WO2018140974A1 - Passive antibody dependent cell-mediated activation - Google Patents

Passive antibody dependent cell-mediated activation Download PDF

Info

Publication number
WO2018140974A1
WO2018140974A1 PCT/US2018/016035 US2018016035W WO2018140974A1 WO 2018140974 A1 WO2018140974 A1 WO 2018140974A1 US 2018016035 W US2018016035 W US 2018016035W WO 2018140974 A1 WO2018140974 A1 WO 2018140974A1
Authority
WO
WIPO (PCT)
Prior art keywords
cells
protein
cell
igg
binds
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2018/016035
Other languages
English (en)
French (fr)
Inventor
Michael Caligiuri
Jianhua Yu
Hongsheng DAI
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Ohio State Innovation Foundation
Original Assignee
Ohio State Innovation Foundation
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Ohio State Innovation Foundation filed Critical Ohio State Innovation Foundation
Priority to US16/480,293 priority Critical patent/US11459378B2/en
Priority to CN201880007963.0A priority patent/CN110536699A/zh
Priority to JP2019541246A priority patent/JP2020505418A/ja
Priority to EP18744927.7A priority patent/EP3573640A4/en
Priority to AU2018213418A priority patent/AU2018213418A1/en
Publication of WO2018140974A1 publication Critical patent/WO2018140974A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/04Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
    • A61K38/08Peptides having 5 to 11 amino acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/20Antivirals for DNA viruses
    • A61P31/22Antivirals for DNA viruses for herpes viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/08Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/081DNA viruses
    • C07K16/085Orthoherpesviridae (F), e.g. pseudorabies virus or Epstein-Barr virus
    • C07K16/087Herpes simplex virus
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/08Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/081DNA viruses
    • C07K16/085Orthoherpesviridae (F), e.g. pseudorabies virus or Epstein-Barr virus
    • C07K16/089Cytomegalovirus
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0645Macrophages, e.g. Kuepfer cells in the liver; Monocytes
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/72Increased effector function due to an Fc-modification
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/732Antibody-dependent cellular cytotoxicity [ADCC]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2533/00Supports or coatings for cell culture, characterised by material
    • C12N2533/50Proteins
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011Details
    • C12N2710/16011Herpesviridae
    • C12N2710/16211Lymphocryptovirus, e.g. human herpesvirus 4, Epstein-Barr Virus
    • C12N2710/16222New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011Details
    • C12N2710/16011Herpesviridae
    • C12N2710/16611Simplexvirus, e.g. human herpesvirus 1, 2
    • C12N2710/16622New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes

Definitions

  • Natural killer (NK) cells are innate lymphoid cells that lack the ability to rearrange germline immunoglobulin genes to generate an adaptive immune response, and can recognize virally infected cells or cancer cells without prior antigen exposure (Orr et al, 2010, Cell 142, 847-856).
  • the functional status of NK cells is regulated by signal inputs from a wide variety of NK cell activating/inhibitory receptors and cytokines.
  • NK cells are also the major effector cells for antibody-dependent cell- mediated cytotoxicity (ADCC), and express the low affinity FcyR-IIIA/CD 16a protein (CD 16a hereafter) that binds an IgG molecule at that molecule's hinge region and initiates NK cell activation via the resulting antigen-antibody complex (Sondermann et al , 2000, Nature 406, 267-273).
  • CD16a is coupled in NK cells with the signal transducer protein ⁇ 3 ⁇ (Anderson et al , 1990, Proc Natl Acad Sci USA 87, 2274- 2278; Lanier et al, 1989, Nature 342, 803-805).
  • NK cell activation through CD16a minimally requires two CD16a binding sites physically close enough to cluster ⁇ 3 ⁇ , whose phosphorylation in turn results in the activation of NK cells and lysis of antibody-coated target cells (O'Shea et al , 1991, Proc Natl Acad Sci USA 88, 350- 354).
  • NK cells can act as a first line of defense against a broad array of infectious pathogens and against malignant transformation.
  • First line of defense connotes protection arising days to weeks before the adaptive, antigen-specific immune system of T-cells and B-cells can detect a pathogen and attack it, and quickly recall its response when the pathogen or tumor itself is present in the body again at a later time.
  • the mechanisms behind this early recognition of pathogens and tumor cells by NK cells and other innate immune cells are largely but not completely unknown (Dai, et al , 2017, Immunity 47(1), 159- 170). Understanding how NK cells and other innate immune cells can see such dangers will improve understanding of how to treat such diseases early, thus saving more lives.
  • NK cells constitute the first line of defense against herpesviruses infection and patients with NK cell deficiencies often suffer severe, recurrent and sometimes fatal HSV infection (Orange, 2012, Journal of Clinical Investigation 122, 798-801).
  • the herpesviridae family includes many significant human pathogens that are yet to have approved vaccines (Gilden et al , 2007, Nat Clin Pract Neurol 3, 82-94), and oncolytic HSV1 has recently been clinically approved for treating melanoma (albeit with moderate therapeutic effects; Andtbacka et al , 2015, J Clin Oncol. Talimogene Laherparepvec Improves Durable Response Rate in Patients With Advanced Melanoma").
  • Talimogene Laherparepvec Improves Durable Response Rate in Patients With Advanced Melanoma”
  • the disclosure provides reagents, methods, and pharmaceutical compositions for promoting immunological activation of immune effector cells.
  • immunological polypeptides comprising a domain that binds an Fc gamma receptor (FcyR) on immune effector cells and a non- overlapping domain that binds Fc binding proteins on target cells.
  • the polypeptides described herein are capable of forming a bridge between an immune effector cell and a target cell without use of the antigen-binding region (the so-called IgG Fab region) of the antibody.
  • This type of immune effector cell activation is referred to herein as passive antibody dependent cell-mediated cytotoxicity (ADCC).
  • Passive ADCC can have both beneficial and deleterious effects in subjects infected with pathogens that encode Fc binding proteins, subjects who express genes that encode Fc binding proteins other than FcyR, and in subjects undergoing treatment with antibody.
  • a pharmaceutical composition for treating a subject infected with a pathogen encoding an Fc-binding protein comprises an immunological polypeptide comprising a domain that binds an Fc gamma receptor (FcyR) on an immune effector cell and a non-overlapping domain that binds the pathogen-encoded Fc binding protein.
  • the immunological polypeptide is an antibody, more specifically an IgG antibody and in particular an Fc fragment of an IgG antibody. Also within the scope of such immunological polypeptides is IgG-containing antisera.
  • a feature of the immunological polypeptides useful in the methods and comprising the pharmaceutical compositions disclosed herein is that the efficacy and utility of said IgG antibodies is independent of their antigenic specificity.
  • the invention also provides reagents, methods and pharmaceutical compositions for preventing neurologic damage in a subject with HSVl infection.
  • the invention further provides reagents, methods and pharmaceutical compositions for preventing death in a subject with HSVl infection.
  • a pharmaceutical composition comprising an immunological polypeptide comprising a domain that binds an FcyR on an immune effector cell and a non-overlapping domain that binds a HSVl -encoded Fc binding protein is provided.
  • the immunological polypeptide is an antibody, more specifically an IgG antibody and in particular an Fc fragment of an IgG antibody. Also within the scope of such immunological polypeptides is IgG- containing antisera.
  • a feature of the immunological polypeptides useful in the methods and comprising the pharmaceutical compositions disclosed herein is that the efficacy and utility of said IgG antibodies is independent of their antigenic specificity.
  • polypeptides comprising an Fc region of an immunoglobulin G (IgG) antibody but do not comprise an Fab region of an antibody.
  • the polypeptide can be a fragment of an IgGl, IgG2, IgG3, or IgG4 immunoglobulin.
  • the polypeptide comprises a single Fc region of an IgG immunoglobulin.
  • the polypeptide comprises two or more Fc regions of one or a plurality of IgG immunoglobulins.
  • the polypeptide comprises an Fc gamma receptor binding site that has been modified to enhance binding to an Fc gamma receptor, and in some embodiments, the polypeptide comprises an Fc gamma receptor binding site that has been modified to delete binding to an Fc gamma receptor or delete binding to an Fc binding protein other than an Fc gamma receptor.
  • the immune effector cell is an immune cell that expresses an Fc gamma receptor.
  • Fc gamma receptors include CD 16a, CD 16b, CD32, and CD64. Therefore in some embodiments, the immune effector cell is a T cell, a B cell, a natural killer (NK) cell, a monocyte, a macrophage, a granulocyte, a neutrophil, or a dendritic cell.
  • the disclosed reagents, methods and pharmaceutical compositions can be used in some embodiments to treat a subject infected with a pathogen expressing an Fc binding protein, wherein the methods comprise administering to the subject a therapeutically effective amount of the pharmaceutical compositions disclosed herein.
  • the pathogen is a virus.
  • the pathogen is herpes simplex virus 1 (HSVl) or HSV2 that expresses the Fc binding protein glycoprotein E (gE).
  • the pathogen is human cytomegalovirus (CMV) that expresses the Fc binding protein comprises a 68kDa-glycoprotein (gp68).
  • the pathogen is Varicella zoster virus (VZV).
  • the pathogen is a bacterium, such as Staphylococcus aureus, Streptococcus, or Escherichia coli.
  • the Fc binding protein expressed by the pathogen comprises protein A, protein G, protein H, or Ml protein.
  • the methods provided herein are applied to a subject undergoing oncolytic viral therapy. While it may be advantageous to inhibit passive ADCC early after oncolytic viral infection of a tumor to allow the virus to spread to other tumor cells, the disclosed methods can also be used to enhance passive ADCC after the tumor cells are infected to enhance killing and clearing of tumor cells.
  • the polypeptide is a fragment of an IgG immunoglobulin modified to bind Fc binding proteins but not bind an FcyR, which will cause them to bind the Fc binding proteins of target cells and prevent them from crosslinking FcyR and activating passive ADCC.
  • the polypeptide can be an IgG fragment that lacks or has been engineered to lack a CD 16a, CD32, or CD64 binding site.
  • the Fc binding site for HSVl gE, protein A and protein G and Ml protein of streptococcus is known to be the CH2-CH3 interface of an IgG molecule. Therefore, in some embodiments, the polypeptide is a fragment of an IgG immunoglobulin comprising the CH2-CH3 interface of IgG but not comprising the FcyR binding region.
  • the polypeptide can be a fragment of an IgGl, IgG2, IgG3 or IgG4 immunoglobulin. In some embodiments, the polypeptide is a fragment from more than one subclass of antibody. Regions of FcyRIIIa/CD16a involved in binding Fc are B/C loop (Trp 131 to Ala 135), F/G loop (Val 176 to Lys 179), C strand (His 137 to Thr 140) and C strand (Asp 147 to His 153) of SEQ ID NO: 24). Additionally, Arg 173 and the connector (He 106 to Trp 108) region are also involved in binding.
  • Cy2 hinge Leu 235 to Ser 239
  • residue Asp 265 to Glu 269 of Fc are known to be the main contact residues for CD16a (Sondermann et al, 2000, Nature 406, 267-273)).
  • modification on the interacting interface can change binding between CD 16a and IgG.
  • replacement of FcyRIII FG- loop with that of FcyRI resulted in a 15-fold increase in IgGl binding affinity (Lu et al, 2011, JBC 286, 40608 -40613).
