoresis, contains a formylglycine, is a2,6-sialylated, does not contain detectable NeuGc, does not contain detectable a-Gal antigen, and/or is mannose-6-phosphorylated.
  • a formylglycine is a2,
  • a kit described herein comprises the recombinant nucleotide expression vector or the formulation in one or more containers.
  • Optionally associated with such one or more containers can be a notice in the form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals or biological products, which notice reflects approval by the agency of manufacture, use or sale for human administration.
  • formulations and kits encompassed herein can be used in accordance with the methods for treating a human patient as provided in this disclosure.
  • the vectors provided herein are modified mRNA encoding for the gene of interest (e.g., the transgene, for example, IDS).
  • the transgene for example, IDS
  • the synthesis of modified and unmodified mRNA for delivery of a transgene to the CSF is taught, for example, in
  • a modified mRNA encoding for IDS e.g., hIDS.
  • Viral vectors include adenovirus, adeno-associated virus (AAV, e.g., AAV9, AAVrhlO), lentivirus, helper-dependent adenovirus, herpes simplex virus, poxvirus, hemagglutinin virus of Japan (HVJ), alphavirus, vaccinia virus, and retrovirus vectors.
  • AAV adeno-associated virus
  • AAVrhlO e.g., AAV9, AAVrhlO
  • lentivirus e.g., AAV9, AAVrhlO
  • helper-dependent adenovirus lentivirus
  • herpes simplex virus poxvirus
  • poxvirus poxvirus
  • HVJ hemagglutinin virus of Japan
  • alphavirus hemagglutinin virus of Japan
  • vaccinia virus vaccinia virus
  • Retroviral vectors include murine leukemia virus (MLV)- and human immunodeficiency virus (HlV)-based vectors.
  • Alphavirus vectors include semliki forest virus (SFV) and Sindbis virus (SIN).
  • the viral vectors provided herein are recombinant viral vectors.
  • the viral vectors provided herein are altered such that they are replication-deficient in humans.
  • the viral vectors are hybrid vectors, e.g., an AAV vector placed into a "helpless" adenoviral vector.
  • viral vectors comprising a viral capsid from a first virus and viral envelope proteins from a second virus.
  • the second virus is vesicular stomatitus virus (VSV).
  • the envelope protein is VSV-G protein.
  • the viral vectors provided herein are HIV based viral vectors.
  • HIV-based vectors provided herein comprise at least two
  • gag and pol genes are from an HIV genome and the env gene is from another virus.
  • the viral vectors provided herein are herpes simplex virus- based viral vectors.
  • herpes simplex virus-based vectors provided herein are modified such that they do not comprise one or more immediately early (IE) genes, rendering them non-cytotoxic.
  • the viral vectors provided herein are MLV based viral vectors.
  • MLV-based vectors provided herein comprise up to 8 kb of heterologous DNA in place of the viral genes.
  • the viral vectors provided herein are lentivirus-based viral vectors.
  • lentiviral vectors provided herein are derived from human lentiviruses.
  • lentiviral vectors provided herein are derived from non- human lentiviruses.
  • lentiviral vectors provided herein are packaged into a lentiviral capsid.
  • lentiviral vectors provided herein comprise one or more of the following elements: long terminal repeats, a primer binding site, a polypurine tract, att sites, and an encapsidation site.
  • the viral vectors provided herein are alphavirus-based viral vectors.
  • alphavirus vectors provided herein are recombinant, replication-defective alphaviruses.
  • alphavirus replicons in the alphavirus vectors provided herein are targeted to specific cell types by displaying a functional heterologous ligand on their virion surface.
  • the viral vectors provided herein are AAV based viral vectors.
  • the viral vectors provided herein are AAV9 or AAVrhlO based viral vectors.
  • the AAV9 or AAVrhlO based viral vectors provided herein retain tropism for CNS cells. Multiple AAV serotypes have been identified.
  • AAV-based vectors provided herein comprise components from one or more serotypes of AAV.
  • AAV based vectors provided herein comprise components from one or more of AAVl, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAVrhlO, AAV10 or AAVl 1.
  • AAV based vectors provided herein comprise components from one or more of AAV8, AAV9, AAVrhlO, AAV10, or AAVl 1 serotypes.
  • AAV9-based viral vectors are used in the methods described herein. Nucleic acid sequences of AAV based viral vectors and methods of making recombinant AAV and AAV capsids are taught, for example, in United States Patent No. 7,282, 199 B2, United States Patent No. 7,790,449 B2, United States Patent No. 8,318,480 B2, United States Patent No. 8,962,332 B2 and International Patent Application No. PCT/EP2014/076466, each of which is incorporated herein by reference in its entirety.
  • AAV e.g., AAV9 or AAVrhl0
  • AAV9-based viral vectors encoding a transgene (e.g., IDS).
  • IDS transgene
  • AAV9-based viral vectors encoding IDS.
  • AAV9-based viral vectors encoding hIDS are examples of AAV9-based viral vectors.
  • AAV9 vectors comprising an artificial genome comprising (i) an expression cassette containing the transgene under the control of regulatory elements and flanked by ITRs; and (ii) a viral capsid that has the amino acid sequence of the AAV9 capsid protein or is at least 95%, 96%, 97%, 98%, 99% or 99.9% identical to the amino acid sequence of the AAV9 capsid protein (SEQ ID NO: 26) while retaining the biological function of the AAV9 capsid.
  • the encoded AAV9 capsid has the sequence of SEQ ID NO: 26 with 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 amino acid substitutions and retaining the biological function of the AAV9 capsid.
  • FIG. 6 provides a comparative alignment of the amino acid sequences of the capsid proteins of different AAV serotypes with potential amino acids that may be substituted at certain positions in the aligned sequences based upon the comparison in the row labeled SUBS.
  • the AAV9 vector comprises an AAV9 capsid variant that has 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 amino acid substitutions identified in the SUBS row of FIG. 6 that are not present at that position in the native AAV9 sequence.
  • the AAV that is used in the methods described herein is Anc80 or Anc80L65, as described in Zinn et al., 2015, Cell Rep. 12(6): 1056-1068, which is incorporated by reference in its entirety.
  • the AAV that is used in the methods described herein comprises one of the following amino acid insertions: LGETTRP or LALGETTRP, as described in United States Patent Nos. 9, 193,956; 9458517; and 9,587,282 and US patent application publication no. 2016/0376323, each of which is incorporated herein by reference in its entirety.
  • the AAV that is used in the methods described herein is AAV.7m8, as described in United States Patent Nos. 9, 193,956; 9,458,517; and
  • the AAV that is used in the methods described herein is any AAV disclosed in United States Patent No. 9,585,971, such as AAV-PHP.B.
  • the AAV that is used in the methods described herein is an AAV disclosed in any of the following patents and patent applications, each of which is incorporated herein by reference in its entirety: United States Patent Nos. 7,906, 111; 8,524,446; 8,999,678; 8,628,966; 8,927,514; 8,734,809; US 9,284,357; 9,409,953; 9,169,299; 9, 193,956; 9458517; and 9,587,282 US patent application publication nos. 2015/0374803; 2015/0126588; 2017/0067908; 2013/0224836; 2016/0215024; 2017/0051257; and International Patent
  • a single-stranded AAV may be used supra.
  • a self-complementary vector e.g., scAAV
  • scAAV single-stranded AAV
  • a self-complementary vector e.g., Wu, 2007, Human Gene Therapy, 18(2): 171-82, McCarty et al, 2001, Gene Therapy, Vol 8, Number 16, Pages 1248-1254; and U.S. Patent Nos. 6,596,535; 7,125,717; and 7,456,683, each of which is incorporated herein by reference in its entirety).
  • the viral vectors used in the methods described herein are adenovirus based viral vectors .
