WO2018183459A1 - Formulations comprising pd-1 binding proteins and methods of making thereof - Google Patents

Formulations comprising pd-1 binding proteins and methods of making thereof Download PDF

Info

Publication number
WO2018183459A1
WO2018183459A1 PCT/US2018/024787 US2018024787W WO2018183459A1 WO 2018183459 A1 WO2018183459 A1 WO 2018183459A1 US 2018024787 W US2018024787 W US 2018024787W WO 2018183459 A1 WO2018183459 A1 WO 2018183459A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
seq
pharmaceutical formulation
antigen
amino acid
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2018/024787
Other languages
English (en)
French (fr)
Inventor
Xiao-Ping Dai
Douglas Banks
Willard R. Foss
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Celgene Corp
Original Assignee
Celgene Corp
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=63678296&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2018183459(A1) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority to EA201991912A priority Critical patent/EA201991912A1/ru
Priority to CA3055984A priority patent/CA3055984A1/en
Priority to BR112019018996A priority patent/BR112019018996A2/pt
Priority to SG11201907948TA priority patent/SG11201907948TA/en
Priority to EP18775686.1A priority patent/EP3601338A4/en
Priority to KR1020197028673A priority patent/KR20190141658A/ko
Priority to AU2018246252A priority patent/AU2018246252A1/en
Priority to MX2019010999A priority patent/MX2019010999A/es
Priority to CN201880034207.7A priority patent/CN110678482A/zh
Application filed by Celgene Corp filed Critical Celgene Corp
Priority to JP2019553183A priority patent/JP2020512359A/ja
Publication of WO2018183459A1 publication Critical patent/WO2018183459A1/en
Priority to IL26888419A priority patent/IL268884A/en
Priority to CONC2019/0010230A priority patent/CO2019010230A2/es
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39591Stabilisation, fragmentation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/06Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies from serum
    • C07K16/065Purification, fragmentation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2809Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/57Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/515Complete light chain, i.e. VL + CL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/567Framework region [FR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/71Decreased effector function due to an Fc-modification
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/732Antibody-dependent cellular cytotoxicity [ADCC]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94Stability, e.g. half-life, pH, temperature or enzyme-resistance