  • Another example is an Fc fragment comprising human IgGl Fc amino acids 262-470 of SEQ ID NO: 10, which bind HSV1 gE, protein A and protein G, but completely failed to bind human Fey receptors (CD 16a, CD32, CD64).
  • the methods disclosed herein involve administering an Fc binding protein, such as protein A or protein G, which will bind antibodies and prevent bridging immune effector cells and target cells by passive ADCC.
  • an Fc binding protein such as protein A or protein G
  • the polypeptide is a fragment of an IgG
  • the polypeptide can be a fragment of an IgG
  • human IgG 4 binds gE while IgG4 mutant H435R is unable to bind gE.
  • the invention provides reagents, methods and pharmaceutical compositions for reducing inflammation in a subject receiving anticancer therapy.
  • These embodiments can comprise administering a therapeutically effective amount of a polypeptide comprising a region that binds to an Fc binding protein but does not comprise a region that binds to an FcyR and administering an anti-cancer therapy comprising a monoclonal antibody drug.
  • the antibody drug is rituximab, tocilizumab, tositumomab, trastuzumab bevacizumab, brentuximab vedotin, cetuximab, daratumumab, ipilimumab, ofatumumab, panitumumab, alemtuzumab or pembrolizumab.
  • the pharmaceutical composition is administered prior to treatment with the monoclonal antibody drug.
  • the subject is being treated with a therapeutic antibody.
  • Most therapeutic monoclonal antibody drugs are produced from mammalian host cell lines to target specific antigens. Side effects and reduce therapeutic efficacy can be caused by sequestration of the antibody by various Fc binding proteins endogenously present in a patient, and interacting via passive ADCC with FcyR-bearing immune cells.
  • the disclosed methods can decrease such side effects of antibody mediated infusion toxicity (the so-called first dose effect), yet enhance antibody -based immunotherapy.
  • the disclosed methods can also be used to prevent cytokine release from FcyR-bearing immune cells, hypotension and multiple organ failure in patients with infection from organisms that have Fc binding proteins.
  • the subject has, or is at risk of having viremia with a virus that encodes an Fc binding protein.
  • These disclosed methods can be used to treat or prevent viremia by enhancing viral clearance by FcyR-bearing immune cells using IgG Fc fragments or antibodies with higher-than-normal affinity for Fc binding proteins and/or FcyR, and utilizing passive ADCC for clearance.
  • compositions for treating cancer in a subject undergoing oncolytic viral therapy can be used to inhibit passive ADCC early after oncolytic viral infection of a tumor so the oncolytic virus can spread to other tumor cells.
  • the immunological polypeptide can be administered prior to treatment with an oncolytic viral therapeutic agent, an in others the immunological polypeptide can be co-administered with an oncolytic viral therapeutic agent.
  • a pharmaceutical composition comprising a polypeptide comprising a region that binds to an Fc binding protein on a target cell but does not comprise a region that binds to an FcyR is provided for inhibiting passive ADCC in a patient undergoing oncolytic viral therapy.
  • a feature of the immunological polypeptides useful in the methods and comprising the pharmaceutical compositions disclosed herein is that the efficacy and utility of said IgG antibodies is independent of their antigenic specificity.
  • reagents, methods, and pharmaceutical compositions provided herein for enhancement of passive ADCC can be used to improve destruction of virally infected tumor cells by FcyR-bearing immune cells.
  • a pharmaceutical composition comprising an
  • immunological polypeptide comprising a domain that binds an FcyR on an immune effector cell and a non-overlapping domain that binds an Fc binding protein on a target cell can be used to enhance passive ADCC to improve destruction of virally - infected tumor cells.
  • the immunological polypeptide is an antibody, more specifically an IgG antibody and in particular an Fc fragment of an IgG antibody.
  • IgG- containing antisera is also within the scope of such immunological polypeptides.
  • Also disclosed herein is a method for identifying viral genes that modulate the interaction of a virally -infected cell and an immune effector cell.
  • the disclosed method can involve transfecting a host cell with an expression vector comprising a candidate viral gene and a reporter gene operably linked to an expression control sequence, exposing the transfected host cells and non-transfected host cells to a cytotoxic immune effector cell, and assaying the exposed transfected host cells and non-transfected host cells to measure cell death as a function of reporter gene expression or activity.
  • a decrease in cell death by the transfected host cells compared to non-transfected host cells is an indication that the viral gene protected the host cell from the immune effector cell
  • an increase in cell death by the transfected host cells compared to non-transfected host cells is an indication that the viral gene made the host cell susceptible to the immune effector cell.
  • the cytotoxic immune effector cell can be a CD4+ T-cell, a CD8+ T-cell, a natural killer (NK) cell, a macrophage, a granulocyte, or a dendritic cell.
  • the reporter gene is a fluorescence gene, wherein the exposed transfected host cells and non-transfected host cells are assayed, inter alia, by flow cytometry to measure cell death as a function of fluorescence, wherein an increase in the percentage of fluorescent transfected host cells compared to non- transfected host cells is an indication that the viral gene protected the host cell from the immune effector cell, and wherein a decrease in mean fluorescence by the transfected host cells compared to non-transfected host cells is an indication that the viral gene made the host cell susceptible to the immune effector cell.
  • the process can be repeated for each gene in a viral genome.
  • the method can further comprising repeating the process for combinations of 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 40, 50, or more genes in a viral genome.
  • the host cell is preferably selected based on its known susceptibility or resistance to killing by an immune effector cell when virally infected.
  • a recombinant oncolytic Herpes Simplex Virus comprising one or more activating mutations in an Us8 gene (SEQ ID NO: 18), one or more activating mutations in an UL12 gene (SEQ ID NO: 12), one or more activating mutations in an UL30 gene (SEQ ID NO: 13), one or more activating mutations in an Us3 gene (SEQ ID NO: 15), one or more activating mutations in an Us5 gene (SEQ ID NO: 14), one or more activating mutations in an Usl2 gene (SEQ ID NO: 16), or any combination thereof.
  • oHSV oncolytic Herpes Simplex Virus
  • HSV1 vector comprising a CMV immediate- early enhancer upstream of the promoter for HSV1 Us7 and HSV1 Us8.
  • the disclosed methods can comprise coating culture plates with recombinant protein A or protein G, culturing human (or mouse) peripheral blood mononuclear cells (PBMC) or purified monocytes with cytokines in the protein A or G-coated plate to generate macrophage or dendritic cells.
  • the disclosed methods can also include culturing human (or mouse) peripheral blood mononuclear cells (PBMC) or purified monocytes with any polymerized form of protein A, protein G, or other IgG-binding proteins.
  • These methods can similarly comprise coating culture plates with recombinant protein A or protein G, culturing human (or mouse) peripheral blood mononuclear cells (PBMC) or purified monocytes with cytokines in the protein A or G-coated plate to generate macrophage or dendritic cells.
  • PBMC peripheral blood mononuclear cells
  • Figures lA to II show differential cytolysis mediated by ectopic gene expression (DC-MEGE) that identified HSVl gE as an NK cell-activating molecule.
  • Figure 1 A is a flow diagram of the DC-MEGE assay.
  • Figure IB shows representative graphs of the DC-MEGE assay for representative HSVl genes.
  • Figure 1C is a bar graph showing DC-MEGE results for all 65 HSVl genes (n>4), wherein expression of HSVl genes UL12, UL30, Us3, Us8 and Usl2 promoted NK cytolysis, while expression of UL48, Us5 and Us6 inhibited NK cytolysis.
  • Figure ID shows cytotoxicity against transfected human glioma cell lines at the specified
  • Figures IF and 1G show phenotypes of primary human NK cells after culturing with transfected glioma cells for 7 hours.
  • Figure 1H shows cytotoxicity of primary human NK cells against glioma cells expressing Us8 in the presence of isotype or Us8/gE-specific antibody.
  • Data in Figures 1C, ID, and 1H are set forth as mean ⁇ sem.
  • Each dotted line in Figure IE, 1H and II links data acquired from the same donor. * p ⁇ 0.05, ** pO.01.
  • Figures 2A to 2G show IgG-linked gE and NK cell activation.
  • Figure 2A shows phenotypes of primary human NK cells after culturing with transfected glioma cells for 7 hours. Percentages of NK cells gaining expression of CD69 or CD107a, or NK cells losing both CD16a and CD62L expression are summarized for 14 donors.
  • Figures 2C and 2D show human PBMC washed with pH 7.4 or pH 4 media, and subsequently stained with lineage markers and human IgG Fc antibody; mean intensity of cell markers and Fc are shown and one representative of at least five donors is shown.
  • Figure 2E shows the presence of human IgG on NK cells from human donors.
  • Figure 2F shows phenotypes of NK cells from donors in Figure 2E after culturing with transfected glioma cells or K562 cells for 7 hour.
  • Figure 2G shows the percentage of NK cells positive for CD69 or CD 107a after co-culturing with glioma cells or K562, plotted against surface IgG intensity of corresponding human donors. Correlation analysis was conducted using linear regression (n>20).
  • Each dotted line in Figures 2A and 2B links data acquired from the same donor. * p ⁇ 0.05, ** pO.01.
  • Figures 3A to 3K show that IgG bridging was essential for NK cell activation by HSV gE.
  • Figure 3 A shows a model structure of a gE-IgGFc-CD16a ternary complex. Front view, side view and top view are shown respectively.
  • CD 16a is shown as a stick
  • gE is shown as a sphere
  • two monomers of IgG Fc dimer are shown as a ribbon.
  • Figure 3B shows binding of human IgG products (Fig. 3B) or CD 16a with or without human IgG products (Fig. 3C) to transfected glioma cells.
  • Figure 3D shows binding of CD 16a to infected glioma cells in the presence of human IgG products.
  • Figure 3E shows phosphorylation of CD3 ⁇ following NK cell stimulation as described in 1H.
  • Figures 3F and 3G show staining of lineage markers and protein A (Fig. 3F) or protein G (Fig. 3G) in human PBMC following a brief wash with pH 7.4 or pH 4 media. The numbers in these Figures are mean intensity of each staining.
  • Figure 31 shows primary human NK cells incubated with protein A or protein G, and subsequently assessed for cytotoxicity against glioma Us7+Us8 (Fig. 31).
  • Figure 3K shows an action model for immunostimulation mediated by IgG Fc (ADCC as an example).
  • Each dotted line in Fig. 3H and 3J links data acquired from the same donor.
  • Figures 3B, 3C, 3D, 3E, 3F and 3G were repeated at least 3 times. * pO.01.
  • Figures 4A to 4F show that passive ADCC promotes viral clearance in vivo.
  • Figure 4A shows cytotoxicity of primary human NK cells against infected glioma cells in the presence or absence of human IgG products.
  • Figure 4B shows cytotoxicity of primary human NK cells against transfected glioma cells in the presence or absence of human IgGl Fc.
  • Figure 4C shows cytotoxicity of primary mouse NK cells against glioma Us7+Us8 in the presence or absence of human IgGl Fc.
  • Figure 4D shows protection of mice against lethal HSV1 infection by human IgG products.
  • the data in Figures 4A, 4B and 4C are set forth as the mean ⁇ sem. * p ⁇ 0.05, ** p ⁇ 0.001.