  • a recombinant adenovirus vector may be used to transfer in the IDS.
  • the recombinant adenovirus can be a first generation vector, with an El deletion, with or without an E3 deletion, and with the expression cassette inserted into either deleted region.
  • the recombinant adenovirus can be a second generation vector, which contains full or partial deletions of the E2 and E4 regions.
  • a helper-dependent adenovirus retains only the adenovirus inverted terminal repeats and the packaging signal (phi).
  • the transgene is inserted between the packaging signal and the 3'ITR, with or without stuff er sequences to keep the artificial genome close to wild-type size of approx. 36 kb.
  • An exemplary protocol for production of adenoviral vectors may be found in Alba et al., 2005, "Gutless adenovirus: last generation adenovirus for gene therapy," Gene Therapy 12:S18-S27, which is incorporated by reference herein in its entirety.
  • the viral vectors used in the methods described herein are lentivirus based viral vectors .
  • a recombinant lentivirus vector may be used to transfer in the IDS.
  • Four plasmids are used to make the construct: Gag/pol sequence containing plasmid, Rev sequence containing plasmids, Envelope protein containing plasmid (i.e. VSV-G), and Cis plasmid with the packaging elements and the IDS gene.
  • the four plasmids are co-transfected into cells (i.e., HEK293 based cells), whereby polyethylenimine or calcium phosphate can be used as transfection agents, among others.
  • the lentivirus is then harvested in the supernatant
  • a vector for use in the methods described herein is one that encodes an IDS (e.g., hIDS) such that, upon transduction of cells in the CNS, or a relevant cell (e.g., a neuronal cell in vivo or in vitro), a glycosylated variant of IDS is expressed by the transduced cell.
  • IDS e.g., hIDS
  • a relevant cell e.g., a neuronal cell in vivo or in vitro
  • a vector for use in the methods described herein is one that encodes an IDS (e.g., hIDS) such that, upon transduction of a cell in the CNS, or a relevant cell (e.g., a neuronal cell in vivo or in vitro), a sulfated variant of IDS is expressed by the cell.
  • IDS e.g., hIDS
  • the vectors provided herein comprise components that modulate gene delivery or gene expression ⁇ e.g., "expression control elements"). In certain embodiments, the vectors provided herein comprise components that modulate gene expression. In certain embodiments, the vectors provided herein comprise components that influence binding or targeting to cells. In certain embodiments, the vectors provided herein comprise components that influence the localization of the polynucleotide ⁇ e.g., the transgene) within the cell after uptake. In certain embodiments, the vectors provided herein comprise components that can be used as detectable or selectable markers, e.g., to detect or select for cells that have taken up the polynucleotide.
  • the viral vectors provided herein comprise one or more promoters.
  • the promoter is a constitutive promoter.
  • the promoter is an inducible promoter.
  • the native IDS gene like most housekeeping genes, primarily uses a GC-rich promoter.
  • strong constitutive promoters that provide for sustained expression of hIDS are used.
  • Such promoters include “CAG” synthetic promoters that contain: “C” - the cytomegalovirus (CMV) early enhancer element; “A” - the promoter as well as the first exon and intron of the chicken beta- actin gene; and “G” - the splice acceptor of the rabbit beta-globin gene (see, Miyazaki et al., 1989, Gene 79: 269-277; and Niwa et al., Gene 108: 193-199).
  • CMV cytomegalovirus
  • the promoter is a CB7 promoter ⁇ see Dinculescu et al., 2005, Hum Gene Ther 16: 649-663, incorporated by reference herein in its entirety).
  • the CB7 promoter includes other expression control elements that enhance expression of the transgene driven by the vector.
  • the other expression control elements include chicken ⁇ -actin intron and/or rabbit ⁇ -globin polA signal.
  • the promoter comprises a TATA box.
  • the promoter comprises one or more elements.
  • the one or more promoter elements may be inverted or moved relative to one another.
  • the elements of the promoter are positioned to function cooperatively.
  • the elements of the promoter are positioned to function independently.
  • the viral vectors provided herein comprise one or more promoters selected from the group consisting of the human CMV immediate early gene promoter, the SV40 early promoter, the Rous sarcoma virus (RS) long terminal repeat, and rat insulin promoter.
  • the vectors provided herein comprise one or more long terminal repeat (LTR) promoters selected from the group consisting of AAV, MLV, MMTV, SV40, RSV, HIV-1, and HIV-2 LTRs.
  • the vectors provided herein comprise one or more tissue specific promoters (e.g., a neuronal cell-specific promoter).
  • the viral vectors provided herein comprise one or more regulatory elements other than a promoter. In certain embodiments, the viral vectors provided herein comprise an enhancer. In certain embodiments, the viral vectors provided herein comprise a repressor. In certain embodiments, the viral vectors provided herein comprise an intron or a chimeric intron. In certain embodiments, the viral vectors provided herein comprise a polyadenylation sequence.
  • the vectors provided herein comprise components that modulate protein delivery.
  • the viral vectors provided herein comprise one or more signal peptides.
  • the signal peptides allow for the transgene product (e.g., IDS) to achieve the proper packaging (e.g. glycosylation) in the cell.
  • the signal peptides allow for the transgene product (e.g., IDS) to achieve the proper localization in the cell.
  • the signal peptides allow for the transgene product (e.g., IDS) to achieve secretion from the cell. Examples of signal peptides to be used in connection with the vectors and transgenes provided herein may be found in Table 1.
  • Signal peptides may also be referred to herein as leader sequences or leader peptides.
  • FAM19A1 (TAFA1) signal MAMVSAMSWVLYLWISACA
  • the viral vectors provided herein comprise one or more untranslated regions (UTRs), e.g., 3' and/or 5' UTRs.
  • UTRs are optimized for the desired level of protein expression.
  • the UTRs are optimized for the mRNA half life of the transgene.
  • the UTRs are optimized for the stability of the mRNA of the transgene.
  • the UTRs are optimized for the secondary structure of the mRNA of the transgene. 5.2.6. Inverted terminal repeats
  • the viral vectors provided herein comprise one or more inverted terminal repeat (ITR) sequences.
  • ITR sequences may be used for packaging the recombinant gene expression cassette into the virion of the viral vector.
  • the ITR is from an AAV, e.g., AAV9 (see, e.g., Yan et al., 2005, J. Virol., 79(l):364-379;
  • the vectors provided herein encode an IDS transgene.
  • the IDS is controlled by appropriate expression control elements for expression in neuronal cells:
  • the IDS ⁇ e.g., hIDS) transgene comprises the amino acid sequence of SEQ ID NO: 1.
  • the IDS ⁇ e.g., hIDS) transgene comprises an amino acid sequence that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the sequence set forth in SEQ ID NO: 1.
  • the HuGlylDS encoded by the transgene can include, but is not limited to human IDS (hIDS) having the amino acid sequence of SEQ ID NO. 1 (as shown in FIG. 1), and derivatives of hIDS having amino acid substitutions, deletions, or additions, e.g., including but not limited to amino acid substitutions selected from corresponding non-conserved residues in orthologs of IDS shown in FIG.
  • hIDS human IDS having the amino acid sequence of SEQ ID NO. 1 (as shown in FIG. 1)
  • derivatives of hIDS having amino acid substitutions, deletions, or additions e.g., including but not limited to amino acid substitutions selected from corresponding non-conserved residues in orthologs of IDS shown in FIG.