Definitions

  • formulations comprising antibodies that specifically bind to human Programmed Death-1 (PD-1) and methods of making the formulations.
  • Drug substances are usually administered as part of a formulation in combination with one or more other agents that serve varied and specialized pharmaceutical functions.
  • Dosage forms of various types may be made through selective use of pharmaceutical excipients.
  • pharmaceutical excipients have various functions and contribute to the pharmaceutical formulations in many different ways, e.g., solubilization, dilution, thickening, stabilization, preservation, coloring, flavoring, etc.
  • the properties that are commonly considered when formulating an active drug substance include bioavailability, ease of manufacture, ease of administration, and stability of the dosage form. Due to the varying properties of active drug substances being formulated, dosage forms typically require pharmaceutical excipients that are uniquely tailored to the active drug substance in order to achieve advantageous physical and pharmaceutical properties.
  • the present disclosure provides formulations comprising proteins that bind to PD-1 ⁇ e.g., human PD-1, SEQ ID NO:43), including binding proteins such as antibodies that bind to PD-1.
  • binding proteins including antibodies
  • binding proteins, including antibodies can be agonists ⁇ e.g., induce PD-1 ligand-like signaling).
  • the binding proteins do not compete with PD-1 ligand ⁇ e.g., PD-L1 and PD-L2) for the interaction with PD-1 ⁇ e.g., a non- blocking antibody).
  • the present disclosure also provides, in certain embodiments, formulations comprising binding proteins, including antibodies or fragments thereof, that (i) bind to human PD-1, (ii) induce PD-1 ligand-like signaling, and (iii) do not compete with PD-L1 and/or PD-L2 for the interaction with PD-1.
  • proteins that bind to PD-1 e.g., human PD-1, SEQ ID NO:43
  • binding proteins such as antibodies that bind to PD-1.
  • a binding protein (e.g., an anti-PD-1 antibody) comprises six complementarity determining regions (CDRs) or fewer than six CDRs.
  • a binding protein (e.g., an anti-PD-1 antibody) comprises one, two, three, four, five, or six CDRs selected from heavy chain variable region (VH) CDRl, VH CDR2, VH CDR3, light chain variable region (VL) CDRl, VL CDR2, and/or VL CDR3.
  • a binding protein (e.g., an anti-PD-1 antibody) comprises one, two, three, four, five, or six CDRs selected from VH CDRl, VH CDR2, VH CDR3, VL CDRl, VL CDR2, and/or VL CDR3 of a monoclonal antibody designated as PDlAB-1, PD 1AB- 2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6 as described herein, or a humanized variant thereof.
  • a monoclonal antibody designated as PDlAB-1, PD 1AB- 2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6 as described herein, or a humanized variant thereof.
  • a binding protein (e.g., an anti-PD-1 antibody) further comprises a scaffold region or framework region (FR), including a VH FRl, VH FR2, VH FR3, VH FR4, VL FRl, VL FR2, VL FR3, and/or VL FR4 of a human immunoglobulin amino acid sequence or a variant thereof.
  • FR scaffold region or framework region
  • the formulation comprises an antibody or antigen-binding fragment thereof that binds to an epitope of human PD-1 recognized by an antibody comprising a light chain variable region having an amino acid sequence of SEQ ID NO: 8 and a heavy chain variable region having an amino acid sequence of SEQ ID NO: 13.
  • the formulation comprises an antibody or antibody fragment thereof that competes for the binding to human PD-1 with an antibody comprising a light chain variable region having an amino acid sequence of SEQ ID NO: 8 and a heavy chain variable region having an amino acid sequence of SEQ ID NO: 13.
  • the formulation comprises an antibody or antigen-binding fragment thereof that comprises a VL comprising VL CDRl, VL CDR2, and VL CDR3 of any one of antibodies PDlAB-1, PD1AB-2, PD 1AB-3, PD 1AB-4, PD 1AB-5, or PDlAB-6 as set forth in Table 1.
  • the formulation comprises an antibody or antigen-binding fragment thereof that comprises a VH comprising VH CDRl, VH CDR2, and VH CDR3 of any one of antibodies PDlAB-1, PD1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PDlAB-6 as set forth in Table 2.
  • the formulation comprises an antibody or antigen-binding fragment thereof that comprises:
  • VL comprising VL FR1, VL FR2, VL FR3, and VL FR4 of any one of
  • VH comprising VH FR1, VH FR2, VH FR3, and VH FR4 of any one of
  • the VL CDRl, VL CDR2, and VL CDR3 of the antibody or antigen-binding fragment thereof of the formulation comprise amino acid sequences of SEQ ID NOS: l, 2, and 3, respectively, and the VH CDRl, VH CDR2, and VH CDR3 of the antibody or antigen-binding fragment thereof of the formulation comprise amino acid sequences of SEQ ID NOS:4, 5, and 6, respectively.
  • the VL CDRl, VL CDR2, and VL CDR3 of the antibody or antigen-binding fragment thereof of the formulation comprise amino acid sequences of SEQ ID NOS:7, 2, and 3, respectively
  • the VH CDRl, VH CDR2, and VH CDR3 of the antibody or antigen-binding fragment thereof of the formulation comprise amino acid sequences of SEQ ID NOS:4, 5, and 6, respectively.
  • the formulation comprises an antibody or antigen-binding fragment thereof that comprises a VL comprising an amino acid sequence of SEQ ID NO:8.
  • the amino acid sequence comprises one or more conservative modifications thereof.
  • the formulation comprises an antibody or antigen-binding fragment thereof that comprises a VL comprising an amino acid sequence of SEQ ID NO:9. In some embodiments, the amino acid sequence comprises one or more conservative modifications thereof. [0017] In some embodiments, the formulation comprises an antibody or antigen-binding fragment thereof that comprises a VL comprising an amino acid sequence of SEQ ID NO: 10. In some embodiments, the amino acid sequence comprises one or more conservative modifications thereof.
  • the formulation comprises an antibody or antigen-binding fragment thereof that comprises a VH comprising an amino acid sequence of SEQ ID NO: 11.
  • the amino acid sequence comprises one or more conservative modifications thereof.
  • the formulation comprises an antibody or antigen-binding fragment thereof that comprises a VH comprising an amino acid sequence of SEQ ID NO: 12.
  • the amino acid sequence comprises one or more conservative modifications thereof.
  • the formulation comprises an antibody or antigen-binding fragment thereof that comprises a VH comprising an amino acid sequence of SEQ ID NO: 13.
  • the amino acid sequence comprises one or more conservative modifications thereof.
  • the formulation comprises an antibody or antigen-binding fragment thereof that comprises: (a) a VL comprising an amino acid sequence of SEQ ID NO:8; and (b) a VH comprising an amino acid sequence of SEQ ID NO: 11.
  • the formulation comprises an antibody or antigen-binding fragment thereof that comprises: (a) a VL comprising an amino acid sequence of SEQ ID NO:9; and (b) a VH comprising an amino acid sequence of SEQ ID NO: 11.
  • the formulation comprises an antibody or antigen-binding fragment thereof that comprises: (a) a VL comprising an amino acid sequence of SEQ ID NO: 10; and (b) a VH comprising an amino acid sequence of SEQ ID NO: 11.
  • the formulation comprises an antibody or antigen-binding fragment thereof that comprises: (a) a VL comprising an amino acid sequence of SEQ ID NO:8; and (b) a VH comprising an amino acid sequence of SEQ ID NO: 12.
  • the formulation comprises an antibody or antigen-binding fragment thereof that comprises: (a) a VL comprising an amino acid sequence of SEQ ID NO:9; and (b) a VH comprising an amino acid sequence of SEQ ID NO: 12.
  • the formulation comprises an antibody or antigen-binding fragment thereof that comprises: (a) a VL comprising an amino acid sequence of SEQ ID NO: 10; and (b) a VH comprising an amino acid sequence of SEQ ID NO: 12.
  • the formulation comprises an antibody or antigen-binding fragment thereof that comprises: (a) a VL comprising an amino acid sequence of SEQ ID NO:8; and (b) a VH comprising an amino acid sequence of SEQ ID NO: 13.
  • the formulation comprises an antibody or antigen-binding fragment thereof that comprises: (a) a VL comprising an amino acid sequence of SEQ ID NO:9; and (b) a VH comprising an amino acid sequence of SEQ ID NO: 13.
  • the formulation comprises an antibody or antigen-binding fragment thereof that comprises: (a) a VL comprising an amino acid sequence of SEQ ID NO: 10; and (b) a VH comprising an amino acid sequence of SEQ ID NO: 13.
  • the amino acid sequence of the VL comprises one or more conservative modifications thereof. In some embodiments, the amino acid sequence of the VH comprises one or more conservative modifications thereof. In some embodiments, the amino acid sequence of the VL and the VH comprises one or more conservative modifications thereof.
  • the formulation comprises an antibody that comprises a human IgGl Fc region. In other embodiments, the formulation comprises an antibody that comprises a variant human IgGl Fc region.
  • the formulation comprises an antibody that comprises a human IgGl-K322A Fc region.
  • the formulation comprises an antibody that comprises a human IgG4 Fc region. In other embodiments, the formulation comprises an antibody that comprises a variant human IgG4 Fc region.
  • the formulation comprises an antibody that comprises a human IgG4P Fc region.
  • the formulation comprises an antibody that comprises a human IgG4PE Fc region.
  • the formulation comprises an antibody or antigen-binding fragment thereof that further comprises a light chain constant region comprising an amino acid sequence of SEQ ID NO:41.
  • the formulation comprises an antibody or antigen-binding fragment thereof that further comprises a heavy chain Fc region comprising an amino acid sequence selected from the group consisting of SEQ ID NOS:36-40.
  • the formulation comprises an antibody or antigen-binding fragment thereof that further comprises a light chain constant region comprising an amino acid sequence of SEQ ID NO:41; and a heavy chain Fc region comprising an amino acid sequence selected from the group consisting of SEQ ID NOS:36-40.
  • the formulation comprises an antibody or antigen-binding fragment thereof that comprises a light chain comprising an amino acid sequence of SEQ ID NO:31.
  • the formulation comprises an antibody or antigen-binding fragment thereof that comprises a heavy chain comprising an amino acid sequence of SEQ ID NO:32.
  • the formulation comprises an antibody or antigen-binding fragment thereof that comprises: (a) a light chain comprising an amino acid sequence of SEQ ID NO: (a) a light chain comprising an amino acid sequence of SEQ ID NO: (a) a light chain comprising an amino acid sequence of SEQ ID NO: (a) a light chain comprising an amino acid sequence of SEQ ID NO: (a) a light chain comprising an amino acid sequence of SEQ ID NO: (a) a light chain comprising an amino acid sequence of SEQ ID
  • the formulation comprises an antibody or antigen-binding fragment thereof that comprises a heavy chain comprising an amino acid sequence of SEQ ID NO: 1
  • the formulation comprises an antibody or antigen-binding fragment thereof that comprises: (a) a light chain comprising an amino acid sequence of SEQ ID NO:31; and (b) a heavy chain comprising an amino acid sequence of SEQ ID NO:33.
  • the formulation comprises an antibody or antigen-binding fragment thereof that comprises a heavy chain comprising an amino acid sequence of SEQ ID NO:34.
  • the formulation comprises an antibody or antigen-binding fragment thereof that comprises: (a) a light chain comprising an amino acid sequence of SEQ ID NO:31; and (b) a heavy chain comprising an amino acid sequence of SEQ ID NO:34.
  • the formulation comprises an antibody or antigen-binding fragment thereof that comprises a heavy chain comprising an amino acid sequence of SEQ ID NO:35.
  • the formulation comprises an antibody or antigen-binding fragment thereof that comprises: (a) a light chain comprising an amino acid sequence of SEQ ID NO:31; and (b) a heavy chain comprising an amino acid sequence of SEQ ID NO:35.
  • the formulation comprises an antibody or antigen-binding fragment thereof that, when bound to PD-1, binds to at least one of residues 100-109 within an amino acid sequence of SEQ ID NO:42.
  • the formulation comprises an antibody or antigen-binding fragment thereof that, when bound to PD-1, binds to at least one of residues 100-105 within an amino acid sequence of SEQ ID NO:42.
  • the formulation comprises an antibody or antigen-binding fragment thereof that, when bound to PD-1, binds to at least one residue selected from the group consisting of N33, T51, S57, LlOO, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • the formulation comprises an antibody or antigen-binding fragment thereof that, when bound to PD-1, binds to two or more residues selected from the group consisting of N33, T51, S57, LlOO, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • the formulation comprises an antibody or antigen-binding fragment thereof that, when bound to PD-1, binds to three or more residues selected from the group consisting of N33, T51, S57, LlOO, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • the formulation comprises an antibody or antigen-binding fragment thereof that, when bound to PD-1, binds to four or more residues selected from the group consisting of N33, T51, S57, LlOO, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • the formulation comprises an antibody or antigen-binding fragment thereof that, when bound to PD-1, binds to five or more residues selected from the group consisting of N33, T51, S57, LlOO, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • the formulation comprises an antibody or antigen-binding fragment thereof that, when bound to PD-1, binds to six or more residues selected from the group consisting of N33, T51, S57, LlOO, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • the formulation comprises an antibody or antigen-binding fragment thereof that, when bound to PD-1, binds to seven or more residues selected from the group consisting of N33, T51, S57, LlOO, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • the formulation comprises an antibody or antigen- binding fragment thereof that, when bound to PD-1, binds to eight or more residues selected from the group consisting of N33, T51, S57, LlOO, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • the formulation comprises an antibody or antigen-binding fragment thereof that, when bound to PD-1, binds to nine or more residues selected from the group consisting of N33, T51, S57, LlOO, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • the formulation comprises an antibody or antigen-binding fragment thereof that, when bound to PD-1, binds to all ten residues from the group consisting of N33, T51, S57, LlOO, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • the formulation comprises an antibody or antigen-binding fragment thereof that, when bound to PD-1, binds to N33 within an amino acid sequence of SEQ ID NO:42.
  • the formulation comprises an antibody or antigen-binding fragment thereof that, when bound to PD-1, binds to T51 within an amino acid sequence of SEQ ID NO:42.
  • the formulation comprises an antibody or antigen-binding fragment thereof that, when bound to PD-1, binds to S57 within an amino acid sequence of SEQ ID NO:42.
  • the formulation comprises an antibody or antigen- binding fragment thereof that, when bound to PD-1, binds to LlOO within an amino acid sequence of SEQ ID NO:42.
  • the formulation comprises an antibody or antigen-binding fragment thereof that, when bound to PD-1, binds to N102 within an amino acid sequence of SEQ ID NO:42.
  • the formulation comprises an antibody or antigen-binding fragment thereof that, when bound to PD-1, binds to G103 within an amino acid sequence of SEQ ID NO:42.
  • the formulation comprises an antibody or antigen-binding fragment thereof that, when bound to PD-1, binds to R104 within an amino acid sequence of SEQ ID NO:42.
  • the formulation comprises an antibody or antigen-binding fragment thereof that, when bound to PD-1, binds to G103 and R104 within an amino acid sequence of SEQ ID NO:42.
  • the formulation comprises an antibody or antigen- binding fragment thereof that, when bound to PD-1, binds to D 105 within an amino acid sequence of SEQ ID NO:42.
  • the formulation comprises an antibody or antigen-binding fragment thereof that, when bound to PD-1, binds to H107 within an amino acid sequence of SEQ ID NO:42.
  • the formulation comprises an antibody or antigen-binding fragment thereof that, when bound to PD-1, binds to SI 09 within an amino acid sequence of SEQ ID NO:42.
  • the epitope of human PD-1 is distinct from the PD-L1 binding site. In another embodiment, the epitope of human PD-1 is distinct from the PD-L2 binding site. In a specific embodiment, the epitope of human PD-1 is distinct from both the PD-L1 binding site and the PD-L2 binding site.
  • the formulation comprises an antibody or antigen-binding fragment thereof that specifically binds to human PD-1 and/or monkey PD-1 (for example, cynomolgus monkey), but not rodent PD-1.
  • human PD-1 and/or monkey PD-1 for example, cynomolgus monkey
  • the formulation comprises an antibody or antigen-binding fragment thereof that has attenuated antibody dependent cellular cytotoxicity (ADCC) activity. In other embodiments, the formulation comprises an antibody or antigen-binding fragment thereof that has attenuated complement dependent cytotoxicity (CDC) activity. In some embodiments, the formulation comprises an antibody or antigen-binding fragment thereof that has attenuated ADCC and/or attenuated CDC activity.
  • ADCC antibody dependent cellular cytotoxicity
  • CDC complement dependent cytotoxicity
  • the formulation comprises an antibody or antigen-binding fragment thereof that has attenuated ADCC and/or attenuated CDC activity.
  • a formulation comprising an antibody or antigen- binding fragment thereof that binds to an epitope of human PD-1, wherein the antibody or antigen-binding fragment thereof: (a) attenuates T cell activity; and/or (b) downregulates PD-1 expression on the surface of T cells.
  • the formulation comprises an antibody that attenuates T cell activity. In another embodiment, the formulation comprises an antibody that downregulates PD-1 expression on the surface of T cells.
  • the attenuation of T cell activity is measured by a T cell effector function.
  • the attenuation of T cell activity by the antibody or antigen-binding fragment thereof occurs in human PBMC or whole blood samples.
  • the attenuation of T cell activity is measured by inhibition of cytokine production.
  • the cytokine that is inhibited by the antibody or
  • the antigen-binding fragment thereof comprises IL-2, IL-17, and/or IFN- ⁇ .
  • the cytokine is selected from the group consisting of IL-1, IL-2, IL-6, IL-12, IL-17, IL-22, IL-23, GM-CSF, IFN- ⁇ , and T F- ⁇ .
  • the cytokine is IL-1.
  • the cytokine is IL-2. In other embodiments, the cytokine is IL-6. In another embodiment, the cytokine is IL-12. In some other embodiments, the cytokine is IL-17. In yet other embodiments, the cytokine is IL-22. In still other embodiments, the cytokine is IL-23. In some embodiments, the cytokine is GM-CSF. In other embodiments, the cytokine is IFN- ⁇ . In yet other embodiments, the cytokine is TNF-a. In certain embodiments, the cytokine is IL-2 and IL-17. In some embodiments, the cytokine is IL-2 and IFN- ⁇ .
  • the cytokine is IL-17 and IFN- ⁇ . In still other embodiments, the cytokine is IL-2, IL-17, and IFN- ⁇ . Other combinations of two, three or more of the above-mentioned cytokines are also
  • the downregulation of PD-1 expression on the surface of T cells occurs as early as 4 hours after the contact with the antibody or antigen-binding fragment thereof of the formulation. In another embodiment, the downregulation occurs as early as 6 hours after the contact. In yet another embodiment, the downregulation occurs as early as 8 hours after the contact. In still another embodiment, the downregulation occurs as early as 10 hours after the contact. In one embodiment, the downregulation occurs as early as 12 hours after the contact. In another embodiment, the downregulation occurs as early as 14 hours after the contact. In yet another embodiment, the downregulation occurs as early as 16 hours after the contact. In still another embodiment, the downregulation occurs as early as 18 hours after the contact. In one embodiment, the downregulation occurs as early as 20 hours after the contact.
  • the downregulation occurs as early as 22 hours after the contact. In yet another embodiment, the downregulation occurs as early as 24 hours after the contact.
  • the contact is with the antibody of the formulation. In other embodiments, the contact is with an antigen-binding fragment thereof of the formulation.
  • the downregulation of PD-1 expression on the surface of T cells precedes cytokine inhibition.
  • the downregulation of PD-1 expression on the surface of T cells occurs as early as 4 hours after the contact with the antibody or antigen-binding fragment thereof of the formulation, and precedes cytokine inhibition.
  • the downregulation occurs as early as 6 hours after the contact with the antibody or antigen-binding fragment thereof of the formulation, and precedes cytokine inhibition.
  • the downregulation occurs as early as 8 hours after the contact with the antibody or antigen-binding fragment thereof of the formulation, and precedes cytokine inhibition.
  • the downregulation occurs as early as 10 hours after the contact with the antibody or antigen-binding fragment thereof of the formulation, and precedes cytokine inhibition. In one embodiment, the downregulation occurs as early as 12 hours after the contact with the antibody or antigen-binding fragment thereof of the formulation, and precedes cytokine inhibition. In another embodiment, the downregulation occurs as early as 14 hours after the contact with the antibody or antigen-binding fragment thereof of the formulation, and precedes cytokine inhibition. In yet another embodiment, the downregulation occurs as early as 16 hours after the contact with the antibody or antigen-binding fragment thereof of the formulation, and precedes cytokine inhibition.
  • the downregulation occurs as early as 18 hours after the contact with the antibody or antigen-binding fragment thereof of the formulation, and precedes cytokine inhibition. In one embodiment, the downregulation occurs as early as 20 hours after the contact with the antibody or antigen-binding fragment thereof of the formulation, and precedes cytokine inhibition. In another embodiment, the downregulation occurs as early as 22 hours after the contact with the antibody or antigen- binding fragment thereof of the formulation, and precedes cytokine inhibition. In yet another embodiment, the downregulation occurs as early as 24 hours after the contact with the antibody or antigen-binding fragment thereof of the formulation, and precedes cytokine inhibition.
  • the downregulation of PD-1 expression on the surface of T cells is concurrent with cytokine inhibition.
  • the downregulation of PD-1 expression on the surface of T cells occurs as early as 4 hours after the contact with the antibody or antigen-binding fragment thereof of the formulation, and is concurrent with cytokine inhibition.
  • the downregulation occurs as early as 6 hours after the contact with the antibody or antigen-binding fragment thereof of the formulation, and is concurrent with cytokine inhibition.
  • the downregulation occurs as early as 8 hours after the contact with the antibody or antigen-binding fragment thereof of the formulation, and is concurrent with cytokine inhibition.
  • the downregulation occurs as early as 10 hours after the contact with the antibody or antigen-binding fragment thereof of the formulation, and is concurrent with cytokine inhibition. In one embodiment, the downregulation occurs as early as 12 hours after the contact with the antibody or antigen-binding fragment thereof of the formulation, and is concurrent with cytokine inhibition. In another embodiment, the downregulation occurs as early as 14 hours after the contact with the antibody or antigen-binding fragment thereof of the formulation, and is concurrent with cytokine inhibition. In yet another embodiment, the downregulation occurs as early as 16 hours after the contact with the antibody or antigen-binding fragment thereof of the formulation, and is concurrent with cytokine inhibition.
  • the downregulation occurs as early as 18 hours after the contact with the antibody or antigen-binding fragment thereof of the formulation, and is concurrent with cytokine inhibition. In one embodiment, the downregulation occurs as early as 20 hours after the contact with the antibody or antigen-binding fragment thereof of the formulation, and is concurrent with cytokine inhibition. In another embodiment, the downregulation occurs as early as 22 hours after the contact with the antibody or antigen-binding fragment thereof of the formulation, and is concurrent with cytokine inhibition. In yet another embodiment, the downregulation occurs as early as 24 hours after the contact with the antibody or antigen-binding fragment thereof of the formulation, and is concurrent with cytokine inhibition.
  • the downregulation of PD-1 expression on the surface of T cells is after cytokine inhibition. In one embodiment, the downregulation of PD-1 expression on the surface of T cells occurs as early as 4 hours after the contact with the antibody or
  • the downregulation occurs as early as 6 hours after the contact with the antibody or antigen-binding fragment thereof of the formulation, and is after cytokine inhibition. In yet another embodiment, the downregulation occurs as early as 8 hours after the contact with the antibody or antigen-binding fragment thereof of the formulation, and is after cytokine inhibition. In still another embodiment, the downregulation occurs as early as 10 hours after the contact with the antibody or antigen-binding fragment thereof of the formulation, and is after cytokine inhibition. In one embodiment, the downregulation occurs as early as 12 hours after the contact with the antibody or antigen-binding fragment thereof of the formulation, and is after cytokine inhibition.
  • the downregulation occurs as early as 14 hours after the contact with the antibody or antigen-binding fragment thereof of the formulation, and is after cytokine inhibition. In yet another embodiment, the downregulation occurs as early as 16 hours after the contact with the antibody or antigen-binding fragment thereof of the formulation, and is after cytokine inhibition. In still another embodiment, the downregulation occurs as early as 18 hours after the contact with the antibody or antigen-binding fragment thereof of the formulation, and is after cytokine inhibition. In one embodiment, the downregulation occurs as early as 20 hours after the contact with the antibody or antigen-binding fragment thereof of the formulation, and is after cytokine inhibition.
  • the downregulation occurs as early as 22 hours after the contact with the antibody or antigen-binding fragment thereof of the formulation, and is after cytokine inhibition. In yet another embodiment, the downregulation occurs as early as 24 hours after the contact with the antibody or antigen-binding fragment thereof of the formulation, and is after cytokine inhibition.
  • the KD of the antibody or antigen-binding fragment thereof of the formulation for binding to purified human PD-1 is from about 1 nM to about 100 nM. In another embodiment, the KD of the antibody or antigen-binding fragment thereof of the formulation for binding to human PD-1 expressed on a cell surface is from about 100 pM to about 10 nM. In another embodiment, the KD of the antibody or antigen-binding fragment thereof of the formulation for binding to monkey PD-1 expressed on a cell surface is from about 100 pM to about 10 nM.
  • the ECso of the antibody or antigen-binding fragment thereof of the formulation for attenuating T cell activity is from about 1 pM to about 10 pM, from about 10 pM to about 100 pM, from about 100 pM to about 1 nM, from about 1 nM to about 10 nM, or from about 10 nM to about 100 nM.
  • the maximal percent attenuation of T cell activity by the antibody or antigen-binding fragment thereof of the formulation is at least about 10%, 20%, 30%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100%.
  • the maximal percent downregulation of PD-1 expression by the antibody or antigen-binding fragment thereof of the formulation is at least about 10%, 20%, 30%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100%.
  • the formulation comprises an antibody that is a monoclonal antibody. In some embodiments, the formulation comprises an antibody that is a humanized, human, or chimeric antibody. In another embodiment, the formulation comprises a humanized antibody that is a deimmunized antibody or a composite human antibody. In certain embodiments,
  • the formulation comprises an antibody that is a humanized antibody.
  • the formulation comprises an antibody that is a humanized antibody that specifically binds human PD-1.
  • the antibody is a humanized monoclonal antibody.
  • the formulation comprises an antibody or antigen-binding fragment thereof that is a Fab, a Fab', a F(ab') 2 , a Fv, a scFv, a dsFv, a diabody, a triabody, or a tetrabody.
  • the formulation comprises an antibody or antigen-binding fragment thereof that is a multispecific antibody formed from antibody fragments.
  • the formulation comprises an antibody or antigen-binding fragment thereof that is a bispecific antibody.
  • the antibody is not an antibody fragment.
  • the formulation comprises an antibody or antigen-binding fragment thereof that is conjugated to an agent.
  • the agent is a radioisotope, a metal chelator, an enzyme, a fluorescent compound, a bioluminescent compound, or a chemiluminescent compound.
  • the pharmaceutical formulation comprises a buffer.
  • the buffer is an acetate buffer, succinate buffer, histidine buffer, or citrate buffer.
  • the buffer is an acetate buffer.
  • the buffer is a succinate buffer.
  • the buffer is a histidine buffer.
  • the buffer is a citrate buffer.
  • the concentration of the buffer is from 0.1 mM to 1 M. In other embodiments, the concentration of the buffer is from 1 mM to 100 mM. In other embodiments, the concentration of the buffer is 10 mM.
  • the formulation comprises acetate buffer at a concentration of from 0.1 mM to 1 M. In another embodiment, the formulation comprises acetate buffer at a concentration of from 0.1 mM to 100 mM. In one embodiment, the formulation comprises acetate buffer at a concentration of from 0.1 mM to 10 mM. In one embodiment, the formulation comprises acetate buffer at a concentration of from 1 mM to 100 mM. In another embodiment, the formulation comprises acetate buffer at a concentration of from 1 mM to 10 mM. In one embodiment, the formulation comprises acetate buffer at a concentration of from 5 mM to 15 mM. In one embodiment, the formulation comprises acetate buffer at a concentration of 5 mM. In one embodiment, the formulation comprises acetate buffer at a concentration of 15 mM. In another embodiment, the formulation comprises acetate buffer at a concentration of 10 mM.
  • the formulation comprises succinate buffer at a concentration of from 0.1 mM to 1 M. In another embodiment, the formulation comprises succinate buffer at a concentration of from 0.1 mM to 100 mM. In one embodiment, the formulation comprises succinate buffer at a concentration of from 0.1 mM to 10 mM. In one embodiment, the formulation comprises succinate buffer at a concentration of from 1 mM to 100 mM. In another embodiment, the formulation comprises succinate buffer at a concentration of from 1 mM to 10 mM. In one embodiment, the formulation comprises succinate buffer at a concentration of from 5 mM to 15 mM. In one embodiment, the formulation comprises succinate buffer at a
  • the formulation comprises succinate buffer at a concentration of 15 mM. In another embodiment, the formulation comprises succinate buffer at a concentration of 10 mM.
  • the formulation comprises histidine buffer at a concentration of from 0.1 mM to 1M. In another embodiment, the formulation comprises histidine buffer at a concentration of from 0.1 mM to 100 mM. In one embodiment, the formulation comprises histidine buffer at a concentration of from 0.1 mM to 10 mM. In one embodiment, the formulation comprises histidine buffer at a concentration of from 1 mM to 100 mM. In another embodiment, the formulation comprises histidine buffer at a concentration of from 1 mM to 10 mM. In one embodiment, the formulation comprises histidine buffer at a concentration of from 5 mM to 15 mM. In one embodiment, the formulation comprises histidine buffer at a concentration of 5 mM. In one embodiment, the formulation comprises histidine buffer at a concentration of 15 mM. In another embodiment, the formulation comprises histidine buffer at a concentration of 10 mM.
  • the formulation comprises citrate buffer at a concentration of from 0.1 mM to 1M. In another embodiment, the formulation comprises citrate buffer at a concentration of from 0.1 mM to 100 mM. In one embodiment, the formulation comprises citrate buffer at a concentration of from 0.1 mM to 10 mM. In one embodiment, the formulation comprises citrate buffer at a concentration of from 1 mM to 100 mM. In another embodiment, the formulation comprises citrate buffer at a concentration of from 1 mM to 10 mM. In one embodiment, the formulation comprises citrate buffer at a concentration of from 5 mM to 15 mM. In one embodiment, the formulation comprises citrate buffer at a concentration of 5 mM. In one embodiment, the formulation comprises citrate buffer at a concentration of 15 mM. In another embodiment, the formulation comprises citrate buffer at a concentration of 10 mM.
  • the pH of the buffer is within the range of pH 4 and 6.5. In some embodiments, the pH of the buffer is within the range of pH 4.7 and 5.7. In other embodiments, the pH of the buffer is about 5.2. In other embodiments, the pH of the buffer is 5.2. In one embodiment, the buffer is 10 mM acetate buffer and the pH is about 5.2. In another embodiment, the buffer is 10 mM succinate buffer and the pH is about 5.2. In yet another embodiment, the buffer is 10 mM histidine buffer and the pH is about 5.2. In still another embodiment, the buffer is 10 mM citrate buffer and the pH is about 5.2.
  • the pH of the formulation is within the range of pH 4 and 6.5. In some embodiments, the pH of the formulation is within the range of pH 4.7 and 5.7. In other embodiments, the pH of the formulation is about 5.2. In other embodiments, the pH of the formulation is 5.2. [0099] In one embodiment, the pH of the formulation is within the range of pH 4 and 6.5, and the formulation comprises acetate buffer. In one embodiment, the pH of the formulation is within the range of pH 4 and 6.5, and the formulation comprises acetate buffer at a concentration of from 5 mM to 15 mM. In one embodiment, the pH of the formulation is within the range of pH 4 and 6.5, and the formulation comprises acetate buffer at a concentration of 10 mM. In one embodiment, the pH of the formulation is within the range of pH 4.7 and 5.7, and the
  • the formulation comprises acetate buffer.
  • the pH of the formulation is within the range of pH 4.7 and 5.7, and the formulation comprises acetate buffer at a concentration of from 5 mM to 15 mM.
  • the pH of the formulation is within the range of pH 4.7 and 5.7, and the formulation comprises acetate buffer at a concentration of 10 mM.
  • the pH of the formulation is about 5.2, and the formulation comprises acetate buffer.
  • the pH of the formulation is about 5.2, and the formulation comprises acetate buffer at a concentration of from 5 mM to 15 mM.
  • the pH of the formulation is about 5.2, and the formulation comprises acetate buffer at a concentration of 10 mM.
  • the pH of the formulation is 5.2, and the formulation comprises acetate buffer. In one embodiment, the pH of the formulation is 5.2, and the formulation comprises acetate buffer at a concentration of from 5 mM to 15 mM. In one embodiment, the pH of the formulation is 5.2, and the formulation comprises acetate buffer at a concentration of 10 mM. In one embodiment, a acetate buffer is the only buffer present in the formulation.
  • the pH of the formulation is within the range of pH 4 and 6.5, and the formulation comprises succinate buffer. In one embodiment, the pH of the formulation is within the range of pH 4 and 6.5, and the formulation comprises succinate buffer at a
  • the pH of the formulation is within the range of pH 4 and 6.5, and the formulation comprises succinate buffer at a concentration of 10 mM. In one embodiment, the pH of the formulation is within the range of pH 4.7 and 5.7, and the formulation comprises succinate buffer. In one embodiment, the pH of the formulation is within the range of pH 4.7 and 5.7, and the formulation comprises succinate buffer at a concentration of from 5 mM to 15 mM. In one embodiment, the pH of the formulation is within the range of pH 4.7 and 5.7, and the formulation comprises succinate buffer at a concentration of 10 mM. In one embodiment, the pH of the formulation is about 5.2, and the formulation comprises succinate buffer.
  • the pH of the formulation is about 5.2, and the formulation comprises succinate buffer at a concentration of from 5 mM to 15 mM. In one embodiment, the pH of the formulation is about 5.2, and the formulation comprises succinate buffer at a concentration of 10 mM. In one embodiment, the pH of the formulation is 5.2, and the formulation comprises succinate buffer. In one embodiment, the pH of the formulation is 5.2, and the formulation comprises succinate buffer at a concentration of from 5 mM to 15 mM. In one embodiment, the pH of the formulation is 5.2, and the formulation comprises succinate buffer at a concentration of 10 mM. In one embodiment, a succinate buffer is the only buffer present in the formulation.
  • the pH of the formulation is within the range of pH 4 and 6.5, and the formulation comprises histidine buffer. In one embodiment, the pH of the formulation is within the range of pH 4 and 6.5, and the formulation comprises histidine buffer at a
  • the pH of the formulation is within the range of pH 4 and 6.5, and the formulation comprises histidine buffer at a concentration of 10 mM. In one embodiment, the pH of the formulation is within the range of pH 4.7 and 5.7, and the formulation comprises histidine buffer. In one embodiment, the pH of the formulation is within the range of pH 4.7 and 5.7, and the formulation comprises histidine buffer at a concentration of from 5 mM to 15 mM. In one embodiment, the pH of the formulation is within the range of pH 4.7 and 5.7, and the formulation comprises histidine buffer at a concentration of 10 mM. In one embodiment, the pH of the formulation is about 5.2, and the formulation comprises histidine buffer.
  • the pH of the formulation is about 5.2, and the formulation comprises histidine buffer at a concentration of from 5 mM to 15 mM. In one embodiment, the pH of the formulation is about 5.2, and the formulation comprises histidine buffer at a concentration of 10 mM. In one embodiment, the pH of the formulation is 5.2, and the formulation comprises histidine buffer. In one embodiment, the pH of the formulation is 5.2, and the formulation comprises histidine buffer at a concentration of from 5 mM to 15 mM. In one embodiment, the pH of the formulation is 5.2, and the formulation comprises histidine buffer at a concentration of 10 mM. In one embodiment, a histidine buffer is the only buffer present in the formulation.
  • the pH of the formulation is within the range of pH 4 and 6.5, and the formulation comprises citrate buffer. In one embodiment, the pH of the formulation is within the range of pH 4 and 6.5, and the formulation comprises citrate buffer at a concentration of from 5 mM to 15 mM. In one embodiment, the pH of the formulation is within the range of pH 4 and 6.5, and the formulation comprises citrate buffer at a concentration of 10 mM. In one embodiment, the pH of the formulation is within the range of pH 4.7 and 5.7, and the
  • the formulation comprises citrate buffer.
  • the pH of the formulation is within the range of pH 4.7 and 5.7, and the formulation comprises citrate buffer at a concentration of from 5 mM to 15 mM.
  • the pH of the formulation is within the range of pH 4.7 and 5.7, and the formulation comprises citrate buffer at a concentration of 10 mM.
  • the pH of the formulation is about 5.2, and the formulation comprises citrate buffer. In one embodiment, the pH of the formulation is about 5.2, and the formulation comprises citrate buffer at a concentration of from 5 mM to 15 mM. In one embodiment, the pH of the formulation is about 5.2, and the formulation comprises citrate buffer at a concentration of 10 mM. In one embodiment, the pH of the formulation is 5.2, and the formulation comprises citrate buffer. In one embodiment, the pH of the formulation is 5.2, and the formulation comprises citrate buffer at a concentration of from 5 mM to 15 mM. In one embodiment, the pH of the formulation is 5.2, and the formulation comprises citrate buffer at a concentration of 10 mM. In one embodiment, a citrate buffer is the only buffer present in the formulation.
  • the pharmaceutical formulation further comprises a surfactant.
  • the surfactant is a polysorbate.
  • the polysorbate is polysorbate-20.
  • the polysorbate is polysorbate-40.
  • the polysorbate is polysorbate-60.
  • the polysorbate is polysorbate-80.
  • the concentration of the surfactant is from 0.001-0.1% (w/v). In one embodiment, the concentration of the surfactant is from 0.001-0.01% (w/v). In one embodiment, the concentration of the surfactant is 0.05% (w/v). In one embodiment, the concentration of the surfactant is about 0.005% (w/v). In one embodiment, the concentration of the surfactant is 0.005% (w/v). In one embodiment, the concentration of the polysorbate-20 is from 0.001-0.1% (w/v). In one embodiment, the concentration of the polysorbate-20 is from 0.001-0.01%) (w/v). In one embodiment, the concentration of the polysorbate-20 is 0.05%> (w/v).
  • the concentration of the polysorbate-20 is about 0.005%> (w/v). In one embodiment, the concentration of the polysorbate-20 is 0.005%) (w/v). In one embodiment, the concentration of the polysorbate-40 is from 0.001-0.1% (w/v). In one embodiment, the concentration of the polysorbate-40 is from 0.001-0.01% (w/v). In one embodiment, the concentration of the polysorbate-40 is 0.05% (w/v). In one embodiment, the concentration of the polysorbate-40 is about 0.005% (w/v). In one embodiment, the concentration of the polysorbate- 40 is 0.005% (w/v). In one embodiment, the concentration of the polysorbate-60 is from 0.001- 0.1% (w/v).
  • the concentration of the polysorbate-60 is from 0.001-0.01% (w/v). In one embodiment, the concentration of the polysorbate-60 is 0.05% (w/v). In one embodiment, the concentration of the polysorbate-60 is about 0.005% (w/v). In one embodiment, the concentration of the polysorbate-60 is 0.005% (w/v). In one embodiment, the concentration of the polysorbate-80 is from 0.001-0.1% (w/v). In one embodiment, the concentration of the polysorbate-80 is from 0.001-0.01% (w/v). In one embodiment, the concentration of the polysorbate-80 is 0.05% (w/v). In one embodiment, the concentration of the polysorbate-80 is about 0.005%) (w/v). In one embodiment, the concentration of the polysorbate-80 is 0.005%) (w/v). In one embodiment, the concentration of the polysorbate-80 is 0.005%) (w/v).
  • the pH of the formulation is within the range of pH 4 and 6.5, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and (iii) an acetate buffer.
  • the pH of the formulation is within the range of pH 4 and 6.5, and the formulation comprises (i) a PD-1 antibody or antigen- binding fragment provided herein, (ii) a surfactant, and (iii) an acetate buffer at a concentration of from 5 mM to 15 mM.
  • the pH of the formulation is within the range of pH 4 and 6.5, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and (iii) an acetate buffer at a concentration of 10 mM. In one embodiment, the pH of the formulation is within the range of pH 4.7 and 5.7, and the
  • formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and (iii) an acetate buffer.
  • pH of the formulation is within the range of pH 4.7 and 5.7
  • the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and (iii) an acetate buffer at a concentration of from 5 mM to 15 mM.
  • the pH of the formulation is within the range of pH 4.7 and 5.7, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and (iii) an acetate buffer at a concentration of 10 mM. In one embodiment, the pH of the formulation is about 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and (iii) an acetate buffer.
  • the pH of the formulation is about 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and (iii) a acetate buffer at a concentration of from 5 mM to 15 mM. In one embodiment, the pH of the formulation is about 5.2, and the formulation comprises (i) a PD-1 antibody or antigen- binding fragment provided herein, (ii) a surfactant, and (iii) an acetate buffer at a concentration of 10 mM.
  • the pH of the formulation is 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and (iii) an acetate buffer.
  • the pH of the formulation is 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and (iii) an acetate buffer at a concentration of from 5 mM to 15 mM.
  • the pH of the formulation is 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and (iii) an acetate buffer at a concentration of 10 mM.
  • a acetate buffer is the only buffer present in the formulation.
  • the surfactant is a polysorbate.
  • the polysorbate is polysorbate- 20.
  • the polysorbate is polysorbate-40.
  • the polysorbate is polysorbate-60.
  • the polysorbate is polysorbate-80.
  • the concentration of the surfactant is from 0.001-0.1% (w/v).
  • the concentration of the surfactant is from 0.001-0.01% (w/v). In one embodiment, the concentration of the surfactant is 0.05% (w/v). In one embodiment, the concentration of the surfactant is about 0.005%) (w/v). In one embodiment, the concentration of the surfactant is 0.005%) (w/v). In one embodiment, the concentration of the polysorbate-20 is from 0.001-0.1% (w/v). In one embodiment, the concentration of the polysorbate-20 is from 0.001-0.01% (w/v). In one embodiment, the concentration of the polysorbate-20 is 0.05%> (w/v). In one embodiment, the concentration of the polysorbate-20 is about 0.005%> (w/v). In one embodiment, the
  • concentration of the polysorbate-20 is 0.005%) (w/v). In one embodiment, the concentration of the polysorbate-40 is from 0.001-0.1% (w/v). In one embodiment, the concentration of the polysorbate-40 is from 0.001-0.01% (w/v). In one embodiment, the concentration of the polysorbate-40 is 0.05%> (w/v). In one embodiment, the concentration of the polysorbate-40 is about 0.005%) (w/v). In one embodiment, the concentration of the polysorbate-40 is 0.005%) (w/v). In one embodiment, the concentration of the polysorbate-60 is from 0.001-0.1%) (w/v). In one embodiment, the concentration of the polysorbate-60 is from 0.001-0.01% (w/v).
  • the concentration of the polysorbate-60 is 0.05%> (w/v). In one embodiment, the concentration of the polysorbate-60 is about 0.005% (w/v). In one embodiment, the concentration of the polysorbate-60 is 0.005% (w/v). In one embodiment, the concentration of the polysorbate-80 is from 0.001-0.1% (w/v). In one embodiment, the concentration of the polysorbate-80 is from 0.001-0.01% (w/v). In one embodiment, the concentration of the polysorbate-80 is 0.05% (w/v). In one embodiment, the concentration of the polysorbate-80 is about 0.005%) (w/v). In one embodiment, the concentration of the polysorbate-80 is 0.005%) (w/v).
  • the pH of the formulation is within the range of pH 4 and 6.5, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein,
  • the pH of the formulation is within the range of pH 4 and 6.5, and the formulation comprises (i) a PD-1 antibody or antigen- binding fragment provided herein, (ii) a surfactant, and (iii) a succinate buffer at a concentration of from 5 mM to 15 mM.
  • the pH of the formulation is within the range of pH 4 and 6.5, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and (iii) a succinate buffer at a concentration of 10 mM.
  • the pH of the formulation is within the range of pH 4.7 and 5.7, and the
  • formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and (iii) a succinate buffer.
  • pH of the formulation is within the range of pH 4.7 and 5.7
  • the formulation comprises (i) a PD-1 antibody or antigen- binding fragment provided herein, (ii) a surfactant, and (iii) a succinate buffer at a concentration of from 5 mM to 15 mM.
  • the pH of the formulation is within the range of pH 4.7 and 5.7, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and (iii) a succinate buffer at a concentration of 10 mM.
  • the pH of the formulation is about 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and (iii) a succinate buffer.
  • the pH of the formulation is about 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and
  • a succinate buffer at a concentration of from 5 mM to 15 mM.
  • the pH of the formulation is about 5.2, and the formulation comprises (i) a PD-1 antibody or antigen- binding fragment provided herein, (ii) a surfactant, and (iii) a succinate buffer at a concentration of 10 mM.
  • the pH of the formulation is 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and (iii) a succinate buffer.
  • the pH of the formulation is 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and (iii) a succinate buffer at a concentration of from 5 mM to 15 mM.
  • the pH of the formulation is 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and (iii) a succinate buffer at a concentration of 10 mM.
  • a succinate buffer is the only buffer present in the formulation.
  • the surfactant is a polysorbate.
  • the polysorbate is polysorbate- 20.
  • the polysorbate is polysorbate-40. In one embodiment, the polysorbate is polysorbate-60. In one embodiment, the polysorbate is polysorbate-80. In one embodiment, the concentration of the surfactant is from 0.001-0.1% (w/v). In one embodiment, the concentration of the surfactant is from 0.001-0.01%) (w/v). In one embodiment, the concentration of the surfactant is 0.05%> (w/v). In one embodiment, the concentration of the surfactant is about 0.005%) (w/v). In one embodiment, the concentration of the surfactant is 0.005%) (w/v). In one embodiment, the concentration of the polysorbate-20 is from 0.001-0.1% (w/v).
  • the concentration of the polysorbate-20 is from 0.001-0.01% (w/v). In one embodiment, the concentration of the polysorbate-20 is 0.05%> (w/v). In one embodiment, the concentration of the polysorbate-20 is about 0.005%> (w/v). In one embodiment, the
  • concentration of the polysorbate-20 is 0.005%) (w/v). In one embodiment, the concentration of the polysorbate-40 is from 0.001-0.1% (w/v). In one embodiment, the concentration of the polysorbate-40 is from 0.001-0.01% (w/v). In one embodiment, the concentration of the polysorbate-40 is 0.05%> (w/v). In one embodiment, the concentration of the polysorbate-40 is about 0.005%) (w/v). In one embodiment, the concentration of the polysorbate-40 is 0.005%) (w/v). In one embodiment, the concentration of the polysorbate-60 is from 0.001-0.1%) (w/v). In one embodiment, the concentration of the polysorbate-60 is from 0.001-0.01% (w/v). In one embodiment, the concentration of the polysorbate-60 is 0.05%> (w/v). In one embodiment, the concentration of the polysorbate-60 is about 0.005%> (w/v). In one embodiment, the concentration of the polysorbate-60 is about 0.005%> (w/v). In one embodiment
  • concentration of the polysorbate-60 is 0.005%) (w/v). In one embodiment, the concentration of the polysorbate-80 is from 0.001-0.1% (w/v). In one embodiment, the concentration of the polysorbate-80 is from 0.001-0.01% (w/v). In one embodiment, the concentration of the polysorbate-80 is 0.05%> (w/v). In one embodiment, the concentration of the polysorbate-80 is about 0.005% (w/v). In one embodiment, the concentration of the polysorbate-80 is 0.005% (w/v).
  • the pH of the formulation is within the range of pH 4 and 6.5, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein,
  • the pH of the formulation is within the range of pH 4 and 6.5, and the formulation comprises (i) a PD-1 antibody or antigen- binding fragment provided herein, (ii) a surfactant, and (iii) a histidine buffer at a concentration of from 5 mM to 15 mM.
  • the pH of the formulation is within the range of pH 4 and 6.5, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and (iii) a histidine buffer at a concentration of 10 mM.
  • the pH of the formulation is within the range of pH 4.7 and 5.7, and the
  • formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and (iii) a histidine buffer.
  • pH of the formulation is within the range of pH 4.7 and 5.7
  • the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and (iii) a histidine buffer at a concentration of from 5 mM to 15 mM.
  • the pH of the formulation is within the range of pH 4.7 and 5.7, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and (iii) a histidine buffer at a concentration of 10 mM.
  • the pH of the formulation is about 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and (iii) a histidine buffer.
  • the pH of the formulation is about 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and
  • the pH of the formulation is about 5.2, and the formulation comprises (i) a PD-1 antibody or antigen- binding fragment provided herein, (ii) a surfactant, and (iii) a histidine buffer at a concentration of 10 mM.
  • the pH of the formulation is 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and (iii) a histidine buffer.
  • the pH of the formulation is 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and (iii) a histidine buffer at a concentration of from 5 mM to 15 mM.
  • the pH of the formulation is 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and (iii) a histidine buffer at a concentration of 10 mM.
  • a histidine buffer is the only buffer present in the formulation.
  • the surfactant is a polysorbate.
  • the polysorbate is polysorbate- 20. In one embodiment, the polysorbate is polysorbate-40. In one embodiment, the polysorbate is polysorbate-60. In one embodiment, the polysorbate is polysorbate-80. In one embodiment, the concentration of the surfactant is from 0.001-0.1% (w/v). In one embodiment, the concentration of the surfactant is from 0.001-0.01%) (w/v). In one embodiment, the concentration of the surfactant is 0.05%> (w/v). In one embodiment, the concentration of the surfactant is about 0.005%) (w/v). In one embodiment, the concentration of the surfactant is 0.005%) (w/v).
  • the concentration of the polysorbate-20 is from 0.001-0.1% (w/v). In one embodiment, the concentration of the polysorbate-20 is from 0.001-0.01% (w/v). In one embodiment, the concentration of the polysorbate-20 is 0.05%> (w/v). In one embodiment, the concentration of the polysorbate-20 is about 0.005%> (w/v). In one embodiment, the
  • concentration of the polysorbate-20 is 0.005%) (w/v). In one embodiment, the concentration of the polysorbate-40 is from 0.001-0.1% (w/v). In one embodiment, the concentration of the polysorbate-40 is from 0.001-0.01% (w/v). In one embodiment, the concentration of the polysorbate-40 is 0.05%> (w/v). In one embodiment, the concentration of the polysorbate-40 is about 0.005%) (w/v). In one embodiment, the concentration of the polysorbate-40 is 0.005%) (w/v). In one embodiment, the concentration of the polysorbate-60 is from 0.001-0.1%) (w/v). In one embodiment, the concentration of the polysorbate-60 is from 0.001-0.01% (w/v). In one embodiment, the concentration of the polysorbate-60 is 0.05%> (w/v). In one embodiment, the concentration of the polysorbate-60 is about 0.005%> (w/v). In one embodiment, the concentration of the polysorbate-60 is about 0.005%> (w/v). In one embodiment
  • concentration of the polysorbate-60 is 0.005%) (w/v).
  • concentration of the polysorbate-80 is from 0.001-0.1% (w/v).
  • concentration of the polysorbate-80 is from 0.001-0.01% (w/v).
  • concentration of the polysorbate-80 is 0.05%> (w/v).
  • concentration of the polysorbate-80 is about 0.005%) (w/v).
  • concentration of the polysorbate-80 is 0.005%) (w/v).
  • the pH of the formulation is within the range of pH 4 and 6.5, and the formulation comprises a (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and (iii) a citrate buffer.
  • the pH of the formulation is within the range of pH 4 and 6.5, and the formulation comprises (i) a PD-1 antibody or antigen- binding fragment provided herein, (ii) a surfactant, and (iii) a citrate buffer at a concentration of from 5 mM to 15 mM.
  • the pH of the formulation is within the range of pH 4 and 6.5, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and (iii) a citrate buffer at a concentration of 10 mM.
  • the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and (iii) a citrate buffer at a concentration of 10 mM.
  • the pH of the formulation is within the range of pH 4.7 and 5.7, and the
  • formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and (iii) a citrate buffer.
  • pH of the formulation is within the range of pH 4.7 and 5.7
  • the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and (iii) a citrate buffer at a concentration of from 5 mM to 15 mM.
  • the pH of the formulation is within the range of pH 4.7 and 5.7, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and (iii) a citrate buffer at a concentration of 10 mM.
  • the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and (iii) a citrate buffer at a concentration of 10 mM.
  • the pH of the formulation is about 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and (iii) a citrate buffer.
  • the pH of the formulation is about 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and (iii) a citrate buffer at a concentration of from 5 mM to 15 mM.
  • the pH of the formulation is about 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and (iii) a citrate buffer at a concentration of 10 mM.
  • the pH of the formulation is 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and (iii) a citrate buffer.
  • the pH of the formulation is 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and (iii) a citrate buffer at a concentration of from 5 mM to 15 mM.
  • the pH of the formulation is 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, and (iii) a citrate buffer at a concentration of 10 mM.
  • a citrate buffer is the only buffer present in the formulation.
  • the surfactant is a polysorbate.
  • the polysorbate is polysorbate-20.
  • the polysorbate is polysorbate-40. In one embodiment, the polysorbate is polysorbate-60. In one embodiment, the polysorbate is polysorbate-80. In one embodiment, the concentration of the surfactant is from 0.001-0.1% (w/v). In one embodiment, the concentration of the surfactant is from 0.001-0.01%) (w/v). In one embodiment, the concentration of the surfactant is 0.05%> (w/v). In one embodiment, the concentration of the surfactant is about 0.005%) (w/v). In one
  • the concentration of the surfactant is 0.005%) (w/v). In one embodiment, the concentration of the polysorbate-20 is from 0.001-0.1% (w/v). In one embodiment, the concentration of the polysorbate-20 is from 0.001-0.01% (w/v). In one embodiment, the concentration of the polysorbate-20 is 0.05%> (w/v). In one embodiment, the concentration of the polysorbate-20 is about 0.005%> (w/v). In one embodiment, the concentration of the polysorbate- 20 is 0.005% (w/v). In one embodiment, the concentration of the polysorbate-40 is from 0.001- 0.1% (w/v). In one embodiment, the concentration of the polysorbate-40 is from 0.001-0.01% (w/v).
  • the concentration of the polysorbate-40 is 0.05%> (w/v). In one embodiment, the concentration of the polysorbate-40 is about 0.005%> (w/v). In one embodiment, the concentration of the polysorbate-40 is 0.005%> (w/v). In one embodiment, the concentration of the polysorbate-60 is from 0.001-0.1% (w/v). In one embodiment, the concentration of the polysorbate-60 is from 0.001-0.01% (w/v). In one embodiment, the concentration of the polysorbate-60 is 0.05%> (w/v). In one embodiment, the concentration of the polysorbate-60 is about 0.005%) (w/v). In one embodiment, the concentration of the polysorbate-60 is 0.005%) (w/v).
  • the concentration of the polysorbate-80 is from 0.001-0.1%) (w/v). In one embodiment, the concentration of the polysorbate-80 is from 0.001-0.01% (w/v). In one embodiment, the concentration of the polysorbate-80 is 0.05%> (w/v). In one embodiment, the concentration of the polysorbate-80 is about 0.005%> (w/v). In one embodiment, the
  • concentration of the polysorbate-80 is 0.005%) (w/v).
  • the pharmaceutical formulation further comprises a polyol.
  • the polyol is a sugar, sugar alcohol, or sugar acid.
  • the polyol is a sugar.
  • the polyol is a sugar alcohol.
  • the polyol is a sugar acid.
  • the polyol is sucrose.
  • the concentration of the sucrose is from 5-10% (w/v).
  • the concentration of the sucrose is from 8-9%> (w/v).
  • the concentration of the sucrose is 9% (w/v).
  • the concentration of the sucrose is about 8.5%> (w/v).
  • the concentration of the sucrose is 8.5%> (w/v).
  • the polyol is maltose. In one embodiment, the concentration of the maltose is from 5-10% (w/v). In one embodiment, the concentration of the maltose is from 8-9% (w/v). In another embodiment, the concentration of the maltose is 9% (w/v). In another embodiment, the concentration of the maltose is about 8.5% (w/v). In another embodiment, the concentration of the maltose is 8.5% (w/v). In one specific embodiment, the polyol is trehalose. In one embodiment, the concentration of the trehalose is from 5-10% (w/v).
  • the concentration of the trehalose is from 8-9% (w/v). In another embodiment, the concentration of the trehalose is 9% (w/v). In another embodiment, the concentration of the trehalose is about 8.5%) (w/v). In another embodiment, the concentration of the trehalose is 8.5%> (w/v).
  • the polyol is mannitol. In one embodiment, the concentration of the mannitol is from 5-10% (w/v). In one embodiment, the concentration of the mannitol is from 8- 9% (w/v). In another embodiment, the concentration of the mannitol is 9%> (w/v).
  • the concentration of the mannitol is about 8.5%> (w/v). In another embodiment, the concentration of the mannitol is 8.5%> (w/v).
  • the polyol is sorbitol. In one embodiment, the concentration of the sorbitol is from 5-10% (w/v). In one embodiment, the concentration of the sorbitol is from 8-9%> (w/v). In another embodiment, the concentration of the sorbitol is 9%> (w/v). In another embodiment, the concentration of the sorbitol is about 8.5%) (w/v). In another embodiment, the concentration of the sorbitol is 8.5%> (w/v).
  • the pH of the formulation is within the range of pH 4 and 6.5, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) an acetate buffer, and (iv) a polyol.
  • the pH of the formulation is within the range of pH 4 and 6.5, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) an acetate buffer at a concentration of from 5 mM to 15 mM, and (iv) a polyol.
  • the pH of the formulation is within the range of pH 4 and 6.5, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) an acetate buffer at a concentration of 10 mM, and (iv) a polyol.
  • the pH of the formulation is within the range of pH 4.7 and 5.7, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) an acetate buffer, and (iv) a polyol.
  • the pH of the formulation is within the range of pH 4.7 and 5.7, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) an acetate buffer at a concentration of from 5 mM to 15 mM, and (iv) a polyol.
  • the pH of the formulation is within the range of pH 4.7 and 5.7, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) an acetate buffer at a concentration of 10 mM, and (iv) a polyol.
  • the pH of the formulation is about 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) an acetate buffer, and (iv) a polyol.
  • the pH of the formulation is about 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) an acetate buffer at a concentration of from 5 mM to 15 mM, and (iv) a polyol.
  • the pH of the formulation is about 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) an acetate buffer at a concentration of 10 mM, and (iv) a polyol.
  • the pH of the formulation is 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) an acetate buffer, and (iv) a polyol.
  • the pH of the formulation is 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) an acetate buffer at a concentration of from 5 mM to 15 mM, and (iv) a polyol.
  • the pH of the formulation is 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) an acetate buffer at a concentration of 10 mM, and (iv) a polyol.
  • an acetate buffer is the only buffer present in the formulation.
  • the polyol is a sugar, sugar alcohol, or sugar acid. In one embodiment, the polyol is a sugar. In another embodiment, the polyol is a sugar alcohol. In yet another embodiment, the polyol is a sugar acid. In one specific embodiment, the polyol is sucrose. In one embodiment, the concentration of the sucrose is from 5-10% (w/v). In one embodiment, the concentration of the sucrose is from 8-9% (w/v). In another embodiment, the concentration of the sucrose is 9% (w/v). In another embodiment, the concentration of the sucrose is about 8.5% (w/v). In another embodiment, the concentration of the sucrose is 8.5% (w/v). In one specific embodiment, the polyol is maltose.
  • the concentration of the maltose is from 5-10% (w/v). In one embodiment, the concentration of the maltose is from 8-9% (w/v). In another embodiment, the concentration of the maltose is 9% (w/v). In another embodiment, the concentration of the maltose is about 8.5% (w/v). In another embodiment, the concentration of the maltose is 8.5% (w/v). In one specific embodiment, the polyol is trehalose. In one embodiment, the concentration of the trehalose is from 5-10% (w/v). In one embodiment, the concentration of the trehalose is from 8-9%) (w/v). In another embodiment, the concentration of the trehalose is 9% (w/v).
  • the concentration of the trehalose is about 8.5%> (w/v). In another embodiment, the concentration of the trehalose is 8.5%> (w/v).
  • the polyol is mannitol. In one embodiment, the concentration of the mannitol is from 5-10% (w/v). In one embodiment, the concentration of the mannitol is from 8-9% (w/v). In another
  • the concentration of the mannitol is 9% (w/v). In another embodiment, the concentration of the mannitol is about 8.5%> (w/v). In another embodiment, the concentration of the mannitol is 8.5%> (w/v). In one specific embodiment, the polyol is sorbitol. In one
  • the surfactant is a polysorbate. In one embodiment, the polysorbate is polysorbate- 20. In one embodiment, the polysorbate is polysorbate-40. In one embodiment, the polysorbate is polysorbate-60. In one embodiment, the polysorbate is polysorbate-80. In one embodiment, the concentration of the surfactant is from 0.001-0.1%) (w/v). In one embodiment, the concentration of the surfactant is from 0.001-0.01%) (w/v). In one embodiment, the concentration of the surfactant is 0.05%> (w/v). In one embodiment, the concentration of the surfactant is about 0.005%) (w/v). In one embodiment, the concentration of the surfactant is 0.005%) (w/v).
  • the concentration of the polysorbate-20 is from 0.001-0.1% (w/v). In one embodiment, the concentration of the polysorbate-20 is from 0.001-0.01% (w/v). In one embodiment, the concentration of the polysorbate-20 is 0.05%> (w/v). In one embodiment, the concentration of the polysorbate-20 is about 0.005%> (w/v). In one embodiment, the
  • concentration of the polysorbate-20 is 0.005%) (w/v). In one embodiment, the concentration of the polysorbate-40 is from 0.001-0.1% (w/v). In one embodiment, the concentration of the polysorbate-40 is from 0.001-0.01% (w/v). In one embodiment, the concentration of the polysorbate-40 is 0.05%> (w/v). In one embodiment, the concentration of the polysorbate-40 is about 0.005%) (w/v). In one embodiment, the concentration of the polysorbate-40 is 0.005%) (w/v). In one embodiment, the concentration of the polysorbate-60 is from 0.001-0.1%) (w/v). In one embodiment, the concentration of the polysorbate-60 is from 0.001-0.01% (w/v). In one embodiment, the concentration of the polysorbate-60 is 0.05% (w/v). In one embodiment, the concentration of the polysorbate-60 is about 0.005% (w/v). In one embodiment, the concentration of the polysorbate-40 is from 0.001-0.1% (w/v). In one embodiment,
  • concentration of the polysorbate-60 is 0.005%) (w/v).
  • concentration of the polysorbate-80 is from 0.001-0.1% (w/v).
  • concentration of the polysorbate-80 is from 0.001-0.01% (w/v).
  • concentration of the polysorbate-80 is 0.05%> (w/v).
  • concentration of the polysorbate-80 is about 0.005%) (w/v).
  • concentration of the polysorbate-80 is 0.005%) (w/v).
  • the pH of the formulation is within the range of pH 4 and 6.5, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) a succinate buffer, and (iv) a polyol.
  • the pH of the formulation is within the range of pH 4 and 6.5, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) a succinate buffer at a concentration of from 5 mM to 15 mM, and (iv) a polyol.
  • the pH of the formulation is within the range of pH 4 and 6.5, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) a succinate buffer at a concentration of 10 mM, and (iv) a polyol.
  • the pH of the formulation is within the range of pH 4.7 and 5.7, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) a succinate buffer, and (iv) a polyol.
  • the pH of the formulation is within the range of pH 4.7 and 5.7, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) a succinate buffer at a concentration of from 5 mM to 15 mM, and (iv) a polyol.