  • Figures 5A to 5H show bacterial IgG-binding proteins activate NK cells through IgG bridging.
  • Figures 5A and 5B show phenotype (Fig. 5A) and IFN ⁇ production (Fig. 5B) of primary human NK cells after being cultured with soluble protein A, or in plates coated with protein A, or in protein A-coated plates that were blocked with mouse serum before NK cell culture.
  • Figure 5C shows human NK cells cultured in plates coated with media or protein A for 30 min, wherein cytotoxicity was assessed against glioma cells; the results shown are mean ⁇ sem.
  • Figure 5D shows phosphorylation of ⁇ 3 ⁇ after exposing primary human NK cells to stimuli indicated in the Figure for lh.
  • Figure 5E shows the phenotype of primary human NK cells after culture with bacteria for 7 hours. In some cases NK cells were pretreated with soluble protein A or protein G, or soluble protein A was pre-incubated with mouse serum or human IgG.
  • Figure 5G shows the phenotype of mouse NK cells after culturing in plates pre-coated with media or protein A.
  • Figure 5H shows the phenotypes of NK cells from BALB/c mice that were injected with control silicone beads or protein A-conjugated silicone beads.
  • Figures 5A, 5D, and 5E were repeated minimally on 4 donors.
  • Figure 6 shows the phenotype of primary human NK cells after culture for 7 hours in plates coated with inactivated pure wild type or Us8-deficient HSV1 F strain viruses. Isotype or Us8/gE-specific antibody was added to interfere with the interaction between NK cells and coated F strain viruses. Representative contour staining of 7 donors is shown.
  • Figure 7 shows the phenotype of primary human NK cells after being cultured for 7 hours with glioma cells expressing different HSV1 genes. A representative contour plot from one of 8 donors is shown.
  • Figure 8 shows the phenotype of NK cells from different donors after being cultured for 7 hours with transfected glioma cells or K562 cells.
  • Figures 9A and 9B show primary human NK cells treated with protein A or protein G, and subsequently cultured with K562 cells, IL12+IL18 or transfected glioma cells. Phenotyping was performed at 7 hours of culture. A representative contour plot from one of 8 donors is shown.
  • Figures 10A and 10B show human NK cells treated with medium alone, protein A or protein G, and subsequently cultured in plates coated with inactivated wildtype HSVl F strain. Phenotyping was performed after 7 hours of culture. A representative contour plot from one donor (Fig. 10A) and statistical summary for 5 donors (Fig. 10B) are shown.
  • Figures HA to 11D show NK cells cultured with infected glioma cells (Fig. 11 A, 11B), or transfected glioma cells (Fig. 11C, 11D), in the presence of medium alone, HSVl non-immune plasma ((-) plasma) or human IgGl Fc, and stained after 7h of culture.
  • a representative contour plot from one donor Fig. 11A and 11C
  • statistical summary of 7-9 donors Fig. 11B and 11D
  • Figure 12A shows serial diluted HSVl F strain mixed with PBS or IgG products, incubated for 30 min at room temperature, and titred on Vero cells for infectivity. All numbers are normalized to PBS treatment (negative control). Human IgG contained anti-HSVl IgG (positive control).
  • Figure 12B shows the phenotype of NK cells from BALB/c mice that were injected with human IgG Fc or rituximab for 24 hours.
  • Figure 13 A shows binding of mouse IgG2a to bacteria.
  • Figure 13B shows binding of CD16a to bacteria in the presence of human IgG products.
  • Figures 14A and 14B show the phenotype (Fig. 14A) and IFN ⁇ production (Fig. 14B) of primary human NK cells after culture with soluble streptococcus protein G, or in plates coated with protein G, or in protein G coated plates which were blocked with mouse serum before NK cell culture.
  • Figure 14C shows human NK cells cultured in plates coated with media or protein A for 30 min, wherein cytotoxicity was assessed against glioma cells. These results are shown as mean ⁇ sem.
  • Figure 15A shows the phenotype of mouse spleen NK cells from C57BL/6 and BALB/c after 24 hours culture with bacteria. This represents one of three
  • Figure 15D shows the phenotype of NK cells from BALB/c mice injected with soluble protein A for 24 hours. The Figures represent one of 3 experiments.
  • Figure 16 shows sequence alignment of protein A (UniProtKB: P99134), protein G (UniProtKB: P06654) and HSV1 gE (UniProtKB: P04488).
  • Figures 17A-17C show morphological and functional changes of human monocytes treated with bacterial IgG-binding proteins.
  • Figure 17A shows the morphology of human monocytes cultured in plates pre-coated with media, protein A, or protein G for 3h or 18h.
  • Figure 17B shows the result of a monocyte respiratory burst assay, in which human primary monocytes were cultured in plates coated with bovine serum (BSA), or protein A, or stimulated with phorbol 12-myristate 13-acetate (PMA; positive control) for a specified time.
  • BSA bovine serum
  • PMA phorbol 12-myristate 13-acetate
  • Figure 17C shows intracellular ILlbeta staining of monocytes as treated in Figure 17B.
  • Figure 18 shows that culture plates pre-coated with protein A and protein G increased efficacy of generating dendritic cells from human monocytes.
  • One million purified human monocytes were seeded in plates on day 0 and cultured with media supplemented with 20ng/ml GM-CSF and IL4 (lOng/ml) to generate dendritic cells. Cells unattached to the plate were removed on day 1. Cells attached to plates were counted on day 1, day 4 and day 7.
  • FIG 19 shows that immobilized protein A and protein G induced respiration burst in primary human monocytes.
  • Freshly isolated human monocytes were cultured under the indicated conditions in the presence of dihydrorhodaminel23 (DHR123) for lOmin or 30min. Cells were analyzed using flow cytometry.
  • DHR123 dihydrorhodaminel23
  • Figure 20 shows that immobilized protein A and protein G induced the production of ⁇ in primary human monocytes. Freshly isolated human monocytes were cultured under the indicated conditions for 6 hours and stained for ⁇ .
  • Figure 21 shows that immobilized protein A and protein G changed the phenotype of primary human monocytes. Freshly isolated human monocytes were cultured under the indicated conditions for 6 hours and stained for HLA-DR and CD14.
  • Figure 22 shows that immobilized protein A and protein G induced respiration burst in primary human neutrophils. Freshly isolated human neutrophils were cultured under the indicated conditions in the presence of DHR 123 for lOmin or 30min. Cells were analyzed using flow cytometry.
  • FIGs 23 A and 23B show that the binding of human Fey receptor CD32 and CD64 to Staphylococcus aureus required the presence of human IgG and protein A.
  • Wild type (wt) or protein A deficient (Spa-) Staphylococcus aureus bacteria were incubated with fluorescently labeled human Fey receptor CD32 as show in in Figure 23 A and CD64 as shown in Figure 23B in the absence or presence of humanized antibody rituximab (Ritu). Filled grey histograms represent unstained bacteria.
  • Figure 24 shows that immobilized protein A, protein G and human IgG changed the phenotype of monocyte-derived dendritic cells.
  • Freshly isolated human monocytes were cultured in the presence of IL4 and GM-CSF in treated plates for specified times and stained for CD86 and CDlc.
  • FIG. 25 shows that immobilized protein A, protein G and human IgG changed the function of monocyte-derived dendritic cells.
  • Dendritic cells were generated from monocytes cultured in plates for 5 days, activated and loaded with Epstem-Barr vims (EBV) replication activator BamHI Z leftward reading frame 1 (BZLF1) peptide for 24 hours, and cultured with autologous T cells for 10 days. EBV-specific cytotoxic T cells were determined by tetramer staining.
  • EBV Epstem-Barr vims
  • Figures 26A and 26B show binding of human and pathogen IgG-binding proteins to IgG molecules from different species.
  • the experimental procedures used are shown in Figure 26A and representative results are shown in Figure 26B for determining interactions between different IgG and IgG-binding proteins using flow cytometry.
  • IgG-binding proteins were cloned individually to fuse with 2 A protein from the Thosea asigna virus and green fluorescent protein (GFP), wherein GFP reports expression of IgG-binding protein.
  • GFP green fluorescent protein
  • To determine interactions between IgG and IgG-binding proteins glioma cells were transfected with IgG binding protein and incubated with fluorescently labeled IgG from different species.
  • FIGS. 27A and 27B show that human primary NK cells, B cells, monocytes and granulocytes are naturally coated with human IgG molecules, which is accessible for protein A binding.
  • Human PBMC were washed with pH7.4 or pH4 media, and subsequently stained with fluorescently labeled lineage markers and mouse anti- human IgG Fc antibody as shown in Figure 27 A, or fluorescently labeled lineage markers and protein A as shown in Figure 27B. Mean intensity of cell markers, human Fc and protein A are shown.
  • Figures 28A-28E show that CMV IgG binding protein gp68 is capable of forming a ternary complex with human IgGl Fc and CD 16a.
  • Figure 28A illustrates the results obtained from glioma cells transfected with individual IgG binding proteins and incubated with fluorescently labeled rituximab.
  • Figure 28B illustrates the results obtained from glioma cells transfected with individual IgG binding proteins and incubated with human IgGl Fc.
  • Figures 28C, 28D, and 28E illustrate the results obtained from transfected glioma cells incubated with fluorescently labeled CD 16a alone (Figure 28C) or in the presence of rituximab (Figure 28D) or human IgGl Fc ( Figure 28E). Filled gray areas represent cells not expressing IgG binding proteins. Heavy black lines represent cells expressing IgG binding proteins.
  • Figures 29A and 29B show the phenotypes of primary human NK cells after being cultured for 7 hours with transfected glioma cells.
  • Figure 29A shows the percentages of NK cells gaining expression of CD69 or CD 107a and cells losing both CD 16a and CD62L.
  • Figure 29B is a graphical summary of the results for 6 donors. * p ⁇ 0.05.
  • Figure 30 demonstrates that mouse cytomegalovirus infection allows 3T3 cells to bind non-immune mouse IgG.
  • 3T3 cells were not infected (filled grey) or infected with murine cytomegalovirus (MCMV; heavy black) for 24h, and incubated with fluorescent labeled IgG. Cells were collected using flow cytometry.
  • MCMV murine cytomegalovirus
  • Ranges can be expressed herein and when such a range is expressed, another aspect includes from the one particular value and/or to the other particular value. Similarly, when values are expressed as approximations, it will be understood that the particular value forms another aspect. It will be further understood that the endpoints of each of the ranges are significant both in relation to the other endpoint, and independently of the other endpoint. It is also understood that when a value is disclosed, then “less than or equal to” the value, “greater than or equal to the value,” and possible ranges between values are also disclosed, as appropriately understood by the skilled artisan. It is also understood that throughout the application data are provided in a number of different formats and that this data represent endpoints and starting points and ranges for any combination of the data points. It is also understood that each unit between two particular units are also disclosed. For example, if 10 and 15 are disclosed, then 1 1, 12, 13, and 14 are also disclosed.
  • subject or “patient” refers to any individual who is the target of administration of a pharmaceutical composition of the invention or treatment using a method as disclosed herein.
  • the subject can be a vertebrate, for example, a mammal.
  • the subject can be a human or veterinary patient.