  • amino acid substitutions at a particular position of hIDS can be selected from among corresponding non-conserved amino acid residues found at that position in the IDS orthologs aligned in FIG. 2, with the proviso that such substitutions do not include any of the deleterious mutations shown in FIG. 3 or as reported by Sukegawa-Hayasaka et al., 2006, supra; Millat et al., 1998, supra; or Bonucelli et al., 2001, supra, each of which is incorporated by reference herein in its entirety.
  • the resulting transgene product can be tested using conventional assays in vitro, in cell culture or test animals to ensure that the mutation does not disrupt IDS function.
  • Preferred amino acid substitutions, deletions or additions selected should be those that maintain or increase enzyme activity, stability or half-life of IDS, as tested by conventional assays in vitro, in cell culture or animal models for MPS II.
  • the enzyme activity of the transgene product can be assessed using a conventional enzyme assay with, for example, 4- Methylumbelliferyl a-L-idopyranosiduronic acid 2-sulfate or 4-methylumbelliferyl sulfate as the substrate (see, e.g., Lee et al., 2015, Clin. Biochem. 48(18): 1350-1353, Dean et al., 2006, Clin. Chem.
  • the ability of the transgene product to correct MPS II phenotype can be assessed in cell culture; e.g., by transducing MPS II cells in culture with a viral vector or other DNA expression construct encoding hIDS or a derivative; by adding the transgene product or a derivative to MPS II cells in culture; or by co-culturing MPS II cells with human neuronal/glial host cells engineered to express and secrete rhIDS or a derivative, and determining correction of the defect in the MPS II cultured cells, e.g., by detecting IDS enzyme activity and/or reduction in GAG storage in the MPS II cells in culture (see, e.g., Stroncek et al., 1999, Transfusion 39(4):343-350, which is incorporated by reference herein in its entirety).
  • the viral vectors provided herein comprise the following elements in the following order: a) a first ITR sequence, b) a first linker sequence, c) a promoter sequence, d) a second linker sequence, e) an intron sequence, f) a third linker sequence, g) a sequence encoding the transgene (e.g., IDS), h) a fourth linker sequence, i) a poly A sequence, j) a fifth linker sequence, and k) a second ITR sequence.
  • the viral vectors provided herein comprise the following elements in the following order: a) a promoter sequence, and b) a sequence encoding the transgene (e.g., IDS).
  • the viral vectors provided herein comprise the following elements in the following order: a) a promoter sequence, and b) a sequence encoding the transgene (e.g., IDS), wherein the transgene comprises a signal peptide.
  • the viral vectors provided herein comprise the following elements in the following order: a) a first ITR sequence, b) a first linker sequence, c) a promoter sequence, d) a second linker sequence, e) an intron sequence, f) a third linker sequence, g) a first UTR sequence, h) a sequence encoding the transgene (e.g., IDS), i) a second UTR sequence, j) a fourth linker sequence, k) a poly A sequence, 1) a fifth linker sequence, and m) a second ITR sequence.
  • the viral vectors provided herein comprise the following elements in the following order: a) a first ITR sequence, b) a first linker sequence, c) a promoter sequence, d) a second linker sequence, e) an intron sequence, f) a third linker sequence, g) a first UTR sequence, h) a sequence encoding the transgene (e.g., IDS), i) a second UTR sequence, j) a fourth linker sequence, k) a poly A sequence, 1) a fifth linker sequence, and m) a second ITR sequence, wherein the transgene comprises a signal peptide, and wherein the transgene encodes hIDS.
  • the viral vectors provided herein may be manufactured using host cells.
  • the viral vectors provided herein may be manufactured using mammalian host cells, for example, A549 , WEHI, 10T1/2, BHK, MDCK, COS1, COS7, BSC 1, BSC 40, BMT 10, VERO, W138, HeLa, 293, Saos, C2C12, L, HT1080, HepG2, primary fibroblast, hepatocyte, and myoblast cells.
  • the viral vectors provided herein may be manufactured using host cells from human, monkey, mouse, rat, rabbit, or hamster.
  • the host cells are stably transformed with the sequences encoding the transgene and associated elements (i.e., the vector genome), and the means of producing viruses in the host cells, for example, the replication and capsid genes (e.g., the rep and cap genes of AAV).
  • the replication and capsid genes e.g., the rep and cap genes of AAV.
  • Virions may be recovered, for example, by CsCh sedimentation.
  • in vitro assays can be used to measure transgene expression from a vector described herein, thus indicating, e.g., potency of the vector.
  • a vector described herein e.g., the HT- 22, SK-N-MC, HCN-1 A, HCN-2, NT2, SH-SY5y, hNSCl 1, or ReNcell VM cell lines, or other cell lines that are derived from neuronal or glial cells or progenitors of neuronal or glial cells can be used to assess transgene expression.
  • characteristics of the expressed product i.e., HuGlylDS
  • HuGlylDS characteristics of the expressed product
  • compositions comprising a vector encoding a transgene described herein and a suitable carrier.
  • a suitable carrier e.g., for administration to the CSF, and, for example, to neuronal cells
  • Methods are described for the administration of a therapeutically effective amount of a transgene construct to human subjects having MPS II. More particularly, methods for administration of a therapeutically effective amount of a transgene construct to patients having MPS II, in particular, for administration to the CSF are described. In particular embodiments, such methods for administration to the CSF of a therapeutically effective amount of a transgene construct can be used to treat to patients having Hunter's syndrome.
  • therapeutically effective doses of the recombinant vector are administered to patients diagnosed with MPS II.
  • the patients have been diagnosed with mild MPS II.
  • the patients have been diagnosed with severe MPS II.
  • the patients have been diagnosed with Hunter's syndrome.
  • therapeutically effective doses of the recombinant vector are administered to patients diagnosed with MPS II who have been identified as responsive to treatment with IDS, e.g., hIDS.
  • therapeutically effective doses of the recombinant vector are administered to pediatric patients. In certain embodiments, therapeutically effective doses of the recombinant vector are administered to patients that are less than three years old. In certain embodiments, therapeutically effective doses of the recombinant vector are administered to patients that are aged 2 to 4 years old. In certain embodiments, therapeutically effective doses of the recombinant vector are administered to patients that are 4 months old or older and less than 5 years old. In a specific embodiment, therapeutically effective doses of the recombinant vector are administered to patients that have severe MPS II and are 4 months old or older and less than 5 years old.
  • therapeutically effective doses of the recombinant vector are administered to patients that are 18 months old or older and 8 years old or younger. In a specific embodiment, therapeutically effective doses of the recombinant vector are administered to patients that are pediatric male patients and are 18 months old or older and 8 years old or younger. In certain embodiments, therapeutically effective doses of the recombinant vector are administered to patients that are aged 3 to 8 years old. In certain embodiments, therapeutically effective doses of the recombinant vector are administered to patients that are aged 8 to 16 years old. In certain embodiments, therapeutically effective doses of the recombinant vector are administered to patients that are 10 years old or younger. In a specific embodiment,
  • therapeutically effective doses of the recombinant vector are administered to patients that have severe MPS II and are 10 years old or younger. In certain embodiments, therapeutically effective doses of the recombinant vector are administered to patients that are more than 10 years old. In certain embodiments, therapeutically effective doses of the recombinant vector are administered to adolescent patients. In certain embodiments, therapeutically effective doses of the recombinant vector are administered to adult patients.