  • the pH of the formulation is within the range of pH 4.7 and 5.7, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) a succinate buffer at a concentration of 10 mM, and (iv) a polyol.
  • the pH of the formulation is about 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) a succinate buffer, and (iv) a polyol.
  • the pH of the formulation is about 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) a succinate buffer at a concentration of from 5 mM to 15 mM, and (iv) a polyol.
  • the pH of the formulation is about 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) a succinate buffer at a concentration of 10 mM, and (iv) a polyol.
  • the pH of the formulation is 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) a succinate buffer, and (iv) a polyol.
  • the pH of the formulation is 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) a succinate buffer at a concentration of from 5 mM to 15 mM, and (iv) a polyol.
  • the pH of the formulation is 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) a succinate buffer at a concentration of 10 mM, and (iv) a polyol.
  • a succinate buffer is the only buffer present in the formulation.
  • the polyol is a sugar, sugar alcohol, or sugar acid. In one embodiment, the polyol is a sugar. In another embodiment, the polyol is a sugar alcohol. In yet another embodiment, the polyol is a sugar acid. In one specific embodiment, the polyol is sucrose. In one embodiment, the concentration of the sucrose is from 5-10% (w/v). In one embodiment, the concentration of the sucrose is from 8-9% (w/v). In another embodiment, the concentration of the sucrose is 9% (w/v). In another embodiment, the concentration of the sucrose is about 8.5% (w/v). In another embodiment, the concentration of the sucrose is 8.5% (w/v). In one specific embodiment, the polyol is maltose.
  • the concentration of the maltose is from 5-10% (w/v). In one embodiment, the concentration of the maltose is from 8-9% (w/v). In another embodiment, the concentration of the maltose is 9% (w/v). In another embodiment, the concentration of the maltose is about 8.5% (w/v). In another embodiment, the concentration of the maltose is 8.5% (w/v). In one specific embodiment, the polyol is trehalose. In one embodiment, the concentration of the trehalose is from 5-10% (w/v). In one embodiment, the concentration of the trehalose is from 8-9%) (w/v). In another embodiment, the concentration of the trehalose is 9%> (w/v).
  • the concentration of the trehalose is about 8.5%> (w/v). In another embodiment, the concentration of the trehalose is 8.5%> (w/v).
  • the polyol is mannitol. In one embodiment, the concentration of the mannitol is from 5-10% (w/v). In one embodiment, the concentration of the mannitol is from 8-9% (w/v). In another embodiment, the concentration of the mannitol is 9% (w/v). In another embodiment, the concentration of the mannitol is about 8.5% (w/v). In another embodiment, the concentration of the mannitol is 8.5% (w/v). In one specific embodiment, the polyol is sorbitol.
  • the concentration of the sorbitol is from 5-10% (w/v). In one embodiment, the concentration of the sorbitol is from 8-9%> (w/v). In another embodiment, the concentration of the sorbitol is 9% (w/v). In another embodiment, the concentration of the sorbitol is about 8.5%> (w/v). In another embodiment, the concentration of the sorbitol is 8.5%> (w/v). In one
  • the surfactant is a polysorbate. In one embodiment, the polysorbate is polysorbate- 20. In one embodiment, the polysorbate is polysorbate-40. In one embodiment, the polysorbate is polysorbate-60. In one embodiment, the polysorbate is polysorbate-80. In one embodiment, the concentration of the surfactant is from 0.001-0.1%) (w/v). In one embodiment, the concentration of the surfactant is from 0.001-0.01%) (w/v). In one embodiment, the concentration of the surfactant is 0.05%> (w/v). In one embodiment, the concentration of the surfactant is about 0.005%) (w/v). In one embodiment, the concentration of the surfactant is 0.005%) (w/v).
  • the concentration of the polysorbate-20 is from 0.001-0.1% (w/v). In one embodiment, the concentration of the polysorbate-20 is from 0.001-0.01% (w/v). In one embodiment, the concentration of the polysorbate-20 is 0.05%> (w/v). In one embodiment, the concentration of the polysorbate-20 is about 0.005%> (w/v). In one embodiment, the
  • concentration of the polysorbate-20 is 0.005%) (w/v). In one embodiment, the concentration of the polysorbate-40 is from 0.001-0.1% (w/v). In one embodiment, the concentration of the polysorbate-40 is from 0.001-0.01% (w/v). In one embodiment, the concentration of the polysorbate-40 is 0.05%> (w/v). In one embodiment, the concentration of the polysorbate-40 is about 0.005%) (w/v). In one embodiment, the concentration of the polysorbate-40 is 0.005%) (w/v). In one embodiment, the concentration of the polysorbate-60 is from 0.001-0.1%) (w/v). In one embodiment, the concentration of the polysorbate-60 is from 0.001-0.01% (w/v). In one embodiment, the concentration of the polysorbate-60 is 0.05%> (w/v). In one embodiment, the concentration of the polysorbate-60 is about 0.005%> (w/v). In one embodiment, the concentration of the polysorbate-60 is about 0.005%> (w/v). In one embodiment
  • concentration of the polysorbate-60 is 0.005%) (w/v).
  • concentration of the polysorbate-80 is from 0.001-0.1% (w/v).
  • concentration of the polysorbate-80 is from 0.001-0.01% (w/v).
  • concentration of the polysorbate-80 is 0.05%> (w/v).
  • concentration of the polysorbate-80 is about 0.005%) (w/v).
  • concentration of the polysorbate-80 is 0.005%) (w/v).
  • the pH of the formulation is within the range of pH 4 and 6.5, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) a histidine buffer, and (iv) a polyol.
  • the pH of the formulation is within the range of pH 4 and 6.5, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) a histidine buffer at a concentration of from 5 mM to 15 mM, and (iv) a polyol.
  • the pH of the formulation is within the range of pH 4 and 6.5, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) a histidine buffer at a concentration of 10 mM, and (iv) a polyol.
  • the pH of the formulation is within the range of pH 4.7 and 5.7, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) a histidine buffer, and (iv) a polyol.
  • the pH of the formulation is within the range of pH 4.7 and 5.7, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) a histidine buffer at a concentration of from 5 mM to 15 mM, and (iv) a polyol.
  • the pH of the formulation is within the range of pH 4.7 and 5.7, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) a histidine buffer at a concentration of 10 mM, and (iv) a polyol.
  • the pH of the formulation is about 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) a histidine buffer, and (iv) a polyol.
  • the pH of the formulation is about 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) a histidine buffer at a concentration of from 5 mM to 15 mM, and (iv) a polyol.
  • the pH of the formulation is about 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) a histidine buffer at a concentration of 10 mM, and (iv) a polyol.
  • the pH of the formulation is 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) a histidine buffer, and (iv) a polyol.
  • the pH of the formulation is 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) a histidine buffer at a concentration of from 5 mM to 15 mM, and (iv) a polyol.
  • the pH of the formulation is 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) a histidine buffer at a concentration of 10 mM, and (iv) a polyol.
  • a histidine buffer is the only buffer present in the formulation.
  • the polyol is a sugar, sugar alcohol, or sugar acid. In one embodiment, the polyol is a sugar. In another embodiment, the polyol is a sugar alcohol. In yet another embodiment, the polyol is a sugar acid. In one specific embodiment, the polyol is sucrose. In one embodiment, the concentration of the sucrose is from 5-10% (w/v). In one embodiment, the concentration of the sucrose is from 8-9% (w/v). In another embodiment, the concentration of the sucrose is 9% (w/v). In another embodiment, the concentration of the sucrose is about 8.5% (w/v). In another embodiment, the concentration of the sucrose is 8.5% (w/v). In one specific embodiment, the polyol is maltose.
  • the concentration of the maltose is from 5-10% (w/v). In one embodiment, the concentration of the maltose is from 8-9% (w/v). In another embodiment, the concentration of the maltose is 9% (w/v). In another embodiment, the concentration of the maltose is about 8.5% (w/v). In another embodiment, the concentration of the maltose is 8.5% (w/v). In one specific embodiment, the polyol is trehalose. In one embodiment, the concentration of the trehalose is from 5-10% (w/v). In one embodiment, the concentration of the trehalose is from 8-9%) (w/v). In another embodiment, the concentration of the trehalose is 9% (w/v).
  • the concentration of the trehalose is about 8.5% (w/v). In another embodiment, the concentration of the trehalose is 8.5% (w/v).
  • the polyol is mannitol. In one embodiment, the concentration of the mannitol is from 5-10% (w/v). In one embodiment, the concentration of the mannitol is from 8-9% (w/v). In another
  • the concentration of the mannitol is 9% (w/v). In another embodiment, the concentration of the mannitol is about 8.5% (w/v). In another embodiment, the concentration of the mannitol is 8.5% (w/v). In one specific embodiment, the polyol is sorbitol. In one
  • the concentration of the sorbitol is from 5-10% (w/v). In one embodiment, the concentration of the sorbitol is from 8-9% (w/v). In another embodiment, the concentration of the sorbitol is 9% (w/v). In another embodiment, the concentration of the sorbitol is about 8.5% (w/v). In another embodiment, the concentration of the sorbitol is 8.5% (w/v). In one
  • the surfactant is a polysorbate. In one embodiment, the polysorbate is polysorbate- 20. In one embodiment, the polysorbate is polysorbate-40. In one embodiment, the polysorbate is polysorbate-60. In one embodiment, the polysorbate is polysorbate-80. In one embodiment, the concentration of the surfactant is from 0.001-0.1%) (w/v). In one embodiment, the concentration of the surfactant is from 0.001-0.01% (w/v). In one embodiment, the concentration of the surfactant is 0.05% (w/v). In one embodiment, the concentration of the surfactant is about 0.005%) (w/v). In one embodiment, the concentration of the surfactant is 0.005%) (w/v).
  • the concentration of the polysorbate-20 is from 0.001-0.1% (w/v). In one embodiment, the concentration of the polysorbate-20 is from 0.001-0.01% (w/v). In one embodiment, the concentration of the polysorbate-20 is 0.05%> (w/v). In one embodiment, the concentration of the polysorbate-20 is about 0.005%> (w/v). In one embodiment, the
  • concentration of the polysorbate-20 is 0.005%) (w/v). In one embodiment, the concentration of the polysorbate-40 is from 0.001-0.1% (w/v). In one embodiment, the concentration of the polysorbate-40 is from 0.001-0.01% (w/v). In one embodiment, the concentration of the polysorbate-40 is 0.05%> (w/v). In one embodiment, the concentration of the polysorbate-40 is about 0.005%) (w/v). In one embodiment, the concentration of the polysorbate-40 is 0.005%) (w/v). In one embodiment, the concentration of the polysorbate-60 is from 0.001-0.1%) (w/v). In one embodiment, the concentration of the polysorbate-60 is from 0.001-0.01% (w/v). In one embodiment, the concentration of the polysorbate-60 is 0.05%> (w/v). In one embodiment, the concentration of the polysorbate-60 is about 0.005%> (w/v). In one embodiment, the concentration of the polysorbate-60 is about 0.005%> (w/v). In one embodiment
  • concentration of the polysorbate-60 is 0.005%) (w/v).
  • concentration of the polysorbate-80 is from 0.001-0.1% (w/v).
  • concentration of the polysorbate-80 is from 0.001-0.01% (w/v).
  • concentration of the polysorbate-80 is 0.05%> (w/v).
  • concentration of the polysorbate-80 is about 0.005%) (w/v).
  • concentration of the polysorbate-80 is 0.005%) (w/v).
  • the pH of the formulation is within the range of pH 4 and 6.5, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) a citrate buffer, and (iv) a polyol.
  • the pH of the formulation is within the range of pH 4 and 6.5, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) a citrate buffer at a concentration of from 5 mM to 15 mM, and (iv) a polyol.
  • the pH of the formulation is within the range of pH 4 and 6.5, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) a citrate buffer at a concentration of 10 mM, and (iv) a polyol.
  • the pH of the formulation is within the range of pH 4.7 and 5.7, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) a citrate buffer, and (iv) a polyol.
  • the pH of the formulation is within the range of pH 4.7 and 5.7, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) a citrate buffer at a concentration of from 5 mM to 15 mM, and (iv) a polyol.
  • the pH of the formulation is within the range of pH 4.7 and 5.7, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) a citrate buffer at a concentration of 10 mM, and (iv) a polyol.
  • the pH of the formulation is about 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) a citrate buffer, and (iv) a polyol.
  • the pH of the formulation is about 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) a citrate buffer at a concentration of from 5 mM to 15 mM, and (iv) a polyol.
  • the pH of the formulation is about 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) a citrate buffer at a concentration of 10 mM, and (iv) a polyol.
  • the pH of the formulation is 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) a citrate buffer, and (iv) a polyol.
  • the pH of the formulation is 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) a citrate buffer at a concentration of from 5 mM to 15 mM, and (iv) a polyol.
  • the pH of the formulation is 5.2, and the formulation comprises (i) a PD-1 antibody or antigen-binding fragment provided herein, (ii) a surfactant, (iii) a citrate buffer at a concentration of 10 mM, and (iv) a polyol.
  • a citrate buffer is the only buffer present in the formulation.
  • the polyol is a sugar, sugar alcohol, or sugar acid. In one embodiment, the polyol is a sugar. In another embodiment, the polyol is a sugar alcohol. In yet another embodiment, the polyol is a sugar acid. In one specific embodiment, the polyol is sucrose. In one embodiment, the concentration of the sucrose is from 5-10% (w/v). In one embodiment, the concentration of the sucrose is from 8-9% (w/v). In another embodiment, the concentration of the sucrose is 9% (w/v). In another embodiment, the concentration of the sucrose is about 8.5% (w/v). In another embodiment, the concentration of the sucrose is 8.5% (w/v). In one specific embodiment, the polyol is maltose.
  • the concentration of the maltose is from 5-10% (w/v). In one embodiment, the concentration of the maltose is from 8-9% (w/v). In another embodiment, the concentration of the maltose is 9% (w/v). In another embodiment, the concentration of the maltose is about 8.5% (w/v). In another embodiment, the concentration of the maltose is 8.5% (w/v). In one specific embodiment, the polyol is trehalose. In one embodiment, the concentration of the trehalose is from 5-10% (w/v). In one embodiment, the concentration of the trehalose is from 8-9%) (w/v). In another embodiment, the concentration of the trehalose is 9% (w/v).
  • the concentration of the trehalose is about 8.5%> (w/v). In another embodiment, the concentration of the trehalose is 8.5%> (w/v).
  • the polyol is mannitol. In one embodiment, the concentration of the mannitol is from 5-10% (w/v). In one embodiment, the concentration of the mannitol is from 8-9% (w/v). In another
  • the concentration of the mannitol is 9%> (w/v). In another embodiment, the concentration of the mannitol is about 8.5%> (w/v). In another embodiment, the concentration of the mannitol is 8.5%> (w/v). In one specific embodiment, the polyol is sorbitol. In one
  • the concentration of the sorbitol is from 5-10% (w/v). In one embodiment, the concentration of the sorbitol is from 8-9% (w/v). In another embodiment, the concentration of the sorbitol is 9% (w/v). In another embodiment, the concentration of the sorbitol is about 8.5% (w/v). In another embodiment, the concentration of the sorbitol is 8.5% (w/v). In one
  • the surfactant is a polysorbate. In one embodiment, the polysorbate is polysorbate- 20. In one embodiment, the polysorbate is polysorbate-40. In one embodiment, the polysorbate is polysorbate-60. In one embodiment, the polysorbate is polysorbate-80. In one embodiment, the concentration of the surfactant is from 0.001-0.1%) (w/v). In one embodiment, the concentration of the surfactant is from 0.001-0.01%) (w/v). In one embodiment, the concentration of the surfactant is 0.05%> (w/v). In one embodiment, the concentration of the surfactant is about 0.005%) (w/v). In one embodiment, the concentration of the surfactant is 0.005%) (w/v).
  • the concentration of the polysorbate-20 is from 0.001-0.1% (w/v). In one embodiment, the concentration of the polysorbate-20 is from 0.001-0.01% (w/v). In one embodiment, the concentration of the polysorbate-20 is 0.05%> (w/v). In one embodiment, the concentration of the polysorbate-20 is about 0.005%> (w/v). In one embodiment, the
  • concentration of the polysorbate-20 is 0.005%) (w/v). In one embodiment, the concentration of the polysorbate-40 is from 0.001-0.1% (w/v). In one embodiment, the concentration of the polysorbate-40 is from 0.001-0.01% (w/v). In one embodiment, the concentration of the polysorbate-40 is 0.05% (w/v). In one embodiment, the concentration of the polysorbate-40 is about 0.005%) (w/v). In one embodiment, the concentration of the polysorbate-40 is 0.005%) (w/v). In one embodiment, the concentration of the polysorbate-60 is from 0.001-0.1%) (w/v). In one embodiment, the concentration of the polysorbate-60 is from 0.001-0.01% (w/v). In one embodiment, the concentration of the polysorbate-60 is 0.05%> (w/v). In one embodiment, the concentration of the polysorbate-60 is about 0.005%> (w/v). In one embodiment, the concentration of the polysorbate-60 is about 0.005%> (w/v). In one embodiment,
  • concentration of the polysorbate-60 is 0.005%) (w/v).
  • concentration of the polysorbate-80 is from 0.001-0.1% (w/v).
  • concentration of the polysorbate-80 is from 0.001-0.01% (w/v).
  • concentration of the polysorbate-80 is 0.05%> (w/v).
  • concentration of the polysorbate-80 is about 0.005%) (w/v).
  • concentration of the polysorbate-80 is 0.005%) (w/v).
  • a pharmaceutical formulation comprising an antibody that binds to PD-1, wherein the formulation has a pH of 5.2 and comprises (i) 10 mM sodium acetate buffer, (ii) 8.5%> (w/v) sucrose, and (iii) 0.005%) (w/v) polysorbate-80.
  • a pharmaceutical formulation comprising an antigen-binding fragment that binds to PD-1, wherein the formulation has a pH of 5.2 and comprises (i) 10 mM sodium acetate buffer, (ii) 8.5%> (w/v) sucrose, and (iii) 0.005%) (w/v) polysorbate-80.
  • the formulation comprises a PD-1 antibody. In other embodiments of the various pharmaceutical formulations provided herein, the formulation comprises a PD-1 antigen-binding fragment.
  • the formulation comprises a PD-1 antibody comprising a VL comprising VL CDR1, VL CDR2, and VL CDR3 of any one of antibodies PDlAB-1, PD1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6 as set forth in Table 1.
  • the formulation comprises a PD-1 antibody comprising a VL comprising VL CDR1, VL CDR2, and VL CDR3 of PDlAB-1 as set forth in Table 1.
  • the formulation comprises a PD-1 antibody comprising a VL comprising VL CDR1, VL CDR2, and VL CDR3 of PDlAB-2 as set forth in Table 1.
  • the formulation comprises a PD-1 antibody comprising a VL comprising VL CDR1, VL CDR2, and VL CDR3 of PDlAB-3 as set forth in Table 1.
  • the formulation comprises a PD-1 antibody comprising a VL comprising VL CDR1, VL CDR2, and VL CDR3 of PDlAB-4 as set forth in Table 1.
  • the formulation comprises a PD-1 antibody comprising a VL comprising VL CDR1, VL CDR2, and VL CDR3 of PDlAB-5 as set forth in Table 1. In some embodiments of the various pharmaceutical formulations provided herein, the formulation comprises a PD-1 antibody comprising a VL comprising VL CDR1, VL CDR2, and VL CDR3 of PD1AB-6 as set forth in Table 1.
  • the formulation comprises a PD-1 antibody comprising a VH comprising VH CDR1, VH CDR2, and VH CDR3 of any one of antibodies PDlAB-1, PDlAB-2, PDlAB-3, PDlAB-4, PDlAB-5, or PD1AB-6 as set forth in Table 2.
  • the formulation comprises a PD-1 antibody comprising a VH comprising VH CDR1, VH CDR2, and VH CDR3 of PDlAB-1 as set forth in Table 2.
  • the formulation comprises a PD-1 antibody comprising a VH comprising VH CDR1, VH CDR2, and VH CDR3 of PDlAB-2 as set forth in Table 2.
  • the formulation comprises a PD-1 antibody comprising a VH comprising VH CDR1, VH CDR2, and VH CDR3 of PDlAB-3 as set forth in Table 2.
  • the formulation comprises a PD-1 antibody comprising a VH comprising VH CDR1, VH CDR2, and VH CDR3 of PDlAB-4 as set forth in Table 2.
  • the formulation comprises a PD-1 antibody comprising a VH comprising VH CDR1, VH CDR2, and VH CDR3 of PDlAB-5 as set forth in Table 2. In some embodiments of the various pharmaceutical formulations provided herein, the formulation comprises a PD-1 antibody comprising a VH comprising VH CDR1, VH CDR2, and VH CDR3 of PD1AB-6 as set forth in Table 2.
  • the formulation comprises a PD-1 antibody comprising (a) a VL comprising VL CDRl, VL CDR2, and VL CDR3 of any one of antibodies PDlAB-1, PDlAB-2, PD1AB-3, PD1AB-4, PD1 AB-5, or PD1 AB-6 as set forth in Table 1, and (b) a VH comprising VH CDRl, VH CDR2, and VH CDR3 of any one of antibodies PDlAB-1, PDlAB-2, PD1AB-3, PD1AB-4, PDlAB-5, or PD1 AB-6 as set forth in Table 2.
  • the formulation comprises a PD-1 antibody comprising (a) a VL comprising VL CDRl, VL CDR2, and VL CDR3 of PDlAB-1 as set forth in Table 1, and (b) a VH comprising VH CDRl, VH CDR2, and VH CDR3 of any one of PDlAB-1 as set forth in Table 2.
  • the formulation comprises a PD-1 antibody comprising (a) a VL comprising VL CDRl, VL CDR2, and VL CDR3 of PD1 AB-2 as set forth in Table 1, and (b) a VH comprising VH CDRl, VH CDR2, and VH CDR3 of PD1 AB-2 as set forth in Table 2.
  • the formulation comprises a PD-1 antibody comprising (a) a VL comprising VL CDRl, VL CDR2, and VL CDR3 of PD1 AB-3 as set forth in Table 1, and (b) a VH comprising VH CDRl, VH CDR2, and VH CDR3 of PDlAB-3 as set forth in Table 2.
  • the formulation comprises a PD-1 antibody comprising (a) a VL comprising VL CDRl, VL CDR2, and VL CDR3 of PDlAB-4 as set forth in Table 1, and (b) a VH comprising VH CDRl, VH CDR2, and VH CDR3 of PD1 AB-4 as set forth in Table 2.
  • the formulation comprises a PD-1 antibody comprising (a) a VL comprising VL CDRl, VL CDR2, and VL CDR3 of PDlAB-5 as set forth in Table 1, and (b) a VH comprising VH CDRl, VH CDR2, and VH CDR3 of PD1 AB- 5 as set forth in Table 2.
  • the formulation comprises a PD-1 antibody comprising (a) a VL comprising VL CDRl, VL CDR2, and VL CDR3 of PDlAB-6 as set forth in Table 1, and (b) a VH comprising VH CDRl, VH CDR2, and VH CDR3 of PDlAB-6 as set forth in Table 2.
  • the formulation comprises PDlAB-1. In some embodiments of the various pharmaceutical formulations provided herein, the formulation comprises PDlAB-2. In other embodiments of the various pharmaceutical formulations provided herein, the formulation comprises PDlAB-3. In some embodiments of the various pharmaceutical formulations provided herein, the formulation comprises PDlAB-4. In other embodiments of the various pharmaceutical formulations provided herein, the formulation comprises PD1AB-5. In some embodiments of the various pharmaceutical formulations provided herein, the various
  • the formulation comprises PD1AB-6.
  • the pharmaceutical formulation comprises a PD-1 antibody that is an IgGl antibody.
  • the pharmaceutical formulation comprises a PD-1 antibody that is an IgGl variant antibody.
  • the formulation comprises PD1AB-6-K3.
  • the formulation comprises PD1AB-6-4P.
  • the various pharmaceutical formulations provided herein are aqueous pharmaceutical formulations.
  • the various pharmaceutical formulations provided herein are stable. Stability of the pharmaceutical formulations provided herein can be measured at a selected temperature for a selected time period.
  • the antibody in the liquid formulations is stable in a liquid form for at least about 3 months. In one embodiment, the antibody in the liquid formulations is stable in a liquid form for at least about 4 months. In one embodiment, the antibody in the liquid formulations is stable in a liquid form for at least about 5 months. In one embodiment, the antibody in the liquid formulations is stable in a liquid form for at least about 6 months. In one embodiment, the antibody in the liquid formulations is stable in a liquid form for at least about 12 months.
  • the antibody in the liquid formulations is stable in a liquid form for at least about 18 months. In one embodiment, the antibody in the liquid formulations is stable in a liquid form for at least about 24 months. Values and ranges intermediate to the above recited time periods are also contemplated, e.g., about 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, or 24 months. In addition, ranges of values using a combination of any of the above recited values as upper and/or lower limits are intended to be included.
  • the pharmaceutical formulation is stable at -70 °C. In some embodiments, the pharmaceutical formulation is stable at 4 °C. In some embodiments, the pharmaceutical formulation is stable at 25 °C.
  • the pharmaceutical formulation is stable at 30 °C. In a specific embodiment, the pharmaceutical formulation is stable for at least 12 months when stored at -70 °C ⁇ 10 °C. In other embodiments, the pharmaceutical formulation is stable for at least 6 months when stored at 5 °C ⁇ 3 °C.
  • a method of making the various pharmaceutical formulations disclosed herein comprising: (a) culturing a cell in a medium, wherein the cell comprises one or more polynucleotides comprising nucleotide sequences encoding a heavy chain, a light chain, or both a heavy chain and a light chain of the antibody or antigen-binding fragment thereof provided herein; (b) harvesting the medium; and (c) subjecting the medium to a series of purification steps.
  • the purification steps comprise: (i) an affinity chromatography; (ii) a viral inactivation; (iii) an ion exchange chromatography; (iv) a viral filtration; and (v) an ultrafiltration/diafiltration.
  • the affinity chromatography comprises: (i) an affinity chromatography; (ii) a viral inactivation; (iii) an ion exchange chromatography; (iv) a viral filtration; and (v) an ultrafiltration/diafiltration.
  • the chromatography is a protein A affinity chromatography.
  • the viral inactivation step is a low-pH viral inactivation step.
  • the ion exchange chromatography is an anion exchange chromatography.
  • the affinity chromatography is a protein A affinity chromatography
  • the viral inactivation step is a low-pH viral inactivation step
  • the ion exchange chromatography is an anion exchange
  • the purification steps comprise: (i) a protein A affinity chromatography; (ii) a low-pH viral inactivation step; (iii) an anion exchange chromatography; (iv) a viral filtration step; and (v) an ultrafiltration/diafiltration.
  • formulations disclosed herein further comprises a formulation step.
  • FIGS. 1A-1B show that the T cell attenuating anti-PD-1 antibodies (PDIAB) do not compete with PD-L1 (PD-Ll-DyL650 denotes PD-L1 conjugated with the dye DyL650) binding to PD-1 : (A) PDlAB-1, PDlAB-2, and PDlAB-6; (B) PDlAB-1, PDlAB-2, PD1AB-3, PDlAB-4, and PDlAB-5. MDX 4H1, an antagonist antibody, blocks PD-L1 binding to PD-1.
  • PDIAB T cell attenuating anti-PD-1 antibodies
  • FIG. 2 depicts that the PD-1 :PD1 AB-6 Fab interaction site is at a distal side of PD-1 relative to the PD-1 :PD-L1 interaction site.
  • FIG. 3 depicts that PD1 AB-6 Fab binds against a PD-1 ⁇ sheet, with substantial interactions formed with a PD-1 loop composed of residues 100-105.
  • FIG. 4 shows the amino acid sequences of heavy chain (HC) and light chain (LC) of PDlAB-6-IgGl and HC of its variants PD1AB-6-K3 and PD1AB-6-4P.
  • FIGS. 5A-5B depict the PD1 AB-6-IgGl affinity for cynomolgus (A) or human (B) PD-1 expressed on CHO cells.
  • FIG. 6 depicts the binding of PD1 AB-6-IgGl, isotype control, and human PD-L1 Fc fusion protein (hPD-Ll Fc) to activated human PBMC gated on CD4+ T cells.
  • FIG. 7 depicts the binding of PD1 AB-6-IgGl, isotype control, and human PD-L1 Fc fusion protein (hPD-Ll Fc) to activated cynomolgus PBMC gated on CD4+ T cells.
  • FIGS. 8A-8D show the PD1AB-6 variants binding to FcyRI (A), FcyRIIIa (V158)
  • FIGS. 9A-9C depict the PD1 AB-6 variants binding to FcyRIIIa (V158) (A) or FcyRI
  • FIGS. 10A-10B depict the ADCC activity of the PD1 AB-6 variants and a control human IgGl Fc among two representatives of four individual healthy donors: (A) Donor 7 and (B) Donor 8.
  • FIG. 11 depicts the CDC activity of the PDlAB-6 variants. Data are representative of
  • FIG. 12 depicts the potent attenuating activity of PDlAB-6 variants in human PBMC assay, measured by IL-2 levels in culture supernatants at 24 hours post-stimulation.
  • FIG. 13 depicts the activity of PD1 AB-6-K3 in human whole blood assay.
  • the graph shows a representative curve from donor 4 used to calculate ECso of IFN- ⁇ inhibition.
  • the table shows EC50 values of IFN- ⁇ inhibition for 4 healthy donors with PDlAB-6 variants and
  • FIGS. 14A-14C depict downregulation of PD-1 expression by PD1 AB-6-IgGl as determined by (A) isotype vs. PD-1 staining on CD3+ T cells in human PBMC activated with anti-CD3 + anti-CD28 for 48 hours, (B) PD-1 expression in isotype IgGl vs.
  • PD1 AB-6-IgGl treated PBMC (the detection anti-PD-1 antibody is not blocked by PD1 AB-6), and (C) PD-1 expression on CD3+ T cells in human PBMC from 3 different donors, activated with anti-CD3 + anti-CD28 and three different concentrations of either isotype IgGl or PDlAB-6-IgGl .
  • FIGS. 15A-15C show (A) PDlAB-6-IgGl, (B) PD1AB-6-4P, and (C) PD1AB-6-K3 binding to PD-1 antigen on Biacore ® T200.
  • FIG. 16 shows differential scanning calorimetry analysis of PD1AB-6 variants.
  • FIG. 17 shows PD1 AB-6-K3 stability at 40 °C, as measured by the weekly change in monomer content over a range of pH.
  • FIG. 18 shows increase in submicron particle size over 8 weeks at the 40 °C thermal stress condition, as measured by DLS over a range of buffers and pH for PD1 AB-6-K3 expressed in CHO cells.
  • FIG. 19 shows rate of increase in turbidity over 8 weeks at the 40 °C thermal stress condition, as measured by A360 over a range of buffers and pH for PD1 AB-6-K3 expressed in CHO cells.
  • FIG. 20 shows PD1AB-6-K3 stability at 5 °C, as measured by the weekly change in monomer content over a range of pH.
  • FIGS. 21A-21B illustrate the flow diagrams of manufacturing process of PD1AB-6- K3 drug substance with (A) showing the upstream cell culture and harvest steps, and (B) showing the downstream purification steps.
  • FIG. 22 is a schematic illustration of the experimental design for a two-arm (2x2) full factorial modeling of the effects of pH and surfactant concentration (e.g., PS-80) on formulations samples containing 10 mM sodium acetate, 9% (w/v) sucrose and 125 mg/ml of PD1AB-6-K3 antibodies
  • pH and surfactant concentration e.g., PS-80
  • FIGS. 23A-23D depict the results of Size Exclusion Chromatography (SEC) at different time points to quantify the fraction of monomer, high molecular weight (HMW) species (aggregates), and low molecular weight (LMW) species (fragments or clips) of the antibody in candidate formulations.
  • SEC Size Exclusion Chromatography
  • A Results of SEC analysis of candidate antibody formulations having 125 mg/ml antibody, 10 mM sodium acetate, 9% (w/v) sucrose, 0.005% (w/v) PS-80, and adjusted to different pH (i.e., pH 5.2, 5.5 and 5.8) after being stored at 4 °C for 12 weeks.
  • a control formulation stored at -80 °C was included.
  • the left panel is an enlarged view of the lower area between 10 and 20 (minutes of elution time) in the right panel. Shown is the change within (B) 12 weeks, (C) 26 weeks, or (D) 14 months of the fraction (%) of HMW of the antibody in candidate formulations stored at 4 °C. Error bars are the standard deviations of replicate injections of an internal standard and represent the precision of the method/integration.
  • FIGS. 24A-24C depict the results of SEC at different time points to quantify the fraction of monomer, HMW species (aggregates), and LMW species (fragments or clips) of the antibody in candidate formulations
  • A Results of SEC analysis of candidate antibody formulations having 125 mg/ml antibody, 10 mM sodium acetate, 9% (w/v) sucrose, 0.005% (w/v) PS-80, and adjusted to different pH (i.e., pH 5.2, 5.5 and 5.8) after being stored at 25 °C for 12 weeks.
  • a control formulation stored at -80 °C was included.
  • the left panel is an enlarged view of the lower area between 10 and 20 (minutes of elution time) in the right panel.
  • FIGS. 25A-25C depict the results of SEC at different time points to quantify the fraction of monomer HMW species (aggregates), and LMW species (fragments or clips) of the antibody in candidate formulations.
  • A Results of SEC analysis of candidate antibody formulations having 125 mg/ml antibody, 10 mM sodium acetate, 9% (w/v) sucrose, 0.005% (w/v) PS-80, and adjusted to different pH (i.e., pH 5.2, 5.5 and 5.8) after being stored at 40 °C for 4 weeks.
  • a control formulation stored at -80 °C was included.
  • the left panel is an enlarged view of the lower area between 10 and 20 (minutes of elution time) in the right panel.
  • FIG. 26 shows the results of CE-SDS analysis of candidate antibody formulations having 125 mg/ml antibody, 10 mM sodium acetate, 9% (w/v) sucrose, and different combinations of PS-80 content (ranging from 0.005%) (w/v)) and pH values (ranging from pH 5.2 to pH 5.8) after the candidate formulations have been stored at 5 °C, 25 °C or 40 °C for 4 weeks.
  • Each bar shows the quantitation of the LMW fraction (%>) of the antibody in candidate formulations as detected by the CE-SDS.
  • a control formulation stored at - 80 °C was included.
  • FIG. 27 shows the results of CE-SDS analysis of candidate antibody formulations having 125 mg/ml antibody, 10 mM sodium acetate, 9%> (w/v) sucrose, and different combinations of PS-80 content (ranging from 0.005%) (w/v)) and pH values (ranging from pH 5.2 to pH 5.8) after the candidate formulations have been stored at 4 °C for 26 weeks. Peaks representing the HMW, the monomer, and the LMW fractions are shown.
  • FIGS. 28A-28B show the results of flow imaging microscopy of candidate antibody formulations having 125 mg/ml antibody, 10 mM sodium acetate, 9% (w/v) sucrose, and different combinations of PS-80 content (ranging from 0.005% (w/v)) and pH values (ranging from pH 5.2 to pH 5.8) after the candidate formulations have been stored at (A) 4 °C for 12 weeks or (B) 25 °C for 12 weeks. Densities (counts/ml) of subvisible particles in the >2 ⁇ , >10 ⁇ , and >25 ⁇ size ranges are shown.
  • FIG. 29 shows the results of flow imaging microscopy of candidate antibody formulations having 125 mg/ml antibody, 10 mM sodium acetate, 9% (w/v) sucrose, and different combinations of PS-80 content (ranging from 0.005% (w/v)) and pH values (ranging from pH 5.2 to pH 5.8) after the candidate formulations have been stored at 4 °C for 12 and/or 26 weeks. Densities (counts/ml) of subvisible particles in the > 10 ⁇ and > 25 ⁇ size ranges are shown.
  • FIGS. 30A-30C depict the results of charge isoform distribution to the antibodies in candidate formulations evaluated using cation exchange chromatograph (CEX).
  • FIG. 31 shows quantitation of the main antibody species (main peak) identified by the CEX analysis of candidate formulations having 125 mg/ml antibody, 10 mM sodium acetate, 9% (w/v) sucrose, and different combinations of PS-80 content (ranging from 0.005%) (w/v)) and pH values (ranging from pH 5.2 to pH 5.8) after the candidate formulations have been stored at 4 °C for 12 weeks or 26 weeks. Data at TO are included as a control.
  • FIG. 31 shows quantitation of the main antibody species (main peak) identified by the CEX analysis of candidate formulations having 125 mg/ml antibody, 10 mM sodium acetate, 9% (w/v) sucrose, and different combinations of PS-80 content (ranging from 0.005%) (w/v)) and pH values (ranging from pH 5.2 to pH 5.8) after the candidate formulations have been stored at 4 °C for 12 weeks or 26 weeks. Data at TO are included as a control.
  • FIG. 31 shows quantitation of the main antibody species (main
  • RP-HPLC reversed-phase high performance liquid chromatography
  • FIGS. 33A-33B depict results of Biacore® analysis of antibodies in the formulation samples.
  • A Representative Biacore® assay results for candidate formulation stored at 40 °C for 4 weeks (left) and at TO (right).
  • B Quantitation of the KD (nM) values for candidate antibody formulations having 125 mg/ml antibody, 10 mM sodium acetate, 9% (w/v) sucrose, and different combinations of PS-80 content (ranging from 0.005%) (w/v)) and pH values (ranging from pH 5.2 to pH 5.8) at TO, or after the candidate formulation has been stored at 25 °C for 4 weeks, or at 40 °C for 4 weeks, or at 4 °C for 12 weeks, or at 25 °C for 12 weeks.
  • FIGS. 34A-34B depict results of the effect of agitation on liquid stability of candidate formulations was examined with SEC and MFI.
  • A Results of SEC analysis of candidate formulations having 125 mg/ml antibody, 10 mM sodium acetate (pH 5.2), 8.5%> (w/v) sucrose, 0.001% (w/v) or 0.015% (w/v) PS-80, after the candidate formulations were agitated at 4 °C for up to 24 hours. Quantitation of the HMW fraction at 0, 4-, 8- and 24-hour time points was shown.
  • FIGS. 35A-35C show the effect of repeated freeze-thaw cycles on liquid stability of candidate formulation was examined with SEC and MFI.
  • A Results of SEC analysis of candidate formulations having 125 mg/ml antibody, 10 mM sodium acetate, 9% (w/v) sucrose, and different combinations of PS-80 content (ranging from 0.005%) (w/v)) and pH values (ranging from pH 5.2 to pH 5.8) after the candidate formulations have gone through repeated cycles. Quantitation of the monomer fraction after 0, 3 or 5 freeze-thaw cycles was shown.
  • binding proteins such as antibodies that bind to PD-1 including human and/or cynomolgus PD-1, and methods of making such pharmaceutical formulations.
  • the antibodies bind to human and/or cynomolgus PD-1.
  • the binding proteins such as antibodies that bind to human and/or cynomolgus PD-1, do not bind to rodent
  • the PD-1 binding proteins including antibodies disclosed herein, are agonists (e.g., can mimic the effect of PD-1 ligand and induce PD-1 signaling).
  • the binding proteins such as antibodies to PD-1 provided herein (i) bind to human and/or cynomolgus PD-1, (ii) do not compete for binding with PD-1 ligand (e.g., PD-L1 and/or
  • the PD-1 antibodies bind to human PD-1. In one embodiment, the PD-1 antibodies bind to cynomolgus PD-1. In one embodiment, the PD-1 antibodies bind to both human PD-1 and cynomolgus PD-1. In some embodiments, the PD-1 antibodies do not compete with PD-L1 for binding to PD-1. In other embodiments, the PD-1 antibodies do not compete with PD-L2 for binding to PD-1. In yet other embodiments, the PD-1 antibodies do not compete with either PD-L1 or PD-L2 for binding to
  • the PD-1 antibodies induce PD-1 signaling.
  • the PD-1 antibodies induce PD-1 signaling.
  • the PD-1 antibodies provided herein bind to both human PD-1 and cynomolgus
  • the binding, competition, and/or signaling is assayed in vitro, e.g., in a cell-based assay. In other embodiments, the binding, competition, and/or signaling is assayed ex vivo, e.g., in a T cell function assay. In other embodiments, the binding, competition, and/or signaling is assayed using a sample from a subject (e.g., a human subject).
  • assays include (1) a human or cynomolgus PBMC assay (see, e.g., Examples 5.2.1 and 5.2.2); (2) a human whole blood sample assay (see, e.g., Example 5.2.1).
  • binding proteins such as anti-PD-1 antibodies, as described herein, exhibit activities that are consistent with the natural biological function of PD-Ll and/or PD-L2. In some embodiments, the activities are exhibited in vitro. In other embodiments, the activities are exhibited ex vivo.
  • the binding proteins such as antibodies that bind to PD-1, provided herein share the common feature of competing with each other for the binding of PD-1. This competitive inhibition can indicate that each antibody binds to the same region of PD-1 ⁇ e.g., the same epitope), thereby asserting similar effects.
  • anti-PD-1 antibodies provided herein include humanized anti-PD-1 antibodies, such as those derived from or based on antibodies PDlAB-1, PD1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, and/or PD1AB -6.
  • anti-PD-1 antibodies provided herein compete for binding with an antibody derived from or based on PDlAB-1, PD1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, and/or PD1AB -6.
  • the anti- PD-1 antibodies have CDR sequences as described in Tables 1-2.
  • the anti-PD-1 antibodies bind to a specific domain or epitope of human PD-1 ⁇ e.g., residues 100- 105; see Example 5.1.4).
  • Tables 1-2 can be extrapolated to other anti-PD-1 antibodies provided herein having the same or similar epitope specificity ⁇ e.g., the same or similar CDRs).
  • the activities of antibodies as shown in Examples 5.1.2-3, 5.1.7-10, 5.2.1-3, and 5.3.1, for an exemplary humanized anti-PD-1 antibody are representative of the activities and effects of the anti-PD-1 antibodies provided herein.
  • the binding proteins such as anti-PD-1 antibodies may comprise immunoglobulin variable regions which comprise one or more CDRs as described in Tables 1-2.
  • the CDRs may be joined with one or more scaffold regions or framework regions (FRs), which orient(s) the CDR(s) such that the proper antigen-binding properties of the CDR(s) is achieved.
  • FRs framework regions
  • the terms "Programmed Death 1,” “Programmed Cell Death 1,” “Protein PD-1,” “PD-1,” “PD-1 polypeptide,” or “PD1” encompasses a polypeptide ("polypeptide” and “protein” are used interchangeably herein), including any native polypeptide, from any vertebrate source, including mammals such as primates ⁇ e.g., humans and cynomolgus monkeys (cynomolgus)), dogs, and rodents ⁇ e.g., mice and rats), unless otherwise indicated.
  • the terms include "related PD-1 polypeptides,” including S P variants thereof.
  • PD-1 also encompasses "full-length,” unprocessed PD-1 as well as any form of PD-1 that results from processing in the cell.
  • the PD1 has an amino acid sequence of SEQ ID NO:43.
  • GenBankTM accession number U64863 provides another exemplary human PD-1 nucleic acid sequence.
  • Related PD-1 polypeptides include allelic variants ⁇ e.g., SNP variants); splice variants; fragments; derivatives; substitution, deletion, and insertion variants; fusion
  • an anti-PD-1 antibody provided herein can bind to a PD-1 polypeptide, a PD-1 polypeptide fragment, a PD-1 antigen, and/or a PD-1 epitope.
  • An "epitope" may be part of a larger PD-1 antigen, which may be part of a larger PD-1 polypeptide fragment, which, in turn, may be part of a larger PD-1 polypeptide.
  • PD-1 may exist in a native or denatured form.
  • PD-1 polypeptides described herein may be isolated from a variety of sources, such as from human tissue types or from another source, or prepared by recombinant or synthetic methods. Orthologs to the PD-1 polypeptide are also well known in the art.
  • a PD-1 polypeptide "extracellular domain” or “ECD” refers to a form of the
  • PD-1 polypeptide that is essentially free of the transmembrane and cytoplasmic domains.
  • a PD-1 polypeptide ECD may have less than 1% of such transmembrane and/or cytoplasmic domains and can have less than 0.5% of such domains.
  • the antibody PDlAB-6 comprises a light chain amino acid sequence of LC_PDlAB-6-IgGl (SEQ ID NO:31) and a heavy chain amino acid sequence of HC_PDlAB-6-IgGl (SEQ ID NO:32), e.g., as shown in FIG. 4.
  • IgGl-PDl AB-6-K3 are used interchangeably and refer to the PD1 AB-6 variant having a K322A substitution in the IgGl Fc region.
  • the PD1 AB-6 variant has a heavy chain amino acid sequence of HC_PDlAB-6-IgGl-K322A (SEQ ID NO:33), e.g., as shown in FIG. 4.
  • PD1 AB-6_IgG4P and “PD1 AB-6-IgG4P” are used interchangeably and refer to the PD1 AB-6 variant having an IgG4P Fc region.
  • the PD-1 antibody variant has a heavy chain amino acid sequence of HC_PDlAB-6-IgG4P (SEQ ID NO:34), e.g., as shown in FIG. 4
  • PD1 AB-6-4PE The terms "PD1 AB-6-4PE,” “IgG4PE_PDl AB-6,” “IgG4PE-PDl AB-6,” and “PD1 AB-6_IgG4PE,” and “PD1 AB-6-IgG4PE” are used interchangeably and refer to the PDlAB-6 variant having an IgG4PE heavy chain amino acid sequence as
  • PD-1 ligand refers to a molecule that binds to PD-1, e.g., in vivo or in vitro.
  • Non-limiting examples of PD-1 ligand include naturally occurring ligands, e.g., PD-1 ligand 1 (PD-L1, also known as B7-H1 or CD274) and PD-1 ligand 2 (PD-L2, also known as B7-DC or CD273), and artificially generated ligands.
  • PD-L1 and “PDL-1” are used interchangeably herein and refer to PD-1 ligand 1 (also known as B7-H1 or CD274).
  • PD-1 activity when applied to a binding protein such as an antibody that binds to PD-1 of the present disclosure, means that the binding protein ⁇ e.g., antibody) mimics or modulates a biological effect induced by the binding of PD-1 ligand, and induces a biological response that otherwise would result from PD-1 ligand binding to PD-1, e.g., in vivo or in vitro.
  • anti-PD-1 antibody for example, an antibody or fragment thereof that binds to PD-1 ⁇ e.g., human PD-1
  • the antibody is deemed to induce a biological response when the response is equal to or greater than 5%, such as equal to or greater than 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100%, 125%, 150%, 175%, or 200%) of the activity of a wild type PD-1 ligand standard.
  • the anti-PD-1 antibody or the PD-1 ligand is immobilized (for example, on a plastic surface or bead).
  • the antibody has the following properties: exhibits an efficacy level of equal to or more than 5% of a PD-1 ligand standard, with an ECso of equal to or less than 100 nM, e.g., 90 nM, 80 nM, 70 nM, 60 nM, 50 nM, 40 nM, 30 nM, 20 nM, 10 nM, 5 nM, 2 nM, 1 nM, 0.5 nM, 0.2 nM, or 0.1 nM in (1) human or cynomolgus PBMC assay ⁇ see, e.g., Examples 4.2.1 and 4.2.2); or (2) human whole blood sample assay ⁇ see, e.g., Example 4.2.1).
  • a PD-1 ligand standard with an ECso of equal to or less than 100 nM, e.g., 90 nM, 80 nM, 70 nM, 60 nM, 50 nM, 40 nM,
  • binding protein refers to a protein comprising a portion ⁇ e.g., one or more binding regions such as CDRs) that binds to PD-1, including human and/or cynomolgus PD-1 and, optionally, a scaffold or framework portion ⁇ e.g., one or more scaffold or framework regions) that allows the binding portion to adopt a conformation that promotes binding of the binding protein to a PD-1 polypeptide, fragment, or epitope.
  • a portion ⁇ e.g., one or more binding regions such as CDRs
  • binding proteins examples include antibodies, such as a human antibody, a humanized antibody, a chimeric antibody, a recombinant antibody, a single chain antibody, a diabody, a triabody, a tetrabody, a Fab fragment, a F(ab') 2 fragment, an IgD antibody, an IgE antibody, an IgM antibody, an IgGl antibody, an IgG2 antibody, an IgG3 antibody, or an IgG4 antibody, and fragments thereof.
  • the binding protein can comprise, for example, an alternative protein scaffold or artificial scaffold with grafted CDRs or CDR derivatives.
  • Such scaffolds include, but are not limited to, antibody-derived scaffolds comprising mutations introduced to, for example, stabilize the three-dimensional structure of the binding protein as well as wholly synthetic scaffolds comprising, for example, a biocompatible polymer. See, e.g., Korndorfer et al, 2003, Proteins: Structure, Function, and Bioinformatics 53(1): 121-29; and Roque et al, 2004, Biotechnol. Prog. 20:639-54.
  • PAMs peptide antibody mimetics
  • scaffolds based on antibody mimetics utilizing fibronectin components as a scaffold.
  • a binding protein is said to specifically bind or selectively bind to PD-1, for example, when the dissociation constant (KD) is ⁇ 10 "7 M.
  • the binding proteins ⁇ e.g., antibodies may specifically bind to PD-1 with a KD of from about 10 "7 M to about 10 "12 M.
  • the binding protein ⁇ e.g., antibody may specifically bind to PD-1 with high affinity when the KD is ⁇ 10 "8 M or KD is ⁇ 10 "9 M.
  • the binding proteins ⁇ e.g., antibodies may specifically bind to purified human PD-1 with a KD of from 1 x 10 "9 M to 10 x 10 "9 M as measured by Biacore ® .
  • the binding proteins ⁇ e.g., antibodies) may specifically bind to purified human PD-1 with a KD of from 0.1 x 10 "9 M to 1 x 10 "9 M as measured by KinExATM (Sapidyne, Boise, ID).
  • the binding proteins ⁇ e.g., antibodies) specifically bind to human PD-1 expressed on cells with a KD of from 0.1 x 10 "9 M to 10 x 10 "9 M.
  • the binding proteins ⁇ e.g., antibodies specifically bind to human PD-1 expressed on cells with a KD of from 0.1 x 10 "9 M to 1 x 10 "9 M. In some embodiments, the binding proteins ⁇ e.g., antibodies) specifically bind to human PD-1 expressed on cells with a KD of 1 x 10 "9 M to 10 x 10 "9 M. In certain embodiments, the binding proteins ⁇ e.g., antibodies) specifically bind to human PD-1 expressed on cells with a KD of about 0.1 x 10 "9 M , about 0.5 x 10 "9 M, about 1 x 10 "9 M, about 5 x 10 "9 M, about 10 x 10 "9 M, or any range or interval thereof.
  • the binding proteins ⁇ e.g., antibodies may specifically bind to cynomolgus PD-1 expressed on cells with a KD of 0.1 x 10 "9 M to 10 x 10 "9 M. In certain embodiments, the binding proteins ⁇ e.g., antibodies) specifically bind to cynomolgus PD-1 expressed on cells with a KD of from
  • the binding proteins ⁇ e.g., antibodies specifically bind to cynomolgus PD-1 expressed on cells with a KD of 1 x 10 "9 M to 10 x 10 "9 M. In certain embodiments, the binding proteins ⁇ e.g., antibodies) specifically bind to cynomolgus PD-1 expressed on cells with a KD of about 0.1 x 10 "9 M , about 0.5 x 10 "9 M, about 1 x 10 "9 M, about 5 x 10 "9 M, about 10 x 10 "9 M, or any range or interval thereof.
  • antibody immunoglobulin
  • Ig immunoglobulin
  • individual anti-PD-1 monoclonal antibodies including agonist, antagonist, neutralizing antibodies, full length or intact monoclonal antibodies
  • anti-PD-1 antibody compositions with polyepitopic or monoepitopic specificity polyclonal or monovalent antibodies
  • multivalent antibodies multispecific antibodies (e.g., bispecific antibodies so long as they exhibit the desired biological activity), formed from at least two intact antibodies, single chain anti-PD-1 antibodies, and fragments of anti-PD-1 antibodies, as described below.
  • an antibody can be human, humanized, chimeric and/or affinity matured, as well as an antibody from other species, for example, mouse and rabbit, etc.
  • the term "antibody” is intended to include a polypeptide product of B cells within the immunoglobulin class of polypeptides that is able to bind to a specific molecular antigen and is composed of two identical pairs of polypeptide chains, wherein each pair has one heavy chain (about 50-70 kDa) and one light chain (about 25 kDa), each amino-terminal portion of each chain includes a variable region of about 100 to about 130 or more amino acids, and each carboxy -terminal portion of each chain includes a constant region. See, e.g., Antibody
  • the specific molecular antigen can be bound by an antibody provided herein, including a PD-1 polypeptide, a PD-1 fragment, or a PD-1 epitope.
  • Antibodies also include, but are not limited to, synthetic antibodies, recombinantly produced antibodies, camelized antibodies, intrabodies, anti-idiotypic (anti-Id) antibodies, and functional fragments (e.g., antigen-binding fragments such as PD-1 -binding fragments) of any of the above, which refers to a portion of an antibody heavy or light chain polypeptide that retains some or all of the binding activity of the antibody from which the fragment was derived.
  • synthetic antibodies recombinantly produced antibodies
  • camelized antibodies camelized antibodies
  • intrabodies e.g., anti-idiotypic (anti-Id) antibodies
  • functional fragments e.g., antigen-binding fragments such as PD-1 -binding fragments
  • Non-limiting examples of functional fragments include single-chain Fvs (scFv) (e.g., including monospecific, bispecific, etc.), Fab fragments, F(ab') fragments, F(ab) 2 fragments, F(ab') 2 fragments, disulfide-linked Fvs (dsFv), Fd fragments, Fv fragments, diabody, triabody, tetrabody, and minibody.
  • scFv single-chain Fvs
  • Fab fragments F(ab') fragments, F(ab) 2 fragments, F(ab') 2 fragments
  • dsFv disulfide-linked Fvs
  • antibodies provided herein include immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, for example, antigen-binding domains or molecules that contain an antigen-binding site that binds to a PD-1 antigen (e.g., one or more CDRs of an anti-PD-1 antibody).
  • a PD-1 antigen e.g., one or more CDRs of an anti-PD-1 antibody.
  • Such antibody fragments can be found in, for example, Harlow and Lane, Antibodies: A Laboratory Manual (1989); Mol. Biology and Biotechnology: A Comprehensive Desk Reference (Myers ed., 1995); Huston et al., 1993, Cell Biophysics 22: 189-224; Pluckthun and Skerra, 1989, Meth. Enzymol. 178:497-515; and Day, Advanced Immunochemistry (2d ed. 1990).
  • the antibodies provided herein can be of any class (e.g., IgG, IgE, IgM, IgD, and IgA) or any subclass (e.g., IgGl, IgG2, IgG3, IgG4, IgAl, and IgA2) of immunoglobulin molecule.
  • Anti-PD-1 antibodies may be agonistic antibodies or antagonistic antibodies.
  • agonistic antibodies to PD-1 including antibodies that induce PD-1 signaling.
  • agonistic antibodies to PD-1 do not compete for the binding of PD-L1 and/or PD-L2 to PD-1.
  • the term "monoclonal antibody” as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, e.g., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts, and each monoclonal antibody will typically recognize a single epitope on the antigen.
  • a "monoclonal antibody,” as used herein is an antibody produced by a single hybridoma or other cell, wherein the antibody binds to only a PD-1 epitope as determined, for example, by ELISA or other antigen-binding or competitive binding assay known in the art.
  • the term “monoclonal” is not limited to any particular method for making the antibody.
  • the monoclonal antibodies useful in the present disclosure may be prepared by the hybridoma methodology first described by Kohler et al, 1975, Nature 256:495, or may be made using recombinant DNA methods in bacterial or eukaryotic animal or plant cells (see, e.g., U.S. Pat. No. 4,816,567).
  • the "monoclonal antibodies” may also be isolated from phage antibody libraries using the techniques described in Clackson et al, 1991, Nature
  • Polyclonal antibodies refer to an antibody population generated in an immunogenic response to a protein having many epitopes and thus includes a variety of different antibodies directed to the same or different epitopes within the protein. Methods for producing polyclonal antibodies are known in the art (See, e.g., Short Protocols in Molecular Biology
  • fragment refers to a peptide or polypeptide that comprises less than the full length amino acid sequence. Such a fragment may arise, for example, from a truncation at the amino terminus, a truncation at the carboxy terminus, and/or an internal deletion of a residue(s) from the amino acid sequence. Fragments may, for example, result from alternative RNA splicing or from in vivo protease activity.
  • PD-1 fragments or anti-PD-1 antibody fragments include polypeptides comprising an amino acid sequence of at least 5 contiguous amino acid residues, at least 10 contiguous amino acid residues, at least 15 contiguous amino acid residues, at least 20 contiguous amino acid residues, at least 25 contiguous amino acid residues, at least 30 contiguous amino acid residues, at least 40 contiguous amino acid residues, at least 50 contiguous amino acid residues, at least 60 contiguous amino residues, at least 70 contiguous amino acid residues, at least 80 contiguous amino acid residues, at least 90 contiguous amino acid residues, at least contiguous 100 amino acid residues, at least 125 contiguous amino acid residues, at least 150 contiguous amino acid residues, at least 175 contiguous amino acid residues, at least 200 contiguous amino acid residues, at least 250, at least 300, at least 350, at least 400, at least 450, at least 500, at least 550, at least 600, at least
  • An "antigen" is a predetermined antigen to which an antibody can selectively bind.
  • a target antigen may be a polypeptide, carbohydrate, nucleic acid, lipid, hapten, or other naturally occurring or synthetic compound. In some embodiments, the target antigen is a polypeptide.
  • antigen-binding fragment refers to that portion of an antibody, which comprises the amino acid residues that interact with an antigen and confer on the binding agent its specificity and affinity for the antigen ⁇ e.g., the CDRs).
  • An “epitope” is the site on the surface of an antigen molecule to which a single antibody molecule binds, such as a localized region on the surface of an antigen, such as a PD-1 polypeptide or a PD-1 polypeptide fragment, that is capable of being bound to one or more antigen binding regions of an antibody, and that has antigenic or immunogenic activity in an animal, such as a mammal (e.g., a human), that is capable of eliciting an immune response.
  • An epitope having immunogenic activity is a portion of a polypeptide that elicits an antibody response in an animal.
  • An epitope having antigenic activity is a portion of a polypeptide to which an antibody binds as determined by any method well known in the art, including, for example, by an immunoassay.
  • Antigenic epitopes need not necessarily be immunogenic. Epitopes often consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and have specific three dimensional structural characteristics as well as specific charge characteristics.
  • Antibody epitopes may be linear epitopes or conformational epitopes. Linear epitopes are formed by a continuous sequence of amino acids in a protein. Conformational epitopes are formed of amino acids that are discontinuous in the protein sequence, but which are brought together upon folding of the protein into its three-dimensional structure.
  • Induced epitopes are formed when the three dimensional structure of the protein is in an altered conformation, such as following activation or binding of another protein or ligand.
  • a PD-1 epitope is a three-dimensional surface feature of a PD-1 polypeptide.
  • a PD-1 epitope is linear feature of a PD-1 polypeptide.
  • an antigen has several or many different epitopes and may react with many different antibodies.
  • An antibody binds "an epitope,” “essentially the same epitope,” or “the same epitope” as a reference antibody, when the two antibodies recognize identical, overlapping, or adjacent epitopes in a three-dimensional space. The most widely used and rapid methods for determining whether two antibodies bind to identical, overlapping, or adjacent epitopes in a
  • competition assays which can be configured in a number of different formats, for example, using either labeled antigen or labeled antibody.
  • the antigen is immobilized on a 96-well plate, or expressed on a cell surface, and the ability of unlabeled antibodies to block the binding of labeled antibodies is measured using radioactive, fluorescent, or enzyme labels.
  • Epitope mapping is the process of identifying the binding sites, or epitopes, of antibodies on their target antigens.
  • Epitope binning is the process of grouping antibodies based on the epitopes they recognize. More particularly, epitope binning comprises methods and systems for discriminating the epitope recognition properties of different antibodies, using competition assays combined with computational processes for clustering antibodies based on their epitope recognition properties and identifying antibodies having distinct binding
  • binding refers to an interaction between molecules including, for example, to form a complex. Interactions can be, for example, non-covalent interactions including hydrogen bonds, ionic bonds, hydrophobic interactions, and/or van der Waals interactions. A complex can also include the binding of two or more molecules held together by covalent or non-covalent bonds, interactions, or forces. The strength of the total non-covalent interactions between a single antigen-binding site on an antibody and a single epitope of a target molecule, such as PD-1, is the affinity of the antibody or functional fragment for that epitope.
  • the ratio of dissociation rate (k 0 ff) to association rate (k 0 n) of an antibody to a monovalent antigen (k 0 ff/k 0 n) is the dissociation constant KD, which is inversely related to affinity.
  • KD dissociation constant
  • the value of KD varies for different complexes of antibody and antigen and depends on both k 0 n and k 0 ff.
  • the dissociation constant KD for an antibody provided herein can be determined using any method provided herein or any other method well known to those skilled in the art.
  • the affinity at one binding site does not always reflect the true strength of the interaction between an antibody and an antigen.
  • the avidity of an antibody can be a better measure of its binding capacity than is the affinity of its individual binding sites. For example, high avidity can compensate for low affinity as is sometimes found for pentameric IgM antibodies, which can have a lower affinity than IgG, but the high avidity of IgM, resulting from its multivalence, enables it to bind antigen effectively.
  • antibodies that specifically bind to PD-1 refer to antibodies that specifically bind to a PD-1 polypeptide, such as a PD-1 antigen, or fragment, or epitope (e.g., human PD-1 such as a human PD-1 polypeptide, antigen, or epitope).
  • An antibody that specifically binds to PD-1 may bind to the extracellular domain or a peptide derived from the extracellular domain of PD-1.
  • An antibody that specifically binds to a PD-1 antigen may be cross-reactive with related antigens (e.g., cynomolgus PD-1). In certain embodiments, an antibody that specifically binds to a PD-1 antigen does not cross-react with other antigens.
  • An antibody that specifically binds to a PD-1 antigen can be identified, for example, by immunoassays, Biacore®, or other techniques known to those of skill in the art.
  • An antibody binds specifically to a PD-1 antigen when it binds to a PD-1 antigen with higher affinity than to any cross-reactive antigen as determined using experimental techniques, such as radioimmunoassays (RIA) and enzyme linked immunosorbent assays (ELISAs).
  • RIA radioimmunoassays
  • ELISAs enzyme linked immunosorbent assays
  • a specific or selective reaction will be at least twice background signal or noise and may be more than 10 times background. See, e.g., Fundamental Immunology 332-36 (Paul ed., 2d ed. 1989) for a discussion regarding antibody specificity.
  • An antibody which "binds an antigen of interest" e.g., a target antigen such as PD-1) is one that binds the antigen with sufficient affinity such that the antibody is useful as a therapeutic agent in targeting a cell or tissue expressing the antigen, and does not significantly cross-react with other proteins.
  • the extent of binding of the antibody to a "non-target" protein will be less than about 10% of the binding of the antibody to its particular target protein, for example, as determined by fluorescence activated cell sorting (FACS) analysis or RIA.
  • FACS fluorescence activated cell sorting
  • the term "specific binding,” “specifically binds to,” or “is specific for” a particular polypeptide or an epitope on a particular polypeptide target means binding that is measurably different from a non-specific interaction. Specific binding can be measured, for example, by determining binding of a molecule compared to binding of a control molecule, which generally is a molecule of similar structure that does not have binding activity.
  • specific binding can be determined by competition with a control molecule that is similar to the target, for example, an excess of non-labeled target. In this case, specific binding is indicated if the binding of the labeled target to a probe is competitively inhibited by excess unlabeled target.
  • anti-PD-1 antibody or "an antibody that binds to PD-1” includes an antibody that is capable of binding PD-1 with sufficient affinity such that the antibody is useful, for example, as a diagnostic agent in targeting PD-1.
  • binding refers to binding where a molecule binds to a particular polypeptide or epitope on a particular polypeptide without substantially binding to any other polypeptide or polypeptide epitope.
  • an antibody that binds to PD-1 has a dissociation constant (KD) of less than or equal to 10 nM, 5 nM, 4 nM, 3 nM, 2 nM, 1 nM, 0.9 nM, 0.8 nM, 0.7 nM, 0.6 nM, 0.5 nM, 0.4 nM, 0.3 nM, 0.2 nM, or 0.1 nM.
  • KD dissociation constant
  • anti-PD-1 antibody binds to an epitope of PD-1 that is conserved among PD-1 from different species (e.g., between human and cynomolgus PD-1).
  • the term "compete" when used in the context of anti-PD-1 antibodies means competition as determined by an assay in which the antibody (or binding fragment) thereof under study prevents or inhibits the specific binding of a reference molecule (e.g., a reference ligand or reference antigen-binding protein, such as a reference antibody) to a common antigen (e.g., PD-1 or a fragment thereof).
  • a reference molecule e.g., a reference ligand or reference antigen-binding protein, such as a reference antibody
  • a common antigen e.g., PD-1 or a fragment thereof.
  • Numerous types of competitive binding assays can be used to determine if a test antibody competes with a reference antibody for binding to PD-1 (e.g., human PD-1).
  • assays examples include solid phase direct or indirect RIA, solid phase direct or indirect enzyme immunoassay (EIA), sandwich competition assay (see, e.g., Stahli et al, 1983, Methods in Enzymology 9:242-53), solid phase direct biotin-avidin EIA (see, e.g., Kirkland et al., 1986, J. Immunol. 137:3614-19), solid phase direct labeled assay, solid phase direct labeled sandwich assay (see, e.g., Harlow and Lane, Antibodies, A Laboratory Manual (1988)), solid phase direct label RIA using 1-125 label (see, e.g., Morel et al, 1988, Mol. Immunol.
  • EIA enzyme immunoassay
  • sandwich competition assay see, e.g., Stahli et al, 1983, Methods in Enzymology 9:242-53
  • solid phase direct biotin-avidin EIA see, e.g., Kirkl
  • such an assay involves the use of a purified antigen (e.g., PD-1 such as human PD-1) bound to a solid surface, or cells bearing either of an unlabeled test antigen-binding protein (e.g., test anti-PD-1 antibody) or a labeled reference antigen-binding protein (e.g., reference anti-PD-1 antibody).
  • a purified antigen e.g., PD-1 such as human PD-1
  • test anti-PD-1 antibody e.g., test anti-PD-1 antibody
  • a labeled reference antigen-binding protein e.g., reference anti-PD-1 antibody
  • Competitive inhibition may be measured by determining the amount of label bound to the solid surface or cells in the presence of the test antigen-binding protein.
  • the test antigen-binding protein is present in excess.
  • Antibodies identified by competition assay include antibodies binding to the same epitope as the reference antibody and/or antibodies binding to an adjacent epitope sufficiently proximal to the epi
  • a competing antibody protein when present in excess, it will inhibit specific binding of a reference antibody to a common antigen by at least 30%, for example 40%>, 45%>, 50%>, 55%>, 60%, 65%, 70%, or 75%. In some instance, binding is inhibited by at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or more.
  • an “isolated” antibody is substantially free of cellular material or other contaminating proteins from the cell or tissue source and/or other contaminant components from which the antibody is derived, or substantially free of chemical precursors or other chemicals when chemically synthesized.
  • the language “substantially free of cellular material” includes preparations of an antibody in which the antibody is separated from cellular components of the cells from which it is isolated or recombinantly produced.
  • an antibody that is substantially free of cellular material includes preparations of antibody having less than about 30%, 25%, 20%), 15%, 10%, 5%), or 1% (by dry weight) of heterologous protein (also referred to herein as a "contaminating protein").
  • when the antibody is recombinantly produced it is substantially free of culture medium, e.g., culture medium represents less than about 20%), 15%), 10%, 5%, or 1% of the volume of the protein preparation.
  • the antibody when the antibody is produced by chemical synthesis, it is substantially free of chemical precursors or other chemicals, for example, it is separated from chemical precursors or other chemicals that are involved in the synthesis of the protein. Accordingly such preparations of the antibody have less than about 30%, 25%, 20%, 15%, 10%, 5%, or 1% (by dry weight) of chemical precursors or compounds other than the antibody of interest. Contaminant components can also include, but are not limited to, materials that would interfere with therapeutic uses for the antibody, and may include enzymes, hormones, and other proteinaceous or nonproteinaceous solutes. In certain embodiments, the antibody will be purified (1) to greater than 95% by weight of antibody as determined by the Lowry method (Lowry et a/., 1951, J. Bio.
  • Isolated antibody includes the antibody in situ within recombinant cells since at least one component of the antibody's natural environment will not be present. Ordinarily, however, isolated antibody will be prepared by at least one purification step. In specific embodiments, antibodies provided herein are isolated.