  • patient specifically refers to a subject under the treatment of a clinician, e.g., physician.
  • prevention is meant to stop a particular event or characteristic, to stabilize or delay the development or progression of a particular event or characteristic, or to minimize the chances that a particular event or characteristic will occur. Prevent does not require comparison to a control as it is typically more absolute than, for example, the term “reduce.” As used herein, something could be reduced but not prevented, but something that is reduced could also be prevented. Likewise, something could be prevented but not reduced, but something that is prevented could also be reduced. It is understood that where reduce or prevent are used, unless specifically indicated otherwise, the use of the other word is also expressly disclosed.
  • treatment refers to the medical management of a subject with the intent to cure, ameliorate, stabilize, or prevent a disease, pathological condition, or disorder.
  • This term includes active treatment, that is, treatment directed specifically toward the improvement of a disease, pathological condition, or disorder, and also includes causal treatment, that is, treatment directed toward removal of the cause of the associated disease, pathological condition, or disorder.
  • this term includes palliative treatment, that is, treatment designed for the relief of symptoms rather than the curing of the disease, pathological condition, or disorder; preventative treatment, that is, treatment directed to minimizing or partially or completely inhibiting the development of the associated disease, pathological condition, or disorder; and supportive treatment, that is, treatment employed to supplement another specific therapy directed toward the improvement of the associated disease, pathological condition, or disorder.
  • a target cell refers to a target of an immune effector cell that expresses an Fc binding protein. This includes virally infected cells and also microorganisms, such as bacteria and fungi.
  • a "host cell” includes an individual cell or cell culture which can be or has been a recipient of a virus and/or viral vector.
  • Host cells include progeny of a single host cell, and the progeny may not necessarily be completely identical (in morphology or of total DNA complement) to the original parent cell due to natural, accidental, or deliberate mutation and/or change.
  • gene is well understood in the art to mean a polynucleotide encoding a polypeptide.
  • a gene can include non-coding regions including, but not limited to, introns, transcribed but untranslated segments, and regulatory elements upstream and downstream of the coding segments.
  • polypeptide polypeptide
  • peptide protein
  • proteins proteins that are post-translationally modified through reactions that include glycosylation, acetylation, myristoylation, and phosphorylation.
  • antibody specifically covers monoclonal antibodies (including full length monoclonal antibodies), polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments so long as they exhibit the desired biological activity.
  • a “native sequence Fc region” comprises an amino acid sequence identical to the amino acid sequence of an Fc region found in nature (e.g., SEQ ID NO: 1), with the caveat that naturally occurring Fc regions and fragments can be heterogeneous in amino acid sequence as the consequence, inter alia, of population-related genetic heterogeneity (although species-specific "canonical" sequences have been derived.
  • Human immunoglobulins, specifically IgG embodiments thereof, are known to exhibit sequence polymorphisms classically termed allotypes. See, Jefferis and Lefranc, 209, Human immunoglobulin allotypes: Possible implications for immunogenicity, mAbs 1 : 1-7.
  • IgG isotypes (IgGl, IgG2, IgG3, and IgG4) comprise such allotypes throughout the scope of naturally occurring variability, including combinations and mixtures thereof as well as isolated and purified allotypes of such isotypes.
  • variant Fc region comprises an amino acid sequence which differs from that of a native sequence Fc region by virtue of at least one "amino acid modification.”
  • the variant Fc region has at least one amino acid substitution compared to a native sequence Fc region or to the Fc region of a parent polypeptide, e.g., from about one to about ten amino acid substitutions, and preferably from about one to about five amino acid substitutions in a native sequence Fc region or in the Fc region of the parent polypeptide.
  • the variant Fc region herein will preferably possess at least about 80% sequence identity with a native sequence Fc region and/or with an Fc region of a parent polypeptide, and more preferably at least about 90% sequence identity therewith, more preferably at least about 95% sequence identity therewith, even more preferably, at least about 99% sequence identity therewith.
  • Fc receptor or “FcR” are used to describe a receptor that binds to the Fc region of an antibody.
  • An FcyR is a receptor that binds to the Fc region of an IgG antibody.
  • FcyRs includes receptors of the FcyRI, FcyRII, and FcyRIII subclasses, including allelic variants and alternatively spliced forms of these receptors.
  • FcyRII receptors include FcyRIIA (an “activating receptor”) (e.g., SEQ ID NO: 21) and FcyRIIB (an “inhibiting receptor”) (e.g., SEQ ID NO: 22), which have similar amino acid sequences that differ primarily in the cytoplasmic domains thereof.
  • Activating receptor FcyRIIA contains an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain.
  • Inhibiting receptor FcyRIIB contains an immunoreceptor tyrosine-based inhibition motif (ITIM) in its cytoplasmic domain.
  • Fc binding protein refers to any protein that binds IgG Fc region outside of the FcyR binding sites.
  • the Fc binding protein binds a region of the Fc region of IgG without interfering with the binding of FcyR to the IgG Fc.
  • an effective amount is meant an amount sufficient to bring about a beneficial or desired clinical result (e.g. improvement in clinical condition).
  • a “promoter” is generally a sequence or sequences of DNA that function when in a relatively fixed location in regard to the transcription start site.
  • promoter contains core elements required for basic interaction of RNA polymerase and transcription factors and can contain upstream elements and response elements.
  • Enhancer generally refers to a sequence of DNA that functions at no fixed distance from the transcription start site and can be either 5' or 3' to the transcription unit. Furthermore, enhancers can be within an intron as well as within the coding sequence itself. They are usually between 10 and 300 bp in length, and they function in cis. Enhancers function to increase transcription from nearby promoters.
  • Enhancers like promoters, also often contain response elements that mediate the regulation of transcription. Enhancers often determine the regulation of expression.
  • reagents, methods, and pharmaceutical compositions for enhancing passive ADCC in a subject are provided herein.
  • methods for treating a subject infected with a pathogen encoding a Fc-binding protein wherein the subject is administered a pharmaceutical composition of the invention comprising a domain that binds an FcyR on an immune effector cell and a non- overlapping domain that binds the pathogen-encoded Fc binding protein.
  • reagents, methods, and pharmaceutical compositions for preventing neurologic damage in a subject with HSVl infection and for preventing death in a subject with HSVl infection are provided.
  • the immunological polypeptide is an antibody, more specifically an IgG antibody and in particular an Fc fragment of an IgG antibody. Also within the scope of such immunological polypeptides is IgG-containing antisera.
  • IgG-containing antisera Also within the scope of such immunological polypeptides is IgG-containing antisera.
  • the immunological polypeptide comprises an Fc region of an immunoglobulin G (IgG) antibody but does not comprise the antigen-binding region of an antibody, e.g., Fab region.
  • the immunological polypeptide can be a fragment of an IgGl (e.g., SEQ ID NO: 6), IgG2 (e.g., SEQ ID NO: 7), IgG3 (e.g., SEQ ID NO: 8) or IgG4 (e.g., SEQ ID NO: 9) immunoglobulin; the sequences set forth herein are exemplary, and the skilled worker will recognize that the claimed reagents, methods, and pharmaceutical compositions comprise allotypic variation of IgG isotyopes.
  • the immunological polypeptide comprises an Fc region of an IgG immunoglobulin, or a fragment thereof capable of simultaneously binding an FcyR and an Fc binding protein, or a fragment thereof capable of binding either an FcyR or an Fc binding protein, but not both (e.g., IgG3) and does not comprise the antigen-binding region of an antibody, e.g., Fab region.
  • the immunological polypeptides of the disclosure comprise a domain that has been altered (naturally, by genetic engineering, or otherwise) to bind the FcyR on an immune effector cell with a higher affinity than IgG found in nature and/or a non-overlapping domain that binds the pathogen-encoded Fc binding protein with a higher affinity than an IgG found in nature.
  • the immunological polypeptide can be a recombinant protein, containing fragments of human IgGl (S6B291; SEQ ID NO: 10).
  • the recombinant protein comprises residue 235-466 of human IgGl (S6B291) (SEQ ID NO: 2), or equivalent homologue sequence of IgG2, IgG3, or IgG4.
  • the immunological polypeptide also can be made by papain or plasmin digestion of human IgGl, IgG2, IgG3 or IgG4 as known in the art (see, for example, Coding, J. (1983). Monoclonal Antibodies: Principles and Practice. Academic Press Inc., London, U K).
  • the polypeptide can be a recombinant protein, containing residue 262-466 of human IgGl (S6B291) (SEQ ID NO: 1), or equivalent homologue sequence of IgG2, IgG3, or IgG4.
  • the immunological polypeptide comprises two or more Fc regions of an IgG
  • the Fc region is modified by for example PEGylation or myrisoylation.
  • the immunological polypeptide comprises an Fc gamma receptor binding site that has been modified to enhance binding to an Fc gamma receptor. In some embodiments, this involves a structure-guided design of the IgG-Fcy receptor interface to produce a higher binding affinity.
  • this involves removal of the fucose linked to Asn297 of an IgG molecule.
  • this involves chemically modifying the polypeptide to enhance Fey receptor binding (see, for example, Konno et al. (2010) Controlling Fucosylation Levels of Antibodies with Osmolality during Cell Culture. In: Kamihira M., Katakura Y., Ito A. (eds) Animal Cell Technology: Basic & Applied Aspects. Animal Cell Technology: Basic & Applied Aspects, vol 16. Springer, Dordrecht).
  • the immune effector cell is an immune cell that expresses an Fc gamma receptor.
  • Fc gamma receptors include CD 16a, CD 16b, CD32, and CD64. Therefore in some embodiments, the immune effector cell is a T-cell, a B cell, a natural killer (NK) cell, a monocyte, a macrophage, a neutrophil or granulocyte, or a dendritic cell.
  • NK natural killer
  • the methods disclosed herein are broadly applicable to any disease or condition in which killing or interruption of target cells or pathogens expressing Fc binding proteins is desirable.
  • a virus or an infected target cell infected with a virus expresses an Fc binding protein.
  • the herpes simplex viruses 1 (HSV1) and HSV2 expresses the Fc binding protein glycoprotein E (gE)(SEQ ID NO: 5) that can induce passive ADCC.
  • the herpes virus cytomegalovirus (CMV) expresses the Fc binding protein 68kDa-glycoprotein (gp68) that can induce passive ADCC. Note that CMV gp32 also binds IgG Fc, but it competes with the same binding site on IgG Fc as CD16a, so it does not induce passive ADCC.
  • VZV Varicella zoster virus expresses the IgG binding protein gE, which is a homologue of HSV1 gE (reference PMC241147 and PMID: 2167554).
  • Viruses that can be targeted by the reagents, methods, and pharmaceutical compositions of the invention in general include but are not limited to those in the following families: picornaviridae; caliciviridae; togaviridae; flaviviridae;
  • coronaviridae coronaviridae; rhabdoviridae; filoviridae; paramyxoviridae; orthomyxoviridae;
  • bunyaviridae bunyaviridae; arenaviridae; reoviridae; retroviridae; hepadnaviridae; parvoviridae; papovaviridae; adenoviridae; herpesviridae; and poxyviridae.
  • the pathogen is a bacterium, such as Staphylococcus aureus, Streptococcus, or Escherichia coli.