  • therapeutically effective doses of the recombinant vector are administered to patients diagnosed with MPS II who have been identified as responsive to treatment with IDS, e.g., hIDS, injected into the CSF prior to treatment with gene therapy.
  • IDS e.g., hIDS
  • therapeutically effective doses of the recombinant vector are administered to the CSF via intrathecal administration (i.e., injection into the subarachnoid space so that the recombinant vectors distribute through the CSF and transduce cells in the CNS).
  • intrathecal administration i.e., injection into the subarachnoid space so that the recombinant vectors distribute through the CSF and transduce cells in the CNS. This can be accomplished in a number of ways - e.g., by intracranial (cisternal or ventricular) injection , or injection into the lumbar cistern.
  • intrathecal administration i.e., injection into the subarachnoid space so that the recombinant vectors distribute through the CSF and transduce cells in the CNS.
  • intracranial (cisternal or ventricular) injection e.g., injection into the lumbar cistern.
  • intrathecal administration i.e., injection into the subarachnoid space so that
  • intraci sternal (IC) injection e.g., into the cisterna magna
  • intraci sternal injection is performed by CT-guided suboccipital puncture.
  • intrathecal injection is performed by lumbar puncture.
  • injection into the subarachnoid space is performed by CI -2 puncture if feasible for the patient.
  • therapeutically effective doses of the recombinant vector are administered to the CNS via intranasal administration.
  • IC intraci sternal
  • CT-guided suboccipital puncture e.g., CT-guided suboccipital puncture.
  • intrathecal injection is performed by lumbar puncture.
  • injection into the subarachnoid space is performed by CI -2 puncture if feasible for the patient.
  • therapeutically effective doses of the recombinant vector are administered to the CNS via intranasal administration.
  • intranasal administration e.g., CI -2 puncture if feasible for
  • therapeutically effective doses of the recombinant vector are administered to the CNS via intraparenchymal injection.
  • intraparenchymal injection is targeted to the striatum.
  • intraparenchymal injection is targeted to the white matter.
  • therapeutically effective doses of the recombinant vector are
  • therapeutically effective doses of the recombinant vector should be administered to the CSF in an injection volume, preferably up to about 20 mL.
  • a carrier suitable for intrathecal injection such as Elliotts B Solution, should be used as a vehicle for the recombinant vectors.
  • Elliots B Solution (generic name: sodium chloride, sodium bicarbonate, anhydrous dextrose, magnesium sulfate, potassium chloride, calcium chloride and sodium phosphate) is a sterile, nonpyrogenic, isotonic solution containing no bacteriostatic preservatives and is used as a diluent for intrathecal administration of chemotherapeutics.
  • a non-replicating recombinant AAV9 vector expressing human iduronate-2-sulfatase is used for treatment.
  • the IDS expression cassette is flanked by inverted terminal repeats (ITRs) and expression is driven by a hybrid of the cytomegalovirus (CMV) enhancer and the chicken beta actin promoter (CB7).
  • the transgene includes the chicken beta actin intron and a rabbit beta-globin polyadenylation (poly A) signal.
  • the rAAV9.hIDS is administered IC (by suboccipital injection) as a single flat dose ranging from 1.4 x 10 13 GC (1.1 x 10 10 GC/g brain mass) to 7.0 ⁇ 10 13 GC (5.6 ⁇ 10 10 GC/g brain mass) in a volume of about 5 to 20 ml. In the event the patient has neutralizing antibodies to AAV, doses at the high range may be used.
  • Combinations of administration of the HuGlylDS to the CSF accompanied by administration of other available treatments are encompassed by the methods of the invention.
  • the additional treatments may be administered before, concurrently or subsequent to the gene therapy treatment.
  • Available treatments for MPS II that could be combined with the gene therapy of the invention include but are not limited to enzyme replacement therapy (ERT) using idursulfase administered systemically or to the CSF; and/or HSCT therapy.
  • ERT can be administered using the rHuGlylDS glycoprotein produced in human neuronal and glial cell lines by recombinant DNA technology.
  • Human neuronal and glial cell lines that can be used for such recombinant glycoprotein production include but are not limited to HT-22, SK-N-MC, HCN-1 A, HCN-2, NT2, SH-SY5y, hNSC l 1, or ReNcell VM to name a few.
  • the cell line used for production can be enhanced by engineering the host cells to co-express a-2,6- sialyltransferase (or both a-2,3- and a-2,6-sialyltransferases) and/or TPST-1 and TPST-2 enzymes responsible for tyrosine-O-sulfation.
  • biomarkers of disease such as GAG
  • IDS enzyme activity in CSF and/or serum.
  • efficacy of treatment with the recombinant vector is monitored by measuring the level of a disease biomarker in the patient.
  • the level of the disease biomarker is measured in the CSF of the patient.
  • the level of the disease biomarker is measured in the serum of the patient.
  • the level of the disease biomarker is measured in the urine of the patient.
  • the disease biomarker is GAG.
  • the disease biomarker is IDS enzyme activity.
  • the disease biomarker is
  • the disease biomarker is a safety event.
  • cognitivitor function is measured by any method known to one of skill in the art.
  • cognitive function is measured via a validated instrument for measuring intelligence quotient (IQ).
  • IQ is measured by Wechsler Abbreviated Scale of Intelligence, Second Edition (WASI-II).
  • cognitive function is measured via a validated instrument for measuring memory.
  • memory is measured by Hopkins Verbal Learning Test (HVLT).
  • cognitive function is measured via a validated instrument for measuring attention.
  • attention is measured by Test Of Variables of Attention (TOVA).
  • cognitive function is measured via a validated instrument for measuring one or more of IQ, memory, and attention.
  • efficacy of treatment with the recombinant vector is monitored by measuring physical characteristics associated with lysosomal storage deficiency in the patient.
  • the physical characteristics are storage lesions.
  • the physical characteristic is short stature.
  • the physical characteristic is coarsened facial features.
  • the physical characteristic is obstructive sleep apnea.
  • the physical characteristic is hearing impairment.
  • the physical characteristic is vision impairment.
  • the visual impairment is due to corneal clouding.
  • the physical characteristic is hydrocephalus.
  • the physical characteristic is spinal cord compression.
  • the physical characteristic is
  • the physical characteristics are bone and joint deformities. In certain embodiments, the physical characteristic is cardiac valve disease. In certain embodiments, the physical characteristics are recurrent upper respiratory infections. In certain embodiments, the physical characteristic is carpal tunnel syndrome. In certain
  • the physical characteristic is macroglossia (enlarged tongue). In certain embodiments, the physical characteristic is enlarged vocal cords and/or change in voice. Such physical characteristics may be measured by any method known to one of skill in the art. TABLE OF SEQUENCES
  • ARGLVLPGYNYLGPGNGLDRGEPVNRADEVAREHDISYNE QLEAGDNPYLKYNHADAEFQEKLADDTSFGGNLGKAVFQA KKRVLEPFGLVEEGAKTAPTGKRIDDHFPKRKKARTEEDS KPSTSSDAEAGPSGSQQLQIPAQPASSLGADTMSAGGGGP LGDNNQGADGVGNASGDWHCDSTWMGDRWTKSTRTWVLP SYNNHQYREIKSGSVDGSNANAYFGYSTPWGYFDFNRFHS HWSPRDWQRLINNYWGFRPRSLRVKIFNIQVKEVTVQDST TTIANNLTSTVQVFTDDDYQLPYWGNGTEGCLPAFPPQV FTLPQYGYATLNRDNTENPTERSSFFCLEYFPSKMLRTGN NFEFTYNFEEVPFHSSFAPSQNLFKLANPLVDQYLYRFVS TNNTGGVQFNKNLAGRYANTYKNWFPGPMGRTQGWNLGSG V