  • a 4-chain antibody unit is a heterotetrameric glycoprotein composed of two identical light (L) chains and two identical heavy (H) chains. In the case of IgGs, the 4-chain unit is generally about 150,000 daltons. Each L chain is linked to an H chain by one covalent disulfide bond, while the two H chains are linked to each other by one or more disulfide bonds depending on the H chain isotype. Each H and L chain also has regularly spaced intrachain disulfide bridges. Each H chain has at the N-terminus, a variable domain (VH) followed by three constant domains (CH) for each of the a and ⁇ chains and four CH domains for ⁇ and ⁇ isotypes.
  • VH variable domain
  • CH constant domains
  • Each L chain has at the N-terminus, a variable domain (VL) followed by a constant domain (CL) at its other end.
  • VL variable domain
  • CL constant domain
  • the VL is aligned with the VH
  • the CL is aligned with the first constant domain of the heavy chain (CHI).
  • Particular amino acid residues are believed to form an interface between the light chain and heavy chain variable domains.
  • the pairing of a VH and VL together forms a single antigen-binding site.
  • Basic and Clinical Immunology 71 see, for example, Basic and Clinical Immunology 71 (Stites et al. eds., 8th ed. 1994).
  • the term "heavy chain” when used in reference to an antibody refers to a polypeptide chain of about 50-70 kDa, wherein the amino-terminal portion includes a variable region of about 120 to 130 or more amino acids, and a carboxy -terminal portion includes a constant region.
  • the constant region can be one of five distinct types, ⁇ e.g., isotypes) referred to as alpha (a), delta ( ⁇ ), epsilon ( ⁇ ), gamma ( ⁇ ), and mu ( ⁇ ), based on the amino acid sequence of the heavy chain constant region.
  • the distinct heavy chains differ in size: ⁇ , ⁇ , and ⁇ contain approximately 450 amino acids, while ⁇ and ⁇ contain approximately 550 amino acids.
  • heavy chains When combined with a light chain, these distinct types of heavy chains give rise to five well known classes ⁇ e.g., isotypes) of antibodies, IgA, IgD, IgE, IgG, and IgM, respectively, including four subclasses of IgG, namely IgGl, IgG2, IgG3, and IgG4.
  • a heavy chain can be a human heavy chain.
  • the term "light chain” when used in reference to an antibody refers to a polypeptide chain of about 25 kDa, wherein the amino-terminal portion includes a variable region of about 100 to about 110 or more amino acids, and a carboxy -terminal portion includes a constant region.
  • the approximate length of a light chain is 211 to 217 amino acids.
  • Light chain amino acid sequences are well known in the art.
  • a light chain can be a human light chain.
  • variable region refers to a portion of the light or heavy chains of an antibody that is generally located at the amino-terminal of the light or heavy chain and has a length of about 120 to 130 amino acids in the heavy chain and about 100 to 110 amino acids in the light chain, and are used in the binding and specificity of each particular antibody for its particular antigen.
  • the variable region of the heavy chain may be referred to as "VH.”
  • the variable region of the light chain may be referred to as "VL.”
  • variable refers to the fact that certain segments of the variable regions differ extensively in sequence among antibodies. The V region mediates antigen binding and defines specificity of a particular antibody for its particular antigen.
  • variable regions consist of less variable (e.g., relatively invariant) stretches called framework regions (FRs) of about 15-30 amino acids separated by shorter regions of greater variability (e.g., extreme variability) called "hypervariable regions" that are each about 9-12 amino acids long.
  • FRs framework regions
  • hypervariable regions regions of heavy and light chains each comprise four FRs, largely adopting a ⁇ sheet configuration, connected by three hypervariable regions, which form loops connecting, and in some cases form part of, the ⁇ sheet structure.
  • hypervariable regions in each chain are held together in close proximity by the FRs and, with the hypervariable regions from the other chain, contribute to the formation of the antigen-binding site of antibodies (see, e.g., Kabat et al, Sequences of Proteins of
  • variable regions are not involved directly in binding an antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody dependent cellular cytotoxicity (ADCC) and complement dependent cytotoxicity (CDC).
  • ADCC antibody dependent cellular cytotoxicity
  • CDC complement dependent cytotoxicity
  • the variable regions differ extensively in sequence between different antibodies.
  • the variable region is a human variable region.
  • variable region residue numbering as in Kabat or "amino acid position numbering as in Kabat”, and variations thereof, refer to the numbering system used for heavy chain variable regions or light chain variable regions of the compilation of antibodies in Kabat et al, supra. Using this numbering system, the actual linear amino acid sequence may contain fewer or additional amino acids corresponding to a shortening of, or insertion into, an FR or CDR of the variable domain.
  • a heavy chain variable domain may include a single amino acid insert (residue 52a according to Kabat) after residue 52 and three inserted residues (e.g., residues 82a, 82b, and 82c, etc. according to Kabat) after residue 82.
  • the Kabat numbering of residues may be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a "standard" Kabat numbered sequence.
  • the Kabat numbering system is generally used when referring to a residue in the variable domain (approximately residues 1-107 of the light chain and residues 1-113 of the heavy chain) (e.g., Kabat et al, supra).
  • the "EU numbering system” or "EU index” is generally used when referring to a residue in an immunoglobulin heavy chain constant region ⁇ e.g., the EU index reported in Kabat et al, supra).
  • the "EU index as in Kabat” refers to the residue numbering of the human IgG 1 EU antibody. Other numbering systems have been described, for example, by AbM, Chothia, Contact, IMGT, and AHon.
  • a "CDR” refers to one of three hypervariable regions (HI, H2 or H3) within the non- framework region of the immunoglobulin (Ig or antibody) VH ⁇ -sheet framework, or one of three hypervariable regions (LI, L2 or L3) within the non-framework region of the antibody VL ⁇ -sheet framework. Accordingly, CDRs are variable region sequences interspersed within the framework region sequences. CDR regions are well known to those skilled in the art and have been defined by, for example, Kabat as the regions of most hypervariability within the antibody variable (V) domains (Kabat et al., 1997, J. Biol. Chem. 252:6609-16; Kabat, 1978, Adv. Prot. Chem.
  • CDR region sequences also have been defined structurally by Chothia as those residues that are not part of the conserved ⁇ -sheet framework, and thus are able to adapt different conformations (Chothia and Lesk, 1987, J. Mol. Biol. 196:901-17). Both terminologies are well recognized in the art. CDR region sequences have also been defined by AbM, Contact, and IMGT. The positions of CDRs within a canonical antibody variable region have been determined by comparison of numerous structures (Al-Lazikani et al., 1997, J. Mol. Biol. 273 :927-48;
  • hypervariable region when used herein refers to the regions of an antibody variable region that are hypervariable in sequence and/or form structurally defined loops.
  • antibodies comprise six hypervariable regions, three in the VH (HI, H2, H3) and three in the VL (LI, L2, L3).
  • a number of hypervariable region delineations are in use and are encompassed herein.
  • the Kabat Complementarity Determining Regions are based on sequence variability and are the most commonly used (see, e.g., Kabat et al, supra). Chothia refers instead to the location of the structural loops (see, e.g., Chothia and Lesk, 1987, J.
  • the end of the Chothia CDR-H1 loop when numbered using the Kabat numbering convention varies between H32 and H34 depending on the length of the loop (this is because the Kabat numbering scheme places the insertions at H35A and H35B; if neither 35 A nor 35B is present, the loop ends at 32; if only 35A is present, the loop ends at 33; if both 35A and 35B are present, the loop ends at 34).
  • the AbM hypervariable regions represent a compromise between the Kabat CDRs and Chothia structural loops, and are used by Oxford Molecular' s AbM antibody modeling software (see, e.g., Antibody Engineering Vol. 2
  • the "contact" hypervariable regions are based on an analysis of the available complex crystal structures. The residues from each of these
  • IMGT ImMunoGeneTics
  • IG immunoglobulins
  • TCR T cell receptors
  • MHC major histocompatibility complex
  • the CDRs are as defined by the IMGT numbering system. In other embodiments, the CDRs are as defined by the Kabat numbering system. In certain embodiments, the CDRs are as defined by the AbM numbering system. In other embodiments, the CDRs are as defined by the Chothia system. In yet other embodiments, the CDRs are as defined by the Contact numbering system.
  • VH CDR3 105-117 95-102 95-102 96-101 93-101
  • VL CDR3 105-117 89-97 89-97 91-96 89-96
  • Hypervariable regions may comprise "extended hypervariable regions” as follows: 24-36 or 24-34 (LI), 46-56 or 50-56 (L2), and 89-97 or 89-96 (L3) in the VL, and 26-35 or 26-35A (HI), 50-65 or 49-65 (H2), and 93-102, 94-102, or 95-102 (H3) in the VH.
  • constant region refers to a carboxy terminal portion of the light and heavy chain which is not directly involved in binding of the antibody to antigen but exhibits various effector function, such as interaction with the Fc receptor.
  • the term refers to the portion of an immunoglobulin molecule having a more conserved amino acid sequence relative to the other portion of the immunoglobulin, the variable region, which contains the antigen binding site.
  • the constant region may contain the CHI, CH2, and CH3 regions of the heavy chain and the CL region of the light chain.
  • FR refers to those variable region residues flanking the CDRs. FR residues are present, for example, in chimeric, humanized, human, domain antibodies, diabodies, linear antibodies, and bispecific antibodies. FR residues are those variable domain residues other than the hypervariable region residues or CDR residues.
  • Fc region herein is used to define a C-terminal region of an
  • immunoglobulin heavy chain including, for example, native sequence Fc regions, recombinant Fc regions, and variant Fc regions.
  • immunoglobulin heavy chain might vary, the human IgG heavy chain Fc region is often defined to stretch from an amino acid residue at position Cys226, or from Pro230, to the
  • a composition of intact antibodies may comprise antibody populations with all K447 residues removed, antibody populations with no K447 residues removed, and antibody populations having a mixture of antibodies with and without the K447 residue.
  • a "functional Fc region” possesses an "effector function” of a native sequence Fc region.
  • effector functions include Clq binding; CDC; Fc receptor binding; ADCC; phagocytosis; downregulation of cell surface receptors (e.g., B cell receptor), etc.
  • Such effector functions generally require the Fc region to be combined with a binding region or binding domain ⁇ e.g., an antibody variable region or domain) and can be assessed using various assays as disclosed.
  • a "native sequence Fc region” comprises an amino acid sequence identical to the amino acid sequence of an Fc region found in nature, and not manipulated, modified, and/or changed ⁇ e.g., isolated, purified, selected, including or combining with other sequences such as variable region sequences) by a human.
  • Native sequence human IgGl Fc regions include a native sequence human IgGl Fc region (non-A and A allotypes); native sequence human IgG2 Fc region; native sequence human IgG3 Fc region; and native sequence human IgG4 Fc region as well as naturally occurring variants thereof.
  • a native human IgGl Fc region amino acid sequence is provided below:
  • a “variant Fc region” comprises an amino acid sequence which differs from that of a native sequence Fc region by virtue of at least one amino acid modification (e.g., substituting, addition, or deletion).
  • the variant Fc region has at least one amino acid substitution compared to a native sequence Fc region or to the Fc region of a parent polypeptide, for example, from about one to about ten amino acid substitutions, or from about one to about five amino acid substitutions in a native sequence Fc region or in the Fc region of a parent polypeptide.
  • the variant Fc region herein can possess at least about 80% homology with a native sequence Fc region and/or with an Fc region of a parent polypeptide, or at least about 90% homology therewith, for example, at least about 95% homology therewith.
  • a variant with one amino acid K change to A at 322 position in the human IgGl Fc amino acid sequence, IgGl-K322A Fc region is provided below:
  • IgG4P Fc region An exemplary variant with one amino acid S change to P at 228 position in the human IgG4 Fc amino acid sequence, IgG4P Fc region, is provided below:
  • IgG4PE Fc region An exemplary variant with two amino acid changes at 228 and 235 positions in the human IgG4 Fc amino acid sequence, IgG4PE Fc region, is provided below:
  • variants when used in relation to PD-1 or to an anti-PD-1 antibody may refer to a peptide or polypeptide comprising one or more (such as, for example, about 1 to about 25, about 1 to about 20, about 1 to about 15, about 1 to about 10, or about 1 to about 5) amino acid sequence substitutions, deletions, and/or additions as compared to a native or unmodified sequence.
  • a PD-1 variant may result from one or more (such as, for example, about 1 to about 25, about 1 to about 20, about 1 to about 15, about 1 to about 10, or about 1 to about 5) changes to an amino acid sequence of a native PD-1.
  • a variant of an anti-PD-1 antibody may result from one or more (such as, for example, about 1 to about 25, about 1 to about 20, about 1 to about 15, about 1 to about 10, or about 1 to about 5) changes to an amino acid sequence of a native or previously unmodified anti-PD-1 antibody.
  • Variants may be naturally occurring, such as allelic or splice variants, or may be artificially constructed.
  • Polypeptide variants may be prepared from the corresponding nucleic acid molecules encoding the variants.
  • the PD-1 variant or anti-PD-1 antibody variant at least retains PD-1 or anti-PD-1 antibody functional activity, respectively.
  • an anti-PD-1 antibody variant binds PD-1 and/or is antagonistic to PD-1 activity.
  • an anti-PD-1 antibody variant binds PD-1 and/or is agonistic to PD-1 activity.
  • the variant is encoded by a single nucleotide polymorphism (S P) variant of a nucleic acid molecule that encodes PD-1 or anti-PD-1 antibody VH or VL regions or subregions, such as one or more CDRs.
  • S P single nucleotide polymorphism
  • an "intact" antibody is one comprising an antigen-binding site as well as a CL and at least heavy chain constant regions, CHI, CH2 and CH3.
  • the constant regions may include human constant regions or amino acid sequence variants thereof.
  • an intact antibody has one or more effector functions.
  • Antibody fragments comprise a portion of an intact antibody, such as the antigen-binding or variable region of the intact antibody.
  • antibody fragments include, without limitation, Fab, Fab', F(ab') 2 , and Fv fragments; diabodies and di-diabodies
  • a "functional fragment,” “binding fragment,” or “antigen-binding fragment” of a therapeutic antibody will exhibit at least one if not some or all of the biological functions attributed to the intact antibody, the function comprising at least binding to the target antigen (e.g., a PD-1 binding fragment or fragment that binds to PD-1).
  • the target antigen e.g., a PD-1 binding fragment or fragment that binds to PD-1).
  • fusion protein refers to a polypeptide that comprises an amino acid sequence of an antibody and an amino acid sequence of a heterologous polypeptide or protein (e.g., a polypeptide or protein not normally a part of the antibody (e.g., a
  • fusion when used in relation to PD-1 or to an anti-PD-1 antibody refers to the joining of a peptide or polypeptide, or fragment, variant, and/or derivative thereof, with a heterologous peptide or polypeptide. In certain embodiments, the fusion protein retains the biological activity of the PD-1 or anti-PD-1 antibody.
  • the fusion protein comprises a PD-1 antibody VH region, VL region, VH CDR (one, two, or three VH CDRs), and/or VL CDR (one, two, or three VL CDRs), wherein the fusion protein binds to a PD-1 epitope, a PD-1 fragment, and/or a PD-1 polypeptide.
  • nucleic acid molecules refers to those which are found in nature and not manipulated, modified, and/or changed (e.g., isolated, purified, selected) by a human being.
  • the antibodies provided herein can include "chimeric" antibodies in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (see U.S. Pat. No. 4,816,567; and Morrison et al, 1984, Proc. Natl. Acad. Sci. USA 81 :6851-55).
  • Humanized forms of nonhuman (e.g., murine) antibodies are chimeric antibodies that include human immunoglobulins (e.g., recipient antibody) in which the native CDR residues are replaced by residues from the corresponding CDR of a nonhuman species (e.g., donor antibody) such as mouse, rat, rabbit, or nonhuman primate having the desired specificity, affinity, and capacity.
  • a nonhuman species e.g., donor antibody
  • one or more FR region residues of the human immunoglobulin are replaced by corresponding nonhuman residues.
  • humanized antibodies can comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance.
  • a humanized antibody heavy or light chain can comprise substantially all of at least one or more variable regions, in which all or substantially all of the CDRs correspond to those of a nonhuman immunoglobulin and all or substantially all of the FRs are those of a human immunoglobulin sequence.
  • the humanized antibody will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
  • Fc immunoglobulin constant region
  • a "human antibody” is one that possesses an amino acid sequence which corresponds to that of an antibody produced by a human and/or has been made using any of the techniques for making human antibodies as disclosed herein. This definition of a human antibody specifically excludes a humanized antibody comprising non-human antigen-binding residues.
  • Human antibodies can be produced using various techniques known in the art, including phage-display libraries (Hoogenboom and Winter, 1991, J. Mol. Biol. 227:381; Marks et al, 1991, J. Mol. Biol. 222:581) and yeast display libraries (Chao et al, 2006, Nature Protocols 1 : 755-68).
  • Human antibodies can be prepared by administering the antigen to a transgenic animal that has been modified to produce such antibodies in response to antigenic challenge, but whose endogenous loci have been disabled, e.g., mice (see, e.g., Jakobovits, 1995, Curr. Opin. Biotechnol.
  • An "affinity matured" antibody is one with one or more alterations (e.g., amino acid sequence variations, including changes, additions, and/or deletions) in one or more HVRs thereof which result in an improvement in the affinity of the antibody for antigen, compared to a parent antibody which does not possess those alteration(s).
  • Affinity matured antibodies can have nanomolar or even picomolar affinities for the target antigen. Affinity matured antibodies are produced by procedures known in the art. For review, see Hudson and Souriau, 2003, Nature Medicine 9: 129-34; Hoogenboom, 2005, Nature Biotechnol. 23 : 1105-16; Quiroz and Sinclair, 2010, Revista Ingeneria Biomedia 4:39-51.
  • blocking antibody or an “antagonist” antibody is one which inhibits or reduces biological activity of the antigen it binds.
  • blocking antibodies or antagonist antibodies may substantially or completely inhibit the biological activity of the antigen.
  • An "agonist” antibody is an antibody that triggers a response, e.g., one that mimics at least one of the functional activities of a polypeptide of interest (e.g., PD-L1).
  • An agonist antibody includes an antibody that is a ligand mimetic, for example, wherein a ligand binds to a cell surface receptor and the binding induces cell signaling or activities via an intercellular cell signaling pathway and wherein the antibody induces a similar cell signaling or activation.
  • An "agonist" of PD-1 refers to a molecule that is capable of activating or otherwise increasing one or more of the biological activities of PD-1, such as in a cell expressing PD-1.
  • an agonist of PD-1 may, for example, act by activating or otherwise increasing the activation and/or cell signaling pathways of a cell expressing a PD-1 protein, thereby increasing a PD-1 -mediated biological activity of the cell relative to the PD-1 -mediated biological activity in the absence of agonist.
  • the antibodies provided herein are agonistic anti-PD-1 antibodies, including antibodies that induce PD-1 signaling.
  • Binding affinity generally refers to the strength of the sum total of noncovalent interactions between a single binding site of a molecule (e.g., a binding protein such as an antibody) and its binding partner (e.g., an antigen). Unless indicated otherwise, as used herein, “binding affinity” refers to intrinsic binding affinity which reflects a 1 : 1 interaction between members of a binding pair (e.g., antibody and antigen).
  • the affinity of a binding molecule X for its binding partner Y can generally be represented by the dissociation constant (KD). Affinity can be measured by common methods known in the art, including those described herein.
  • the "KD" or "KD value" may be measured by assays known in the art, for example by a binding assay.
  • the KD may be measured in a RIA, for example, performed with the Fab version of an antibody of interest and its antigen (Chen et al, 1999, J. Mol Biol 293 : 865-81).
  • the KD or KD value may also be measured by using surface plasmon resonance assays by Biacore ® , using, for example, a Biacore ® TM-2000 or a Biacore ® TM-3000, or by biolayer interferon! etry using, for example, the Octet®QK384 system.
  • Biacore ® surface plasmon resonance assays by Biacore ®
  • TM-2000 or a Biacore ® TM-3000 or by biolayer interferon! etry using, for example, the Octet®QK384 system.
  • biolayer interferon! etry using, for example, the Octet®QK384 system.
  • association or “association rate” or “k 0 n” may also be determined with the same surface plasmon resonance or biolayer interferometry techniques described above using, for example, a Biacore ® TM-2000 or a Biacore ® TM-3000, or the Octet®QK384 system.
  • inhibitor refers to partial (such as, 1%, 2%, 5%, 10%, 20%, 25%, 50%, 75%, 90%, 95%, 99%) or complete ⁇ i.e., 100%) inhibition.
  • Attenuate refers to partial (such as, 1%, 2%, 5%, 10%, 20%, 25%, 50%, 75%, 90%, 95%, 99%) or complete (i.e., 100%)) reduction in a property, activity, effect, or value.
  • Antibody effector functions refer to the biological activities attributable to the Fc region ⁇ e.g., a native sequence Fc region or amino acid sequence variant Fc region) of an antibody, and vary with the antibody isotype. Examples of antibody effector functions include but are not limited to: Clq binding; CDC; Fc receptor binding; ADCC; phagocytosis;
  • B cell surface receptors e.g., B cell receptor
  • B cell activation downregulation of cell surface receptors ⁇ e.g., B cell receptor
  • T cell effector functions refer to the biological activities attributable to various types of T cells, including but not limited to cytotoxic T cells, T helper cells, and memory T cells. Examples of T cell effector functions include: increasing T cell proliferation, secreting cytokines, releasing cytotoxins, expressing membrane-associated molecules, killing target cells, activating macrophages, and activating B cells.
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • FcRs Fc receptors
  • cytotoxic cells e.g., Natural Killer (NK) cells, neutrophils, and macrophages
  • cytotoxins subsequently kill the target cell with cytotoxins.
  • the antibodies "arm" the cytotoxic cells and are absolutely required for such killing.
  • NK cells the primary cells for mediating ADCC, express FcyRIII only, whereas monocytes express FcyRI, FcyRII, and FCYRIII.
  • FCR expression on hematopoietic cells is known (see, e.g., Ravetch and Kinet, 1991, Annu. Rev. Immunol.
  • ADCC activity of a molecule of interest can be assessed in vitro, for example, in an animal model (see, e.g., Clynes et al, 1998, Proc. Natl. Acad. Sci. USA 95:652-56).
  • Antibodies with little or no ADCC activity may be selected for use.
  • ADCP antibody-dependent cellular phagocytosis
  • FcRs Fc receptors
  • phagocytotic cells e.g., neutrophils, monocytes, and macrophages
  • FcRs Fc receptors
  • an in vitro ADCP assay see, e.g., Bracher et al, 2007, J. Immunol. Methods 323 : 160-71 can be performed.
  • phagocytotic cells for such assays include peripheral blood mononuclear cells (PBMC), purified monocytes from PBMC, or U937 cells differentiated to the mononuclear type.
  • PBMC peripheral blood mononuclear cells
  • ADCP activity of the molecule of interest may be assessed in vivo, for example, in an animal model (see, e.g., Wallace et al, 2001, J. Immunol. Methods
  • Antibodies with little or no ADCP activity may be selected for use.
  • Fc receptor or "FcR” describes a receptor that binds to the Fc region of an antibody.
  • An exemplary FcR is a native sequence human FcR.
  • an exemplary FcR is one that binds an IgG antibody (e.g., a gamma receptor) and includes receptors of the FcyRI, FcyRII, and FcyRIII subclasses, including allelic variants and alternatively spliced forms of these receptors.
  • FcyRII receptors include FcyRIIA (an “activating receptor") and FcyRIIB (an “inhibiting receptor”), which have similar amino acid sequences that differ primarily in the cytoplasmic domains thereof ⁇ see, e.g., Daeron, 1997, Annu. Rev. Immunol. 15:203-34).
  • FcRs are known ⁇ see, e.g., Ravetch and Kinet, 1991, Annu. Rev. Immunol. 9:457-92; Capel et al., 1994, Immunomethods 4:25-34; and de Haas et al., 1995, J. Lab. Clin. Med. 126:330-41).
  • FcR FcR
  • the term also includes the neonatal receptor, FcRn, which is responsible for the transfer of maternal IgGs to the fetus ⁇ see, e.g., Guyer et al, 1976, J. Immunol. 117:587-93; and Kim et al, 1994, Eu. J. Immunol. 24:2429-34).
  • Antibody variants with improved or diminished binding to FcRs have been described ⁇ see, e.g., WO 2000/42072; U.S. Pat. Nos. 7, 183,387; 7,332,581; and 7.335,742; Shields et al. 2001, J. Biol. Chem. 9(2):6591-604).
  • CDC complement dependent cytotoxicity
  • Activation of the classical complement pathway is initiated by the binding of the first component of the complement system (Clq) to antibodies (of the appropriate subclass) which are bound to their cognate antigen.
  • Clq first component of the complement system
  • a CDC assay ⁇ see, e.g., Gazzano-Santoro et al, 1996, J. Immunol. Methods 202: 163) may be performed.
  • Polypeptide variants with altered Fc region amino acid sequences polypeptides with a variant Fc region
  • increased or decreased Clq binding capability have been described ⁇ see, e.g., US Pat. No. 6, 194,551; WO 1999/51642; Idusogie et al, 2000, J. Immunol. 164: 4178-84).
  • Antibodies with little or no CDC activity may be selected for use.
  • identity refers to a relationship between the sequences of two or more polypeptide molecules or two or more nucleic acid molecules, as determined by aligning and comparing the sequences.
  • Percent (%) amino acid sequence identity with respect to a reference polypeptide sequence is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity.
  • Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, or MEGALIGN (DNAStar, Inc.) software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
  • a "modification" of an amino acid residue/position refers to a change of a primary amino acid sequence as compared to a starting amino acid sequence, wherein the change results from a sequence alteration involving said amino acid residue/position.
  • typical modifications include substitution of the residue with another amino acid (e.g., a conservative or non-conservative substitution), insertion of one or more (e.g., generally fewer than 5, 4, or 3) amino acids adjacent to said residue/position, and/or deletion of said residue/position.
  • analog refers to a polypeptide that possesses a similar or identical function as a PD-1 polypeptide, a fragment of a PD-1 polypeptide, or an anti-PD-1 antibody but does not necessarily comprise a similar or identical amino acid sequence of a PD-1 polypeptide, a fragment of a PD-1 polypeptide, or an anti-PD-1 antibody, or possess a similar or identical structure of a PD-1 polypeptide, a fragment of a PD-1 polypeptide, or an anti-PD-1 antibody.
  • a polypeptide that has a similar amino acid sequence refers to a polypeptide that satisfies at least one of the followings: (a) a polypeptide having an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%), at least 90%, at least 95%, or at least 99% identical to the amino acid sequence of a PD-1 polypeptide, a fragment of a PD-1 polypeptide, or an anti-PD-1 antibody provided herein; (b) a polypeptide encoded by a nucleotide sequence that hybridizes under stringent conditions to a nucleotide sequence encoding a PD-1 polypeptide, a fragment of a PD-1 polypeptide, or an anti-PD-1 antibody (or VH or VL region thereof) described herein at least 5 amino acid residues, at least 10 amino acid residues
  • a polypeptide with similar structure to a PD-1 polypeptide, a fragment of a PD-1 polypeptide, or an anti-PD-1 antibody provided herein refers to a polypeptide that has a similar secondary, tertiary, or quaternary structure of a PD-1 polypeptide, a fragment of a PD-1 polypeptide, or an anti-PD-1 antibody provided herein.
  • the structure of a polypeptide can be determined by methods known to those skilled in the art, including but not limited to, X-ray crystallography, nuclear magnetic resonance, and crystallographic electron microscopy.
  • the term “derivative” as used herein refers to a polypeptide that comprises an amino acid sequence of a PD-1 polypeptide, a fragment of a PD-1 polypeptide, or an antibody that binds to a PD-1 polypeptide which has been altered by the introduction of amino acid residue substitutions, deletions, or additions.
  • the term “derivative” as used herein also refers to a PD-1 polypeptide, a fragment of a PD-1 polypeptide, or an antibody that binds to a PD-1 polypeptide which has been chemically modified, e.g., by the covalent attachment of any type of molecule to the polypeptide.
  • a PD-1 polypeptide, a fragment of a PD-1 polypeptide, or an anti-PD-1 antibody may be chemically modified, e.g., by increase or decrease of glycosylation, acetylation, pegylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, chemical cleavage, linkage to a cellular ligand or other protein, etc.
  • the derivatives are modified in a manner that is different from naturally occurring or starting peptide or
  • polypeptides either in the type or location of the molecules attached. Derivatives further include deletion of one or more chemical groups which are naturally present on the peptide or polypeptide. Further, a derivative of a PD-1 polypeptide, a fragment of a PD-1 polypeptide, or an anti-PD-1 antibody may contain one or more non-classical amino acids. A polypeptide derivative possesses a similar or identical function as a PD-1 polypeptide, a fragment of a PD-1
  • polypeptide or an anti-PD-1 antibody provided herein.
  • the term "host” as used herein refers to an animal, such as a mammal ⁇ e.g., a human).
  • host cell refers to a particular subject cell that may be transfected with a nucleic acid molecule and the progeny or potential progeny of such a cell. Progeny of such a cell may not be identical to the parent cell transfected with the nucleic acid molecule due to mutations or environmental influences that may occur in succeeding generations or integration of the nucleic acid molecule into the host cell genome.
  • vector refers to a substance that is used to carry or include a nucleic acid sequence, including for example, a nucleic acid sequence encoding an anti-PD-1 antibody as described herein, in order to introduce a nucleic acid sequence into a host cell.
  • Vectors applicable for use include, for example, expression vectors, plasmids, phage vectors, viral vectors, episomes, and artificial chromosomes, which can include selection sequences or markers operable for stable integration into a host cell' s chromosome. Additionally, the vectors can include one or more selectable marker genes and appropriate expression control sequences.
  • Selection control sequences can include constitutive and inducible promoters, transcription enhancers, transcription terminators, and the like, which are well known in the art.
  • both nucleic acid molecules can be inserted, for example, into a single expression vector or in separate expression vectors.
  • the encoding nucleic acids can be operationally linked to one common expression control sequence or linked to different expression control sequences, such as one inducible promoter and one constitutive promoter.
  • nucleic acid molecules into a host cell can be confirmed using methods well known in the art. Such methods include, for example, nucleic acid analysis such as Northern blots or polymerase chain reaction (PCR) amplification of mRNA, immunoblotting for expression of gene products, or other suitable analytical methods to test the expression of an introduced nucleic acid sequence or its corresponding gene product. It is understood by those skilled in the art that the nucleic acid molecules are expressed in a sufficient amount to produce a desired product (e.g., an anti-PD-1 antibody as described herein), and it is further understood that expression levels can be optimized to obtain sufficient expression using methods well known in the art.
  • a desired product e.g., an anti-PD-1 antibody as described herein
  • an "isolated nucleic acid” is a nucleic acid, for example, an RNA, DNA, or a mixed nucleic acids, which is substantially separated from other genome DNA sequences as well as proteins or complexes such as ribosomes and polymerases, which naturally accompany a native sequence.
  • An "isolated" nucleic acid molecule is one which is separated from other nucleic acid molecules which are present in the natural source of the nucleic acid molecule.
  • an "isolated" nucleic acid molecule, such as a cDNA molecule can be substantially free of other cellular material, or culture medium when produced by recombinant techniques, or substantially free of chemical precursors or other chemicals when chemically synthesized.
  • nucleic acid molecules encoding an antibody as described herein are isolated or purified.
  • the term embraces nucleic acid sequences that have been removed from their naturally occurring environment, and includes recombinant or cloned DNA isolates and chemically synthesized analogues or analogues biologically synthesized by heterologous systems.
  • a substantially pure molecule may include isolated forms of the molecule.
  • Polynucleotide or “nucleic acid,” as used interchangeably herein, refers to polymers of nucleotides of any length and includes DNA and RNA.
  • the nucleotides can be
  • a polynucleotide may comprise modified nucleotides, such as methylated nucleotides and their analogs.
  • Oligonucleotide refers to short, generally single- stranded, synthetic polynucleotides that are generally, but not necessarily, fewer than about 200 nucleotides in length.
  • oligonucleotide and “polynucleotide” are not mutually exclusive.
  • a cell that produces an anti-PD-1 antibody of the present disclosure may include a parent hybridoma cell, as well as bacterial and eukaryotic host cells into which nucleic acids encoding the antibodies have been introduced. Suitable host cells are disclosed below.
  • the left-hand end of any single-stranded polynucleotide sequence disclosed herein is the 5' end; the left-hand direction of double-stranded polynucleotide sequences is referred to as the 5' direction.
  • the direction of 5' to 3' addition of nascent RNA transcripts is referred to as the transcription direction; sequence regions on the DNA strand having the same sequence as the RNA transcript that are 5' to the 5' end of the RNA transcript are referred to as "upstream sequences"; sequence regions on the DNA strand having the same sequence as the RNA transcript that are 3 ' to the 3 ' end of the RNA transcript are referred to as "downstream sequences.”
  • nucleic acid or grammatical equivalents thereof as it is used in reference to nucleic acid molecule refers to a nucleic acid molecule in its native state or when manipulated by methods well known to those skilled in the art that can be transcribed to produce mRNA, which is then translated into a polypeptide and/or a fragment thereof.
  • the antisense strand is the complement of such a nucleic acid molecule, and the encoding sequence can be deduced therefrom.
  • recombinant antibody refers to an antibody that is prepared, expressed, created, or isolated by recombinant means.
  • Recombinant antibodies can be antibodies expressed using a recombinant expression vector transfected into a host cell, antibodies isolated from a recombinant, combinatorial antibody library, antibodies isolated from an animal (e.g., a mouse or cow) that is transgenic and/or transchromosomal for human immunoglobulin genes (see, e.g., Taylor et al, 1992, Nucl. Acids Res. 20:6287-95), or antibodies prepared, expressed, created, or isolated by any other means that involves splicing of immunoglobulin gene sequences to other DNA sequences.
  • Such recombinant antibodies can have variable and constant regions, including those derived from human germline immunoglobulin sequences (See Kabat et al., supra). In certain embodiments, however, such recombinant antibodies may be subjected to in vitro mutagenesis (or, when an animal transgenic for human Ig sequences is used, in vivo somatic mutagenesis), thus the amino acid sequences of the VH and VL regions of the recombinant antibodies are sequences that, while derived from and related to human germline VH and VL sequences, may not naturally exist within the human antibody germline repertoire in vivo.
  • detectable probe refers to a composition that provides a detectable signal.
  • the term includes, without limitation, any fluorophore, chromophore, radiolabel, enzyme, antibody or antibody fragment, and the like, that provide a detectable signal via its activity.
  • detectable agent refers to a substance that can be used to ascertain the existence or presence of a desired molecule, such as an anti-PD-1 antibody as described herein, in a sample or subject.
  • a detectable agent can be a substance that is capable of being visualized or a substance that is otherwise able to be determined and/or measured (e.g., by quantitation).
  • a diagnostic agent refers to a substance administered to a subject that aids in the diagnosis of a disease, disorder, or condition. Such substances can be used to reveal, pinpoint, and/or define the localization of a disease causing process.
  • a diagnostic agent includes a substance that is conjugated to an anti-PD-1 antibody as described herein, that when administered to a subject or contacted with a sample from a subject aids in the diagnosis of a PD-1 -mediated disease.
  • composition is intended to encompass a product containing the specified ingredients (e.g., an antibody provided herein) in, optionally, the specified amounts.
  • Carriers as used herein include pharmaceutically acceptable carriers, excipients, or stabilizers that are nontoxic to the cell or mammal being exposed thereto at the dosages and concentrations employed. Often the physiologically acceptable carrier is an aqueous pH buffered solution.
  • physiologically acceptable carriers include buffers, such as phosphate, citrate, and other organic acids; antioxidants, including ascorbic acid; low molecular weight (e.g., fewer than about 10 amino acid residues) polypeptide; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers, such as polyvinylpyrrolidone; amino acids, such as glycine, glutamine, asparagine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates, including glucose, mannose, or dextrins; chelating agents, such as EDTA; sugar alcohols, such as mannitol or sorbitol; salt-forming counterions, such as sodium; and/or nonionic surfactants, such as TWEENTM, polyethylene glycol (PEG), and PLURONICSTM.
  • buffers such as phosphate, citrate, and other organic acids
  • antioxidants including ascorbic acid
  • carrier can also refer to a diluent, adjuvant (e.g., Freund's adjuvant (complete or incomplete)), excipient, or vehicle.
  • adjuvant e.g., Freund's adjuvant (complete or incomplete)
  • excipient or vehicle.
  • Such carriers, including pharmaceutical carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable, or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil, and the like. Water is an exemplary carrier when a composition (e.g., a pharmaceutical composition) is administered intravenously.
  • Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions.
  • Suitable excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol, and the like.
  • the composition if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents.
  • Compositions can take the form of solutions, suspensions, emulsion, tablets, pills, capsules, powders, sustained-release formulations, and the like.
  • compositions can include standard carriers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, etc. Examples of suitable pharmaceutical carriers are described in Remington and Gennaro, Remington's Pharmaceutical Sciences (18th ed. 1990).
  • Compositions, including pharmaceutical compounds may contain an anti-PD-1 antibody, for example, in isolated or purified form, together with a suitable amount of carriers.
  • pharmaceutically acceptable as used herein means being approved by a regulatory agency of the Federal or a state government, or listed in United States Pharmacopeia, European Pharmacopeia, or other generally recognized Pharmacopeia for use in animals, and more particularly in humans.
  • excipient refers to an inert substance which is commonly used as a diluent, vehicle, preservative, binder, or stabilizing agent, and includes, but is not limited to, proteins (e.g., serum albumin, etc.), amino acids (e.g., aspartic acid, glutamic acid, lysine, arginine, glycine, histidine, etc.), fatty acids and phospholipids (e.g., alkyl sulfonates, caprylate, etc.), surfactants (e.g., SDS, polysorbate, nonionic surfactant, etc.), polyols (e.g., sucrose, maltose, trehalose, mannitol, sorbitol, etc.). See, also, Remington and Gennaro, Remington's Pharmaceutical Sciences (18th ed. 1990), which is hereby incorporated by reference in its entirety.
  • proteins e.g., serum albumin, etc.
  • amino acids
  • a subject is a mammal, such as a non-primate (e.g., cow, pig, horse, cat, dog, rat, etc.) or a primate (e.g., monkey and human). In specific embodiments, the subject is a human.
  • a non-primate e.g., cow, pig, horse, cat, dog, rat, etc.
  • a primate e.g., monkey and human.
  • the subject is a human.
  • administer refers to the act of injecting or otherwise physically delivering a substance as it exists outside the body (e.g., an anti-PD-1 antibody as described herein) into a patient, such as by mucosal, intradermal, intravenous, intramuscular delivery, and/or any other method of physical delivery described herein or known in the art.
  • a substance as it exists outside the body (e.g., an anti-PD-1 antibody as described herein) into a patient, such as by mucosal, intradermal, intravenous, intramuscular delivery, and/or any other method of physical delivery described herein or known in the art.
  • substantially all refers to at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or about 100%.
  • the phrase "substantially similar” or “substantially the same” denotes a sufficiently high degree of similarity between two numeric values (e.g., one associated with an antibody of the present disclosure and the other associated with a reference antibody) such that one of skill in the art would consider the difference between the two values to be of little or no biological and/or statistical significance within the context of the biological characteristic measured by the values (e.g., KD values).
  • the difference between the two values may be less than about 50%, less than about 40%, less than about 30%, less than about 20%, less than about 10%, or less than about 5%, as a function of the value for the reference antibody.
  • the phrase “substantially increased,” “substantially reduced,” or “substantially different,” as used herein, denotes a sufficiently high degree of difference between two numeric values (e.g., one associated with an antibody of the present disclosure and the other associated with a reference antibody) such that one of skill in the art would consider the difference between the two values to be of statistical significance within the context of the biological characteristic measured by the values. For example, the difference between said two values can be greater than about 10%), greater than about 20%, greater than about 30%, greater than about 40%, or greater than about 50%, as a function of the value for the reference antibody.
  • compositions comprising antibodies that bind to a PD-1 polypeptide, a PD-1 polypeptide fragment, a PD-1 peptide, or a PD-1 epitope.
  • the pharmaceutical formulations provided herein comprise antibodies that bind to human and/or cynomolgus PD-1.
  • the PD-1 antibodies bind to human PD-1.
  • the PD-1 antibodies bind to cynomolgus PD-1.
  • the PD-1 antibodies bind to both human PD-1 and cynomolgus PD-1.
  • the antibodies provided herein do not bind to rodent PD-1.
  • the anti-PD-1 antibodies bind to the extracellular domain (ECD) of PD-1.
  • ECD extracellular domain
  • the anti-PD-1 antibodies bind to an epitope in the ECD of PD-1, which is distinct from the PD-Ll binding site. In certain embodiments, the anti-PD-1 antibodies bind to an epitope in the ECD of PD-1, which is distinct from the PD-L2 biding site. In certain embodiments, the anti-PD-1 antibodies bind to an epitope in the ECD of PD-1, which is distinct from both the PD- Ll and PD-L2-binding site.
  • the pharmaceutical formulation comprises an antibody that competitively blocks an anti-PD-1 antibody disclosed herein from binding to a PD-1
  • the pharmaceutical formulation comprises an antibody that competes for binding to a PD-1 polypeptide with an anti-PD-1 antibody provided herein.
  • the pharmaceutical formulation comprises antibodies that do not block the binding of PD-Ll to a PD-1 polypeptide. In some embodiments, the
  • the pharmaceutical formulation comprises antibodies that do not block the binding of PD-L2 to a PD-1 polypeptide. In some embodiments, the pharmaceutical formulation comprises antibodies that do not block the binding of PD-Ll or PD-L2 to a PD-1 polypeptide.
  • the pharmaceutical formulation comprises antibodies that do not compete with PD-Ll for binding to a PD-1 polypeptide. In some embodiments, the pharmaceutical formulation comprises antibodies that do not compete with PD-L2 for binding to a PD-1 polypeptide. In some embodiments, the pharmaceutical formulation comprises antibodies that do not compete with PD-Ll or PD-L2 for binding to a PD-1 polypeptide.
  • the pharmaceutical formulation comprises antibodies that do not inhibit binding of PD-Ll to PD-1. In other embodiments, the pharmaceutical formulation comprises antibodies that do not inhibit binding of PD-L2 to PD-1. In specific embodiments, the pharmaceutical formulation comprises antibodies that do not inhibit binding of PD-Ll to PD-1 or binding of PD-L2 to PD-1.
  • the pharmaceutical formulation comprises anti-PD-1 antibodies that are conjugated or recombinantly fused, e.g., to a diagnostic agent or detectable agent.
  • the present disclosure provides a pharmaceutical formulation comprising anti-PD-1 antibodies that may find use herein as therapeutic agents. In another embodiment, the present disclosure provides a pharmaceutical formulation comprising anti-PD-1 antibodies that may find use herein as diagnostic agents. Exemplary antibodies of the
  • formulations include polyclonal, monoclonal, humanized, human, bispecific, and
  • heteroconjugate antibodies as well as variants thereof having improved affinity or other properties.
  • compositions comprising antibodies that bind to PD-1, including a PD-1 polypeptide, a PD-1 polypeptide fragment, a PD-
  • the pharmaceutical formulations comprise antibodies that bind to human and/or cynomolgus PD-1. In other embodiments, the pharmaceutical formulations comprise antibodies that do not bind to rodent PD-1 (e.g., a mouse PD-1). In one embodiment, the pharmaceutical formulations comprise antibodies that bind to human PD-1. In another embodiment, the pharmaceutical formulations comprise antibodies that bind to cynomolgus PD-1. In another embodiment, the pharmaceutical formulations comprise antibodies that bind to human PD-1 and cynomolgus PD-1.
  • the pharmaceutical formulations comprise antibodies that bind to human PD-1 and do not bind to a rodent PD-1 (e.g., a mouse PD-1). In some embodiments, the pharmaceutical formulations comprise antibodies that bind to cynomolgus PD-1 and do not bind to a rodent PD-1 (e.g., a mouse PD-1). In some embodiments, the pharmaceutical formulations comprise antibodies that bind to human PD-1, bind to a cynomolgus PD-1, and do not bind to a rodent PD-1 (e.g., a mouse PD-1).
  • the pharmaceutical formulations comprise antibodies that do not block the binding of PD-L1 to a PD-1 polypeptide.
  • the anti-PD-1 antibodies do not block the binding of PD-L2 to a PD-1 polypeptide.
  • the pharmaceutical formulations comprise antibodies that do not block the binding of PD-L1 or PD- L2 to a PD-1 polypeptide.
  • the pharmaceutical formulations comprise anti- PD-1 antibodies that are humanized antibodies (e.g., comprising human constant regions) that bind to PD-1, including a PD-1 polypeptide, a PD-1 polypeptide fragment, a PD-1 peptide, or a PD-1 epitope.
  • the pharmaceutical formulations comprises an anti-PD-1 antibody that comprises a VH region, VL region, VH CDRl, VH CDR2, VH CDR3, VL CDRl, VL CDR2, and/or VL CDR3 of any one of the murine monoclonal antibodies provided herein, such as an amino acid sequence depicted in Tables 1-6.
  • the isolated antibody or functional fragment thereof of the pharmaceutical formulations provided herein comprises one, two, and/or three heavy chain CDRs and/or one, two, and/or three light chain CDRs from: (a) the antibody PDlAB-1, (b) the antibody PD1AB-2, (c) the antibody PDlAB-3, (d) the antibody PDlAB-4, (e) the antibody PDlAB-5, or (f) the antibody PDlAB-6, as shown in Tables 1-2. Table 1. VL CDR Amino Acid Sequences
  • a pharmaceutical formulation provided herein comprises an antibody that comprises or consists of six CDRs, for example, VH CDRl, VH CDR2, VH
  • a pharmaceutical formulation provided herein comprises an antibody that can comprise fewer than six CDRs. In some embodiments, a pharmaceutical formulation provided herein comprises an antibody that comprises or consists of one, two, three, four, or five CDRs selected from the group consisting of VH CDRl, VH CDR2, VH CDR3, VL CDRl, VL CDR2, and/or VL CDR3 identified in Tables 1-2.
  • a pharmaceutical formulation provided herein comprises an antibody that comprises or consists of one, two, three, four, or five CDRs selected from the group consisting of VH CDRl, VH CDR2, VH CDR3, VL CDRl, VL CDR2, and/or
  • a pharmaceutical formulation provided herein comprises an antibody that comprises or consists of one, two, three, four, or five CDRs of anyone of the VH CDRl, VH CDR2, VH CDR3, VL CDRl, VL CDR2, and/or VL CDR3 identified in Tables 1-2.
  • a pharmaceutical formulation provided herein comprises an antibody that comprises one or more (e.g., one, two, or three) VH CDRs listed in Table 2. In other embodiments, a pharmaceutical formulation provided herein comprises an antibody that comprises one or more (e.g., one, two, or three) VL CDRs listed in Table 1. In yet other embodiments, a pharmaceutical formulation provided herein comprises an antibody that comprises one or more (e.g., one, two, or three) VH CDRs listed in Table 2 and one or more VL CDRs listed in Table 1. Accordingly, in some embodiments, a pharmaceutical formulation provided herein comprises an antibody that comprises a VH CDRl having an amino acid sequence of SEQ ID NO:4.
  • a pharmaceutical formulation provided herein comprises an antibody that comprises a VH CDR2 having an amino acid sequence of SEQ ID NO:5. In some embodiments, a pharmaceutical formulation provided herein comprises an antibody that comprises a VH CDR3 having an amino acid sequence of SEQ ID NO:6. In some embodiments, a pharmaceutical formulation provided herein comprises an antibody that comprises a VH CDRl and/or a VH CDR2 and/or a VH CDR3 independently selected from any one of the VH CDRl, VH CDR2, VH CDR3 amino acid sequence(s) as depicted in Table 2.
  • a pharmaceutical formulation provided herein comprises an antibody that comprises a VL CDRl having an amino acid sequence of any one of SEQ ID NOS: 1 and 7.
  • a pharmaceutical formulation provided herein comprises an antibody that comprises a VL CDR2 having an amino acid sequence of SEQ ID NO:2.
  • a pharmaceutical formulation provided herein comprises an antibody that comprises a VL CDR3 having an amino acid sequence of SEQ ID NO:3.
  • a pharmaceutical formulation provided herein comprises an antibody that comprises a VL CDRl and/or a VL CDR2 and/or a VL CDR3 independently selected from any one of the VL CDRl, VL CDR2, VL CDR3 amino acid sequences as depicted in Table 1.
  • the pharmaceutical formulation comprises an antibody that comprises a VH region comprising: (1) a VH CDRl having an amino acid sequence of SEQ ID NO:4; (2) a VH CDR2 having an amino acid sequence of SEQ ID NO:5; and (3) a VH CDR3 having an amino acid sequence of SEQ ID NO:6; and a VL region comprising: (1) a VL CDR1 having an amino acid sequence of SEQ ID NO: 1 ; (2) a VL CDR2 having an amino acid sequence of SEQ ID NO:2; and (3) a VL CDR3 having an amino acid sequence of SEQ ID N0 3.
  • the pharmaceutical formulation comprises an antibody that comprises a VH region comprising: (1) a VH CDR1 having an amino acid sequence of SEQ ID NO:4; (2) a VH CDR2 having an amino acid sequence of SEQ ID NO:5; and (3) a VH CDR3 having an amino acid sequence of SEQ ID NO:6; and a VL region comprising: (1) a VL CDR1 having an amino acid of SEQ ID NOS:7; (2) a VL CDR2 having an amino acid sequence of SEQ ID NO:2; and (3) a VL CDR3 having an amino acid sequence of SEQ ID NO:3.
  • the pharmaceutical formulation comprises an antibody that comprises a VH region comprising: (1) a VH CDR1 having an amino acid sequence of SEQ ID NO:4; (2) a VH CDR2 having an amino acid sequence of SEQ ID NO:5; and (3) a VH CDR3 having an amino acid sequence of SEQ ID NO:6.
  • the pharmaceutical formulation comprises an antibody that comprises a VL region comprising: (1) a VL CDR1 having an amino acid sequence of SEQ ID NO: 1 ; (2) a VL CDR2 having an amino acid sequence of SEQ ID NO:2; and (3) a VL CDR3 having an amino acid sequence of SEQ ID NO:3.
  • the pharmaceutical formulation comprises an antibody that comprises a VL region comprising: (1) a VL CDR1 having an amino acid sequence of SEQ ID NOS: 7; (2) a VL CDR2 having an amino acid sequence of SEQ ID NO:2; and (3) a VL CDR3 having an amino acid sequence of SEQ ID NO:3.
  • compositions comprising antibodies that comprise one or more (e.g., one, two, or three) VH CDRs and one or more (e.g., one, two, or three) VL CDRs listed in Tables 1-2.
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDR1 (SEQ ID NO:4) and a VL CDR1 (SEQ ID NOS: l or 7).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDR1 (SEQ ID NO:4) and a VL CDR2 (SEQ ID NO:2).
  • provided herein is a pharmaceutical formulation comprising an antibody that comprises a VH CDR1 (SEQ ID NO:4) and a VL CDR3 (SEQ ID NO:3).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDR2 (SEQ ID NO:5) and a VL CDRl (SEQ ID NOS: 1 or 7).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDR2 (SEQ ID NO:5) and a VL CDR2 (SEQ ID NO:2).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDR2 (SEQ ID NO:5) and a VL CDR3 (SEQ ID NO:3).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDR3 (SEQ ID NO:6) and a VL CDRl (SEQ ID NOS: 1 or 7).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDR3 (SEQ ID NO:6) and a VL CDR2 (SEQ ID NO:2).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDR3 (SEQ ID NO:6) and a VL CDR3 (SEQ ID NO:3).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDRl (SEQ ID NO:4), a VH CDR2 (SEQ ID NO:5), and a VL CDRl (SEQ ID NOS: 1 or 7).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDRl (SEQ ID NO:4), a VH CDR2 (SEQ ID NO:5), and a VL CDR2 (SEQ ID NO:2).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDRl (SEQ ID NO:4), a VH CDR2 (SEQ ID NO:5), and a VL CDR3 (SEQ ID NOS:3).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDR2 (SEQ ID NO:5), a VH CDR3 (SEQ ID NO:6), and a VL CDRl (SEQ ID NOS: l or 7).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDR2 (SEQ ID NO:5), a VH CDR3 (SEQ ID NO:6), and a VL CDR2 (SEQ ID NO:2).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDR2 (SEQ ID NO:5), a VH CDR3 (SEQ ID NO:6), and a VL CDR3 (SEQ ID NO:3).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDRl (SEQ ID NO:4), a VH CDR3 (SEQ ID NO:6), and a VL CDRl (SEQ ID NOS: 1 or 7).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDRl (SEQ ID NO:4), a VH CDR3 (SEQ ID NO:6), and a VL CDR2 (SEQ ID NO:2).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDRl (SEQ ID NO:4), a VH CDR3 (SEQ ID NO:6), and a VL CDR3 (SEQ ID NO:3).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDRl (SEQ ID NO:4), a VL CDRl (SEQ ID NOS: 1 or 7), and a VL CDR2 (SEQ ID NO:2).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDRl (SEQ ID NO:4), a VL CDRl (SEQ ID NOS: l or 7), and a VL CDR3 (SEQ ID NO:3).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDRl (SEQ ID NO:4), a VL CDR2 (SEQ ID NO:2), and a VL CDR3 (SEQ ID NO:3).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDR2 (SEQ ID NO:5), a VL CDRl (SEQ ID NOS: 1 or 7), and a VL CDR2 (SEQ ID NO:2).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDR2 (SEQ ID NO:5), a VL CDRl (SEQ ID NOS: 1 or 7), and a VL CDR3 (SEQ ID NO:3).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDR2 (SEQ ID NO:5), a VL CDR2 (SEQ ID NO:2), and a VL CDR3 (SEQ ID NO:3).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDR3 (SEQ ID NO:6), a VL CDRl (SEQ ID NOS: 1 or 7), and a VL CDR2 (SEQ ID NO:2).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDR3 (SEQ ID NO:6), a VL CDRl (SEQ ID NOS: 1 or 7), and a VL CDR3 (SEQ ID NO:3).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDR3 (SEQ ID NO:6), a VL CDR2 (SEQ ID NO:2), and a VL CDR3 (SEQ ID NO:3).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDRl (SEQ ID NO:4), a VH CDR2 (SEQ ID NO:5), a VH CDR3 (SEQ ID NO:6), and a VL CDRl (SEQ ID NOS: 1 or 7).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDRl (SEQ ID NO:4), a VH CDR2 (SEQ ID NO:5), a VH CDR3 (SEQ ID NO:6), and a VL CDR2 (SEQ ID NO:2).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDRl (SEQ ID NO:4), a VH CDR2 (SEQ ID NO:5), a VH CDR3 (SEQ ID NO:6), and a VL CDR3 (SEQ ID NO:3).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDRl (SEQ ID NO:4), a VH CDR2 (SEQ ID NO:5), a VL CDRl (SEQ ID NOS: 1 or 7), and a VL CDR2 (SEQ ID NO:2).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDRl (SEQ ID NO:4), a VH CDR2 (SEQ ID NO:5), a VL CDRl (SEQ ID NOS: 1 or 7), and a VL CDR3 (SEQ ID NO:3).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDRl (SEQ ID NO:4), a VH CDR2 (SEQ ID NO:5), a VL CDR2 (SEQ ID NO:2), and a VL CDR3 (SEQ ID NO:3).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDRl (SEQ ID NO:4), a VH CDR3 (SEQ ID NO:6), a VL CDRl (SEQ ID NOS: 1 or 7), and a VL CDR2 (SEQ ID NO:2).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDRl (SEQ ID NO:4), a VH CDR3 (SEQ ID NO:6), a VL CDRl (SEQ ID NOS: 1 or 7), and a VL CDR3 (SEQ ID NO:3).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDRl (SEQ ID NO:4), a VH CDR3 (SEQ ID NO:6), a VL CDR2 (SEQ ID NO:2), and a VL CDR3 (SEQ ID NO:3).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDR2 (SEQ ID NO:5), a VH CDR3 (SEQ ID NO:6), a VL CDRl (SEQ ID NOS: 1 or 7), and a VL CDR2 (SEQ ID NO:2).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDR2 (SEQ ID NO:5), a VH CDR3 (SEQ ID NO:6), a VL CDRl (SEQ ID NOS: l or 7), and a VL CDR3 (SEQ ID NO:3).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDR2 (SEQ ID NO:5), a VH CDR3 (SEQ ID NO:6), a VL CDR2 (SEQ ID NO:2), and a VL CDR3 (SEQ ID NO:3).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDRl (SEQ ID NO:4), a VH CDR2 (SEQ ID NO:5), a VH CDR3 (SEQ ID NO:6), a VL CDRl (SEQ ID NOS: 1 or 7), and a VL CDR2 (SEQ ID NO:2).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDRl (SEQ ID NO:4), a VH CDR2 (SEQ ID NO:5), a VH CDR3 (SEQ ID NO:6), a VL CDRl (SEQ ID NOS: 1 or 7), and a VL CDR3 (SEQ ID NO:3).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDRl (SEQ ID NO:4), a VH CDR2 (SEQ ID NO:5), a VH CDR3 (SEQ ID NO:6), a VL CDR2 (SEQ ID NO:2), and a VL CDR3 (SEQ ID NO:3).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDRl (SEQ ID NO:4), a VH CDR2 (SEQ ID NO:5), a VL CDRl (SEQ ID NOS: 1 or 7), a VL CDR2 (SEQ ID NO:2), and a VL CDR3 (SEQ ID NO:3).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDRl (SEQ ID NO:4), a VH CDR3 (SEQ ID NO:6), a VL CDRl (SEQ ID NOS: 1 or 7), a VL CDR2 (SEQ ID NO:2), and a VL CDR3 (SEQ ID NO:3).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDR2 (SEQ ID NO:5), a VH CDR3 (SEQ ID NO:6), a VL CDRl (SEQ ID NOS: l or 7), a VL CDR2 (SEQ ID NO:2), and a VL CDR3 (SEQ ID NO:3).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDRl (SEQ ID NO:4), a VL CDRl (SEQ ID NOS: 1 or 7), a VL CDR2 (SEQ ID NO:2), and a VL CDR3 (SEQ ID NO:3).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDR2 (SEQ ID NO:5), a VL CDRl (SEQ ID NOS: 1 or 7), a VL CDR2 (SEQ ID NO:2), and a VL CDR3 (SEQ ID NO:3).
  • a pharmaceutical formulation comprising an antibody that comprises a VH CDR3 (SEQ ID NO:6), a VL CDRl (SEQ ID NOS: 1 or 7), a VL CDR2 (SEQ ID NO:2), and a VL CDR3 (SEQ ID NO:3).
  • a pharmaceutical formulation comprising an antibody that comprises any combination thereof of the VH CDRs and VL CDRs listed in Tables 1-2.
  • the CDRs disclosed herein include consensus sequences derived from groups of related antibodies (see, e.g., Tables 1-2).
  • a "consensus sequence” refers to amino acid sequences having conserved amino acids common among a number of sequences and variable amino acids that vary within a given amino acid sequences.
  • the isolated antibody or functional fragment thereof of a pharmaceutical formulation provided herein further comprises one, two, three, and/or four heavy chain FRs and/or one, two, three, and/or four light chain FRs from: (a) the antibody PDlAB-1, (b) the antibody PD1AB-2, (c) the antibody PD1AB-3, (d) the antibody PD1AB-4, (e) the antibody PD1AB-5, or (f) the antibody PD1AB-6, as shown in Tables 3-4.
  • VH FR Amino Acid Sequences Antibody VH FR1 VH FR2 VH FR3 VH FR4 (SEQ ID NO:) (SEQ ID NO:) (SEQ ID NO:) (SEQ ID NO:) (SEQ ID NO:)
  • the isolated antibody or functional fragment thereof of a pharmaceutical formulation provided herein further comprises one, two, three, and/or four heavy chain FRs from: (a) the antibody PDlAB-1, (b) the antibody PD1AB-2, (c) the antibody
  • the antibody heavy chain FR(s) is from the antibody PDlAB-1. In some embodiments, the antibody heavy chain FR(s) is from the antibody PD1AB- 2. In other embodiments, the antibody heavy chain FR(s) is from the antibody PDlAB-3. In certain embodiments, the antibody heavy chain FR(s) is from the antibody PDlAB-4. In other embodiments, the antibody heavy chain FR(s) is from the antibody PDlAB-5. In another embodiment, the antibody heavy chain FR(s) is from the antibody PDlAB-6.
  • the isolated antibody or functional fragment thereof of a pharmaceutical formulation provided herein further comprises one, two, three, and/or four light chain FRs from: (a) the antibody PDlAB-1, (b) the antibody PD1AB-2, (c) the antibody
  • the antibody light chain FR(s) is from the antibody PDlAB-1. In some embodiments, the antibody light chain FR(s) is from the antibody PD1AB-2. In other embodiments, the antibody light chain FR(s) is from the antibody PDlAB-3. In certain embodiments, the antibody light chain FR(s) is from the antibody PDlAB-4. In other embodiments, the antibody light chain FR(s) is from the antibody PDlAB-5. In another embodiment, the antibody light chain FR(s) is from the antibody PDlAB-6.
  • an antibody or fragment thereof of a pharmaceutical formulation described herein comprises a VH region that comprises: (1) a VH FR1 having an amino acid sequence selected from the group consisting of SEQ ID NOS: 19 and 24; (2) a VH FR2 having an amino acid sequence of SEQ ID NO:20; (3) a VH FR3 having an amino acid sequence selected from the group consisting of SEQ ID NOS:21 and 23; and/or (4) a VH FR4 having an amino acid sequence of SEQ ID NO:22.
  • an antibody or fragment thereof of a pharmaceutical formulation described herein comprises a VH region that comprises: (1) a VH FR1 having an amino acid of SEQ ID NO: 19; (2) a VH FR2 having an amino acid sequence of SEQ ID NO:20; (3) a VH FR3 having an amino acid sequence of SEQ ID NO:21; and/or (4) a VH FR4 having an amino acid sequence of SEQ ID NO: 22.
  • an antibody or fragment thereof of a pharmaceutical formulation described herein comprises a VH region that comprises: (1) a VH FR1 having an amino acid sequence of SEQ ID NO: 19; (2) a VH FR2 having an amino acid sequence of SEQ ID NO:20; (3) a VH FR3 having an amino acid sequence of SEQ ID NO: 23; and/or (4) a VH FR4 having an amino acid sequence of SEQ ID NO:22.
  • an antibody or fragment thereof of a pharmaceutical formulation described herein comprises a VH region that comprises: (1) a VH FR1 having an amino acid sequence of SEQ ID NO: 24; (2) a VH FR2 having an amino acid sequence of SEQ ID NO:20; (3) a VH FR3 having an amino acid sequence of SEQ ID NO:21; and/or (4) a VH FR4 having an amino acid sequence of SEQ ID NO:22.
  • an antibody or fragment thereof of a pharmaceutical formulation described herein comprises a VH region that comprises: (1) a VH FR1 having an amino acid sequence of SEQ ID NO:24; (2) a VH FR2 having an amino acid sequence of SEQ ID NO:20; (3) a VH FR3 having an amino acid sequence of SEQ ID NO: 23; and/or (4) a VH FR4 having an amino acid sequence of SEQ ID NO:22.
  • the antibody comprises a VH region comprising all four of the above- referenced VH FR1, VH FR2, VH FR3, and VH FR4.
  • the humanized antibody of a pharmaceutical formulation comprises a VH region that includes a VH FR1 having an amino acid sequence selected from the group consisting of SEQ ID NOS: 19 and 24.
  • the humanized antibody of a pharmaceutical formulation comprises a VH region that includes a VH FR1 having an amino acid sequence of SEQ ID NO: 19.
  • the humanized antibody of a pharmaceutical formulation comprises a VH region that includes a VH FR1 having an amino acid sequence of SEQ ID NO:24.
  • the humanized antibody of a pharmaceutical formulation comprises a VH region that includes a VH FR2 having an amino acid sequence of SEQ ID NO: 20.
  • the humanized antibody of a pharmaceutical formulation comprises a VH region that includes a VH FR3 having an amino acid sequence selected from the group consisting of SEQ ID NOS:21 and 23.
  • the humanized antibody of a pharmaceutical formulation comprises a VH region that includes a VH FR3 having an amino acid sequence of SEQ ID NO:21. In one embodiment, the humanized antibody of a pharmaceutical formulation comprises a VH region that includes a VH FR3 having an amino acid sequence of SEQ ID NO:23. In other embodiments, the humanized antibody of a pharmaceutical formulation comprises a VH region that includes a VH FR4 having an amino acid sequence of SEQ ID NO:22.
  • an antibody or fragment thereof of a pharmaceutical formulation described herein comprises a VL region that comprises: (1) a VL FR1 having an amino acid sequence of SEQ ID NO: 14; (2) a VL FR2 having an amino acid sequence of SEQ ID NO: 15; (3) a VL FR3 having an amino acid sequence selected from the group consisting of SEQ ID NOS: 16 and 18; and/or (4) a VL FR4 having an amino acid sequence of SEQ ID NO: 17.
  • the VL region comprises: (1) a VL FR1 having an amino acid sequence of SEQ ID NO: 14; (2) a VL FR2 having an amino acid sequence of SEQ ID NO: 15; (3) a VL FR3 having an amino acid sequence of SEQ ID NOS: 16; and/or (4) a VL FR4 having an amino acid sequence of SEQ ID NO: 17.
  • the VL region that comprises: (1) a VL FR1 having an amino acid sequence of SEQ ID NO: 14; (2) a VL FR2 having an amino acid sequence of SEQ ID NO: 15; (3) a VL FR3 having an amino acid sequence of SEQ ID NO: 18; and/or (4) a VL FR4 having an amino acid sequence of SEQ ID NO: 17.
  • the humanized antibody of a pharmaceutical formulation comprises a VL region that includes a VL FR1 having an amino acid sequence of SEQ ID NO: 14.
  • the humanized antibody of a pharmaceutical formulation comprises a VL region that includes a VL FR2 having an amino acid sequence of SEQ ID NO: 15.
  • the humanized antibody of a pharmaceutical formulation comprises a VL region that includes a VL FR3 having an amino acid sequence selected from the group consisting of SEQ ID NOS: 16 and 18.
  • the humanized antibody of a pharmaceutical formulation comprises a VL region that includes a VL FR3 having an amino acid sequence of SEQ ID NOS: 16.
  • the humanized antibody of a pharmaceutical formulation comprises a VL region that includes a VL FR3 having an amino acid sequence of SEQ ID NOS: 16.