  • Staphylococcus aureus expresses the Fc binding protein A
  • Streptococcus expresses the Fc binding proteins protein G, protein H, and Ml protein
  • Escherichia coli expresses the Fc binding protein Ml protein. Therefore, in some embodiments, the Fc binding protein comprises protein G, protein H, or Ml protein.
  • Bacteria in general include but are not limited to: P. aeruginosa; E. coli, Klebsiella sp.; Serratia sp.; Pseudomanas sp.; P. cepacia; Acinetobacter sp.; S.
  • E. faecalis S. pneumonias; S. aureus; Haemophilus sp.; Neisseria Sp.; N. meningitidis ;Bacteroides sp.; Citrobacter sp.; Branhamella sp.; Salmonelia sp.; Shigel la sp. ; S. pyogenes;
  • Mycoplasma sp. Chlamydia sp. ; Rickettsia sp. ; Spirochaeta;
  • Parasites include but are not limited to: Plasmodium falciparum, P. vivax, P. ovale, P. malaria; Toxoplasma gondii; Leishmania mexicana, L. tropica, L. major, L. aethiopica, L. donovani, Trypanosoma cruzi, T. brucei, Schistosoma mansoni, S. haematobium, S. japonium; Trichinella spiralis; Wuchereria bancrofti; Brugia malayli; Entamoeba histolytica; Enterobius vermiculoarus; Taenia solium, T.
  • Paragonimus westermani P. caliensis; Chlonorchis sinensis; Opisthorchis felineas, G. Viverini, Fasciola hepatica Sarcoptes scabiei, Pediculus humanus; Phthirius pubis; and Dermatobia hominis.
  • Fungi in general include but are not limited to: Cryptococcus neoformans; Blastomyces dermatitidis; Aiellomyces dermatitidis; Histoplasfria capsulatum;
  • Coccidioides immitis Coccidioides immitis; Candids species, including C. albicans, C. tropicalis, C.
  • Rhizopus species Rhizomucor species
  • the immunological polypeptide is a fragment of an IgG immunoglobulin modified to not bind an Fc gamma receptor (FcyR).
  • the immunological polypeptide does not comprise amino acids 235-262 of SEQ ID No. 10, or functional equivalent thereof.
  • the polypeptide can be an IgG fragment that lacks a CD 16a, CD32, or CD64 binding site.
  • this can be is a fragment of an IgGl, IgG2, IgG3 or IgG4 immunoglobulin.
  • the immunological polypeptide is a fragment from more than one subclass of antibody.
  • compositions for reducing inflammation in a subject receiving anticancer therapy comprise administering a
  • an immunological polypeptide comprising a region that binds to an Fc binding protein but does not comprise a region that binds to an Fc gamma receptor (FcyR); and administering an anti-cancer therapy comprising a monoclonal antibody drug, wherein the immunological polypeptide does not comprise amino acids 235-262 of SEQ ID No. 10, or functional equivalent thereof.
  • the subject is being treated with a therapeutic antibody such as rituximab, tocilizumab, tositumomab, trastuzumab bevacizumab, brentuximab vedotin, cetuximab, daratumumab, ipilimumab, ofatumumab, panitumumab, alemtuzumab or pembrolizumab.
  • Most therapeutic monoclonal antibody drugs are produced from mammalian host cell lines to target specific antigens. Side effects and reduced therapeutic efficacy can result from sequestration of the antibody by various native Fc binding proteins.
  • the disclosed methods can decrease side effects of antibody mediated infusion toxicity (the so-called "first dose effect”), yet enhance antibody-based immunotherapy.
  • reagents, methods, and pharmaceutical compositions for treating a subject undergoing oncolytic HSV1 viral therapy comprising administering a pharmaceutical composition to a subject comprising an polypeptide comprising a region that binds to a binds a Fc binding protein on a target cell but does not comprise a region that binds to a FcyR.
  • a pharmaceutical composition comprising an polypeptide comprising a region that binds to a binds a Fc binding protein on a target cell but does not comprise a region that binds to a FcyR.
  • the immunological polypeptide does not comprise amino acids 235-262 of SEQ ID No. 10, or functional equivalent thereof.
  • the methods can be used to inhibit passive ADCC early after oncolytic viral infection of a tumor so the virus can spread to other tumor cells. While it may be advantageous to inhibit passive ADCC early after oncolytic viral infection of a tumor so the virus can spread to other tumor cells, the disclosed methods can also be used to enhance passive ADCC after the tumor cells are infected to enhance killing of tumor cells.
  • the methods disclosed herein provide a pharmaceutical composition comprising an immunological polypeptide comprising a domain that binds an FcyR on an immune effector cell and a non-overlapping domain that binds n Fc binding protein on a target cell.
  • the immunological polypeptide is an antibody, more specifically an IgG antibody and in particular an Fc fragment of an IgG antibody. Also within the scope of such immunological polypeptides is IgG containing antisera.
  • immunological polypeptides useful in the methods and comprising the pharmaceutical compositions disclosed herein is that the efficacy and utility of said IgG antibodies is independent of their antigenic specificity.
  • the immune effector cell can be any immune cell that expresses an Fc gamma receptor.
  • Fc gamma receptors include CD 16a, CD 16b, CD32, and CD64. Therefore in some embodiments, the immune effector cell is a T-cell, a B cell, a natural killer (NK) cell, a monocyte, a macrophage, a neutrophil or granulocyte, or a dendritic cell.
  • NK natural killer
  • the method is referred to herein as differential cytolysis mediated by ectopic gene expression (DC- MEGE). This method provides for a comprehensive understanding of the interaction between human lymphocytes and each gene expressed by target cells infected with a virus.
  • the disclosed methods can comprise transfecting a host cell with an expression vector comprising a candidate viral gene and a reporter gene operably linked to an expression control sequence, exposing the transfected host cells and non- transfected host cells to a cytotoxic immune effector cell, and assaying the exposed transfected host cells and non-transfected host cells to measure cell death as a function of reporter gene expression or activity.
  • a decrease in cell death by the transfected host cells compared to non-transfected host cells is an indication that the viral gene suppressed the immune effector cell or in other words, protected the transfected host cell from the immune effector cell; and an increase in cell death by the transfected host cells compared to non-transfected host cells is an indication that the viral gene activated the immune effector cell or in other words, made the transfected host cell susceptible to the immune effector cell.
  • the reporter gene is a fluorescence gene, wherein the exposed transfected host cells and non-transfected host cells are assayed by flow cytometry to measure cell death as a function of fluorescence, wherein an increase in the percentage of fluorescent transfected host cells compared to non-transfected host cells is an indication that the viral gene protected the transfected host cell from the immune effector cell, and wherein a decrease in mean fluorescence by the transfected host cells compared to non-transfected host cells is an indication that the viral gene made the transfected host cell susceptible to the immune effector cell.
  • a fluorescence reading where only non-infected, non-fluorescent cells are killed, and fluorescence increases is an indication that the transfected target cell was protected from killing.
  • a fluorescence reading where only infected, fluorescent cells are killed, and fluorescence decreases, is an indication that the transfected target cell was susceptible to killing.
  • a fluorescence reading where there is no change in fluorescence is an indication that the target cell remained unchanged to the cytotoxic lymphocyte killing.
  • fluorescent protein genes includes: AcGFPl, Azami-Green, Azurite BFP, BFP, CFP, Citrine, Clover, CopGFP, Cycle 3 GFP, CyOFPl, CyPet, dlEGFP, d2ECFP, d2EGFP, d2EYFP, d4EGFP, daGFP, Dendra2, dKeima-Red, dKeima570, Dronpa-Greenl, Dronpa-Green3, DsRed-Express, DsRed-Express2, DsRed-Max, DsRed-Monomer, DsRed.T3, DsRedl, DsRed2, dTomato, E2-Crimson, E2-Orange, E2-Red/Green, EBFP, EBFP2, ECFP, ecliptic pHluorin, EGFP, Emerald GFP, EosFP, EYFP, Fast-FT, Fluorescent Timer, FusionRed, GFP, GFP
  • pTurboFP602-PRL pTurboGFP-B, pTurboGFP-C, pTurboGFP-N, pTurboGFP-PRL, pTurboRFP-B, pTurboRFP-C, pTurboRFP-N, pTurboRFP-PRL, pTurboYFP-B, pTurboYFP-C, pTurboYFP-N, pTurboYFP-PRL, pZsGreen, pZsGreenl-1, pZsGreenl-Cl, pZsGreenl-Nl, pZsYellow, pZsYellowl-Cl, pZsYellowl-Nl, ratiometric pHluorin, Rhacostoma GFP, rsEGFP, rsEGFP2, rsTagRFP, Slow-FT, super-
  • the process can be repeated for each gene in a viral genome.
  • the method can further comprise of repeating the process for each gene individually, or for combinations of 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 40, 50, or more genes in a viral genome.
  • the cytotoxic immune effector cell can be a CD4+ T-cell, a CD 8+ T-cell, a natural killer (NK) cell, a macrophage, a granulocyte, or a dendritic cell.
  • NK natural killer
  • the method described above can be repeated for each candidate immune effector cell alone, or in combination with other immune cells or bioactive agents.
  • the disclosed methods can also be used to assay the effects of candidate drugs on a gene's ability to affect cytolysis. For example, if a gene is found to protect a cell from killing by immune effector cells, a series of candidate drugs can be added in future assays to find a drug that inhibits the gene's protection.
  • a host cell is preferably selected based on its known susceptibility or resistance to killing by an immune effector cell when virally infected, expressing exogenous proteins, or in native status.
  • Host cells can be primary cells isolated from an animal or a human subject.
  • the host cells can be a cell line, such as an
  • Host cells can include a single cell type, or a mixture of cells. Host cells can be cultured in suspension, on a surface (two-dimensional), or in a three- dimensional matrix.
  • the methods disclosed herein comprise exposing transfected host cells and non-transfected host cells to a cytotoxic immune effector cell. This step can involve co-culturing the host cells and cytotoxic immune effector cells under standard culture condition (37°C with 5% CO2) or relevant experimental settings that enhance or inhibit the function of immune cells and host cells.
  • GBM Oncolytic HSV Glioblastoma multiforme
  • oHSV oncolytic HSV
  • HSV Us8, UL12, UL30, US3, and Usl2 genes make glioma cells more susceptible to killing by NK cells. Therefore, also disclosed herein is a recombinant oncolytic Herpes Simplex Virus (oHSV), comprising one or more activating mutations in an Us 8 gene, one or more activating mutations in an UL12 gene, one or more activating mutations in an UL30 gene, one or more activating mutations in an Us3 gene, one or more activating mutations in an Us 12 gene, or any combination thereof.
  • oHSV oncolytic Herpes Simplex Virus
  • the disclosed oHSV may be derived from several different types of herpes viruses.
  • the Herpesviridae are a large family of DNA viruses that cause diseases in humans and animals. Herpes virus is divided into three subfamilies, alpha, beta, and gamma. Herpes viruses all share a common structure and are composed of relatively large double-stranded, linear DNA genomes encoding 100-200 genes encased within an icosahedral protein cage called the capsid which is itself wrapped in a lipid bilayer membrane called the envelope.
  • the large genome provides many non-essential sites for introducing one or more transgenes without inactivating the virus (e.g., without completely inhibiting infection or replication).