  • a hIDS cDNA-based vector comprising a transgene comprising hIDS (SEQ ID NO: 1).
  • the transgene also comprises nucleic acids comprising a signal peptide chosen from the group listed in Table 2.
  • the vector additionally comprises a promoter.
  • a hIDS cDNA-based vector is constructed comprising a transgene comprising hIDS having amino acid substitutions, deletions, or additions compared to the hIDS sequence of SEQ ID NO: 1, e.g., including but not limited to amino acid substitutions selected from corresponding non-conserved residues in orthologs of IDS shown in FIG.
  • the transgene also comprises nucleic acids comprising a signal peptide chosen from the group listed in Table 2.
  • the vector additionally comprises a promoter.
  • An hIDS cDNA-based vector is deemed useful for treatment of MPS II when expressed as a transgene.
  • An animal model for MPS II for example a mouse model described in Garcia et al., 2007, J Inherit Metab Dis 30: 924-34 or Muenzer et al., 2001, Acta Paediatr Suppl 91 :98-99 is administered a recombinant vector that encodes hIDS intrathecally at a dose sufficient to deliver and maintain a therapeutically effective concentration of the transgene product in the CSF of the animal. Following treatment, the animal is evaluated for improvement in symptoms consistent with the disease in the particular animal model.
  • An hIDS cDNA-based vector is deemed useful for treatment of MPS II when expressed as a transgene.
  • a subject presenting with MPS II is administered a cDNA-based vector that encodes hIDS (e.g., such as Construct 1 (see below) intrathecally at a dose sufficient to deliver and maintain a therapeutic concentration of the transgene product in the CSF.
  • hIDS e.g., such as Construct 1 (see below
  • Construct 1 AAV9.CB7.hIDS (recombinant adeno-associated virus serotype 9 capsid containing human iduronate-2-sulfatase expression cassette). See paragraph [0019] and
  • Product will be delivered as a single intraci sternal (IC) dose.
  • IC intraci sternal
  • Two dose levels will be evaluated, 1.3 ⁇ 10 10 genome copies (GC)/g brain mass (Dose 1) and 6.5 ⁇ 10 10 GC/g brain mass (Dose 2).
  • Total dose administered will account for estimated brain size of study subjects based on their age. Total volume of product administered will not exceed 5 mL.
  • Construct 1 administered by IC injection.
  • Safety will be the primary focus for the initial 24 weeks after treatment (primary study period). Following completion of the primary study period, subjects will continue to be assessed (safety and efficacy) for up to a total of 104 weeks following treatment with Construct 1. At the end of the study, subjects will be invited to participate in a long-term follow-up study.
  • the first 3 eligible subjects will be enrolled into the Dose 1 cohort (1.3 ⁇ 10 10 GC/g brain mass). After Construct 1 administration to the first subject, there will be an 8-week observation period for safety.
  • the Internal Safety Committee (ISC) will review the safety data obtained during the first 8 weeks (including data obtained during the Week 8 visit) for this subject, and if there are no safety concerns, the 2 nd subject may be enrolled. The same process will be used to enroll the 3 rd subject. If no safety review trigger (SRT) event is observed, all available safety data for the Dose 1 cohort obtained up to and including the Week 8 visit for the 3 rd subject will be evaluated by the Independent Data Monitoring Committee (IDMC).
  • ISC Internal Safety Committee
  • the subsequent 2 subjects will follow the same dosing scheme as the initial dose cohort with dosing of each subsequent subject occurring after all safety data obtained during the first 8 weeks (including data obtained during the Week 8 visit) for the last dosed subject have been reviewed.
  • the ISC will review all subject safety data obtained up to and including the Week 2 visit of the 2 nd subject and may determine that it is safe to proceed with dosing of the 3 rd subject immediately after this assessment. All available safety data for the Dose 2 cohort will be evaluated by the IDMC after the Week 8 visit for the 3 rd subject in the Dose 2 cohort.
  • All subjects will initially receive immune suppression (IS) in the study based on findings of potential immunogenicity in the nonclinical safety/toxicology study conducted in animals and will include corticosteroids (methylprednisolone 10 mg/kg intravenously [IV] once on Day 1 predose and oral prednisone starting at 0.5 mg/kg/day on Day 2 with gradual tapering and discontinuation by Week 12), tacrolimus (1 mg twice daily [BID] by mouth [PO] Day 2 to Week 24 with target blood level of 4-8 ng/mL and tapering over 8 weeks between Week 24 and 32) and sirolimus (a loading dose of 1 mg/m 2 every 4 hours x 3 doses on Day -2 and then from Day -1 : sirolimus 0.5 mg/m 2 /day divided in BID dosing with target blood level of 4-8 ng/ml until Week 48).
  • Neurologic assessments and tacrolimus/sirolimus blood level monitoring will be conducted as per Table 3. The doses of sirolimus and tacrolimus and
  • Efficacy assessments will include neurocognitive function, auditory capacity, brain MRI, liver and spleen size, and measurements of levels of pharmacodynamic (PD) biomarkers in CSF, plasma, and urine.
  • Neurocognitive or adaptive scales performed as part of subjects' standard of care while participating in the trial may also be collected, as determined by the study sponsor after discussing with the site.
  • Safety through Week 104 AE reporting, laboratory evaluations, vital signs, ECGs, physical examinations, and neurologic assessments
  • VABS-II Comprehensive Interview Form
  • ELISPOT o Enzyme-linked immunospot
  • the total duration of the study may be 104 weeks post-dose with a primary safety evaluation time point of 24 weeks. Screening may take up to 35 days.
  • the subject's legal guardian(s) is(are) willing and able to provide written, signed informed consent after the nature of the study has been explained, and prior to any research-related procedures.
  • ALT aminotransferase
  • AST aspartate aminotransferase
  • HIV human immunodeficiency virus
  • hepatitis B or hepatitis C virus infection has a history of human immunodeficiency virus (HIV) or hepatitis B or hepatitis C virus infection, or positive screening tests for hepatitis B surface antigen or hepatitis B core antibody, or hepatitis C or HIV antibodies
  • VZV herpes zoster
  • CMV cytomegalovirus
  • EBV Epstein-Barr virus
  • GAG(s) Glycosaminoglycan(s)
  • ECGs electrocardiograms
  • physical examinations physical examinations
  • neurologic assessments
  • VABS-II Comprehensive Interview Form
  • ABR auditory brainstem response
  • IS therapy will include corticosteroids (methylprednisolone 10 mg/kg IV once on Day 1 predose and oral prednisone starting at 0.5 mg/kg/day on Day 2 with gradual tapering and discontinuation by Week 12), tacrolimus (1 mg twice daily [BID] by mouth [PO] Day 2 to Week 24 with target blood level of 4-8 ng/mL and tapering over 8 weeks between Week 24 and 32), and sirolimus (a loading dose of 1 mg/m 2 every 4 hours x 3 doses on Day -2 and then from Day -1 : sirolimus 0.5 mg/m 2 /day divided in twice a day dosing with target blood level of 4-8 ng/ml until Week 48).
  • Neurologic assessments and tacrolimus/sirolimus blood level monitoring will be conducted as per Table 3. The doses of sirolimus and tacoids
  • Construct 1 The safety and tolerability of Construct 1 will be monitored through assessment of AEs and serious adverse events (SAEs), chemistry, hematology, urinalysis, markers of CSF inflammation, immunogenicity, vector shedding (vector concentration), vital signs,
  • ECGs electrocardiograms
  • physical examinations including neurological assessments.
  • Efficacy assessments will include neurocognitive and adaptive function, auditory capacity, brain MRI, liver and spleen size, measurements of levels of PD biomarkers in CSF, plasma, and urine.
  • IP investigational product
  • HSCT hematopoietic stem cell transplantation
  • ICF Informed Consent Form
  • ALT aminotransferase
  • AST aspartate aminotransferase