  • pharmaceutical formulation comprises a VL region that includes a VL FR3 having an amino acid sequence of SEQ ID NO: 18.
  • an antibody or fragment thereof of a pharmaceutical formulation described herein comprises a VH region and a VL region, wherein the VH region comprises: (1) a VH FRl having an amino acid sequence selected from the group consisting of SEQ ID NOS: 19 and 24; (2) a VH FR2 having an amino acid sequence of SEQ ID NO:20; (3) a VH FR3 having an amino acid sequence selected from the group consisting of SEQ ID NOS:21 and 23; and/or (4) a VH FR4 having an amino acid sequence of SEQ ID NO:22; and wherein the VL region comprises: (1) a VL FRl having an amino acid sequence of SEQ ID NO: 14; (2) a VL FR2 having an amino acid sequence of SEQ ID NO: 15; (3) a VL FR3 having an amino acid sequence selected from the group consisting of SEQ ID NOS:
  • the pharmaceutical formulation comprises a VL region comprising all four of the above-referenced VL FRl, VL FR2, VL FR3, and VL FR4.
  • the antibody of a pharmaceutical formulation comprises a VH region comprising all four of the above-referenced VH FRl, VH FR2, VH FR3, and VH FR4, and a VL region comprising all four of the above- referenced VL FRl, VL FR2, VL FR3, and VL FR4.
  • an antibody or fragment thereof of a pharmaceutical formulation comprises a VH region and a VL region, wherein the VH region comprises: (1) a VH FRl having an amino acid sequence of SEQ ID NO: 19; (2) a VH FR2 having an amino acid sequence of SEQ ID NO:20; (3) a VH FR3 having an amino acid sequence of SEQ ID NO:21; and/or (4) a VH FR4 having an amino acid sequence of SEQ ID NO:22; and wherein the VL region comprises: (1) a VL FRl having an amino acid sequence of SEQ ID NO: 14; (2) a VL FR2 having an amino acid sequence of SEQ ID NO: 15; (3) a VL FR3 having an amino acid sequence of SEQ ID NO: 16; and/or (4) a VL FR4 having an amino acid sequence of SEQ ID NO: 17.
  • the antibody of a pharmaceutical formulation comprises a VH region comprising all four of the above-referenced VH FRl, VH FR2, VH FR3, and VH FR4. In other embodiments, the antibody of a pharmaceutical formulation comprises a VL region comprising all four of the above-referenced VL FRl, VL FR2, VL FR3, and VL FR4. In yet other embodiments, the antibody of a pharmaceutical formulation comprises a VH region comprising all four of the above-referenced VH FR1, VH FR2, VH FR3, and VH FR4, and a VL region comprising all four of the above-referenced VL FR1, VL FR2, VL FR3, and VL FR4.
  • an antibody or fragment thereof of a pharmaceutical formulation comprises a VH region and a VL region, wherein the VH region comprises: (1) a VH FR1 having an amino acid sequence of SEQ ID NO: 19; (2) a VH FR2 having an amino acid sequence of SEQ ID NO:20; (3) a VH FR3 having an amino acid sequence of SEQ ID NO:21; and/or (4) a VH FR4 having an amino acid sequence of SEQ ID NO:22; and wherein the VL region comprises: (1) a VL FR1 having an amino acid sequence of SEQ ID NO: 14; (2) a VL FR2 having an amino acid sequence of SEQ ID NO: 15; (3) a VL FR3 having an amino acid sequence of SEQ ID NO: 18; and/or (4) a VL FR4 having an amino acid sequence of SEQ ID NO: 17.
  • the antibody of a pharmaceutical formulation comprises a VH region comprising all four of the above-referenced VH FR1, VH FR2, VH FR3, and VH FR4. In other embodiments, the antibody of a pharmaceutical formulation comprises a VL region comprising all four of the above-referenced VL FR1, VL FR2, VL FR3, and VL FR4. In yet other embodiments, the antibody of a pharmaceutical formulation comprises a VH region comprising all four of the above-referenced VH FR1, VH FR2, VH FR3, and VH FR4, and a VL region comprising all four of the above-referenced VL FR1, VL FR2, VL FR3, and VL FR4.
  • an antibody or fragment thereof of a pharmaceutical formulation comprises a VH region and a VL region, wherein the VH region comprises: (1) a VH FR1 having an amino acid sequence of SEQ ID NO: 19; (2) a VH FR2 having an amino acid sequence of SEQ ID NO:20; (3) a VH FR3 having an amino acid sequence of SEQ ID NO:23; and/or (4) a VH FR4 having an amino acid sequence of SEQ ID NO:22; and wherein the VL region comprises: (1) a VL FR1 having an amino acid sequence of SEQ ID NO: 14; (2) a VL FR2 having an amino acid sequence of SEQ ID NO: 15; (3) a VL FR3 having an amino acid sequence of SEQ ID NO: 16; and/or (4) a VL FR4 having an amino acid sequence of SEQ ID NO: 17.
  • the antibody of a pharmaceutical formulation comprises a VH region comprising all four of the above-referenced VH FR1, VH FR2, VH FR3, and VH FR4. In other embodiments, the antibody of a pharmaceutical formulation comprises a VL region comprising all four of the above-referenced VL FR1, VL FR2, VL FR3, and VL FR4. In yet other embodiments, the antibody of a pharmaceutical formulation comprises a VH region comprising all four of the above-referenced VH FR1, VH FR2, VH FR3, and VH FR4, and a VL region comprising all four of the above-referenced VL FR1, VL FR2, VL FR3, and VL FR4.
  • an antibody or fragment thereof of a pharmaceutical formulation comprises a VH region and a VL region, wherein the VH region comprises: (1) a VH FR1 having an amino acid sequence of SEQ ID NO: 19; (2) a VH FR2 having an amino acid sequence of SEQ ID NO:20; (3) a VH FR3 having an amino acid sequence of SEQ ID NO:23; and/or (4) a VH FR4 having an amino acid sequence of SEQ ID NO:22; and wherein the VL region comprises: (1) a VL FR1 having an amino acid sequence of SEQ ID NO: 14; (2) a VL FR2 having an amino acid sequence of SEQ ID NO: 15; (3) a VL FR3 having an amino acid sequence of SEQ ID NO: 18; and/or (4) a VL FR4 having an amino acid sequence of SEQ ID NO: 17.
  • the antibody of a pharmaceutical formulation comprises a VH region comprising all four of the above-referenced VH FR1, VH FR2, VH FR3, and VH FR4. In other embodiments, the antibody of a pharmaceutical formulation comprises a VL region comprising all four of the above-referenced VL FR1, VL FR2, VL FR3, and VL FR4. In yet other embodiments, the antibody of a pharmaceutical formulation comprises a VH region comprising all four of the above-referenced VH FR1, VH FR2, VH FR3, and VH FR4, and a VL region comprising all four of the above-referenced VL FR1, VL FR2, VL FR3, and VL FR4.
  • an antibody or fragment thereof of a pharmaceutical formulation comprises a VH region and a VL region, wherein the VH region comprises: (1) a VH FR1 having an amino acid sequence of SEQ ID NO:24; (2) a VH FR2 having an amino acid sequence of SEQ ID NO:20; (3) a VH FR3 having an amino acid sequence of SEQ ID NO:21; and/or (4) a VH FR4 having an amino acid sequence of SEQ ID NO:22; and wherein the VL region comprises: (1) a VL FR1 having an amino acid sequence of SEQ ID NO: 14; (2) a VL FR2 having an amino acid sequence of SEQ ID NO: 15; (3) a VL FR3 having an amino acid sequence of SEQ ID NO: 16; and/or (4) a VL FR4 having an amino acid sequence of SEQ ID NO: 17.
  • the antibody of a pharmaceutical formulation comprises a VH region comprising all four of the above-referenced VH FR1, VH FR2, VH FR3, and VH FR4. In other embodiments, the antibody of a pharmaceutical formulation comprises a VL region comprising all four of the above-referenced VL FR1, VL FR2, VL FR3, and VL FR4. In yet other embodiments, the antibody of a pharmaceutical formulation comprises a VH region comprising all four of the above-referenced VH FR1, VH FR2, VH FR3, and VH FR4, and a VL region comprising all four of the above-referenced VL FR1, VL FR2, VL FR3, and VL FR4.
  • an antibody or fragment thereof of a pharmaceutical formulation comprises a VH region and a VL region, wherein the VH region comprises: (1) a VH FR1 having an amino acid sequence of SEQ ID NO:24; (2) a VH FR2 having an amino acid sequence of SEQ ID NO:20; (3) a VH FR3 having an amino acid sequence of SEQ ID NO:21; and/or (4) a VH FR4 having an amino acid sequence of SEQ ID NO:22; and wherein the VL region comprises: (1) a VL FR1 having an amino acid sequence of SEQ ID NO: 14; (2) a VL FR2 having an amino acid sequence of SEQ ID NO: 15; (3) a VL FR3 having an amino acid sequence of SEQ ID NO: 18; and/or (4) a VL FR4 having an amino acid sequence of SEQ ID NO: 17.
  • the antibody of a pharmaceutical formulation comprises a VH region comprising all four of the above-referenced VH FR1, VH FR2, VH FR3 and VH FR4. In other embodiments, the antibody of a pharmaceutical formulation comprises a VL region comprising all four of the above-referenced VL FR1, VL FR2, VL FR3 and VL FR4. In yet other embodiments, the antibody of a pharmaceutical formulation comprises a VH region comprising all four of the above-referenced VH FR1, VH FR2, VH FR3, and VH FR4, and a VL region comprising all four of the above-referenced VL FR1, VL FR2, VL FR3, and VL FR4.
  • an antibody or fragment thereof of a pharmaceutical formulation comprises a VH region and a VL region, wherein the VH region comprises: (1) a VH FR1 having an amino acid sequence of SEQ ID NO:24; (2) a VH FR2 having an amino acid sequence of SEQ ID NO:20; (3) a VH FR3 having an amino acid sequence of SEQ ID NO:23; and/or (4) a VH FR4 having an amino acid sequence of SEQ ID NO:22; and wherein the VL region comprises: (1) a VL FR1 having an amino acid sequence of SEQ ID NO: 14; (2) a VL FR2 having an amino acid sequence of SEQ ID NO: 15; (3) a VL FR3 having an amino acid sequence of SEQ ID NO: 16; and/or (4) a VL FR4 having an amino acid sequence of SEQ ID NO: 17.
  • the antibody of a pharmaceutical formulation comprises a VH region comprising all four of the above-referenced VH FR1, VH FR2, VH FR3, and VH FR4. In other embodiments, the antibody of a pharmaceutical formulation comprises a VL region comprising all four of the above-referenced VL FR1, VL FR2, VL FR3, and VL FR4. In yet other embodiments, the antibody of a pharmaceutical formulation comprises a VH region comprising all four of the above-referenced VH FRl, VH FR2, VH FR3, and VH FR4, and a VL region comprising all four of the above-referenced VL FRl, VL FR2, VL FR3, and VL FR4.
  • an antibody or fragment thereof of a pharmaceutical formulation comprises a VH region and a VL region, wherein the VH region comprises: (1) a VH FRl having an amino acid sequence of SEQ ID NO:24; (2) a VH FR2 having an amino acid sequence of SEQ ID NO:20; (3) a VH FR3 having an amino acid sequence of SEQ ID NO:23; and/or (4) a VH FR4 having an amino acid sequence of SEQ ID NO:22; and wherein the VL region comprises: (1) a VL FRl having an amino acid sequence of SEQ ID NO: 14; (2) a VL FR2 having an amino acid sequence of SEQ ID NO: 15; (3) a VL FR3 having an amino acid sequence of SEQ ID NO: 18; and/or (4) a VL FR4 having an amino acid sequence of SEQ ID NO: 17.
  • the antibody of a pharmaceutical formulation comprises a VH region comprising all four of the above-referenced VH FRl, VH FR2, VH FR3, and VH FR4. In other embodiments, the antibody of a pharmaceutical formulation comprises a VL region comprising all four of the above-referenced VL FRl, VL FR2, VL FR3, and VL FR4.
  • the antibody of a pharmaceutical formulation comprises a VH region comprising all four of the above-referenced VH FRl, VH FR2, VH FR3, and VH FR4, and a VL region comprising all four of the above-referenced VL FRl, VL FR2, VL FR3, and VL FR4.
  • compositions that comprise antibodies comprising one or more (e.g., one, two, three, or four) VH FRs and one or more (e.g., one, two, three, or four) VL FRs listed in Tables 3-4.
  • a pharmaceutical formulation that comprises an antibody comprising a VH FRl (SEQ ID NOS: 19 or 24) and a VL FRl (SEQ ID NO: 14).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24) and a VL FR2 (SEQ ID NO: 15).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24) and a VL FR3 (SEQ ID NOS: 16 or 18). In another embodiment, the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24) and a VL FR4 (SEQ ID NO: 17). In other embodiments, the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20) and a VL FRl (SEQ ID NO: 14). In one embodiment, the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20) and a VL FR2 (SEQ ID NO: 15). In some embodiments, the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20) and a VL FR2 (SEQ ID NO: 15). In some embodiments, the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO: 20) and a V
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20) and a VL FR3 (SEQ ID NOS: 16 or 18). In another embodiment, the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20) and a VL FR4 (SEQ ID NO: 17). In one embodiment, the pharmaceutical formulation comprises an antibody that comprises a VH FR3 (SEQ ID NO:21) and a VL FRl (SEQ ID NO: 14). In other embodiments, the pharmaceutical formulation comprises an antibody that comprises a VH FR3 (SEQ ID NO:21) and a VL FR2 (SEQ ID NO: 15).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR3 (SEQ ID NO:21) and a VL FR3 (SEQ ID NOS: 16 or 18). In some embodiments, the pharmaceutical formulation comprises an antibody that comprises a VH FR3 (SEQ ID NO:21) and a VL FR4 (SEQ ID NO: 17). In one embodiment, the pharmaceutical formulation comprises an antibody that comprises a VH FR4 (SEQ ID NO:22) and a VL FRl (SEQ ID NO: 14). In another embodiment, the pharmaceutical formulation comprises an antibody that comprises a VH FR4 (SEQ ID NO:22) and a VL FR2 (SEQ ID NO: 15).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR4 (SEQ ID NO:22) and a VL FR3 (SEQ ID NOS: 16 or 18). In some embodiments, the pharmaceutical formulation comprises an antibody that comprises a VH FR4 (SEQ ID NO:22) and a VL FR4 (SEQ ID NO: 17). In another embodiment, the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), and a VL FRl (SEQ ID NO: 14).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), and a VL FR2 (SEQ ID NO: 15).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), and a VL FRl (SEQ ID NO: 14).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), and a VL FR2 (SEQ ID NO: 15).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VL FRl (SEQ ID NO: 14), and a VL FR2 (SEQ ID NO: 15).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VL FRl (SEQ ID NO: 14), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VL FRl (SEQ ID NO: 14), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VL FR2 (SEQ ID NO: 15) and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VL FR2 (SEQ ID NO: 15) and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NO: 19 or 24), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VL FRl (SEQ ID NO: 14), and a VL FR2 (SEQ ID NO: 15).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VL FRl (SEQ ID NO: 14), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VL FRl (SEQ ID NO: 14), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VL FR2 (SEQ ID NO: 15) and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VL FR2 (SEQ ID NO: 15) and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR3 (SEQ ID NOS:21 or 23), a VL FRl (SEQ ID NO: 14), and a VL FR2 (SEQ ID NO: 15).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR3 (SEQ ID NOS:21 or 23), a VL FRl (SEQ ID NO: 14), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR3 (SEQ ID NOS:21 or 23), a VL FRl (SEQ ID NO: 14), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR3 (SEQ ID NOS:21 or 23), a VL FR2 (SEQ ID NO: 15) and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR3 (SEQ ID NOS:21 or 23), a VL FR2 (SEQ ID NO: 15) and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR3 (SEQ ID NOS:21 or 23), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), and a VL FR2 (SEQ ID NO: 15).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15) and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15) and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR4 (SEQ ID NO:22), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NO:21), and a VL FRl (SEQ ID NO: 14).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NO:21), and a VL FR2 (SEQ ID NO: 15).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NO:21), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NO:21), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), and a VL FRl (SEQ ID NO: 14).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), and a VL FR2 (SEQ ID NO: 15).
  • a VH FRl SEQ ID NOS: 19 or 24
  • a VH FR2 SEQ ID NO:20
  • a VH FR4 SEQ ID NO:22
  • VL FR2 SEQ ID NO: 15
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), and a VL FRl (SEQ ID NO: 14).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), and a VL FR2 (SEQ ID NO: 15).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), and a VL FRl (SEQ ID NO: 14).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), and a VL FR2 (SEQ ID NO: 15).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VL FRl (SEQ ID NO: 14), and a VL FR2 (SEQ ID NO: 15).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VL FRl (SEQ ID NO: 14), and a VL FR3 (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VL FRl (SEQ ID NO: 14), and a VL FR3 (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VL FRl (SEQ ID NO: 14), and a VL FR3 (SEQ ID NOS: 19 or 24), a VH FR2
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VL FRl (SEQ ID NO: 14), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NO:21), a VL FRl (SEQ ID NO: 14), and a VL FR2 (SEQ ID NO: 15).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NO:21), a VL FRl (SEQ ID NO: 14), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NO:21), a VL FRl (SEQ ID NO: 14), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NO:21), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NO:21), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NO:21), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), and a VL FR2 (SEQ ID NO: 15).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NOS: 19 or 24), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NOS: 19 or 24), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NOSEQ ID NOS: 19 or 24), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NOSEQ ID NOS: 19 or 24), a VH FR4 (SEQ ID NO:22), a VL FR2 (S
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR4 (SEQ ID NO:22), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NO:21), a VL FRl (SEQ ID NO: 14), and a VL FR2 (SEQ ID NO: 15).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO: 20), a VH FR3 (SEQ ID NO:21), a VL FRl (SEQ ID NO: 14), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NO:21), a VL FRl (SEQ ID NO: 14), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NO:21), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NO:21), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NO:21), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), and a VL FR2 (SEQ ID NO: 15).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO:
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), and a VL FR2 (SEQ ID NO: 15).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NOSEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NOSEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR2 (S
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VL FRl (SEQ ID NO: 14), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VL FR1 (SEQ ID NO: 14), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR3 (SEQ ID NOS:21 or 23), a VL FR1 (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR3 (SEQ ID NOS:21 or 23), a VL FR1 (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NOS:21 or 23), a VH FR3 (SEQ ID NOS:21 or 23), a VL FR1 (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NOS:21 or 23), a VL FR1 (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NOS: 21 or 23), a VL FR1 (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NOS: 21 or 23), a VL FR1 (SEQ ID NO: 14
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR3 (SEQ ID NOS:21 or 23), a VL FR1 (SEQ ID NO: 14), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR3 (SEQ ID NOS:21 or 23), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR4 (SEQ ID NO:22), a VL FR1 (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR4 (SEQ ID NO:22), a VL FR1 (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR4 (SEQ ID NO:22), a VL FR1 (SEQ ID NO: 14), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR1 (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), and a VL FR1 (SEQ ID NO: 14).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR1 (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), and a VL FR2 (SEQ ID NO: 15).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR1 (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VL FRl (SEQ ID NO: 14), and a VL FR2 (SEQ ID NO: 15).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VL FRl (SEQ ID NO: 14), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VL FRl (SEQ ID NO: 14), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • a VH FRl SEQ ID NOS: 19 or 24
  • VH FR2 SEQ ID NO:20
  • VH FR3 SEQ ID NOS:21 or 23
  • VL FR3 SEQ ID NOS: 16 or 18
  • VL FR4 SEQ ID NO: 17
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), and a VL FR2 (SEQ ID NO: 15).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), and a VL FR4 (SEQ ID NO: 17).
  • a VH FRl SEQ ID NOS: 19 or 24
  • a VH FR2 SEQ ID NO:20
  • VH FR4 SEQ ID NO:22
  • VL FRl SEQ ID NO: 14
  • VL FR4 SEQ ID NO: 17
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FR2
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), and a VL FR2 (SEQ ID NO: 15).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), and a VL FR2 (SEQ ID NO: 15).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR3 (SEQ ID NOS:
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VL FRl (SEQ ID NO: 14), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • a VH FRl SEQ ID NOS: 19 or 24
  • a VH FR2 SEQ ID NO:20
  • VL FR2 SEQ ID NO: 15
  • VL FR3 SEQ ID NOS: 16 or 18
  • VL FR4 SEQ ID NO: 17
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NOS:21 or 23), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NOS:21 or 23), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NOS:21 or 23), a VL FRl (SEQ ID NO: 14), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NOS:21 or 23), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NOS:21 or 23), a VL FR2 (SEQ ID NO: 15), a VL
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VL FRl (SEQ ID NO: 14), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR1 (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR1 (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR1 (SEQ ID NO: 14), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR1 (SEQ ID NOS: 19 or 24), a VL FR1 (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VL FR1 (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR3 (SEQ ID NOS:21 or 23), a VL FR1 (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR4 (SEQ ID NO:22), a VL FR1 (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR1 (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR1 (SEQ ID NO: 14), and a VL FR2 (SEQ ID NO: 15).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR1 (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR1 (SEQ ID NO: 14), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR1 (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR1 (SEQ ID NO: 14), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • a VH FRl SEQ ID NOS: 19 or 24
  • VH FR2 SEQ ID NO:20
  • VH FR3 SEQ ID NOS:21 or 23
  • a VH FR4 SEQ ID NO:22
  • VL FR2 SEQ ID NO: 15
  • VL FR3 SEQ ID NOS: 16 or 18
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VL FRl (SEQ ID NO: 14), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR1 (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR1 (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR1 (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR1 (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR1 (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR1 (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR1 (SEQ ID NO: 14), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR1 (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR1 (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR1 (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR1 (SEQ ID NO: 14), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR1 (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VL FR1 (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR1 (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NOS:21 or 23), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR3 (SEQ ID NOS: 16 or 18).
  • a VH FRl SEQ ID NOS: 19 or 24
  • VH FR2 SEQ ID NO:20
  • VH FR3 SEQ ID NOS:21 or 23
  • a VH FR4 SEQ ID NO:22
  • VL FRl SEQ ID NO: 14
  • VL FR2 SEQ ID NO: 15
  • VL FR3 SEQ ID NOS: 16 or 18
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), and a VL FR4 (SEQ ID NO: 17).
  • VH FRl SEQ ID NOS: 19 or 24
  • VH FR2 SEQ ID NO:20
  • VH FR3 SEQ ID NOS:21 or 23
  • a VH FR4 SEQ ID NO:22
  • VL FRl SEQ ID NO: 14
  • VL FR2 SEQ ID NO: 15
  • VL FR4 SEQ ID NO: 17
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • VH FRl SEQ ID NOS: 19 or 24
  • VH FR2 SEQ ID NO:20
  • VH FR3 SEQ ID NOS:21 or 23
  • a VH FR4 SEQ ID NO:22
  • VL FRl SEQ ID NO: 14
  • VL FR3 SEQ ID NOS: 16 or 18
  • VL FR4 SEQ ID NO: 17
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • VH FRl SEQ ID NOS: 19 or 24
  • VH FR2 SEQ ID NO:20
  • VH FR3 SEQ ID NOS:21 or 23
  • a VH FR4 SEQ ID NO:22
  • VL FR2 SEQ ID NO: 15
  • VL FR3 SEQ ID NOS: 16 or 18
  • VL FR4 SEQ ID NO: 17
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • VH FRl SEQ ID NOS: 19 or 24
  • VH FR2 SEQ ID NO:20
  • VH FR3 SEQ ID NOS:21 or 23
  • VL FRl SEQ ID NO: 14
  • VL FR2 SEQ ID NO: 15
  • VL FR3 SEQ ID NOS: 16 or 18
  • VL FR4 SEQ ID NO: 17
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR2 (SEQ ID NO:20), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • VH FRl SEQ ID NOS: 19 or 24
  • VH FR2 SEQ ID NO:20
  • VH FR4 SEQ ID NO:22
  • VL FRl SEQ ID NO: 14
  • VL FR2 SEQ ID NO: 15
  • VL FR3 SEQ ID NOS: 16 or 18
  • VL FR4 SEQ ID NO: 17
  • the pharmaceutical formulation comprises an antibody that comprises a VH FRl (SEQ ID NOS: 19 or 24), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • VH FRl SEQ ID NOS: 19 or 24
  • VH FR3 SEQ ID NOS:21 or 23
  • a VH FR4 SEQ ID NO:22
  • VL FRl SEQ ID NO: 14
  • VL FR2 SEQ ID NO: 15
  • VL FR3 SEQ ID NOS: 16 or 18
  • VL FR4 SEQ ID NO: 17
  • the pharmaceutical formulation comprises an antibody that comprises a VH FR2 (SEQ ID NO:20), a VH FR3 (SEQ ID NOS:21 or 23), a VH FR4 (SEQ ID NO:22), a VL FRl (SEQ ID NO: 14), a VL FR2 (SEQ ID NO: 15), a VL FR3 (SEQ ID NOS: 16 or 18), and a VL FR4 (SEQ ID NO: 17).
  • the pharmaceutical formulation comprises an antibody that comprises any combination thereof of the VH FRs (SEQ ID NOS: 19-24) and the VL FRs (SEQ ID NOS: 14-18) listed in Tables 3-4.
  • the pharmaceutical formulation comprises an antibody that comprises a VH region or VH domain. In other embodiments, the pharmaceutical formulation comprises an antibody that comprises a VL region or VL domain. In certain embodiments, the antibodies of pharmaceutical formulations provided herein have a combination of (i) a VH domain or VH region; and/or (ii) a VL domain or VL region. In yet other embodiments, the antibodies of pharmaceutical formulations provided herein have a combination of (i) a VH domain or VH region; and/or (ii) a VL domain or VL region selected from the group consisting of SEQ ID NOS: 8-13 as set forth in Tables 5-6.
  • the pharmaceutical formulation comprises an antibody having a combination of (i) a VH domain or VH region; and/or (ii) a VL domain or VL region of any one of antibodies PDlAB-1, PDlAB-2, PDlAB-3, PD1AB-4, PD1AB-5, or PD1AB-6, as set forth in Tables 5-6.
  • the pharmaceutical formulation comprises an antibody that comprises a VH region comprising: (1) a VH CDR1 having an amino acid sequence of SEQ ID NO:4; (2) a VH CDR2 having an amino acid sequence of SEQ ID NO:5; and (3) a VH CDR3 having an amino acid sequence of SEQ ID NO: 6; and a VL region selected from the group consisting of SEQ ID NOS:8-10 as set forth in Table 5.
  • the VL region has an amino acid sequence of SEQ ID NO: 8.
  • the VL region has an amino acid sequence of SEQ ID NO:9.
  • the VL region has an amino acid sequence of SEQ ID NO: 10.
  • the pharmaceutical formulation comprises an antibody that comprises a VH region selected from the group consisting of SEQ ID NOS: 11-13 as set forth in Table 6; and a VL region comprising: (1) a VL CDRl having an amino acid sequence selected from the group consisting of SEQ ID NOS: 1 and 7; (2) a VL CDR2 having an amino acid sequence of SEQ ID NO:2; and (3) a VL CDR3 having an amino acid sequence of SEQ ID NO:3.
  • the pharmaceutical formulation comprises an antibody that comprises a VH region selected from the group consisting of SEQ ID NOS: 11-13 as set forth in Table 6; and a VL region comprising: (1) a VL CDRl having an amino acid sequence of SEQ ID NO: 1; (2) a VL CDR2 having an amino acid sequence of SEQ ID NO:2; and (3) a VL CDR3 having an amino acid sequence of SEQ ID NO:3.
  • the pharmaceutical formulation comprises an antibody that comprises a VH region selected from the group consisting of SEQ ID NOS: 11-13 as set forth in Table 6; and a VL region comprising: (1) a VL CDRl having an amino acid sequence of SEQ ID NO:7; (2) a VL CDR2 having an amino acid sequence of SEQ ID NO:2; and (3) a VL CDR3 having an amino acid sequence of SEQ ID NO:3.
  • the pharmaceutical formulation comprises an antibody that comprises a VH region having an amino acid sequence of SEQ ID NO: 11.
  • the pharmaceutical formulation comprises an antibody that comprises a VH region having an amino acid sequence of SEQ ID NO: 12. In some embodiments, the pharmaceutical formulation comprises an antibody that comprises a VH region having an amino acid sequence of SEQ ID NO: 13.
  • a pharmaceutical formulation comprising an antibody encoded by an isolated nucleic acid molecule, e.g., an immunoglobulin heavy chain, light chain, VH region, VL region, VH CDRl, VH CDR2, VH CDR3, VL CDRl, VL CDR2, and/or VL CDR3 of anti-PD-1 antibodies that bind to a PD-1 polypeptide, a PD-1 polypeptide fragment, a PD-1 peptide, or a PD-1 epitope.
  • an antibody encoded by an isolated nucleic acid molecule e.g., an immunoglobulin heavy chain, light chain, VH region, VL region, VH CDRl, VH CDR2, VH CDR3, VL CDRl, VL CDR2, and/or VL CDR3 of anti-PD-1 antibodies that bind to a PD-1 polypeptide, a PD-1 polypeptide fragment, a PD-1 peptide, or a PD-1 epitope.
  • nucleic acid sequences for the VL region and the VH region of any one of antibodies PDlAB-1, PDlAB-2, PDlAB-3, PDlAB-4, PDlAB-5, and PDlAB-6 are shown in Tables 7-8.
  • the pharmaceutical formulation comprises an antibody having a VH and a VL amino acid sequence of PDlAB-1. In some embodiments, the pharmaceutical formulation comprises an antibody having a VH amino acid sequence of SEQ ID NO: 11, and a VL amino acid sequence of SEQ ID NO:8. [0295] In other embodiments, the pharmaceutical formulation comprises an antibody having a VH and a VL amino acid sequence of PD1AB-2. In some embodiments, the pharmaceutical formulation comprises an antibody having a VH amino acid sequence of SEQ ID NO: 11, and a VL amino acid sequence of SEQ ID NO:9.
  • the pharmaceutical formulation comprises an antibody having a VH and a VL amino acid sequence of PD1AB-3. In some embodiments, the pharmaceutical formulation comprises an antibody having a VH amino acid sequence of SEQ ID NO: 12, and a VL amino acid sequence of SEQ ID NO: 10.
  • the pharmaceutical formulation comprises an antibody having a VH and a VL amino acid sequence of PD1AB-4. In some embodiments, the pharmaceutical formulation comprises an antibody having a VH amino acid sequence of SEQ ID NO: 12, and a VL amino acid sequence of SEQ ID NO:9.
  • the pharmaceutical formulation comprises an antibody having a VH and a VL amino acid sequence of PD1AB-5. In some embodiments, the pharmaceutical formulation comprises an antibody having a VH amino acid sequence of SEQ ID NO: 13, and a VL amino acid sequence of SEQ ID NO:9.
  • the pharmaceutical formulation comprises an antibody having a VH and a VL amino acid sequence of PD1AB-6. In some embodiments, the pharmaceutical formulation comprises an antibody having a VH amino acid sequence of SEQ ID NO: 13, and a VL amino acid sequence of SEQ ID NO:8.
  • the pharmaceutical formulation comprises an antibody having a VH CDRl, VH CDR2 and VH CDR3 of the VH region of PDlAB-1. In other embodiments, the pharmaceutical formulation comprises an antibody having a VL CDRl, VL CDR2 and VL CDR3 of the VL region of PDlAB-1. In other embodiments, the pharmaceutical formulation comprises an antibody having a VH CDRl, VH CDR2 and VH CDR3 of the VH region of PD1AB-2, and a VL CDRl, VL CDR2 and VL CDR3 of the VL region of PDlAB-1.
  • the pharmaceutical formulation comprises an antibody having a VH CDRl, VH CDR2 and VH CDR3 of the VH region having amino acid sequence of SEQ ID NO: 11. In other embodiments, the pharmaceutical formulation comprises and antibody having a VL CDRl, VL CDR2 and VL CDR3 of the VL region having amino acid sequence of SEQ ID NO: 8. In some embodiments, the pharmaceutical formulation comprises an antibody having a VH CDRl, VH CDR2 and VH CDR3 of the VH region having amino acid sequence of SEQ ID NO: 11, and a VL CDR1, VL CDR2 and VL CDR3 of the VL region having amino acid sequence of SEQ ID NO:8.
  • the pharmaceutical formulation comprises an antibody having a VH CDR1, VH CDR2 and VH CDR3 of the VH region of PD1AB-2. In other embodiments, the pharmaceutical formulation comprises an antibody having a VL CDR1, VL CDR2 and VL CDR3 of the VL region of PD1AB-2. In other embodiments, the pharmaceutical formulation comprises an antibody having a VH CDR1, VH CDR2 and VH CDR3 of the VH region of PD1AB-2, and a VL CDR1, VL CDR2 and VL CDR3 of the VL region of PD1AB-2.
  • the pharmaceutical formulation comprises an antibody having a VH CDR1, VH CDR2 and VH CDR3 of the VH region having amino acid sequence of SEQ ID NO: 11. In other embodiments, the pharmaceutical formulation comprises and antibody having a VL CDR1, VL CDR2 and VL CDR3 of the VL region having amino acid sequence of SEQ ID NO:9. In some embodiments, the pharmaceutical formulation comprises an antibody having a VH CDR1, VH CDR2 and VH CDR3 of the VH region having amino acid sequence of SEQ ID NO: 11, and a VL CDR1, VL CDR2 and VL CDR3 of the VL region having amino acid sequence of SEQ ID NO:9.
  • the pharmaceutical formulation comprises an antibody having a VH CDR1, VH CDR2 and VH CDR3 of the VH region of PD1AB-3. In other embodiments, the pharmaceutical formulation comprises an antibody having a VL CDR1, VL CDR2 and VL CDR3 of the VL region of PD1AB-3. In other embodiments, the pharmaceutical formulation comprises an antibody having a VH CDR1, VH CDR2 and VH CDR3 of the VH region of PD1AB-3, and a VL CDR1, VL CDR2 and VL CDR3 of the VL region of PD1AB-3.
  • the pharmaceutical formulation comprises an antibody having a VH CDR1, VH CDR2 and VH CDR3 of the VH region having amino acid sequence of SEQ ID NO: 12. In other embodiments, the pharmaceutical formulation comprises and antibody having a VL CDR1, VL CDR2 and VL CDR3 of the VL region having amino acid sequence of SEQ ID NO: 10. In some embodiments, the pharmaceutical formulation comprises an antibody having a VH CDR1, VH CDR2 and VH CDR3 of the VH region having amino acid sequence of SEQ ID NO: 12, and a VL CDR1, VL CDR2 and VL CDR3 of the VL region having amino acid sequence of SEQ ID NO: 10.
  • the pharmaceutical formulation comprises an antibody having a VH CDRl, VH CDR2 and VH CDR3 of the VH region of PD1AB-4. In other embodiments, the pharmaceutical formulation comprises an antibody having a VL CDRl, VL CDR2 and VL CDR3 of the VL region of PD1AB-4. In other embodiments, the pharmaceutical formulation comprises an antibody having a VH CDRl, VH CDR2 and VH CDR3 of the VH region of PD1AB-4, and a VL CDRl, VL CDR2 and VL CDR3 of the VL region of PD1AB-4.
  • the pharmaceutical formulation comprises an antibody having a VH CDRl, VH CDR2 and VH CDR3 of the VH region having amino acid sequence of SEQ ID NO: 12. In other embodiments, the pharmaceutical formulation comprises and antibody having a VL CDRl, VL CDR2 and VL CDR3 of the VL region having amino acid sequence of SEQ ID NO:9. In some embodiments, the pharmaceutical formulation comprises an antibody having a VH CDRl, VH CDR2 and VH CDR3 of the VH region having amino acid sequence of SEQ ID NO: 12, and a VL CDRl, VL CDR2 and VL CDR3 of the VL region having amino acid sequence of SEQ ID NO:9.
  • the pharmaceutical formulation comprises an antibody having a VH CDRl, VH CDR2 and VH CDR3 of the VH region of PD1AB-5. In other embodiments, the pharmaceutical formulation comprises an antibody having a VL CDRl, VL CDR2 and VL CDR3 of the VL region of PD1AB-5. In other embodiments, the pharmaceutical formulation comprises an antibody having a VH CDRl, VH CDR2 and VH CDR3 of the VH region of PD1AB-5, and a VL CDRl, VL CDR2 and VL CDR3 of the VL region of PD1AB-5.
  • the pharmaceutical formulation comprises an antibody having a VH CDRl, VH CDR2 and VH CDR3 of the VH region having amino acid sequence of SEQ ID NO: 13.
  • the pharmaceutical formulation comprises and antibody having a VL CDRl, VL CDR2 and VL CDR3 of the VL region having amino acid sequence of SEQ ID NO:9.
  • the pharmaceutical formulation comprises an antibody having a VH CDRl, VH CDR2 and VH CDR3 of the VH region having amino acid sequence of SEQ ID NO: 13, and a VL CDRl, VL CDR2 and VL CDR3 of the VL region having amino acid sequence of SEQ ID NO:9.
  • the pharmaceutical formulation comprises an antibody having a VH CDRl, VH CDR2 and VH CDR3 of the VH region of PD1AB-6. In other embodiments, the pharmaceutical formulation comprises an antibody having a VL CDRl, VL CDR2 and VL CDR3 of the VL region of PD1AB-6. In other embodiments, the pharmaceutical formulation comprises an antibody having a VH CDR1, VH CDR2 and VH CDR3 of the VH region of PD1AB-6, and a VL CDR1, VL CDR2 and VL CDR3 of the VL region of PD1AB-6.
  • the pharmaceutical formulation comprises an antibody having a VH CDR1, VH CDR2 and VH CDR3 of the VH region having amino acid sequence of SEQ ID NO: 13. In other embodiments, the pharmaceutical formulation comprises and antibody having a VL CDR1, VL CDR2 and VL CDR3 of the VL region having amino acid sequence of SEQ ID NO: 8. In some embodiments, the pharmaceutical formulation comprises an antibody having a VH CDR1, VH CDR2 and VH CDR3 of the VH region having amino acid sequence of SEQ ID NO: 13, and a VL CDR1, VL CDR2 and VL CDR3 of the VL region having amino acid sequence of SEQ ID NO:8.
  • the pharmaceutical formulation comprises an antibody or antigen-binding fragment thereof described herein, which specifically binds to a PD-1 polypeptide (e.g., an ECD of PD-1, for example human PD-1), and comprises a light chain and a heavy chain, wherein the light chain comprises a constant region having an amino acid sequence of:
  • a PD-1 polypeptide e.g., an ECD of PD-1, for example human PD-1
  • the light chain comprises a constant region having an amino acid sequence of:
  • the pharmaceutical formulation comprises an antibody or antigen-binding fragment thereof described herein, which specifically binds to a PD-1 polypeptide (e.g., an ECD of PD-1, for example human PD-1), and comprises a light chain and a heavy chain, wherein the heavy chain comprises a human IgGl Fc region having an amino acid sequence of:
  • a PD-1 polypeptide e.g., an ECD of PD-1, for example human PD-1
  • the heavy chain comprises a human IgGl Fc region having an amino acid sequence of:
  • the pharmaceutical formulation comprises an antibody or antigen-binding fragment thereof described herein, which specifically binds to a PD-1 polypeptide (e.g., an ECD of PD-1, for example human PD-1), and comprises a light chain and a heavy chain, wherein the heavy chain does not comprise a human IgGl Fc region having an amino acid sequence of SEQ IDNO:36.
  • a PD-1 polypeptide e.g., an ECD of PD-1, for example human PD-1
  • the heavy chain does not comprise a human IgGl Fc region having an amino acid sequence of SEQ IDNO:36.
  • the pharmaceutical formulation comprises an antibody or antigen-binding fragment thereof described herein, which specifically binds to a PD-1 polypeptide (e.g., an ECD of PD-1, for example human PD-1), and comprises a light chain and a heavy chain, wherein the heavy chain comprises a human IgGl-K322A Fc region having an amino acid sequence of:
  • a PD-1 polypeptide e.g., an ECD of PD-1, for example human PD-1
  • the heavy chain comprises a human IgGl-K322A Fc region having an amino acid sequence of:
  • the pharmaceutical formulation comprises an antibody or antigen-binding fragment thereof described herein, which specifically binds to a PD-1 polypeptide (e.g., an ECD of PD-1, for example human PD-1), and comprises a light chain and a heavy chain, wherein the heavy chain comprises a human IgG4 Fc region having an amino acid sequence of:
  • a PD-1 polypeptide e.g., an ECD of PD-1, for example human PD-1
  • the heavy chain comprises a human IgG4 Fc region having an amino acid sequence of:
  • the pharmaceutical formulation comprises an antibody or antigen-binding fragment thereof described herein, which specifically binds to a PD-1 polypeptide (e.g., an ECD of PD-1, for example human PD-1), and comprises a light chain and a heavy chain, wherein the heavy chain comprises a human IgG4P Fc region having an amino acid sequence of:
  • a PD-1 polypeptide e.g., an ECD of PD-1, for example human PD-1
  • the heavy chain comprises a human IgG4P Fc region having an amino acid sequence of:
  • the pharmaceutical formulation comprises an antibody or antigen-binding fragment thereof described herein, which specifically binds to a PD-1 polypeptide (e.g., an ECD of PD-1, for example human PD-1), and comprises a light chain and a heavy chain, wherein the heavy chain comprises a human IgG4PE Fc region having an amino acid sequence of:
  • a PD-1 polypeptide e.g., an ECD of PD-1, for example human PD-1
  • the heavy chain comprises a human IgG4PE Fc region having an amino acid sequence of:
  • the pharmaceutical formulation comprises an antibody or antigen-binding fragment thereof described herein, which specifically binds to a PD-1 polypeptide (e.g., an ECD of PD-1, for example human PD-1), and comprises a light chain and a heavy chain, wherein the heavy chain does not comprise a human IgG4PE Fc region having an amino acid sequence of SEQ ID NO:40.
  • a PD-1 polypeptide e.g., an ECD of PD-1, for example human PD-1
  • the heavy chain does not comprise a human IgG4PE Fc region having an amino acid sequence of SEQ ID NO:40.
  • the pharmaceutical formulation comprises an antibody or antigen-binding fragment thereof described herein, which specifically binds to a PD-1 polypeptide (e.g., an ECD of PD-1, for example human PD-1), and comprises a light chain and a heavy chain, wherein the light chain comprises a constant region having an amino acid sequence of SEQ ID NO:41 ; and the heavy chain comprises an Fc region having an amino acid sequence selected from the group consisting of SEQ ID NOS:36-40.
  • a PD-1 polypeptide e.g., an ECD of PD-1, for example human PD-1
  • the heavy chain comprises an Fc region having an amino acid sequence selected from the group consisting of SEQ ID NOS:36-40.
  • the pharmaceutical formulation comprises an antibody provided herein, which specifically binds to a PD-1 polypeptide (e.g., an ECD of PD-1, for example human PD-1), and comprises a light chain and a heavy chain, wherein the light chain comprises an amino acid sequence as follows: DI ⁇ /MTQSPDSLAVSLGERATINCKSGQSVLYSSNQKNFLAWYQQKPGQPPKLLIYWASTRESGV PDRFSGSGSGTDFTLTISSLQAEDVAVYYCHQYLYSWTFGQGTKLEIKRTVAAPSVFIFPPSDE QLKSGTASWCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYE KHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO:31, LC_PDlAB-6-IgGl).
  • a PD-1 polypeptide e.g., an ECD of PD-1, for example human PD-1
  • the pharmaceutical formulation comprises an antibody provided herein, which specifically binds to a PD-1 polypeptide (e.g., an ECD of PD-1, for example human PD-1), and comprises a light chain and a heavy chain, wherein the heavy chain comprises an amino acid sequence as follows:
  • a PD-1 polypeptide e.g., an ECD of PD-1, for example human PD-1
  • the heavy chain comprises an amino acid sequence as follows:
  • the pharmaceutical formulation comprises an antibody provided herein, which specifically binds to a PD-1 polypeptide (e.g., an ECD of PD-1, for example human PD-1), and comprises a light chain and a heavy chain, wherein the heavy chain comprises an amino acid sequence as follows:
  • a PD-1 polypeptide e.g., an ECD of PD-1, for example human PD-1
  • the heavy chain comprises an amino acid sequence as follows:
  • the pharmaceutical formulation comprises an antibody provided herein, which specifically binds to a PD-1 polypeptide (e.g., an ECD of PD-1, for example human PD-1), and comprises a light chain and a heavy chain, wherein the heavy chain comprises an amino acid sequence as follows:
  • a PD-1 polypeptide e.g., an ECD of PD-1, for example human PD-1
  • the heavy chain comprises an amino acid sequence as follows:
  • the pharmaceutical formulation comprises an antibody provided herein, which specifically binds to a PD-1 polypeptide (e.g., an ECD of PD-1, for example human PD-1), and comprises a light chain and a heavy chain, wherein the heavy chain comprises an amino acid sequence as follows:
  • a PD-1 polypeptide e.g., an ECD of PD-1, for example human PD-1
  • the heavy chain comprises an amino acid sequence as follows:
  • the pharmaceutical formulation comprises an antibody provided herein, which specifically binds to a PD-1 polypeptide (e.g., an ECD of PD-1, for example human PD-1), and comprises a light chain and a heavy chain, wherein (i) the light chain comprises an amino acid sequence of SEQ ID NO:31; and (ii) the heavy chain comprises an amino acid sequence of SEQ ID NO:32.
  • a PD-1 polypeptide e.g., an ECD of PD-1, for example human PD-1
  • the light chain comprises an amino acid sequence of SEQ ID NO:31
  • the heavy chain comprises an amino acid sequence of SEQ ID NO:32.
  • the pharmaceutical formulation comprises an antibody provided herein, which specifically binds to a PD-1 polypeptide (e.g., an ECD of PD-1, for example human PD-1), and comprises a light chain and a heavy chain, wherein (i) the light chain comprises an amino acid sequence of SEQ ID NO:31 ; and (ii) the heavy chain comprises an amino acid sequence of SEQ ID NO:33.
  • a PD-1 polypeptide e.g., an ECD of PD-1, for example human PD-1
  • the light chain comprises an amino acid sequence of SEQ ID NO:31
  • the heavy chain comprises an amino acid sequence of SEQ ID NO:33.
  • the pharmaceutical formulation comprises an antibody provided herein, which specifically binds to a PD-1 polypeptide (e.g., an ECD of PD-1, for example human PD-1), and comprises a light chain and a heavy chain, wherein (i) the light chain comprises an amino acid sequence of SEQ ID NO:31 ; and (ii) the heavy chain comprises an amino acid sequence of SEQ ID NO:34.
  • a PD-1 polypeptide e.g., an ECD of PD-1, for example human PD-1
  • the light chain comprises an amino acid sequence of SEQ ID NO:31
  • the heavy chain comprises an amino acid sequence of SEQ ID NO:34.
  • the pharmaceutical formulation comprises an antibody provided herein, which specifically binds to a PD-1 polypeptide (e.g., an ECD of PD-1, for example human PD-1), and comprises a light chain and a heavy chain, wherein (i) the light chain comprises an amino acid sequence of SEQ ID NO:31 ; and (ii) the heavy chain comprises an amino acid sequence of SEQ ID NO:35.
  • a PD-1 polypeptide e.g., an ECD of PD-1, for example human PD-1
  • the light chain comprises an amino acid sequence of SEQ ID NO:31
  • the heavy chain comprises an amino acid sequence of SEQ ID NO:35.
  • the pharmaceutical formulations comprise antibodies that compete with one of the exemplified antibodies or functional fragments for binding to PD-1. Such antibodies may also bind to the same epitope as one of the herein exemplified antibodies, or an overlapping epitope. Antibodies and fragments that compete with or bind to the same epitope as the exemplified antibodies are expected to show similar functional properties.
  • the exemplified antigen-binding proteins and fragments include those with the VH and VL regions, and CDRs provided herein, including those in Tables 1-6.
  • pharmaceutical formulations provided herein comprise antibodies that include those that compete with an antibody comprising: (a) 1, 2, 3, 4, 5, or all 6 of the CDRs listed for an antibody listed in Tables 1-2; (b) a VH and a VL selected from the VH and the VL regions listed for an antibody listed in Tables 5-6; or (c) two light chains and two heavy chains comprising a VH and a VL as specified for an antibody listed in Tables 5-6.
  • pharmaceutically comprising: (a) 1, 2, 3, 4, 5, or all 6 of the CDRs listed for an antibody listed in Tables 1-2; (b) a VH and a VL selected from the VH and the VL regions listed for an antibody listed in Tables 5-6; or (c) two light chains and two heavy chains comprising a VH and a VL as specified for an antibody listed in Tables 5-6.
  • formulations provided herein comprise an antibody that is PDlAB-1. In some embodiments, pharmaceutical formulations provided herein comprise an antibody that is PD1AB-2. In some embodiments, pharmaceutical formulations provided herein comprise an antibody that is PD1AB-3. In some embodiments, pharmaceutical formulations provided herein comprise an antibody that is PD1AB-4. In some embodiments, pharmaceutical formulations provided herein comprise an antibody that is PD1AB-5. In some embodiments, pharmaceutical formulations provided herein comprise an antibody that is PD1AB-6. [0323] In another aspect, pharmaceutical formulations provided herein comprise antibodies or antigen-binding fragments thereof that bind to a region, including an epitope, of human PD-1 or cynomolgus PD-1.
  • pharmaceutical formulations provided herein comprise an antibody that binds to a region of human PD-1 (SEQ ID NO:42) comprising amino acid residues 33 to 109 of human PD-1.
  • pharmaceutical formulations provided herein comprise an antibody that binds to a specific epitope of human PD- 1.
  • pharmaceutical formulations provided herein comprise an antibody or antigen-binding fragment thereof, that when bound to PD-1, binds to at least one of residues 100-109 (SEQ ID NO:43) within an amino acid sequence of SEQ ID NO:42.
  • pharmaceutical formulations provided herein comprise an antibody or antigen- binding fragment thereof, that when bound to PD-1, binds to at least one of residues 100-105 (SEQ ID NO:44) within an amino acid sequence of SEQ ID NO:42.
  • pharmaceutical formulations provided herein comprise an antibody or antigen-binding fragment thereof, that when bound to PD-1, binds to at least one residue selected from the group consisting of N33, T51, S57, L100, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • pharmaceutical formulations provided herein comprise an antibody or antigen-binding fragment thereof, that when bound to PD-1, binds to at least one residue selected from the group consisting of L100, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • pharmaceutical formulations provided herein comprise an antibody or antigen-binding fragment thereof, that when bound to PD-1, binds to two or more residues selected from the group consisting of N33, T51, S57, L100, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • pharmaceutical formulations provided herein comprise an antibody or antigen-binding fragment thereof, that when bound to PD-1, binds to three or more residues selected from the group consisting of N33, T51, S57, L100, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • pharmaceutical formulations provided herein comprise an antibody or antigen-binding fragment thereof, that when bound to PD-1, binds to four or more residues selected from the group consisting of N33, T51, S57, L100, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • pharmaceutical formulations provided herein comprise an antibody or antigen-binding fragment thereof, that when bound to PD-1, binds to five or more residues selected from the group consisting of N33, T51, S57, L100, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • pharmaceutical formulations provided herein comprise an antibody or antigen-binding fragment thereof, that when bound to PD-1, binds to six or more residues selected from the group consisting of N33, T51, S57, L100, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • pharmaceutical formulations provided herein comprise an antibody or antigen-binding fragment thereof, that when bound to PD-1, binds to seven or more residues selected from the group consisting of N33, T51, S57, L100, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • pharmaceutical formulations provided herein comprise an antibody or antigen-binding fragment thereof, that when bound to PD-1, binds to eight or more residues selected from the group consisting of N33, T51, S57, L100, N102, G103, R104, D105, HI 07, and SI 09 within an amino acid sequence of SEQ ID NO:42.
  • pharmaceutical formulations provided herein comprise an antibody or antigen-binding fragment thereof, that when bound to PD-1, binds to nine or more residues selected from the group consisting of N33, T51, S57, L100, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • pharmaceutical formulations provided herein comprise an antibody or antigen-binding fragment thereof, that when bound to PD-1, binds to all ten residues from the group consisting of N33, T51, S57, L100, N102, G103, R104, D105, H107, and S109 within an amino acid sequence of SEQ ID NO:42.
  • pharmaceutical formulations provided herein comprise an antibody or antigen-binding fragment thereof, that when bound to PD-1, binds to N33 within an amino acid sequence of SEQ ID NO:42.
  • pharmaceutical formulations provided herein comprise an antibody or antigen-binding fragment thereof, that when bound to PD-1, binds to T51 within an amino acid sequence of SEQ ID NO:42.
  • pharmaceutical formulations provided herein comprise an antibody or antigen- binding fragment thereof, that when bound to PD-1, binds to S57 within an amino acid sequence of SEQ ID NO:42.
  • pharmaceutical formulations provided herein comprise an antibody or antigen-binding fragment thereof, that when bound to PD-1, binds to LI 00 within an amino acid sequence of SEQ ID NO:42.
  • pharmaceutical formulations provided herein comprise an antibody or antigen-binding fragment thereof, that when bound to PD-1, binds to N102 within an amino acid sequence of SEQ ID NO:42.
  • pharmaceutical formulations provided herein comprise an antibody or antigen- binding fragment thereof, that when bound to PD-1, binds to G103 within an amino acid sequence of SEQ ID NO:42.
  • pharmaceutical formulations provided herein comprise an antibody or antigen-binding fragment thereof, that when bound to PD-1, binds to R104 within an amino acid sequence of SEQ ID NO:42.
  • pharmaceutical formulations provided herein comprise an antibody or antigen-binding fragment thereof, that when bound to PD-1, binds to G103 and R104 within an amino acid sequence of SEQ ID NO:42.
  • pharmaceutical formulations provided herein comprise an antibody or antigen-binding fragment thereof, that when bound to PD-1, binds to D105 within an amino acid sequence of SEQ ID NO:42.
  • pharmaceutical formulations provided herein comprise an antibody or antigen-binding fragment thereof, that when bound to PD-1, binds to H107 within an amino acid sequence of SEQ ID NO:42.
  • pharmaceutical formulations provided herein comprise an antibody or antigen- binding fragment thereof, that when bound to PD-1, binds to S I 09 within an amino acid sequence of SEQ ID NO:42. Any combination of two, three, four, five, six, seven, eight, nine, ten or more of the above-referenced amino acid PD-1 binding sites is also contemplated.
  • compositions comprising antibodies that specifically bind to PD-1 and can modulate PD-1 activity and/or expression (e.g., activate PD-1 signaling and/or inhibit PD-1 expression).
  • pharmaceutical formulations comprising a PD-1 agonist that is an antibody provided herein that specifically binds to an ECD of human PD-1, and activates (e.g., partially activates) at least one PD-1 activity (e.g., inhibiting cytokine production).
  • pharmaceutical formulations comprising a PD-1 agonist that is an antibody provided herein that specifically binds to an ECD of human PD-1, and downregulates PD-1 expression.
  • provided herein are pharmaceutical formulations comprising antibodies that specifically bind to PD-1 and that (a) attenuate T cell activity, e.g., as determined by inhibition of cytokine production; and/or (b) downregulate PD-1 expression in a cell.
  • pharmaceutical formulations comprising antibodies that specifically bind to PD-1 and that (a) attenuate T cell activity, e.g., as determined by inhibition of cytokine production; (b) downregulate PD-1 expression in a cell; and/or (c) do not inhibit PD-Ll and/or PD-L2 binding to PD-1.
  • provided herein are pharmaceutical formulations comprising antibodies that specifically bind to PD-1 and that (a) attenuate T cell activity, e.g., as determined by inhibition of cytokine production; (b) downregulate PD-1 expression in a cell; and/or (c) do not inhibit PD-Ll and/or PD-L2 binding to PD-1.
  • compositions comprising antibodies that specifically bind to PD-1, an ECD of human PD-1, or an epitope of an ECD of human PD-1 thereof.
  • pharmaceutical formulations comprising antibodies that specifically bind to an epitope of an ECD of human PD-1 that is distinct from the PD-Ll binding site.
  • pharmaceutical formulations comprising antibodies that specifically bind to an epitope of an ECD of human PD-1 that is distinct from the PD-L2 binding site.
  • pharmaceutical formulations comprising antibodies that specifically bind to an epitope of an ECD of human PD-1 that is distinct from both the PD-Ll and PD-L2 binding sites.
  • provided herein are pharmaceutical formulations comprising antibodies that do not inhibit binding of PD-Ll to PD-1. In other embodiments, provided herein are pharmaceutical formulations comprising antibodies that do not inhibit binding of PD-L2 to PD-1. In specific embodiments, provided herein are
  • compositions comprising antibodies that do not inhibit binding of PD-Ll to PD-1 or binding of PD-L2 to PD-1.
  • PD-1 activity can relate to any activity of PD-1 such as those known or described in the art.
  • PD-1 activity and PD-1 signaling are used interchangeably herein.
  • PD- 1 activity is induced by PD-1 ligand (e.g., PD-Ll) binding to PD-1.
  • Expression levels of PD-1 can be assessed by methods described herein or known to one of skill in the art (e.g., Western blotting, ELISA, immunohistochemistry, or flow cytometry).
  • provided herein are pharmaceutical formulations comprising antibodies that specifically bind to PD-1 and decrease PD-1 expression.
  • provided herein are pharmaceutical formulations comprising antibodies that specifically bind to PD-1 and attenuate T cell activity.
  • compositions comprising antibodies that specifically bind to PD-1 and inhibit cytokine production.
  • pharmaceutical formulations comprising antibodies that specifically bind to PD-1 and activate (e.g., partially activate) PD-1 signaling.
  • pharmaceutical formulations provided herein comprise antibodies that specifically bind to PD-1, an ECD of human PD-1, or an epitope of an ECD of human PD-1 thereof.
  • pharmaceutical formulations provided herein comprise antibodies that specifically bind to an epitope of an ECD of human PD-1 that is distinct from the PD-L1 binding site.
  • pharmaceutical formulations provided herein comprise antibodies that specifically bind to an epitope of an ECD of human PD-1 that is distinct from the PD-L2 binding site. In certain embodiments, pharmaceutical formulations provided herein comprise antibodies that specifically bind to an epitope of an ECD of human PD-1 that is distinct from both the PD-L1 and PD-L2 binding sites. In certain embodiments, pharmaceutical formulations provided herein comprise antibodies that do not inhibit binding of PD-L1 to PD-1. In other embodiments, pharmaceutical formulations provided herein comprise antibodies that do not inhibit binding of PD-L2 to PD-1. In specific embodiments, pharmaceutical formulations provided herein comprise antibodies that do not inhibit binding of PD-L1 to PD-1 or binding of PD-L2 to PD-1.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein attenuates (e.g., partially attenuates) T cell activity. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein attenuates T cell activity by at least about 10%. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein attenuates T cell activity by at least about 15%. In some
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein attenuates T cell activity by at least about 20%. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein attenuates T cell activity by at least about 25%. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein attenuates T cell activity by at least about 30%. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein attenuates T cell activity by at least about 35%. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein attenuates T cell activity by at least about 40%. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein attenuates T cell activity by at least about 45%.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein attenuates T cell activity by at least about 50%. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein attenuates T cell activity by at least about 55%. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein attenuates T cell activity by at least about 60%. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein attenuates T cell activity by at least about 65%. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein attenuates T cell activity by at least about 70%.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein attenuates T cell activity by at least about 75%. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein attenuates T cell activity by at least about 80%. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein attenuates T cell activity by at least about 85%. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein attenuates T cell activity by at least about 90%. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein attenuates T cell activity by at least about 95%.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein attenuates T cell activity by at least about 98%. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein attenuates T cell activity by at least about 99%. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein attenuates T cell activity by at least about 100%. In certain embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein can attenuate (e.g., partially attenuate) T cell activity by at least about 25% to about 65%. In specific embodiments, the T cell activity attenuation is assessed by methods described herein.
  • the T cell activity attenuation is assessed by methods known to one of skill in the art. In certain embodiments, the T cell activity attenuation is relative to T cell activity in the presence of stimulation without any anti-PD-1 antibody. In certain embodiments, the T cell activity attenuation is relative to T cell activity in the presence of stimulation with an unrelated antibody (e.g., an antibody that does not specifically bind to PD-1).
  • an unrelated antibody e.g., an antibody that does not specifically bind to PD-1).
  • a non-limiting example of T cell activity is secretion of a cytokine. In some embodiments, the cytokine is selected from the group consisting of IL-2, IL-17, IFN- ⁇ , or any combination thereof.
  • the cytokine is selected from the group consisting of IL-1, IL-2, IL-6, IL-12, IL-17, IL-22, IL-23, GM-CSF, IFN- ⁇ , and TNF-a.
  • the cytokine is IL-1.
  • the cytokine is IL-2.
  • the cytokine is IL-6.
  • the cytokine is IL-12.
  • the cytokine is IL-17.
  • the cytokine is IL-22.
  • the cytokine is IL-23.
  • the cytokine is GM-CSF.
  • the cytokine is IFN- ⁇ . In yet other embodiments, the cytokine is TNF-a. In certain embodiments, the cytokine is IL-2 and IL-17. In some embodiments, the cytokine is IL-2 and IFN- ⁇ . In yet other embodiments, the cytokine is IL-17 and IFN- ⁇ . In still other
  • the cytokine is IL-2, IL-17, and IFN- ⁇ .
  • antibodies of a pharmaceutical formulation provided herein e.g. , any one of antibodies PDlAB-1, PDlAB-2, PDlAB-3, PDlAB-4, PDlAB-5, or PDlAB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD lAB-2, PDlAB-3, PDlAB-4, PDlAB-5, or PDlAB-6) specifically bind to PD-1 and inhibit IL-2 secretion (e.g. , from a cell, for example, T cells).
  • IL-2 secretion e.g. , from a cell, for example, T cells.
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 5%. In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 10%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 15%). In other embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 20%>. In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 25%>.
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 30%>. In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 35%). In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 40%>. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 45%>.
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 50%>. In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 55%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 60%. In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 65%. In one embodiment, an antibody of a
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 70%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 75%). In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 80%>. In other
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 85%>. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 90%. In one embodiment, an antibody of a pharmaceutical
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 95%).
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 98%>.
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-2 secretion by at least about 99%.
  • antibodies of a pharmaceutical formulation provided herein specifically bind to PD-1 and inhibit IL-2 secretion by at least about 25% or 35%, optionally to about 75%.
  • the inhibition of IL-2 secretion is assessed by methods described herein. In other embodiments, the inhibition of IL-2 secretion is assessed by methods known to one of skill in the art (e.g., MesoScaleTM
  • the IL-2 secretion is inhibited relative to IL-2 secretion in the absence of anti-PD-1 antibody. In other embodiments, the IL-2 secretion is inhibited relative to IL-2 secretion in the presence of an unrelated antibody (e.g., an antibody that does not specifically bind to PD-1).
  • an unrelated antibody e.g., an antibody that does not specifically bind to PD-1).
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein e.g., any one of antibodies PDlAB-1, PD1AB-2, PD 1AB-3, PD 1AB-4, PD1AB-5, or PD1AB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6) inhibits IL-2 secretion.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein e.g., any one of antibodies PDlAB-1, PD1AB-2, PD 1AB-3, PD 1AB-4, PD1AB-5, or PD1AB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6) inhibits
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-2 secretion with an ECso of at most about 50 nM. In other embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-2 secretion with an EC50 of at most about 40 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-2 secretion with an EC50 of at most about 30 nM. In some embodiments, an anti-PD-1 antibody of a
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-2 secretion with an EC50 of at most about 20 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-2 secretion with an EC50 of at most about 10 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-2 secretion with an EC50 of at most about 5 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-2 secretion with an EC50 of at most about 1 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-2 secretion with an EC50 of at most about 0.75 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-2 secretion with an EC50 of at most about 0.5 nM. In other embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-2 secretion with an EC50 of at most about 0.1 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL- 2 secretion with an EC50 of at most about 0.05 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-2 secretion with an EC50 of at most about 0.01 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-2 secretion with an EC50 of at most about 0.005 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-2 secretion with an EC50 of at most about 0.001 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-2 secretion with an EC50 of at least about 50 nM. In other embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-2 secretion with an EC50 of at least about 40 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-2 secretion with an EC50 of at least about 30 nM. In another embodiment, an anti-PD- 1 antibody of a pharmaceutical formulation provided herein inhibits IL-2 secretion with an EC50 of at least about 20 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-2 secretion with an EC50 of at least about 10 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL- 2 secretion with an EC50 of at least about 5 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-2 secretion with an EC50 of at least about 1 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-2 secretion with an EC50 of at least about 0.75 nM. In other embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-2 secretion with an EC50 of at least about 0.5 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-2 secretion with an EC50 of at least about 0.1 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-2 secretion with an EC50 of at least about 0.05 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-2 secretion with an EC50 of at least about 0.01 nM. In another embodiment, an anti- PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-2 secretion with an EC50 of at least about 0.005 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-2 secretion with an EC50 of at least about 0.001 nM. In specific embodiments, the EC50 is assessed by methods described herein. In other embodiments, the EC50 is assessed by other methods known to one of skill in the art (e.g., MSD multiplex assay). In a specific embodiment, the EC50 is assessed by MSD multiplex assay.