  • viral vectors are preferably modified (e.g., replication conditional, attenuated) so that they do not have undesirable effects (e.g., killing normal cells, causing disease).
  • oncolytic Herpes virus refers to any one of a number of therapeutic viruses having a Herpes virus origin that are useful for killing cancer cells, particularly cancer stem cells, and/or inhibiting growth of a tumor, for example by killing cancer stem cells in the tumor.
  • an oncolytic Herpes virus is a mutant version of a wild-type Herpes virus.
  • the wild-type Herpes virus is of the subfamily alpha (i.e., is a Herpes simplex virus)
  • the oncolytic Herpes viruses may be referred to as an oncolytic Herpes Simplex virus (oHSV).
  • the oHSV is a replication-conditional Herpes virus.
  • Replication-conditional Herpes viruses are designed to preferentially replicate in actively dividing cells, such as cancer cells, in particular cancer stem cells. Thus, these replication-conditional viruses target cancer cells for oncolysis, and replicate in these cells so that the virus can spread to other cancer cells. In preferred embodiments, replication conditional Herpes viruses target cancer stem cells for oncolysis, and replicate in these cells so that the virus can spread to other cancer stem cells.
  • the disclosed oHSV may comprise any one of a number of mutations that affect expression of a viral gene.
  • a mutation is in virulence gene that contributes to the pathogenicity of the virus to a host organism.
  • the mutation may be a point mutation, a deletion, an inversion, or an insertion.
  • the mutation is an inactivating mutation.
  • activating mutation is intended to broadly indicate a mutation or alteration to a gene wherein the expression of that gene is significantly decreased, or wherein the gene product is rendered nonfunctional, or its ability to function is significantly decreased.
  • one aspect involves viral mutants with defects in the function of a viral gene needed for nucleic acid metabolism, such as thymidine kinase (Martuza et al, 1991, Science 252:854-856), ribonucleotide reductase (RR) (Goldstein & Weller, 1988, J. Virol. 62: 196-205; Boviatsis et al, 1994, Gene Ther. 1 :323-331; Boviatsis et al, 1994, Cancer Res. 54:5745-5751 ; Mineta ei a/., 1994, Cancer Res. 54:3363-3366), or uracil-N-glycosylase (Pyles and Thompson, 1994, J. Virol. 68:4963-4972).
  • Another aspect involves viral mutants with defects in the function of the ⁇ -34.5 gene
  • the disclosed oHSV can comprise viruses that are based on herpes viruses, such as herpes simplex viruses (HSV), for example, HSV-1 (e. g., HSV-1 strain F or strain Patton) or HSV-2, that include an inactivating mutation in a virulence gene.
  • HSV-1 e. g., HSV-1 strain F or strain Patton
  • HSV-2 e. g., HSV-2 strain F or strain Patton
  • this mutation can be an inactivating mutation in the ⁇ -34.5 gene, which is the major HSV neurovirulence determinant.
  • viruses described above and herein and elsewhere can include an additional mutation or modification that is made to prevent reversion of the virus to wild type.
  • the virus can include a mutation in the ICP6 gene (SEQ ID NO: 26), which encodes the large subunit of ribonucleotide reductase.
  • the disclosed oHSV can also include sequences encoding a heterologous gene product, such as a vaccine antigen or an immunomodulatory protein.
  • Virus carrying heterologous gene products may also be referred to as augmented viruses
  • viruses also contain a heterologous nucleic acid sequence encoding one or more therapeutic agents, for example, a cytotoxin, an immunomodulatory protein (i.e., a protein that either enhances or suppresses a host immune response to an antigen), a tumor antigen, small interfering nucleic acid, an antisense RNA molecule, or a ribozyme.
  • immunomodulatory proteins include, e. g., cytokines (e. g., interleukins, alpha-interferon, beta-interferon, gamma-interferon, tumor necrosis factor, granulocyte macrophage colony stimulating factor (GM-CSF), macrophage colony stimulating factor (M-CSF), and granulocyte colony stimulating factor (G- CSF)), chemokines (e.g., neutrophil activating protein (NAP), macrophage chemoattractant and activating factor (MCAF), RANTES, and macrophage inflammatory peptides MIP-1 a and MIP-lb), complement components and their receptors, immune system accessory molecules (e.g., B7.1 and B7.2), adhesion molecules (e.g., ICAM-1, 2, and 3), and adhesion receptor molecules.
  • cytokines e. g., interleukins, alpha-interferon, beta-interferon, gamma-interferon, tumor
  • tumor antigens examples include, in non-limiting examples, the E6 and E7 antigens of human papillomavirus, EBV-derived proteins (Van der Bruggen et al, 1991, Science 254: 1643-1647), mucins (Livingston et al, 1992, Curr. Opin. Immun. 4 (5): 624-629), such as MIJC1 (Burchell et al, 1989, Int. J. Cancer 44: 691-696), melanoma tyrosinase, and MZ2-E (Van der Bruggen et al, supra).
  • E6 and E7 antigens of human papillomavirus EBV-derived proteins
  • mucins Livingston et al, 1992, Curr. Opin. Immun. 4 (5): 624-629
  • MIJC1 Berchell et al, 1989, Int. J. Cancer 44: 691-696
  • melanoma tyrosinase
  • Therapeutic agents can also be an RNA molecule, such as an antisense RNA molecule that, by hybridization interactions, can be used to block expression of a cellular or pathogen mRNA.
  • the RNA molecule can be a ribozyme (e.g., a hammerhead or a hairpin-based ribozyme) designed either to repair a defective cellular RNA, or to destroy an undesired cellular or pathogen-encoded RNA (see, e.g., Sullenger, 1995, Chem. Biol. 2 (5): 249-253; Czubayko et ctl, 1997, Gene Ther. 4 (9): 943-949; Rossi, 1997, Ciba Found. Symp.
  • the therapeutic agent can be a small interfering nucleic acid molecule capable of inhibiting expression of a gene associated with the cancer, such as an oncogene.
  • Small interfering nucleic acids e.g., shRNAs, miRNAs
  • shRNAs small interfering nucleic acids
  • miRNAs small interfering nucleic acids that inhibit the expression of these genes and their homologues are useful as therapeutic agents in certain embodiments of the methods.
  • Oncogenes associated with various cancers are well known in the art and disclosed, in non-limiting examples, in Cooper, 1995, Oncogenes. Jones and Bartlett Publishers, and Vogelstein and Kinzler, 1998, The Genetic Basis of Human Cancer. McGraw-Hill the contents are incorporated herein by reference in their entirety.
  • a heterologous nucleic acid sequence can be inserted into the disclosed oHSV in a location that renders it under the control of a regulatory sequence of the virus.
  • the heterologous nucleic acid sequence can be inserted as part of an expression cassette that includes regulatory elements, such as promoters or enhancers.
  • regulatory elements can be selected by those of ordinary skill in the art based on, for example, the desired tissue-specificity and level of expression.
  • a cell-type specific or tumor-specific promoter can be used to limit expression of a gene product to a specific cell type. This is particularly useful, for example, when a cytotoxic, immunomodulatory, or tumor antigenic gene product is being produced in a tumor cell in order to facilitate its destruction.
  • tissue-specific promoters local administration of the viruses of the invention can result in localized expression and effect.
  • non-tissue specific promoters examples include the early Cytomegalovirus (CMV) promoter (U.S. Pat. No. 4,168,062) and the Rous Sarcoma Virus promoter (Norton et al, 1985, Molec. Cell. Biol. 5: 281). Also, HSV promoters, such as HSV-1 IE and IE 4/5 promoters, can be used.
  • CMV Cytomegalovirus
  • HSV promoters such as HSV-1 IE and IE 4/5 promoters, can be used.
  • tissue-specific promoters examples include, for example, prostate-specific antigen (PSA) promoter, which is specific for cells of the prostate; desmin promoter, which is specific for muscle cells (Li et al, 1989, Gene 78: 243; Li et al, 1991, J. Biol. Chem. 266: 6562; Li et al, 1993, J. Biol. Chem. 268: 10403); enolase promoter, which is specific for neurons (Forss-Petter et al, 1986, J. Neuroscience Res. 16 (1): 141-156); beta-globin promoter, which is specific for erythroid cells (Townes et al, 1985, EMBO J.
  • PSA prostate-specific antigen
  • desmin promoter which is specific for muscle cells
  • enolase promoter which is specific for neurons
  • beta-globin promoter which is specific for erythroid cells (Townes et al, 1985, EMBO J.
  • tau-globin promoter which is also specific for erythroid cells (Brinster et al, 1980, Nature 283: 499); growth hormone promoter, which is specific for pituitary cells (Behringer et al, 1988, Genes Dev. 2: 453); insulin promoter, which is specific for pancreatic beta cells (Selden et al, 1986, Nature 321 : 545); glial fibrillary acidic protein promoter, which is specific for astrocytes (Brenner et al, 1994, J. Neurosci. 14: 1030); tyrosine hydroxylase promoter, which is specific for catecholaminergic neurons (Kim et al, 1993, J. Biol. Chem.
  • amyloid precursor protein promoter which is specific for neurons (Salbaum et al, 1988, EMBO J. 7: 2807); dopamine beta- hydroxylase promoter, which is specific for noradrenergic and adrenergic neurons (Hoyle et al, 1994, J. Neurosci. 14: 2455); tryptophan hydroxylase promoter, which is specific for serotonin/pineal gland cells (Boularand et al, 1995, J. Biol. Chem. 270: 3757); choline acetyltransferase promoter, which is specific for cholinergic neurons (Hersh et al, 1993, J. Neurochem.
  • aromatic L-amino acid decarboxylase (AADC) promoter which is specific for catecholaminergic/5-HT/D-type cells (Thai et al, 1993, Mol. Brain Res. 17: 227); proenkephalin promoter, which is specific for neuronal/spermatogenic epididymal cells (Borsook et al, 1992, Mol. Endocrinol. 6: 1502); reg (pancreatic stone protein) promoter, which is specific for colon and rectal tumors, and pancreas and kidney cells (Watanabe et al, 1990, J Biol. Chem.
  • parathyroid hormone-related peptide (PTHrP) promoter which is specific for liver and cecum tumors, and neurilemoma, kidney, pancreas, and adrenal cells (Campos et al, 1992, Mol. Endocrinol. 6: 1642).
  • promoters that function specifically in tumor cells include the stromelysin 3 promoter, which is specific for breast cancer cells (Basset et al, 1990, Nature 348: 699); the surfactant protein A promoter, which is specific for non-small cell lung cancer cells (Smith et al, 1994, Hum. Gene Ther. 5: 29-35); the secretory leukoprotease inhibitor (SLPI) promoter, which is specific for SLPI-expressing carcinomas (Garver et al, 1994, Gene Ther. 1 : 46-50); the tyrosinase promoter, which is specific for melanoma cells (Vile et al, 1994, Gene Therapy 1 : 307; WO
  • fibrosarcoma/tumorigenic cells (Gazit et al, 1995, Cancer Res. 55 (8): 1660); the AP2 adipose enhancer, which is specific for adipocytes (Graves, 1992, J. Cell.