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Medicinal Chemistry (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Epidemiology (AREA)
  • Microbiology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Virology (AREA)
  • Plant Pathology (AREA)
  • Biophysics (AREA)
  • Physics & Mathematics (AREA)
  • Neurosurgery (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Neurology (AREA)
  • Dermatology (AREA)
  • Oil, Petroleum & Natural Gas (AREA)
  • Hematology (AREA)
  • Psychology (AREA)
  • Otolaryngology (AREA)
  • Diabetes (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Obesity (AREA)
  • Mycology (AREA)
PCT/US2018/027568 2017-04-14 2018-04-13 Treatment of mucopolysaccharidosis ii with recombinant human iduronate-2 sulfatase (ids) produced by human neural or glial cells Ceased WO2018191666A1 (en)

Priority Applications (15)

Application Number Priority Date Filing Date Title
KR1020197033526A KR20190139951A (ko) 2017-04-14 2018-04-13 인간 뉴런 또는 신경교 세포에 의해 생성된 재조합 인간 이두로네이트-2 설파타제(ids)를 이용한 뮤코다당증 ii형의 치료
US16/604,427 US11613739B2 (en) 2017-04-14 2018-04-13 Treatment of mucopolysaccharidosis II with recombinant human iduronate-2-sulfatase (IDS) produced by human neural or glial cells
KR1020247017405A KR20240093919A (ko) 2017-04-14 2018-04-13 인간 뉴런 또는 신경교 세포에 의해 생성된 재조합 인간 이두로네이트-2 설파타제(ids)를 이용한 뮤코다당증 ii형의 치료
JP2019555865A JP2020516291A (ja) 2017-04-14 2018-04-13 ヒト神経細胞又はグリア細胞により生産された組換えヒトイズロン酸−2−スルファターゼ(ids)によるムコ多糖症ii型の治療
IL307936A IL307936A (en) 2017-04-14 2018-04-13 Treatment of mucopolysaccharidosis ii with recombinant human iduronate-2 sulfatase (ids) produced by human neural or glial cells
BR112019021569-7A BR112019021569A2 (pt) 2017-04-14 2018-04-13 Precursor de iduronato-2-sulfatase humana recombinante glicosilada (ids), método para tratar um sujeito humano diagnosticado com mucopolissacaridose tipo ii (mps ii)
CA3059441A CA3059441A1 (en) 2017-04-14 2018-04-13 Treatment of mucopolysaccharidosis ii with recombinant human iduronate-2-sulfatase (ids) produced by human neural or glial cells
AU2018253303A AU2018253303B2 (en) 2017-04-14 2018-04-13 Treatment of mucopolysaccharidosis II with recombinant human iduronate-2 sulfatase (IDS) produced by human neural or glial cells
EP18783760.4A EP3609526A4 (en) 2017-04-14 2018-04-13 TREATMENT OF MUCOPOLY SACCHARIDOSIS II WITH RECOMBINANT HUMAN IDURONATE-2-SULPHATASE (IDS) FROM HUMAN NERVOUS OR GLIA CELLS
IL269892A IL269892B2 (en) 2017-04-14 2018-04-13 Treatment of mucopolysaccharidosis ii with recombinant human iduronate-2 sulfatase (ids) produced by human neural or glial cells
SG11201909361S SG11201909361SA (en) 2017-04-14 2018-04-13 Treatment of mucopolysaccharidosis ii with recombinant human iduronate-2 sulfatase (ids) produced by human neural or glial cells
JP2022209169A JP2023052096A (ja) 2017-04-14 2022-12-27 ヒト神経細胞又はグリア細胞により生産された組換えヒトイズロン酸-2-スルファターゼ(ids)によるムコ多糖症ii型の治療
US18/659,404 US20250051740A1 (en) 2017-04-14 2024-05-09 Treatment of mucopolysaccharidosis ii with recombinant human iduronate-2-sulfatase (ids) produced by human neural or glial cells
AU2025200141A AU2025200141A1 (en) 2017-04-14 2025-01-09 Treatment of mucopolysaccharidosis II with recombinant human iduronate-2 sulfatase (IDS) produced by human neural or glial cells
JP2025019080A JP2025087702A (ja) 2017-04-14 2025-02-07 ヒト神経細胞又はグリア細胞により生産された組換えヒトイズロン酸-2-スルファターゼ(ids)によるムコ多糖症ii型の治療