  • antibodies of a pharmaceutical formulation provided herein e.g., any one of antibodies PDlAB-1, PDlAB-2, PDlAB-3, PDlAB-4, PDlAB-5, or PDlAB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD lAB-2, PDlAB-3, PDlAB-4, PDlAB-5, or PDlAB-6) specifically bind to PD-1 and inhibit IL-17 secretion (e.g., from a cell, for example, T cells).
  • IL-17 secretion e.g., from a cell, for example, T cells.
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 5%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 10%. In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 15%. In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 20%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 25%.
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 30%. In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 35%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 40%. In other embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 45%. In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 50%.
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 55%). In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 60%. In one
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 65%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 70%. In other embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 75%). In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 80%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 85%.
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 90%. In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 95%). In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 98%. In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-17 secretion by at least about 99%.
  • antibodies of a pharmaceutical formulation provided herein specifically bind to PD-1 and inhibit IL-17 secretion by at least about 25% or 35%, optionally to about 75%.
  • the inhibition of IL-17 secretion is assessed by methods described herein.
  • the inhibition of IL-17 secretion is assessed by methods known to one of skill in the art (e.g., MSD multiplex assay).
  • the IL-17 secretion is inhibited relative to IL-17 secretion in the absence of anti-PD-1 antibody.
  • the IL-17 secretion is inhibited relative to IL-17 secretion in the presence of an unrelated antibody (e.g., an antibody that does not specifically bind to PD-1).
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein (e.g., any one of antibodies PDlAB-1, PD1AB-2, PD 1AB-3, PD 1AB-4, PD1AB-5, or PD1AB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6) inhibits IL-17 secretion.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-17 secretion with an EC50 of at most about 50 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-17 secretion with an EC50 of at most about 40 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL- 17 secretion with an EC50 of at most about 30 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-17 secretion with an EC50 of at most about 20 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-17 secretion with an EC50 of at most about 10 nM. In one
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL- 17 secretion with an EC50 of at most about 5 nM. In other embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-17 secretion with an EC50 of at most about 1 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-17 secretion with an EC50 of at most about 0.75 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-17 secretion with an EC50 of at most about 0.5 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-17 secretion with an EC50 of at most about 0.1 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-17 secretion with an EC50 of at most about 0.05 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-17 secretion with an EC50 of at most about 0.01 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-17 secretion with an EC50 of at most about 0.005 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-17 secretion with an EC50 of at most about 0.001 nM. In other embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-17 secretion with an EC50 of at least about 50 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-17 secretion with an EC50 of at least about 40 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-17 secretion with an EC50 of at least about 30 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-17 secretion with an EC50 of at least about 20 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-17 secretion with an EC50 of at least about 10 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-17 secretion with an EC50 of at least about 5 nM. In other embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-17 secretion with an EC50 of at least about 1 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-17 secretion with an EC50 of at least about 0.75 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-17 secretion with an EC50 of at least about 0.5 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-17 secretion with an EC50 of at least about 0.1 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-17 secretion with an EC50 of at least about 0.05 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-17 secretion with an EC50 of at least about 0.01 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-17 secretion with an EC50 of at least about 0.005 nM. In other embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-17 secretion with an EC50 of at least about 0.001 nM. In specific embodiments, the EC50 is assessed by methods described herein. In other embodiments, the EC50 is assessed by other methods known to one of skill in the art (e.g., MSD multiplex assay). In a specific embodiment, the EC50 is assessed by MSD multiplex assay.
  • antibodies of a pharmaceutical formulation provided herein e.g., any one of antibodies PDlAB-1, PDlAB-2, PDlAB-3, PDlAB-4, PDlAB-5, or PDlAB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD 1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6) specifically bind to PD-1 and inhibit IFN- ⁇ secretion (e.g., from a cell, for example, T cells).
  • IFN- ⁇ secretion e.g., from a cell, for example, T cells.
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 5%. In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 10%. In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 15%). In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 20%>. In one
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 25%>. In other embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 30%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 35%o. In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 40%>. In one
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 45%>. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 50%>. In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 55%o. In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 60%>.
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 65%>. In other embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 70%>. In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 75%o. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 80%>.
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 85%. In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 90%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 95%. In other embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 98%.
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IFN- ⁇ secretion by at least about 99%. In specific embodiments, antibodies of a pharmaceutical formulation provided herein specifically bind to PD-1 and inhibit IFN- ⁇ secretion by at least about 25% or 35%, optionally to about 75%. In some embodiments, the inhibition of IFN- ⁇ secretion is assessed by methods described herein. In other embodiments, the inhibition of IFN- ⁇ secretion is assessed by methods known to one of skill in the art (e.g., MSD multiplex assay). In a specific embodiment, the IFN- ⁇ secretion is inhibited relative to IFN- ⁇ secretion in the absence of anti-PD-1 antibody. In other embodiments, the IFN- ⁇ secretion is inhibited relative to IFN- ⁇ secretion in the presence of an unrelated antibody (e.g., an antibody that does not specifically bind to PD-1).
  • an unrelated antibody e.g., an antibody that does not specifically bind
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein e.g., any one of antibodies PDlAB-1, PD1AB-2, PD 1AB-3, PD 1AB-4, PD1AB-5, or PD1AB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6) inhibits IFN- ⁇ secretion.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IFN- ⁇ secretion with an ECso of at most about 50 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IFN- ⁇ secretion with an ECso of at most about 40 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IFN- ⁇ secretion with an ECso of at most about 30 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IFN- ⁇ secretion with an ECso of at most about 20 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IFN- ⁇ secretion with an ECso of at most about 10 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IFN- ⁇ secretion with an EC50 of at most about 5 nM. In another embodiment, an anti-PD- 1 antibody of a pharmaceutical formulation provided herein inhibits IFN- ⁇ secretion with an EC50 of at most about 1 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IFN- ⁇ secretion with an EC50 of at most about 0.75 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IFN- ⁇ secretion with an EC50 of at most about 0.5 nM.
  • an anti- PD-1 antibody of a pharmaceutical formulation provided herein inhibits IFN- ⁇ secretion with an EC50 of at most about 0.1 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IFN- ⁇ secretion with an EC50 of at most about 0.05 nM. In other embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IFN- ⁇ secretion with an EC50 of at most about 0.01 nM. In another embodiment, an anti- PD-1 antibody of a pharmaceutical formulation provided herein inhibits IFN- ⁇ secretion with an EC50 of at most about 0.005 nM. In some embodiments, an anti-PD-1 antibody of a
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IFN- ⁇ secretion with an EC50 of at most about 0.001 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IFN- ⁇ secretion with an EC50 of at least about 50 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IFN- ⁇ secretion with an EC50 of at least about 40 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IFN- ⁇ secretion with an EC50 of at least about 30 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IFN- ⁇ secretion with an EC50 of at least about 20 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IFN- ⁇ secretion with an EC50 of at least about 10 nM. In other embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IFN- ⁇ secretion with an EC50 of at least about 5 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IFN- ⁇ secretion with an EC50 of at least about 1 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IFN- ⁇ secretion with an EC50 of at least about 0.75 nM. In some embodiments, an anti- PD-1 antibody of a pharmaceutical formulation provided herein inhibits IFN- ⁇ secretion with an EC50 of at least about 0.5 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IFN- ⁇ secretion with an EC50 of at least about 0.1 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IFN- ⁇ secretion with an EC50 of at least about 0.05 nM. In other embodiments, an anti- PD-1 antibody of a pharmaceutical formulation provided herein inhibits IFN- ⁇ secretion with an EC50 of at least about 0.01 nM. In some embodiments, an anti-PD-1 antibody of a
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IFN- ⁇ secretion with an EC50 of at least about 0.001 nM.
  • the EC50 is assessed by methods described herein. In other embodiments, the EC50 is assessed by other methods known to one of skill in the art (e.g., MSD multiplex assay). In a specific embodiment, the EC50 is assessed by MSD multiplex assay.
  • antibodies of a pharmaceutical formulation provided herein e.g., any one of antibodies PDlAB-1, PDlAB-2, PDlAB-3, PDlAB-4, PDlAB-5, or PDlAB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD lAB-2, PDlAB-3, PDlAB-4, PDlAB-5, or PDlAB-6) specifically bind to PD-1 and inhibit IL-1 secretion (e.g., from a cell, for example, T cells).
  • IL-1 secretion e.g., from a cell, for example, T cells.
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 5%. In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 10%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 15%). In other embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 20%>. In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 25%>.
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 30%>. In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 35%). In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 40%>. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 45%>. In other embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 50%.
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 55%). In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 60%. In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 65%>. In one embodiment, an antibody of a
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 70%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 75%). In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 80%>. In other
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 85%>. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 90%. In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 95%). In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 98%>. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-1 secretion by at least about 99%.
  • antibodies of a pharmaceutical formulation provided herein specifically bind to PD-1 and inhibit IL-1 secretion by at least about 25% or 35%, optionally to about 75%.
  • the inhibition of IL-1 secretion is assessed by methods described herein.
  • the inhibition of IL-1 secretion is assessed by methods known to one of skill in the art (e.g., MSD multiplex assay).
  • the IL-1 secretion is inhibited relative to IL-1 secretion in the absence of anti-PD-1 antibody.
  • the IL-1 secretion is inhibited relative to IL-1 secretion in the presence of an unrelated antibody (e.g., an antibody that does not specifically bind to PD-1).
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein e.g., any one of antibodies PDlAB-1, PD1AB-2, PD 1AB-3, PD 1AB-4, PD1AB-5, or PD1AB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6) inhibits IL-1 secretion.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein e.g., any one of antibodies PDlAB-1, PD1AB-2, PD 1AB-3, PD 1AB-4, PD1AB-5, or PD1AB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6) inhibits
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-1 secretion with an EC50 of at most about 50 nM. In other embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-1 secretion with an EC50 of at most about 40 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-1 secretion with an EC50 of at most about 30 nM. In some embodiments, an anti-PD-1 antibody of a
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-1 secretion with an EC50 of at most about 20 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-1 secretion with an EC50 of at most about 10 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-1 secretion with an EC50 of at most about 5 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-1 secretion with an EC50 of at most about 1 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-1 secretion with an EC50 of at most about 0.75 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-1 secretion with an EC50 of at most about 0.5 nM. In other embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-1 secretion with an EC50 of at most about 0.1 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL- 1 secretion with an EC50 of at most about 0.05 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-1 secretion with an EC50 of at most about 0.01 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-1 secretion with an EC50 of at most about 0.005 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-1 secretion with an EC50 of at most about 0.001 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-1 secretion with an EC50 of at least about 50 nM. In other embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-1 secretion with an EC50 of at least about 40 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-1 secretion with an EC50 of at least about 30 nM. In another embodiment, an anti-PD- 1 antibody of a pharmaceutical formulation provided herein inhibits IL-1 secretion with an EC50 of at least about 20 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-1 secretion with an EC50 of at least about 10 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL- 1 secretion with an EC50 of at least about 5 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-1 secretion with an EC50 of at least about 1 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-1 secretion with an EC50 of at least about 0.75 nM. In other embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-1 secretion with an EC50 of at least about 0.5 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-1 secretion with an EC50 of at least about 0.1 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-1 secretion with an EC50 of at least about 0.05 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-1 secretion with an EC50 of at least about 0.01 nM. In another embodiment, an anti- PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-1 secretion with an EC50 of at least about 0.005 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-1 secretion with an EC50 of at least about 0.001 nM. In specific embodiments, the EC50 is assessed by methods described herein. In other embodiments, the EC50 is assessed by other methods known to one of skill in the art (e.g., MSD multiplex assay). In a specific embodiment, the EC50 is assessed by MSD multiplex assay.
  • antibodies of a pharmaceutical formulation provided herein e.g., any one of antibodies PDlAB-1, PDlAB-2, PDlAB-3, PDlAB-4, PDlAB-5, or PDlAB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD lAB-2, PDlAB-3, PDlAB-4, PDlAB-5, or PDlAB-6) specifically bind to PD-1 and inhibit IL-6 secretion (e.g., from a cell, for example, T cells).
  • IL-6 secretion e.g., from a cell, for example, T cells.
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 5%. In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 10%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 15%. In other embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 20%. In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 25%.
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 30%. In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 35%). In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 40%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 45%. In other embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 50%.
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 55%). In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 60%. In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 65%. In one embodiment, an antibody of a
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 70%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 75%). In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 80%. In other
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 85%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 90%. In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 95%). In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 98%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-6 secretion by at least about 99%.
  • antibodies of a pharmaceutical formulation provided herein specifically bind to PD-1 and inhibit IL-6 secretion by at least about 25% or 35%, optionally to about 75%.
  • the inhibition of IL-6 secretion is assessed by methods described herein.
  • the inhibition of IL-6 secretion is assessed by methods known to one of skill in the art (e.g., MSD multiplex assay).
  • the IL-6 secretion is inhibited relative to IL-6 secretion in the absence of anti-PD-1 antibody.
  • the IL-6 secretion is inhibited relative to IL-6 secretion in the presence of an unrelated antibody (e.g., an antibody that does not specifically bind to PD-1).
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein e.g., any one of antibodies PDlAB-1, PD1AB-2, PD 1AB-3, PD 1AB-4, PD1AB-5, or PD1AB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6) inhibits IL-6 secretion.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein e.g., any one of antibodies PDlAB-1, PD1AB-2, PD 1AB-3, PD 1AB-4, PD1AB-5, or PD1AB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6) inhibits
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-6 secretion with an ECso of at most about 50 nM. In other embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-6 secretion with an ECso of at most about 40 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-6 secretion with an EC50 of at most about 30 nM. In some embodiments, an anti-PD-1 antibody of a
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-6 secretion with an EC50 of at most about 20 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-6 secretion with an EC50 of at most about 10 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-6 secretion with an EC50 of at most about 5 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-6 secretion with an EC50 of at most about 1 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-6 secretion with an EC50 of at most about 0.75 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-6 secretion with an EC50 of at most about 0.5 nM. In other embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-6 secretion with an EC50 of at most about 0.1 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL- 6 secretion with an EC50 of at most about 0.05 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-6 secretion with an EC50 of at most about 0.01 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-6 secretion with an EC50 of at most about 0.005 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-6 secretion with an EC50 of at most about 0.001 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-6 secretion with an EC50 of at least about 50 nM. In other embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-6 secretion with an EC50 of at least about 40 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-6 secretion with an EC50 of at least about 30 nM. In another embodiment, an anti-PD- 1 antibody of a pharmaceutical formulation provided herein inhibits IL-6 secretion with an EC50 of at least about 20 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-6 secretion with an EC50 of at least about 10 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL- 6 secretion with an EC50 of at least about 5 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-6 secretion with an EC50 of at least about 1 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-6 secretion with an EC50 of at least about 0.75 nM. In other embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-6 secretion with an EC50 of at least about 0.5 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-6 secretion with an EC50 of at least about 0.1 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-6 secretion with an EC50 of at least about 0.05 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-6 secretion with an EC50 of at least about 0.01 nM. In another embodiment, an anti- PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-6 secretion with an EC50 of at least about 0.005 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-6 secretion with an EC50 of at least about 0.001 nM. In specific embodiments, the EC50 is assessed by methods described herein. In other embodiments, the EC50 is assessed by other methods known to one of skill in the art (e.g., MSD multiplex assay). In a specific embodiment, the EC50 is assessed by MSD multiplex assay.
  • antibodies of a pharmaceutical formulation provided herein e.g., any one of antibodies PDlAB-1, PDlAB-2, PDlAB-3, PDlAB-4, PDlAB-5, or PDlAB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD lAB-2, PDlAB-3, PDlAB-4, PDlAB-5, or PDlAB-6) specifically bind to PD-1 and inhibit IL-12 secretion (e.g., from a cell, for example, T cells).
  • IL-12 secretion e.g., from a cell, for example, T cells.
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 5%. In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 10%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 15%). In other embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 20%. In one embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 5%. In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 10%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-12 secreti
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 25%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 30%. In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 35%). In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 40%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 45%.
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 50%. In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 55%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 60%. In one
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 65%. In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 70%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 75%). In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 80%>. In other embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 85%>.
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 90%. In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 95%. In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 98%>. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-12 secretion by at least about 99%.
  • antibodies of a pharmaceutical formulation provided herein specifically bind to PD-1 and inhibit IL-12 secretion by at least about 25% or 35%, optionally to about 75%.
  • the inhibition of IL-12 secretion is assessed by methods described herein.
  • the inhibition of IL-12 secretion is assessed by methods known to one of skill in the art (e.g., MSD multiplex assay).
  • the IL-12 secretion is inhibited relative to IL-12 secretion in the absence of anti-PD-1 antibody.
  • the IL-12 secretion is inhibited relative to IL-12 secretion in the presence of an unrelated antibody (e.g., an antibody that does not specifically bind to PD-1).
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein e.g., any one of antibodies PDlAB-1, PD1AB-2, PD 1AB-3, PD 1AB-4, PD1AB-5, or PD1AB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6) inhibits IL-12 secretion.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein e.g., any one of antibodies PDlAB-1, PD1AB-2, PD 1AB-3, PD 1AB-4, PD1AB-5, or PD1AB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6) inhibits
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-12 secretion with an ECso of at most about 50 nM. In other embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-12 secretion with an ECso of at most about 40 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL- 12 secretion with an ECso of at most about 30 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-12 secretion with an EC50 of at most about 20 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-12 secretion with an EC50 of at most about 10 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL- 12 secretion with an EC50 of at most about 5 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-12 secretion with an EC50 of at most about 1 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-12 secretion with an EC50 of at most about 0.75 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL- 12 secretion with an EC50 of at most about 0.5 nM. In other embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-12 secretion with an EC50 of at most about 0.1 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-12 secretion with an EC50 of at most about 0.05 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL- 12 secretion with an EC50 of at most about 0.01 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-12 secretion with an EC50 of at most about 0.005 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-12 secretion with an EC50 of at most about 0.001 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-12 secretion with an EC50 of at least about 50 nM. In other embodiments, an anti-PD- 1 antibody of a pharmaceutical formulation provided herein inhibits IL-12 secretion with an EC50 of at least about 40 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-12 secretion with an EC50 of at least about 30 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-12 secretion with an EC50 of at least about 20 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-12 secretion with an EC50 of at least about 10 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-12 secretion with an EC50 of at least about 5 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-12 secretion with an EC50 of at least about 1 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-12 secretion with an EC50 of at least about 0.75 nM. In other embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-12 secretion with an EC50 of at least about 0.5 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-12 secretion with an EC50 of at least about 0.1 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-12 secretion with an EC50 of at least about 0.05 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-12 secretion with an EC50 of at least about 0.01 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-12 secretion with an EC50 of at least about 0.005 nM. In one embodiment, an anti-PD- 1 antibody of a pharmaceutical formulation provided herein inhibits IL-12 secretion with an EC50 of at least about 0.001 nM. In specific embodiments, the EC50 is assessed by methods described herein. In other embodiments, the EC50 is assessed by other methods known to one of skill in the art (e.g., MSD multiplex assay). In a specific embodiment, the EC50 is assessed by MSD multiplex assay.
  • antibodies of a pharmaceutical formulation provided herein e.g., any one of antibodies PDlAB-1, PDlAB-2, PDlAB-3, PDlAB-4, PDlAB-5, or PDlAB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD lAB-2, PDlAB-3, PDlAB-4, PDlAB-5, or PDlAB-6) specifically bind to PD-1 and inhibit IL-22 secretion (e.g., from a cell, for example, a T cell).
  • IL-22 secretion e.g., from a cell, for example, a T cell
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-22 secretion by at least about 5%. In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-22 secretion by at least about 10%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-22 secretion by at least about 15%). In other embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-22 secretion by at least about 20%. In one embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-22 secretion by at least about 5%. In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-22 secretion by at least about 10%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-22 secreti
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-22 secretion by at least about 25%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-22 secretion by at least about 30%>. In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-22 secretion by at least about 35%. In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-22 secretion by at least about 40%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-22 secretion by at least about 45%.
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-22 secretion by at least about 50%. In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-22 secretion by at least about 55%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-22 secretion by at least about 60%. In one
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-22 secretion by at least about 65%. In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-22 secretion by at least about 70%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-22 secretion by at least about 75%). In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-22 secretion by at least about 80%. In other embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-22 secretion by at least about 85%.
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-22 secretion by at least about 90%. In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-22 secretion by at least about 95%. In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-22 secretion by at least about 98%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-22 secretion by at least about 99%.
  • antibodies of a pharmaceutical formulation provided herein specifically bind to PD-1 and inhibit IL-22 secretion by at least about 25% or 35%, optionally to about 75%.
  • the inhibition of IL-22 secretion is assessed by methods described herein.
  • the inhibition of IL-22 secretion is assessed by methods known to one of skill in the art (e.g., MSD multiplex assay).
  • the IL-22 secretion is inhibited relative to IL-22 secretion in the absence of anti-PD-1 antibody.
  • the IL-22 secretion is inhibited relative to IL-22 secretion in the presence of an unrelated antibody (e.g., an antibody that does not specifically bind to PD-1).
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein e.g., any one of antibodies PDlAB-1, PD1AB-2, PD 1AB-3, PD 1AB-4, PD1AB-5, or PD1AB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6) inhibits IL-22 secretion.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein e.g., any one of antibodies PDlAB-1, PD1AB-2, PD 1AB-3, PD 1AB-4, PD1AB-5, or PD1AB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6) inhibits
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-22 secretion with an EC50 of at most about 50 nM. In other embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-22 secretion with an EC50 of at most about 40 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL- 22 secretion with an EC50 of at most about 30 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-22 secretion with an EC50 of at most about 20 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-22 secretion with an EC50 of at most about 10 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL- 22 secretion with an EC50 of at most about 5 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-22 secretion with an EC50 of at most about 1 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-22 secretion with an EC50 of at most about 0.75 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL- 22 secretion with an EC50 of at most about 0.5 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-22 secretion with an EC50 of at most about 0.1 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-22 secretion with an EC50 of at most about 0.05 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL- 22 secretion with an EC50 of at most about 0.01 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-22 secretion with an EC50 of at most about 0.005 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-22 secretion with an EC50 of at most about 0.001 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-22 secretion with an EC50 of at least about 50 nM. In other embodiments, an anti-PD- 1 antibody of a pharmaceutical formulation provided herein inhibits IL-22 secretion with an EC50 of at least about 40 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-22 secretion with an EC50 of at least about 30 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-22 secretion with an EC50 of at least about 20 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-22 secretion with an EC50 of at least about 10 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-22 secretion with an EC50 of at least about 5 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-22 secretion with an EC50 of at least about 1 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-22 secretion with an EC50 of at least about 0.75 nM. In other embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-22 secretion with an EC50 of at least about 0.5 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-22 secretion with an EC50 of at least about 0.1 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-22 secretion with an EC50 of at least about 0.05 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-22 secretion with an EC50 of at least about 0.01 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-22 secretion with an EC50 of at least about 0.005 nM. In one embodiment, an anti-PD- 1 antibody of a pharmaceutical formulation provided herein inhibits IL-22 secretion with an EC50 of at least about 0.001 nM. In specific embodiments, the EC50 is assessed by methods described herein. In other embodiments, the EC50 is assessed by other methods known to one of skill in the art (e.g., MSD multiplex assay). In a specific embodiment, the EC50 is assessed by MSD multiplex assay.
  • antibodies of a pharmaceutical formulation provided herein e.g., any one of antibodies PDlAB-1, PDlAB-2, PDlAB-3, PDlAB-4, PDlAB-5, or PDlAB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD lAB-2, PDlAB-3, PDlAB-4, PDlAB-5, or PDlAB-6) specifically bind to PD-1 and inhibit IL-23 secretion (e.g., from a cell, for example, a T cell).
  • IL-23 secretion e.g., from a cell, for example, a T cell
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-23 secretion by at least about 5%. In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-23 secretion by at least about 10%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-23 secretion by at least about 15%). In other embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-23 secretion by at least about 20%. In one embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-23 secretion by at least about 5%. In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-23 secretion by at least about 10%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibit
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-23 secretion by at least about 25%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-23 secretion by at least about 30%>. In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-23 secretion by at least about 35%). In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-23 secretion by at least about 40%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-23 secretion by at least about 45%.
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-23 secretion by at least about 50%. In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-23 secretion by at least about 55%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-23 secretion by at least about 60%. In one
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-23 secretion by at least about 65%. In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-23 secretion by at least about 70%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-23 secretion by at least about 75%). In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-23 secretion by at least about 80%.
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-23 secretion by at least about 85%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-23 secretion by at least about 90%. In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-23 secretion by at least about 95%. In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-23 secretion by at least about 98%.
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits IL-23 secretion by at least about 99%.
  • antibodies of a pharmaceutical formulation provided herein specifically bind to PD-1 and inhibit IL-23 secretion by at least about 25% or 35%, optionally to about 75%.
  • the inhibition of IL-23 secretion is assessed by methods described herein.
  • the inhibition of IL-23 secretion is assessed by methods known to one of skill in the art (e.g., MSD multiplex assay).
  • the IL-23 secretion is inhibited relative to IL-23 secretion in the absence of anti-PD-1 antibody.
  • the IL-23 secretion is inhibited relative to IL-23 secretion in the presence of an unrelated antibody (e.g., an antibody that does not specifically bind to PD-1).
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein e.g., any one of antibodies PDlAB-1, PD1AB-2, PD 1AB-3, PD 1AB-4, PD1AB-5, or PD1AB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6) inhibits IL-23 secretion.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein e.g., any one of antibodies PDlAB-1, PD1AB-2, PD 1AB-3, PD 1AB-4, PD1AB-5, or PD1AB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6) inhibits
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-23 secretion with an ECso of at most about 50 nM. In other embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-23 secretion with an ECso of at most about 40 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL- 23 secretion with an ECso of at most about 30 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-23 secretion with an ECso of at most about 20 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-23 secretion with an ECso of at most about 10 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL- 23 secretion with an ECso of at most about 5 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-23 secretion with an ECso of at most about 1 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-23 secretion with an EC50 of at most about 0.75 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL- 23 secretion with an EC50 of at most about 0.5 nM. In other embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-23 secretion with an EC50 of at most about 0.1 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-23 secretion with an EC50 of at most about 0.05 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL- 23 secretion with an EC50 of at most about 0.01 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-23 secretion with an EC50 of at most about 0.005 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-23 secretion with an EC50 of at most about 0.001 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-23 secretion with an EC50 of at least about 50 nM. In other embodiments, an anti-PD- 1 antibody of a pharmaceutical formulation provided herein inhibits IL-23 secretion with an EC50 of at least about 40 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-23 secretion with an EC50 of at least about 30 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-23 secretion with an EC50 of at least about 20 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-23 secretion with an EC50 of at least about 10 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-23 secretion with an EC50 of at least about 5 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-23 secretion with an EC50 of at least about 1 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-23 secretion with an EC50 of at least about 0.75 nM. In other embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-23 secretion with an EC50 of at least about 0.5 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-23 secretion with an EC50 of at least about 0.1 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-23 secretion with an EC50 of at least about 0.05 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-23 secretion with an EC50 of at least about 0.01 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits IL-23 secretion with an EC50 of at least about 0.005 nM. In one embodiment, an anti-PD- 1 antibody of a pharmaceutical formulation provided herein inhibits IL-23 secretion with an EC50 of at least about 0.001 nM. In specific embodiments, the EC50 is assessed by methods described herein. In other embodiments, the EC50 is assessed by other methods known to one of skill in the art (e.g., MSD multiplex assay). In a specific embodiment, the EC50 is assessed by MSD multiplex assay.
  • antibodies of a pharmaceutical formulation provided herein e.g., any one of antibodies PDlAB-1, PD1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD 1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6) specifically bind to PD-1 and inhibit GM-CSF secretion (e.g., from a cell, for example, T cells).
  • GM-CSF secretion e.g., from a cell, for example, T cells.
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits GM-CSF secretion by at least about 5%. In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits GM-CSF secretion by at least about 10%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits GM-CSF secretion by at least about 15%. In other embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits GM-CSF secretion by at least about 20%.
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits GM-CSF secretion by at least about 25%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits GM-CSF secretion by at least about 30%. In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits GM-CSF secretion by at least about 35%. In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits GM-CSF secretion by at least about 40%.
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits GM-CSF secretion by at least about 45%. In other embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits GM-CSF secretion by at least about 50%. In some embodiments, an antibody of a
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits GM-CSF secretion by at least about 55%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits GM-CSF secretion by at least about 60%. In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits GM-CSF secretion by at least about 65%. In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits GM-CSF secretion by at least about 70%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits GM-CSF secretion by at least about 75%.
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits GM-CSF secretion by at least about 80%. In other embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits GM-CSF secretion by at least about 85%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits GM-CSF secretion by at least about 90%. In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits GM-CSF secretion by at least about 95%. In some embodiments, an antibody of a
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits GM-CSF secretion by at least about 98%.
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits GM-CSF secretion by at least about 99%.
  • antibodies of a pharmaceutical formulation provided herein specifically bind to PD-1 and inhibit GM-CSF secretion by at least about 25% or 35%, optionally to about 75%.
  • the inhibition of GM-CSF secretion is assessed by methods described herein. In other embodiments, the inhibition of GM-CSF secretion is assessed by methods known to one of skill in the art (e.g., MSD multiplex assay).
  • the GM-CSF secretion is inhibited relative to GM-CSF secretion in the absence of anti-PD-1 antibody. In other embodiments, the GM-CSF secretion is inhibited relative to GM- CSF secretion in the presence of an unrelated antibody (e.g., an antibody that does not specifically bind to PD-1).
  • an unrelated antibody e.g., an antibody that does not specifically bind to PD-1).
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein e.g., any one of antibodies PDlAB-1, PD1AB-2, PD 1AB-3, PD 1AB-4, PD1AB-5, or PD1AB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6) inhibits GM-CSF secretion.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits GM-CSF secretion with an EC50 of at most about 50 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits GM-CSF secretion with an EC50 of at most about 40 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits GM-CSF secretion with an EC50 of at most about 30 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits GM-CSF secretion with an EC50 of at most about 20 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits GM-CSF secretion with an EC50 of at most about 10 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits GM-CSF secretion with an EC50 of at most about 5 nM. In one embodiment, an anti-PD- 1 antibody of a pharmaceutical formulation provided herein inhibits GM-CSF secretion with an EC50 of at most about 1 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits GM-CSF secretion with an EC50 of at most about 0.75 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits GM-CSF secretion with an EC50 of at most about 0.5 nM.
  • an anti- PD-1 antibody of a pharmaceutical formulation provided herein inhibits GM-CSF secretion with an EC50 of at most about 0.1 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits GM-CSF secretion with an EC50 of at most about 0.05 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits GM-CSF secretion with an EC50 of at most about 0.01 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits GM-CSF secretion with an EC50 of at most about 0.005 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits GM-CSF secretion with an EC50 of at most about 0.001 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits GM-CSF secretion with an EC50 of at least about 50 nM. In other embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits GM-CSF secretion with an EC50 of at least about 40 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits GM-CSF secretion with an EC50 of at least about 30 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits GM-CSF secretion with an EC50 of at least about 20 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits GM-CSF secretion with an EC50 of at least about 10 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits GM-CSF secretion with an EC50 of at least about 5 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits GM-CSF secretion with an EC50 of at least about 1 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits GM-CSF secretion with an EC50 of at least about 0.75 nM. In other embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits GM-CSF secretion with an EC50 of at least about 0.5 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits GM-CSF secretion with an EC50 of at least about 0.1 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits GM-CSF secretion with an EC50 of at least about 0.05 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits GM-CSF secretion with an EC50 of at least about 0.01 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits GM-CSF secretion with an EC50 of at least about 0.005 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits GM-CSF secretion with an EC50 of at least about 0.001 nM. In specific embodiments, the EC50 is assessed by methods described herein. In other
  • the EC50 is assessed by other methods known to one of skill in the art (e.g., MSD multiplex assay). In a specific embodiment, the EC50 is assessed by MSD multiplex assay.
  • antibodies of a pharmaceutical formulation provided herein e.g., any one of antibodies PDlAB-1, PDlAB-2, PDlAB-3, PDlAB-4, PDlAB-5, or PDlAB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD lAB-2, PDlAB-3, PDlAB-4, PDlAB-5, or PDlAB-6) specifically bind to PD-1 and inhibit TNF-a secretion (e.g., from a cell, for example, a T cell).
  • TNF-a secretion e.g., from a cell, for example, a T cell
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits TNF-a secretion by at least about 5%. In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits TNF-a secretion by at least about 10%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits TNF-a secretion by at least about 15%. In other embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits TNF-a secretion by at least about 20%.
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits TNF-a secretion by at least about 25%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits TNF-a secretion by at least about 30%. In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits TNF-a secretion by at least about 35%). In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits TNF-a secretion by at least about 40%.
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits TNF-a secretion by at least about 45%. In other embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits TNF-a secretion by at least about 50%. In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits TNF-a secretion by at least about 55%). In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits TNF-a secretion by at least about 60%. In one
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits TNF-a secretion by at least about 65%. In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits TNF-a secretion by at least about 70%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits TNF-a secretion by at least about 75%). In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits TNF-a secretion by at least about 80%.
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits TNF-a secretion by at least about 85%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits TNF-a secretion by at least about 90%. In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits TNF-a secretion by at least about 95%). In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits TNF-a secretion by at least about 98%.
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and inhibits TNF-a secretion by at least about 99%.
  • antibodies of a pharmaceutical formulation provided herein specifically bind to PD-1 and inhibit TNF-a secretion by at least about 25% or 35%, optionally to about 75%.
  • the inhibition of TNF-a secretion is assessed by methods described herein.
  • the inhibition of TNF-a secretion is assessed by methods known to one of skill in the art (e.g., MSD multiplex assay).
  • the TNF-a secretion is inhibited relative to TNF-a secretion in the absence of anti-PD-1 antibody.
  • the TNF-a secretion is inhibited relative to TNF-a secretion in the presence of an unrelated antibody (e.g., an antibody that does not specifically bind to PD-1).
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein e.g., any one of antibodies PDlAB-1, PD1AB-2, PD 1AB-3, PD 1AB-4, PD1AB-5, or PD1AB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6) inhibits TNF-a secretion.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein e.g., any one of antibodies PDlAB-1, PD1AB-2, PD 1AB-3, PD 1AB-4, PD1AB-5, or PD1AB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6) inhibits
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits TNF-a secretion with an ECso of at most about 50 nM. In other embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits TNF-a secretion with an ECso of at most about 40 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits TNF-a secretion with an ECso of at most about 30 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits TNF-a secretion with an ECso of at most about 20 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits TNF-a secretion with an ECso of at most about 10 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits TNF-a secretion with an ECso of at most about 5 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits TNF-a secretion with an ECso of at most about 1 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits TNF-a secretion with an ECso of at most about 0.75 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits TNF-a secretion with an ECso of at most about 0.5 nM. In other embodiments, an anti- PD-1 antibody of a pharmaceutical formulation provided herein inhibits TNF-a secretion with an EC50 of at most about 0.1 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits TNF-a secretion with an EC50 of at most about 0.05 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits TNF-a secretion with an EC50 of at most about 0.01 nM.
  • an anti- PD-1 antibody of a pharmaceutical formulation provided herein inhibits TNF-a secretion with an EC50 of at most about 0.005 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits TNF-a secretion with an EC50 of at most about 0.001 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits TNF-a secretion with an EC50 of at least about 50 nM. In other embodiments, an anti- PD-1 antibody of a pharmaceutical formulation provided herein inhibits TNF-a secretion with an EC50 of at least about 40 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits TNF-a secretion with an EC50 of at least about 30 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits TNF-a secretion with an EC50 of at least about 20 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits TNF-a secretion with an EC50 of at least about 10 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits TNF-a secretion with an EC50 of at least about 5 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits TNF-a secretion with an EC50 of at least about 1 nM. In some embodiments, an anti-PD- 1 antibody of a pharmaceutical formulation provided herein inhibits TNF-a secretion with an EC50 of at least about 0.75 nM. In other embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits TNF-a secretion with an EC50 of at least about 0.5 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits TNF-a secretion with an EC50 of at least about 0.1 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits TNF-a secretion with an EC50 of at least about 0.05 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits TNF-a secretion with an EC50 of at least about 0.01 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein inhibits TNF-a secretion with an EC50 of at least about 0.005 nM. In one embodiment, an anti- PD-1 antibody of a pharmaceutical formulation provided herein inhibits TNF-a secretion with an EC50 of at least about 0.001 nM. In specific embodiments, the EC50 is assessed by methods described herein. In other embodiments, the EC50 is assessed by other methods known to one of skill in the art (e.g., MSD multiplex assay). In a specific embodiment, the EC50 is assessed by MSD multiplex assay.
  • antibodies of a pharmaceutical formulation provided herein e.g., any one of antibodies PDlAB-1, PDlAB-2, PDlAB-3, PDlAB-4, PDlAB-5, or PDlAB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD lAB-2, PDlAB-3, PDlAB-4, PDlAB-5, or PDlAB-6) specifically bind to PD-1 and downregulate PD-1 expression (e.g., in a cell, for example, T cells).
  • a pharmaceutical formulation provided herein e.g., any one of antibodies PDlAB-1, PDlAB-2, PDlAB-3, PDlAB-4, PDlAB-5, or PDlAB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD lAB-2, PDlAB-3, PDlAB-4, PD
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and downregulates PD-1 expression by at least about 5%. In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and downregulates PD-1 expression by at least about 10%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and downregulates PD-1 expression by at least about 15%. In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and downregulates PD-1 expression by at least about 20%. In other embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and downregulates PD-1 expression by at least about 25%. In another
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and downregulates PD-1 expression by at least about 30%. In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and downregulates PD-1 expression by at least about 35%. In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and downregulates PD-1 expression by at least about 40%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and downregulates PD-1 expression by at least about 45%. In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and downregulates PD-1 expression by at least about 50%. In other embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and downregulates PD-1 expression by at least about 55%. In another
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and downregulates PD-1 expression by at least about 60%. In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and downregulates PD-1 expression by at least about 65%. In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and downregulates PD-1 expression by at least about 70%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and downregulates PD-1 expression by at least about 75%. In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and downregulates PD-1 expression by at least about 80%. In some embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and downregulates PD-1 expression by at least about 85%. In another
  • an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and downregulates PD-1 expression by at least about 90%. In other embodiments, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and downregulates PD-1 expression by at least about 95%. In one embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and downregulates PD-1 expression by at least about 98%. In another embodiment, an antibody of a pharmaceutical formulation provided herein specifically binds to PD-1 and downregulates PD-1 expression by at least about 99%.
  • antibodies of a pharmaceutical formulation provided herein specifically bind to PD-1 and downregulates PD-1 expression by at least about 25% or 35%), optionally to about 75%.
  • the downregulation of PD-1 expression is assessed by methods described herein.
  • the downregulation of PD-1 expression is assessed by methods known to one of skill in the art (e.g., flow cytometry, Western blotting, Northern blotting, or RT-PCR).
  • the downregulation of PD-1 expression is assessed by flow cytometry.
  • the downregulation of PD-1 expression is assessed by Western blotting.
  • the downregulation of PD-1 expression is assessed by Northern blotting.
  • the downregulation of PD-1 expression is assessed by Northern blotting.
  • the downregulation of PD-1 expression is assessed by RT-PCR.
  • the PD-1 expression is downregulated relative to PD-1 expression downregulation in the absence of anti- PD-1 antibody.
  • the PD-1 expression is downregulated relative to PD-1 expression downregulation in the presence of an unrelated antibody (e.g., an antibody that does not specifically bind to PD-1).
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein (e.g., any one of antibodies PDlAB-1, PD1AB-2, PD 1AB-3, PD 1AB-4, PD1AB-5, or PD1AB-6 or an antigen-binding fragment thereof, or an antibody comprising CDRs of any one of antibodies PDlAB-1, PD1AB-2, PD1AB-3, PD1AB-4, PD1AB-5, or PD1AB-6) downregulates PD-1 expression.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein downregulates PD-1 expression with an EC50 of at most about 50 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein downregulates PD-1 expression with an EC50 of at most about 40 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein downregulates PD-1 expression with an EC50 of at most about 30 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein downregulates PD-1 expression with an EC50 of at most about 20 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein downregulates PD-1 expression with an EC50 of at most about 10 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein downregulates PD-1 expression with an EC50 of at most about 5 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein downregulates PD-1 expression with an EC50 of at most about 1 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein downregulates PD-1 expression with an EC50 of at most about 0.75 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein downregulates PD-1 expression with an EC50 of at most about 0.5 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein downregulates PD-1 expression with an EC50 of at most about 0.1 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein downregulates PD-1 expression with an EC50 of at most about 0.05 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein downregulates PD-1 expression with an EC50 of at most about 0.01 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein downregulates PD-1 expression with an EC50 of at most about 0.005 nM.
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein downregulates PD-1 expression with an EC50 of at most about 0.001 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein downregulates PD-1 expression with an EC50 of at least about 50 nM. In other embodiments, an anti-PD-1 antibody of a
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein downregulates PD-1 expression with an EC50 of at least about 40 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein downregulates PD-1 expression with an EC50 of at least about 30 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein downregulates PD-1 expression with an EC50 of at least about 20 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein downregulates PD-1 expression with an EC50 of at least about 10 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein downregulates PD-1 expression with an EC50 of at least about 5 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical
  • an anti-PD-1 antibody of a pharmaceutical formulation provided herein downregulates PD-1 expression with an EC50 of at least about 1 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein downregulates PD-1 expression with an EC50 of at least about 0.75 nM. In other embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein downregulates PD-1 expression with an EC50 of at least about 0.5 nM. In another embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein downregulates PD-1 expression with an EC50 of at least about 0.1 nM. In one embodiment, an anti-PD-1 antibody of a pharmaceutical formulation provided herein downregulates PD-1 expression with an EC50 of at least about 0.05 nM. In some embodiments, an anti-PD-1 antibody of a pharmaceutical formulation provided herein downregulates PD-1 expression with an EC50 of at least about 0.01 nM. In another embodiment, an anti-PD-1 antibody
  • the EC50 is assessed by methods described herein. In other embodiments, the EC50 is assessed by other methods known to one of skill in the art (e.g., flow cytometry, Western blotting, Northern blotting, or RT-PCR). In a specific embodiment, the EC50 is assessed by flow cytometry. In another embodiment, the EC50 is assessed by Western blotting. In yet another embodiment, the EC50 is assessed by Northern blotting. In still another embodiment, the EC50 is assessed by RT-PCR.
  • the downregulation of PD-1 expression on the surface of T cells occurs as early as 4 hours after the contact with the antibody or antigen-binding fragment thereof of pharmaceutical formulations provided herein.
  • the antibody or antigen-binding fragment thereof of pharmaceutical formulations provided herein occurs as early as 4 hours after the contact with the antibody or antigen-binding fragment thereof of pharmaceutical formulations provided herein.
  • downregulation occurs as early as 6 hours after the contact. In yet another embodiment, the downregulation occurs as early as 8 hours after the contact. In still another embodiment, the downregulation occurs as early as 10 hours after the contact. In one embodiment, the
  • downregulation occurs as early as 12 hours after the contact. In another embodiment, the downregulation occurs as early as 14 hours after the contact. In yet another embodiment, the downregulation occurs as early as 16 hours after the contact. In still another embodiment, the downregulation occurs as early as 18 hours after the contact. In one embodiment, the
  • the downregulation occurs as early as 20 hours after the contact. In another embodiment, the downregulation occurs as early as 22 hours after the contact. In yet another embodiment, the downregulation occurs as early as 24 hours after the contact.
  • the contact is with the antibody. In other embodiments, the contact is with an antigen-binding fragment thereof.
  • the downregulation of PD-1 expression on the surface of T cells precedes cytokine inhibition.
  • the downregulation of PD-1 expression on the surface of T cells occurs as early as 4 hours after the contact with the antibody or antigen-binding fragment thereof of pharmaceutical formulations, and precedes cytokine inhibition.
  • the downregulation occurs as early as 6 hours after the contact with the antibody or antigen-binding fragment thereof of pharmaceutical formulations, and precedes cytokine inhibition.
  • the downregulation occurs as early as 8 hours after the contact with the antibody or antigen-binding fragment thereof of
  • the downregulation occurs as early as 10 hours after the contact with the antibody or antigen-binding fragment thereof of pharmaceutical formulations, and precedes cytokine inhibition. In one embodiment, the downregulation occurs as early as 12 hours after the contact with the antibody or antigen-binding fragment thereof of pharmaceutical formulations, and precedes cytokine inhibition. In another embodiment, the downregulation occurs as early as 14 hours after the contact with the antibody or antigen-binding fragment thereof of pharmaceutical formulations, and precedes cytokine inhibition. In yet another embodiment, the downregulation occurs as early as 16 hours after the contact with the antibody or antigen-binding fragment thereof of pharmaceutical formulations, and precedes cytokine inhibition.
  • the downregulation occurs as early as 18 hours after the contact with the antibody or antigen-binding fragment thereof of pharmaceutical formulations, and precedes cytokine inhibition. In one embodiment, the downregulation occurs as early as 20 hours after the contact with the antibody or antigen-binding fragment thereof of pharmaceutical formulations, and precedes cytokine inhibition. In another embodiment, the downregulation occurs as early as 22 hours after the contact with the antibody or antigen-binding fragment thereof of pharmaceutical formulations, and precedes cytokine inhibition. In yet another embodiment, the downregulation occurs as early as 24 hours after the contact with the antibody or antigen-binding fragment thereof of pharmaceutical formulations, and precedes cytokine inhibition.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Epidemiology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Engineering & Computer Science (AREA)
  • Public Health (AREA)
  • Endocrinology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicinal Preparation (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
PCT/US2018/024787 2017-03-29 2018-03-28 Formulations comprising pd-1 binding proteins and methods of making thereof Ceased WO2018183459A1 (en)