  • Cancer 60: 843 the c-erbB-3 and c-erbB-2 promoters, which are specific for breast cancer cells (Quin et al, 1994, Histopathology 25: 247); the c-erbB4 promoter, which is specific for breast and gastric cancer cells (Rajkumar et al, 1994, Breast Cancer Res. Trends 29: 3); the thyroglobulin promoter, which is specific for thyroid carcinoma cells (Mariotti et al, 1995, J. Clin. Endocrinol. Meth. 80: 468); the a- fetoprotein promoter, which is specific for hepatoma cells (Zuibel et al, 1995, J. Cell. Phys.
  • villin promoter which is specific for gastric cancer cells (Osbom et al, 1988, Vir chows Arch. A. Pathol. Anat. Histopathol. 413: 303); and the albumin promoter, which is specific for hepatoma cells (Huber, 1991, Proc. Natl. Acad. Sci. U.S.A. 88: 8099).
  • the disclosed oHSV can be used to treat a subject having (e.g., harboring) or at risk of having a cancer stem cell (CSC) and/or a tumor having CSCs (e.g., a tumor for which sustained growth is dependent on CSCs; such tumors may also be referred to as a CSC-dependent tumor).
  • CSC cancer stem cell
  • a tumor having CSCs e.g., a tumor for which sustained growth is dependent on CSCs; such tumors may also be referred to as a CSC-dependent tumor.
  • Whether a subject is deemed "at risk" of having a CSC or a tumor having CSCs is a determination that may be within the discretion of the skilled practitioner caring for the subject. Any suitable diagnostic test and/or criteria can be used.
  • a subject may be considered "at risk" of having a CSC or a tumor having CSCs if (i) the subject has a mutation, genetic polymorphism, gene or protein expression profile, and/or presence of particular substances in the blood, associated with increased risk of developing or having cancer relative to other members of the general population not having mutation or genetic polymorphism; (ii) the subject has one or more risk factors such as having a family history of cancer, having been exposed to a carcinogen or tumor-promoting agent or condition, e.g., asbestos, tobacco smoke, aflatoxin, radiation, chronic infection/inflammation, etc., advanced age; (iii) the subject has one or more symptoms of cancer, etc.
  • risk factors such as having a family history of cancer, having been exposed to a carcinogen or tumor-promoting agent or condition, e.g., asbestos, tobacco smoke, aflatoxin, radiation, chronic infection/inflammation, etc., advanced age; (iii) the subject has one or more symptoms of cancer, etc.
  • the cancer is a colon carcinoma, a pancreatic cancer, a breast cancer, an ovarian cancer, a prostate cancer, a squamous cell carcinoma, a cervical cancer, a lung carcinoma, a small cell lung carcinoma, a bladder carcinoma, a squamous cell carcinoma, a basal cell carcinoma, an adenocarcinoma, a sweat gland carcinoma, a sebaceous gland carcinoma, a papillary carcinoma, a papillary adenocarcinoma, a cystadenocarcinoma, a medullary carcinoma, a bronchogenic carcinoma, a renal cell carcinoma, a hepatocellular carcinoma, a bile duct carcinoma, a choriocarcinoma, a seminoma, an embryonal carcinoma, a Wilms' tumor, melanoma, or a testicular tumor.
  • the cancer is a glioma.
  • the cancer is a breast or prostate carcinoma.
  • the cancer is a brain cancer.
  • the cancer is a glioma.
  • a glioma is a type of primary central nervous system (CNS) tumor that arises from glial cells.
  • CNS central nervous system
  • gliomas can also affect the spinal cord or any other part of the CNS, such as the optic nerves.
  • the gliomas for which the methods of the invention are useful to treat include ependymomas, astrocytomas, oligodendrogliomas, and mixed gliomas, such as oligoastrocytomas.
  • the gliomas contain cancer stem cells that are CD133+.
  • the glioma is a glioblastoma.
  • Gliomas are further categorized according to their grade, which is determined by pathologic evaluation of the tumor.
  • Low-grade gliomas are well-differentiated (not anaplastic); these are benign and portend a better prognosis for the patient.
  • High- grade gliomas are undifferentiated or anaplastic; these are malignant and carry a worse prognosis.
  • WHO World Health Organization
  • the WHO system assigns a grade from 1 to 4, with 1 being the least aggressive and 4 being the most aggressive.
  • Various types of astrocytomas are given corresponding WHO grades.
  • WHO Grade 1 includes, for example, pilocytic astrocytoma
  • WHO Grade 2 includes, for example, diffuse or low-grade astrocytoma
  • WHO Grade 3 includes, for example, anaplastic (malignant) astrocytoma
  • WHO Grade 4 includes, for example, glioblastoma multiforme (most common glioma in adults). Accordingly, in some embodiments the methods of the invention are useful for treating patients (subjects) with WHO Grade 1, Grade 2, Grade 3, or Grade 4 gliomas.
  • the herpes virus can be administered, for example, to a tumor of the subject.
  • the patient can have or be at risk of developing metastatic cancer, and the treatment can be carried out to treat or prevent such cancer.
  • HSV gE and gl enhance passive ADCC and promote clearance of HSV 1 infection by FcyR-bearing immune cells. Therefore, disclosed is an HSV vaccine that comprises a viral vector comprising the HSV Us7 and Us8 genes that encode gE and gl. These genes can be operably connected, collectively or independently, to an expression control sequence that promotes earlier and/or higher expression of gE and gl in infected cells to promote passive ADCC.
  • the vector is an attenuated HSV vector.
  • Methods to construct expression vectors containing genetic sequences and appropriate transcriptional and translational control elements are well established and described previously (Kambara, et al, 2005, Cancer Res. 65, 2832-9). These methods include in vitro recombinant DNA techniques, synthetic techniques, and in vivo genetic recombination. Such techniques are described in Sambrook et al, Molecular Cloning, A Laboratory Manual (Cold Spring Harbor Press, Plainview, N.Y., 1989), and Ausubel et al, Current Protocols in Molecular Biology (John Wiley & Sons, New York, N.Y., 1989).
  • Expression vectors generally contain regulatory sequences necessary elements for the translation and/or transcription of the inserted coding sequence.
  • the coding sequence is preferably operably linked to a promoter and/or enhancer to help control the expression of the desired gene product.
  • Promoters used in biotechnology are of different types according to the intended type of control of gene expression. They can be generally divided into constitutive promoters, tissue-specific or development-stage-specific promoters, inducible promoters, and synthetic promoters.
  • An enhancer is a sequence of DNA that functions at no fixed distance from the transcription start site and can be either 5' or 3' to the transcription unit. Furthermore, enhancers can be within an as well as within the coding sequence itself. They are usually between 10 and 300 bp in length, and they function in cis. Enhancers function to increase transcription from nearby promoters. Enhancers also often contain response elements that mediate the regulation of transcription. Promoters can also contain response elements that mediate the regulation of transcription. Enhancers often determine the regulation of expression of a gene.
  • enhancer sequences are now known from mammalian genes (globin, elastase, albumin, a-fetoprotein and insulin), typically one will use an enhancer from a eukaryotic cell virus for general expression.
  • Preferred examples are the SV40 enhancer on the late side of the replication origin (bp 100-270), the cytomegalovirus early promoter enhancer, the polyoma enhancer on the late side of the replication origin, and adenovirus enhancers.
  • the promoter is an immediate-early (IE) promoter, such as the cytomegalovirus (CMV) promoter/enhancer, or EFla, CAG, SV40, PGK1, Ubc, human beta actin promoter, etc.
  • IE immediate-early
  • compositions disclosed can be used therapeutically in combination with a pharmaceutically acceptable carrier.
  • pharmaceutically acceptable is meant a material that is not biologically or otherwise undesirable, i.e., the material may be administered to a subject without causing any undesirable biological effects or interacting in a deleterious manner with any of the other components of the pharmaceutical composition in which it is contained.
  • the carrier is selected to minimize any degradation of the active ingredient and to minimize any adverse side effects in the subject, as would be well known to one of skill in the art.
  • the polypeptide or viral vector disclosed herein When the polypeptide or viral vector disclosed herein is prepared for administration, it can be combined with a pharmaceutically acceptable carrier, diluent or excipient to form a pharmaceutical formulation, or unit dosage form.
  • a pharmaceutically acceptable carrier diluent or excipient to form a pharmaceutical formulation, or unit dosage form.
  • the total active ingredients in such formulations include from 0.1 to 99.9% by weight of the formulation.
  • a "pharmaceutically acceptable" substance is a carrier, diluent, excipient, and/or salt that is compatible with the other ingredients of the formulation, and not deleterious to the recipient thereof.
  • the active ingredient for administration may be present as a powder or as granules; as a solution, a suspension or an emulsion.
  • the vectors or polypeptides can be formulated and administered to treat a variety of disease states by any means that produces contact of the active ingredient with the agent's site of action in the body of the organism. They can be administered by any conventional means available for use in conjunction with pharmaceuticals, either as individual therapeutic active ingredients or in a
  • therapeutic active ingredients They can be administered alone, but are generally administered with a pharmaceutical carrier selected on the basis of the chosen route of administration and standard pharmaceutical practice.
  • water, suitable oil, saline, aqueous dextrose (glucose), and related sugar solutions and glycols such as propylene glycol or polyethylene glycols are suitable carriers for parenteral solutions.
  • Solutions for parenteral administration contain the active ingredient, suitable stabilizing agents and, if necessary, buffer substances.
  • Antioxidizing agents such as sodium bisulfate, sodium sulfite or ascorbic acid, either alone or combined, are suitable stabilizing agents.
  • parenteral solutions can contain preservatives such as benzalkonium chloride, methyl- or propyl-paraben and chlorobutanol.
  • Suitable pharmaceutical carriers are described in Remington's Pharmaceutical Sciences, a standard reference text in this field.
  • control release preparations can include appropriate macromolecules, for example polymers, polyesters, polyamino acids, polyvinyl, pyrolidone, ethylenevinylacetate, methyl cellulose, carboxymethyl cellulose or protamine sulfate.
  • concentration of macromolecules as well as the methods of incorporation can be adjusted in order to control release.
  • the agent can be incorporated into particles of polymeric materials such as polyesters, polyamino acids, hydrogels, poly (lactic acid) or ethylenevinylacetate copolymers. In addition to being incorporated, these agents can also be used to trap the compound in microcapsules.
  • compositions containing the therapeutic agents disclosed herein can be prepared by procedures known in the art using well known and readily available ingredients.
  • the therapeutic agents can also be formulated as solutions appropriate for parenteral administration, for instance by intramuscular, subcutaneous or intravenous routes.
  • the pharmaceutical formulations of the therapeutic agents can also take the form of an aqueous or anhydrous solution or dispersion, or alternatively the form of an emulsion or suspension.
  • compositions including pharmaceutical composition, may be administered in a number of ways depending on whether local or systemic treatment is desired, and on the area to be treated. These parenteral (including subcutaneous, intravenous, intramedullary, intraarticular, intramuscular, or intraperitoneal injection), topical, transdermal, and oral. Administration may occur in a single dose or in repeat administrations.
  • the vectors or polypeptides disclosed herein may be administered in combination with other therapeutic agents such as monoclonal antibodies and intraveneous IgG.
  • treatment refers to a method of reducing the effects of a disease or condition or symptom of the disease or condition.
  • treatment can refer to a 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 100% reduction in the severity of an established disease or condition or symptom of the disease or condition.