Applications Claiming Priority (8)

Application Number Priority Date Filing Date Title
US201762485659P 2017-04-14 2017-04-14
US62/485,659 2017-04-14
US201762573921P 2017-10-18 2017-10-18
US62/573,921 2017-10-18
US201762574355P 2017-10-19 2017-10-19
US62/574,355 2017-10-19
US201762579686P 2017-10-31 2017-10-31
US62/579,686 2017-10-31

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US16/604,427 A-371-Of-International US11613739B2 (en) 2017-04-14 2018-04-13 Treatment of mucopolysaccharidosis II with recombinant human iduronate-2-sulfatase (IDS) produced by human neural or glial cells
US202318170438A Continuation 2017-04-14 2023-02-16

Publications (1)

Publication Number Publication Date
WO2018191666A1 true WO2018191666A1 (en) 2018-10-18

Family

ID=63793615

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2018/027568 Ceased WO2018191666A1 (en) 2017-04-14 2018-04-13 Treatment of mucopolysaccharidosis ii with recombinant human iduronate-2 sulfatase (ids) produced by human neural or glial cells

Country Status (12)

Country Link
US (2) US11613739B2 (https=)
EP (1) EP3609526A4 (https=)
JP (3) JP2020516291A (https=)
KR (2) KR20190139951A (https=)
AU (2) AU2018253303B2 (https=)
BR (1) BR112019021569A2 (https=)
CA (1) CA3059441A1 (https=)
IL (2) IL269892B2 (https=)
SG (1) SG11201909361SA (https=)
TW (2) TW202532642A (https=)
UY (1) UY37679A (https=)
WO (1) WO2018191666A1 (https=)

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2021154963A1 (en) * 2020-01-29 2021-08-05 Regenxbio Inc. Treatment of mucopolysaccharidosis ii with recombinant human iduronate-2-sulfatase (ids) produced by human neural or glial cells
WO2022165313A1 (en) 2021-02-01 2022-08-04 Regenxbio Inc. Gene therapy for neuronal ceroid lipofuscinoses
US11613739B2 (en) 2017-04-14 2023-03-28 Regenxbio Inc. Treatment of mucopolysaccharidosis II with recombinant human iduronate-2-sulfatase (IDS) produced by human neural or glial cells
US11986515B2 (en) 2021-02-10 2024-05-21 Regenxbio Inc. Treatment of mucopolysaccharidosis II with recombinant human iduronate-2-sulfatase (IDS)

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN110960671A (zh) * 2019-12-25 2020-04-07 广州中医药大学(广州中医药研究院) Elabela多肽新用途及其药物

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2011163649A2 (en) * 2010-06-25 2011-12-29 Shire Human Genetic Therapies, Inc Methods and compositions for cns delivery of iduronate-2-sulfatase
US20140242059A1 (en) * 2011-06-24 2014-08-28 Medigenebio Corporation Composition and formulation comprising recombinant human iduronate-2-sulfatase and preparation method thereof
WO2016187017A1 (en) * 2015-05-15 2016-11-24 Mcivor R Scott Adeno-associated for therapeutic delivery to central nervous system

Family Cites Families (35)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA2379166C (en) 1999-08-09 2013-03-26 Targeted Genetics Corporation Enhancement of expression of a single-stranded, heterologous nucleotide sequence from recombinant viral vectors by designing the sequence such that it forms instrastrand base pairs
MX359371B (es) 2001-11-13 2018-09-25 Univ Pennsylvania Un metodo para detectar y/o identificar secuencias del virus adeno-asociado y aislamiento de secuencias novedosas identificadas de ese modo.
PT1453547T (pt) 2001-12-17 2016-12-28 Univ Pennsylvania Sequências do vírus adeno-associado (aav) do serotipo 8, vetores contendo as mesmas, e utilizações destas
EP2345731B1 (en) 2003-09-30 2015-10-21 The Trustees of the University of Pennsylvania Adeno-associated virus (AAV) clades, sequences, vectors containing same, and uses thereof
ES2525067T3 (es) 2005-04-07 2014-12-17 The Trustees Of The University Of Pennsylvania Método de incremento de la función de un vector de AAV
JP4495210B2 (ja) 2005-06-09 2010-06-30 パナソニック株式会社 振幅誤差補償装置及び直交度誤差補償装置
GB2437893A (en) * 2006-07-25 2007-11-07 Celladon Corp Extended antegrade epicardial coronary infusion of adeno-associated viral vectors for gene therapy
EP2012122A1 (en) * 2007-07-06 2009-01-07 Medigene AG Mutated parvovirus structural proteins as vaccines
ES2635726T3 (es) * 2007-06-06 2017-10-04 Genzyme Corporation Terapia génica para enfermedades de almacenamiento lisosómico
US8734809B2 (en) 2009-05-28 2014-05-27 University Of Massachusetts AAV's and uses thereof
US8628966B2 (en) 2010-04-30 2014-01-14 City Of Hope CD34-derived recombinant adeno-associated vectors for stem cell transduction and systemic therapeutic gene transfer
US8927514B2 (en) 2010-04-30 2015-01-06 City Of Hope Recombinant adeno-associated vectors for targeted treatment
WO2012057363A1 (ja) 2010-10-27 2012-05-03 学校法人自治医科大学 神経系細胞への遺伝子導入のためのアデノ随伴ウイルスビリオン
WO2012109570A1 (en) 2011-02-10 2012-08-16 The University Of North Carolina At Chapel Hill Viral vectors with modified transduction profiles and methods of making and using the same
CN105755044A (zh) 2011-04-22 2016-07-13 加利福尼亚大学董事会 具有变异衣壳的腺相关病毒病毒体及其使用方法
ES2857773T5 (es) 2011-08-24 2024-06-04 Univ Leland Stanford Junior Nuevas proteínas de la cápside de AAV para la transferencia de ácidos nucleicos
WO2013170078A1 (en) 2012-05-09 2013-11-14 Oregon Health & Science University Adeno associated virus plasmids and vectors
CA2905952A1 (en) 2013-03-13 2014-10-02 The Children's Hospital Of Philadelphia Adeno-associated virus vectors and methods of use thereof
CN115120746A (zh) * 2013-05-15 2022-09-30 明尼苏达大学董事会 腺相关病毒介导的基因向中枢神经系统转移
ES2739288T3 (es) 2013-09-13 2020-01-30 California Inst Of Techn Recuperación selectiva
CN106232618A (zh) 2013-10-11 2016-12-14 马萨诸塞眼科耳科诊所 预测祖先病毒序列的方法及其用途
JP6818551B2 (ja) 2013-12-03 2021-01-20 ホオキパ バイオテック ジーエムビーエイチ Cmvワクチン
GB201403684D0 (en) 2014-03-03 2014-04-16 King S College London Vector
DK3107562T3 (da) * 2014-02-19 2019-12-16 Bioasis Technologies Inc P97-ids-fusionsproteiner
WO2015164757A1 (en) 2014-04-25 2015-10-29 Oregon Health & Science University Methods of viral neutralizing antibody epitope mapping
EP3151866B1 (en) 2014-06-09 2023-03-08 Voyager Therapeutics, Inc. Chimeric capsids
EP3166626B1 (en) 2014-07-11 2021-04-28 Biostrategies LC Materials and methods for treating disorders associated with sulfatase enzymes
US20180185495A1 (en) * 2014-11-10 2018-07-05 Alexion Pharmaceuticals, Inc. Therapeutic compositions of alpha-l-iduronidase, iduronate-2-sulfatase, and alpha-galactosidase a and methods of use thereof
MA41198A (fr) 2014-12-18 2017-10-24 Shire Human Genetic Therapies Essais d'activité enzymatique pour i2s
WO2016126729A1 (en) 2015-02-03 2016-08-11 Visa International Service Association Validation identity tokens for transactions
EP3101125A1 (en) * 2015-06-05 2016-12-07 Laboratorios Del Dr. Esteve, S.A. Adenoassociated virus vectors for the treatment of mucopolysaccharidoses
IL258005B2 (en) * 2015-09-17 2025-01-01 Res Inst Nationwide Childrens Hospital Methods and materials for gene therapy for beta-4,1-N-acetylgalactosaminyltransferase 2
SG10201912761UA (en) 2016-04-15 2020-02-27 The Trustees Of The Univ Of Pennsyvania Gene therapy for treating mucopolysaccharidosis type ii
KR20190139951A (ko) 2017-04-14 2019-12-18 리젠엑스바이오 인크. 인간 뉴런 또는 신경교 세포에 의해 생성된 재조합 인간 이두로네이트-2 설파타제(ids)를 이용한 뮤코다당증 ii형의 치료
BR112022015183A2 (pt) 2020-01-29 2022-12-20 Regenxbio Inc Método para tratamento de um sujeito humano diagnosticado com mucopolissacaridose tipo ii (mps ii)