Priority Applications (12)

Application Number Priority Date Filing Date Title
JP2019553183A JP2020512359A (ja) 2017-03-29 2018-03-28 Pd−1結合タンパク質を含む製剤及びそれを作製する方法
AU2018246252A AU2018246252A1 (en) 2017-03-29 2018-03-28 Formulations comprising PD-1 binding proteins and methods of making thereof
BR112019018996A BR112019018996A2 (pt) 2017-03-29 2018-03-28 formulações compreendendo proteínas de ligação de pd-1 e métodos para produzir as mesmas
SG11201907948TA SG11201907948TA (en) 2017-03-29 2018-03-28 Formulations comprising pd-1 binding proteins and methods of making thereof
EP18775686.1A EP3601338A4 (en) 2017-03-29 2018-03-28 FORMULATIONS INCLUDING PROTEINS BINDING PD-1 AND THEIR PREPARATION METHODS
KR1020197028673A KR20190141658A (ko) 2017-03-29 2018-03-28 Pd-1 결합 단백질을 포함하는 제제 및 이의 제조 방법
MX2019010999A MX2019010999A (es) 2017-03-29 2018-03-28 Formulaciones que comprenden proteinas de union a pd-1 y metodos para preparar las mismas.
EA201991912A EA201991912A1 (ru) 2017-03-29 2018-03-28 Составы, содержащие pd-1-связывающие белки, и способы их получения
CN201880034207.7A CN110678482A (zh) 2017-03-29 2018-03-28 包含pd-1结合蛋白的制剂及其制备方法
CA3055984A CA3055984A1 (en) 2017-03-29 2018-03-28 Formulations comprising pd-1 binding proteins and methods of making thereof
IL26888419A IL268884A (en) 2017-03-29 2019-08-23 Formulations comprising pd-1 binding proteins and methods of making thereof
CONC2019/0010230A CO2019010230A2 (es) 2017-03-29 2019-09-20 Formulaciones que comprenden proteínas de unión a pd-1 y métodos para realizarlas

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201762478524P 2017-03-29 2017-03-29
US62/478,524 2017-03-29

Publications (1)

Publication Number Publication Date
WO2018183459A1 true WO2018183459A1 (en) 2018-10-04

Family

ID=63678296

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2018/024787 Ceased WO2018183459A1 (en) 2017-03-29 2018-03-28 Formulations comprising pd-1 binding proteins and methods of making thereof

Country Status (16)

Country Link
US (1) US20180289802A1 (https=)
EP (1) EP3601338A4 (https=)
JP (1) JP2020512359A (https=)
KR (1) KR20190141658A (https=)
CN (1) CN110678482A (https=)
AU (1) AU2018246252A1 (https=)
BR (1) BR112019018996A2 (https=)
CA (1) CA3055984A1 (https=)
CL (1) CL2019002605A1 (https=)
CO (1) CO2019010230A2 (https=)
EA (1) EA201991912A1 (https=)
EC (1) ECSP19076344A (https=)
IL (1) IL268884A (https=)
MX (1) MX2019010999A (https=)
SG (1) SG11201907948TA (https=)
WO (1) WO2018183459A1 (https=)

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10513558B2 (en) 2015-07-13 2019-12-24 Cytomx Therapeutics, Inc. Anti-PD1 antibodies, activatable anti-PD1 antibodies, and methods of use thereof
JP2022523025A (ja) * 2019-01-28 2022-04-21 アムジエン・インコーポレーテツド 原薬及び製剤プロセスの統合による生物製剤製造のための連続的な製造プロセス
EP4008345A1 (en) * 2020-12-03 2022-06-08 Hexal AG Novel formulations for antibodies
US20230295329A1 (en) * 2020-07-31 2023-09-21 Jiangsu Hengrui Pharmaceuticals Co., Ltd. Anti-pd-1 antibody pharmaceutical composition and use thereof
US12312405B2 (en) 2020-05-26 2025-05-27 Boehringer Ingelheim International Gmbh Anti-PD-1 antibodies

Families Citing this family (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EA201890790A1 (ru) 2015-09-29 2018-10-31 Селджин Корпорейшн Связывающие pd-1 белки и способы их применения
EP3515943A4 (en) 2016-09-19 2020-05-06 Celgene Corporation METHODS OF TREATING VITILIGO WITH PD-1 BINDING PROTEINS
BR112019004733A2 (pt) 2016-09-19 2019-05-28 Celgene Corp métodos de tratamento de distúrbios imunes usando proteínas de ligação a pd-1
TWI849895B (zh) 2018-02-09 2024-07-21 日商小野藥品工業股份有限公司 雙特異性抗體
KR102735988B1 (ko) 2019-02-18 2024-12-03 일라이 릴리 앤드 캄파니 치료 항체 제제
US20230143066A1 (en) * 2020-04-17 2023-05-11 Ono Pharmaceutical Co., Ltd. Method for removing color from drug substance of protein preparation
US20240342083A1 (en) * 2021-07-29 2024-10-17 Shanghai Junshi Biosciences Co., Ltd. Anti-pd-1 antibody pharmaceutical composition and use thereof
CN117088981B (zh) * 2023-08-15 2024-09-10 福建医科大学附属协和医院 抗b7-h3的单链抗体

Citations (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2008047914A1 (fr) * 2006-10-20 2008-04-24 Forerunner Pharma Research Co., Ltd. Agent anticancéreux comprenant un anticorps anti-hb-egf en tant qu'ingrédient actif
WO2010040105A2 (en) * 2008-10-02 2010-04-08 Trubion Pharmaceuticals, Inc. Cd86 antagonist multi-target binding proteins
US20110177074A1 (en) * 2008-03-27 2011-07-21 Sivakumar Pallavur V Compositions and methods for inhibiting pdgfrbeta and vegf-a
US8008449B2 (en) * 2005-05-09 2011-08-30 Medarex, Inc. Human monoclonal antibodies to programmed death 1 (PD-1) and methods for treating cancer using anti-PD-1 antibodies alone or in combination with other immunotherapeutics
US8900587B2 (en) * 2007-06-18 2014-12-02 Merck Sharp & Dohme Corp. Antibodies to human programmed death receptor PD-1
WO2015048520A1 (en) * 2013-09-27 2015-04-02 Genentech, Inc. Anti-pdl1 antibody formulations
WO2015103139A1 (en) * 2013-12-31 2015-07-09 Development Center For Biotechnology Anti-vegf antibodies and use thereof
WO2016168716A1 (en) * 2015-04-17 2016-10-20 Bristol-Myers Squibb Company Compositions comprising a combination of an anti-pd-1 antibody and another antibody
US20170088618A1 (en) * 2015-09-29 2017-03-30 Celgene Corporation Pd-1 binding proteins and methods of use thereof

Family Cites Families (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2003011911A1 (fr) * 2001-07-31 2003-02-13 Ono Pharmaceutical Co., Ltd. Substance specifique pour pd-1
TW201134488A (en) * 2010-03-11 2011-10-16 Ucb Pharma Sa PD-1 antibodies
JP6701079B2 (ja) * 2013-12-20 2020-05-27 インターベット インターナショナル ベー. フェー. ヒトpd−1に対するイヌ化マウス抗体
TWI681969B (zh) * 2014-01-23 2020-01-11 美商再生元醫藥公司 針對pd-1的人類抗體
TWI595006B (zh) * 2014-12-09 2017-08-11 禮納特神經系統科學公司 抗pd-1抗體類和使用彼等之方法
BR112019004733A2 (pt) * 2016-09-19 2019-05-28 Celgene Corp métodos de tratamento de distúrbios imunes usando proteínas de ligação a pd-1
EP3515943A4 (en) * 2016-09-19 2020-05-06 Celgene Corporation METHODS OF TREATING VITILIGO WITH PD-1 BINDING PROTEINS

Patent Citations (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8008449B2 (en) * 2005-05-09 2011-08-30 Medarex, Inc. Human monoclonal antibodies to programmed death 1 (PD-1) and methods for treating cancer using anti-PD-1 antibodies alone or in combination with other immunotherapeutics
WO2008047914A1 (fr) * 2006-10-20 2008-04-24 Forerunner Pharma Research Co., Ltd. Agent anticancéreux comprenant un anticorps anti-hb-egf en tant qu'ingrédient actif
US8900587B2 (en) * 2007-06-18 2014-12-02 Merck Sharp & Dohme Corp. Antibodies to human programmed death receptor PD-1
US20110177074A1 (en) * 2008-03-27 2011-07-21 Sivakumar Pallavur V Compositions and methods for inhibiting pdgfrbeta and vegf-a
WO2010040105A2 (en) * 2008-10-02 2010-04-08 Trubion Pharmaceuticals, Inc. Cd86 antagonist multi-target binding proteins
WO2015048520A1 (en) * 2013-09-27 2015-04-02 Genentech, Inc. Anti-pdl1 antibody formulations
WO2015103139A1 (en) * 2013-12-31 2015-07-09 Development Center For Biotechnology Anti-vegf antibodies and use thereof
WO2016168716A1 (en) * 2015-04-17 2016-10-20 Bristol-Myers Squibb Company Compositions comprising a combination of an anti-pd-1 antibody and another antibody
US20170088618A1 (en) * 2015-09-29 2017-03-30 Celgene Corporation Pd-1 binding proteins and methods of use thereof

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See also references of EP3601338A4 *

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10513558B2 (en) 2015-07-13 2019-12-24 Cytomx Therapeutics, Inc. Anti-PD1 antibodies, activatable anti-PD1 antibodies, and methods of use thereof
JP2022523025A (ja) * 2019-01-28 2022-04-21 アムジエン・インコーポレーテツド 原薬及び製剤プロセスの統合による生物製剤製造のための連続的な製造プロセス
JP7617004B2 (ja) 2019-01-28 2025-01-17 アムジエン・インコーポレーテツド 原薬及び製剤プロセスの統合による生物製剤製造のための連続的な製造プロセス
US12312405B2 (en) 2020-05-26 2025-05-27 Boehringer Ingelheim International Gmbh Anti-PD-1 antibodies
US20230295329A1 (en) * 2020-07-31 2023-09-21 Jiangsu Hengrui Pharmaceuticals Co., Ltd. Anti-pd-1 antibody pharmaceutical composition and use thereof
EP4008345A1 (en) * 2020-12-03 2022-06-08 Hexal AG Novel formulations for antibodies
WO2022117795A1 (en) * 2020-12-03 2022-06-09 Hexal Ag Novel formulations for antibodies

Also Published As

Publication number Publication date
ECSP19076344A (es) 2019-10-31
US20180289802A1 (en) 2018-10-11
EP3601338A4 (en) 2020-12-16
MX2019010999A (es) 2020-02-05
CO2019010230A2 (es) 2020-01-17
EA201991912A1 (ru) 2020-03-10
EP3601338A1 (en) 2020-02-05
IL268884A (en) 2019-10-31
CN110678482A (zh) 2020-01-10
BR112019018996A2 (pt) 2020-04-14
CA3055984A1 (en) 2018-10-04
AU2018246252A1 (en) 2019-09-19
SG11201907948TA (en) 2019-09-27
CL2019002605A1 (es) 2020-05-29
KR20190141658A (ko) 2019-12-24
JP2020512359A (ja) 2020-04-23

Similar Documents

Publication Publication Date Title
US20230272076A1 (en) PD-1 Binding Proteins and Methods of Use Thereof
US12084499B2 (en) SIRP-α binding proteins and methods of use thereof
US20180289802A1 (en) Formulations comprising pd-1 binding proteins and methods of making thereof
US20210163595A1 (en) Methods of treating vitiligo using pd-1 binding antibodies
US10751414B2 (en) Methods of treating psoriasis using PD-1 binding antibodies
US11591390B2 (en) SIRP-α binding proteins and methods of use thereof
JP7829547B2 (ja) 抗Notch2抗体及び使用方法

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18775686

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3055984

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: DZP2019000436

Country of ref document: DZ

ENP Entry into the national phase

Ref document number: 2018246252

Country of ref document: AU

Date of ref document: 20180328

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: NC2019/0010230

Country of ref document: CO

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112019018996

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2019553183

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20197028673

Country of ref document: KR

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2018775686

Country of ref document: EP

Effective date: 20191029

WWP Wipo information: published in national office

Ref document number: NC2019/0010230

Country of ref document: CO

ENP Entry into the national phase

Ref document number: 112019018996

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20190912