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2011163649A2 (en) * 2010-06-25 2011-12-29 Shire Human Genetic Therapies, Inc Methods and compositions for cns delivery of iduronate-2-sulfatase
US20140242059A1 (en) * 2011-06-24 2014-08-28 Medigenebio Corporation Composition and formulation comprising recombinant human iduronate-2-sulfatase and preparation method thereof
WO2016187017A1 (en) * 2015-05-15 2016-11-24 Mcivor R Scott Adeno-associated for therapeutic delivery to central nervous system

Non-Patent Citations (7)

* Cited by examiner, † Cited by third party
Title
BIELICKI ET AL.: "Recombinant human iduronate-2-sulphatase: correction of mucopolysaccharidosis-type II fibroblasts and characterization of the purified enzyme", BIOCHEM J, vol. 289, 1 January 1993 (1993-01-01), pages 241 - 246, XP055081180 *
DANIELE ET AL.: "Uptake of recombinant iduronate-2-sulfatase into neuronal and glial cells in vitro", BIOCHIM BIOPHYS ACTA, vol. 1588, no. 3, 12 December 2002 (2002-12-12), pages 203 - 209, XP004389111 *
DATABASE Nucleotide [O] 26 August 2016 (2016-08-26), "Mus musculus iduronate 2-sulfatase (Ids), mRNA", XP055556682, retrieved from NCBI Database accession no. NM_010498 *
GHADERI ET AL.: "Production platforms for biotherapeutic glycoproteins:Occurrence, impact, and challenges of non-human sialylation", BIOTECHNOL GENET ENG REV, vol. 28, 15 April 2013 (2013-04-15), pages 147 - 175, XP055556640 *
HINDERER ET AL.: "Delivery of an Adeno-Associated Virus Vector into Cerebrospinal Fluid Attenuates Central Nervous System Disease in Mucopolysaccharidosis Type II Mice", HUM GENE THER, vol. 27, no. 11, 10 August 2016 (2016-08-10), pages 906 - 915, XP055337758 *
MOTAS ET AL.: "CNS-directed gene therapy for the treatment of neurologic and somatic mucopolysaccharidosis type II (Hunter syndrome", JCI INSIGHT, vol. 1, no. 9, 16 June 2016 (2016-06-16), XP055401203 *
ZUBER ET AL.: "The Effect of Recombinant Human Iduronate-2-Sulfatase (Idursulfase) on Growth in Young Patients with Mucopolysaccharidosis Type II", PLOS ONE, vol. 9, no. 1, 13 January 2014 (2014-01-13), pages 1 - 5, XP055556673 *

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11613739B2 (en) 2017-04-14 2023-03-28 Regenxbio Inc. Treatment of mucopolysaccharidosis II with recombinant human iduronate-2-sulfatase (IDS) produced by human neural or glial cells
WO2021154963A1 (en) * 2020-01-29 2021-08-05 Regenxbio Inc. Treatment of mucopolysaccharidosis ii with recombinant human iduronate-2-sulfatase (ids) produced by human neural or glial cells
JP2023512242A (ja) * 2020-01-29 2023-03-24 レジェンクスバイオ インコーポレーテッド ヒト神経細胞またはヒトグリア細胞が産生した組換えヒトイズロン酸-2-スルファターゼ(ids)によるムコ多糖症iiの治療
WO2022165313A1 (en) 2021-02-01 2022-08-04 Regenxbio Inc. Gene therapy for neuronal ceroid lipofuscinoses
US11986515B2 (en) 2021-02-10 2024-05-21 Regenxbio Inc. Treatment of mucopolysaccharidosis II with recombinant human iduronate-2-sulfatase (IDS)

Also Published As

Publication number Publication date
AU2018253303A1 (en) 2019-10-31
BR112019021569A2 (pt) 2020-05-12
KR20240093919A (ko) 2024-06-24
AU2025200141A1 (en) 2025-01-30
IL269892B1 (en) 2023-12-01
IL307936A (en) 2023-12-01
US20200149019A1 (en) 2020-05-14
JP2020516291A (ja) 2020-06-11
UY37679A (es) 2018-11-30
CA3059441A1 (en) 2018-10-18
IL269892A (https=) 2019-12-31
US11613739B2 (en) 2023-03-28
AU2018253303B2 (en) 2024-11-21
SG11201909361SA (en) 2019-11-28
KR20190139951A (ko) 2019-12-18
IL269892B2 (en) 2024-04-01
TW201903146A (zh) 2019-01-16
EP3609526A1 (en) 2020-02-19
US20250051740A1 (en) 2025-02-13
JP2023052096A (ja) 2023-04-11
EP3609526A4 (en) 2021-01-13
JP2025087702A (ja) 2025-06-10
TW202532642A (zh) 2025-08-16

Similar Documents

Publication Publication Date Title
US20250051740A1 (en) Treatment of mucopolysaccharidosis ii with recombinant human iduronate-2-sulfatase (ids) produced by human neural or glial cells
US20240050537A1 (en) Treatment of mucopolysaccharidosis i with fully-human glycosylated human alpha-l-iduronidase (idua)
EP4096631A1 (en) Treatment of mucopolysaccharidosis ii with recombinant human iduronate-2-sulfatase (ids) produced by human neural or glial cells
US20230059395A1 (en) Treatment of mucopolysaccharidosis i with fully-human glycosylated human alpha-l-iduronidase (idua)
AU2022221284A9 (en) Treatment of mucopolysaccharidosis ii with recombinant human iduronate-2-sulfatase (ids)
EP3823590A1 (en) Treatment of mucopolysaccharidosis i with fully-human glycosylated human alpha-l-iduronidase (idus)
WO2025075963A1 (en) Methods and formulations for treating mucopolysaccharidosis ii-associated hearing loss with recombinant human iduronate-2-sulfatase

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18783760

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3059441

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2019555865

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112019021569

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2018253303

Country of ref document: AU

Date of ref document: 20180413

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20197033526

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2018783760

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2018783760

Country of ref document: EP

Effective date: 20191114

ENP Entry into the national phase

Ref document number: 112019021569

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20191014