  • a method for treating a disease is considered to be a treatment if there is a 10% reduction in one or more symptoms of the disease in a subject as compared to a control.
  • the reduction can be a 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, or any percent reduction in between 10% and 100% as compared to native or control levels. It is understood that treatment does not necessarily refer to a cure or complete ablation of the disease, condition, or symptoms of the disease or condition.
  • the terms prevent, preventing, and prevention of a disease or disorder refers to an action, for example, administration of a therapeutic agent, that occurs before or at about the same time a subject begins to show one or more symptoms of the disease or disorder, which inhibits or delays onset or exacerbation of one or more symptoms of the disease or disorder.
  • references to decreasing, reducing, or inhibiting include a change of 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater as compared to a control level. Such terms can include but do not necessarily include complete elimination.
  • compositions may be given following, preceding, in lieu of, or in combination with, other therapies in the subject.
  • the subject may have been administered a vaccine or other composition in order to stimulate an immune response.
  • a cell engineered to express the polypeptides disclosed herein is provided.
  • the engineered cell can be propagated in cell culture (e.g., as opposed to being a part of a living animal ("/ ' « vivo")).
  • the cell may be a mammalian cell, e.g., a CHO cell or a human cell or a mouse hybridoma cell.
  • Examples of other types of cells that may be used for expression the polypeptides disclosed herein include mouse myeloma cells (e.g., NSO), human embryonic kidney cells (e.g., HEK293), monkey kidney cells (e.g., COS), human epithelial carcinoma cells (e.g., HeLa), human fibrosarcoma cells (e.g., HT-1080), baby hamster kidney cells, yeast cells, insect cells, and others (see, e.g., Fernandez et al. (eds.) Gene Expression Systems, Academic Press, 1999). Any cell compatible with the disclosed polypeptides and appropriate culture conditions may be used.
  • mouse myeloma cells e.g., NSO
  • human embryonic kidney cells e.g., HEK293
  • monkey kidney cells e.g., COS
  • human epithelial carcinoma cells e.g., HeLa
  • human fibrosarcoma cells e.g., HT-1080
  • polypeptides such as those that simultaneously bind an FcyRand an Fc binding domain protein, are known in the art.
  • One method which may be employed is the method of Kohler, G. et al. (1975) Continuous Cultures Of Fused Cells Secreting Antibody Of Predefined Specificity " Nature 256:495-497 or a modification thereof.
  • an immune effector cell that expresses such an activating receptor are obtained using host cells that over-express such molecules.
  • modified polypeptides include polypeptides with conservative substitutions of amino acid residues, one or more deletions or additions of amino acids which do not significantly deleteriously change the functional activity, or use of chemical analogs.
  • Amino acid residues which can be conservatively substituted for one another include but are not limited to:
  • polypeptides also include glycosylated and nonglycosylated polypeptides, as well as polypeptides with other post-translational modifications, such as, for example, glycosylation with different sugars, acetylation, and phosphorylation.
  • amino acid substitutions would be conservative, i.e., the substituted amino acid would possess similar chemical properties as that of the original amino acid. Such conservative substitutions are known in the art, and examples have been provided above.
  • Modifications include using coupling techniques known in the art, including, but not limited to, enzymatic means, oxidative substitution and chelation. Modifications can be used, for example, for attachment of labels for immunoassay, such as the attachment of radioactive moieties for radioimmunoassay. Modified polypeptides are made using established procedures in the art and can be screened using standard assays known in the art.
  • the invention also encompasses fusion proteins comprising one or more fragments or regions from the disclosed polypeptides.
  • a fusion polypeptide is provided that comprises at least 10 contiguous amino acids of an IgG Fc region.
  • Polypeptides of the invention may be conveniently prepared using solid phase peptide synthesis (Merrifield, B. (1986) "Solid Phase Synthesis," Science
  • Vectors containing polynucleotides that encode the disclosed polypeptides can be introduced into a host cell by any of a number of appropriate means, including electroporation, transfection employing calcium chloride, rubidium chloride, calcium phosphate, DEAE-dextran, or other substances; microprojectile bombardment;
  • lipofection e.g., where the vector is an infectious agent such as vaccinia virus.
  • infectious agent such as vaccinia virus
  • Any host cells capable of over-expressing heterologous DNAs can be used for the purpose of isolating the genes encoding the disclosed polypeptides.
  • suitable mammalian host cells include but are not limited to COS, HeLa, and CHO cells.
  • Example 1 A novel function of immunoglobulin G in immune recognition.
  • HSV1 F strain was purchased from ATCC, Manassas, VA. Generating Us8 deficient HSV1 F was described previously (Suenaga ei a/. , 2014, Microbiology and Immunology 58, 513-522).
  • R8411 a HSVl F strain which expresses luciferase was provided by Bernard Roizman (Zerboni et al, 2013, J Virol 87, 2791-2802).
  • Wild type (WT) newman strain (ATCC, 25904) and protein A deficient (Spa-) newman were a gift from Dr Timothy Frost (Dublin, Ireland), and grew in tryptic soy broth (Patel et al , 1987, Infect Immun 55, 3103- 3110).
  • Biotinylated CD 16a and HulgGI Fc was purchased from Sino Biological, Beijing, China, IgGlFc(ACD16) was made by cloning human IgGl Fc aa262-466 (SEQ ID NO: 2) into a pFuse vector (InvivoGen, San Diego,CA) after IL2 signal peptide, expressed in BHK cells and purified using protein A agarose beads (Thermofisher). Pooled human IgG (GamaStan, Grifols USA, Los Angeles, CA), which contains HSVl specific antibody, was purchased from Ohio State University pharmacy, Columbus, OH.
  • Human IgG Fc (12724, Scripps Laboratories, San Diego, CA) was validated as containing no Fab, and did not bind cells infected with Us8- HSVl viruses.
  • Rituximab Genentech, South San Francisco, CA
  • Darzalex Janssen Pharmaceuticals, Fremont, CA
  • HSVl genes were amplified from HSVl F strain DNA (sequence accession number: GU734771) with gene specific primers, which are flanked with Spel site at the 5' and Pad site at the 3' end, respectively (e.g., SEQ ID NOs: 25, 27-170), and cloned into a pCDH vector (System Bioscience, Palo Alto, CA, CD510B) using conventional methods.
  • Glioma cells were derived from primary human brain tumors and grown in DMEM/F12 (Life Technology, Carlsbad, CA) supplemented with B27 (1 :50), heparin (5 ug/mL), basic FGF (bFGF) (20 ng/ mL), and EGF (20 ng/mL) as described previously (Mao et al , 2013, Proc Natl Acad Sci USA 110, 8644-8649). Except as noted otherwise, #83 glioma cells were used throughout this study (Mao et al., 2013, Proc Natl Acad Sci U SA 110, 8644-8649).
  • glioma cells were washed once with DMEM/F12 media, and resuspended in 100 ⁇ of basic nucleofector solution (Lonza Inc., Allendale, NJ). Subsequently, the cell suspension was mixed with 6 ⁇ g of plasmid expressing HSVl genes and nucleofected using program A33 (Amaxa GmBH, Koeln, Germany). Following nucleofection, cells were immediately mixed with 1 ml media and transferred into one well of 6-well plates containing 4 ml DMEM/F12 with all supplements.
  • glioma cells were resuspended and centrifuged down at 50g for 5 min to remove cell debris and dead cells. Subsequently, 1 x 10 4 glioma cells were resuspended with 100 ⁇ DMEM/F12 media and seeded into each well of a U bottom 96-well plate. Purified human NK cells were resuspended in RPMI media (Life Technology, Carlsbad, CA) supplemented with 10% heat inactivated FBS (Sigma- Aldrich, St.
  • NK cells were added to culture with transfected glioma cells.
  • 100 ⁇ RPMI 1640 media supplemented with 10% FBS, instead of human NK cells was added to the seeded glioma cells.
  • Culture samples were collected using LSRII (BD Biosciences, Franklin Lakes, NJ) at 5h of culture. Living glioma cells were gated in based on their forward scatter (FSC) and side scatter (SSC) and measured for the percentage of GFP+ cells.
  • FSC forward scatter
  • SSC side scatter
  • GFP%(+nk) percentage of GFP in presence of NK cells
  • GFP%(—nk) percentage of GFP in absence of NK cells
  • Vero cells were seeded at a density of 7x l0 6 cells per 100 mm dish and inoculated with 2.5 pfu per cell of HSV-1 F strain or #30 mutants (Suenaga et al. 2014, Microbiology and Immunology 58, 513- 522). At 24 hours post-inoculation, culture media and cell debris were collected. After three freeze-thaw cycles to release virus, cell debris was removed by low speed centrifugation (2,000*g for 5 minutes), samples were loaded on a 5 ml 35% sucrose gradient and centrifuged in a Beckman SW27 rotor at 25,000 rpm for 1 hour. Virus pellet was collected, washed and concentrated in PBS.
  • HSVl viruses were treated with 0.2% Trition-100 for 30min. Inactivated viruses were diluted to 0. lug/ml for coating plates. Plaque assay. Briefly, sequentially diluted viruses were loaded on single layer of Vero cells and incubated at 37°C; pooled human IgG (final concentration 0.1%) was added lh later to restrain viral spread. Plaques were counted after 48h culture. To determine the effect of human IgG3, human IgG Fc, Rituximab, daratumumab, and human IgG on the infectivity of HSV1, lug/ml of these reagents were added into sequentially diluted viruses and incubated at room temperature for 30min prior to a plaque assay. Treated viruses were tittered with standard plaque assay and all results were normalized to PBS control.
  • NK cell Isolation and stimulation condition All NK cells used herein were freshly enriched from peripheral blood leukopacks of healthy donors (American Red Cross, Columbus, OH) using RosetteSep cocktail (StemCell Technologies, Cambridge, MA) as previously described (Yu et al. 2010, Blood 115, 274-281). A half million isolated human NK cells were incubated with media, or media supplement with 5ug/ml protein A or protein G for 30min prior to stimulation. 1 xlO 5 infected or transfected glioma cells, or K562 cells were used in the culture with 5xl0 5 NK cells. For all CD 107a staining, CD 107a antibody was added at the beginning of the cell culture.
  • Chromium release cytotoxicity assay Chromium release cytotoxicity assay. Glioma cells were labeled by incubating 5xl0 5 cells in 50 51 Cr for 90min at 37°C. Radiolabeled cells were washed 3 times and resuspended in complete RPMI 1640 media, and seeded in U bottom 96-well plates in triplicates at a concentration of 5xl0 4 cells/ml. In some cases, antibodies or IgG products (5ug/ml) were added into radiolabeled target cells and incubated on ice for 30 minutes for binding or blocking certain interactions. Effector cells were added in specified effector-to-target ratios (E:T, x-axis on Figure ID) and incubated at 37°C for 4-6 hours. Cytolysis was then measured and calculated as previously described (Dai et al, 2017, Immunity, 47, 159-170)).
  • NK cells phosphorylation staining.
  • One-half million NK cells were rested at 37°C for lh and then stimulated with H 2 0 2 (1 lmM), IL12(10ng/ml)+IL18(10ng/ml), 2xl0 5 transfected glioma cells, or lxlO 8 cfu of bacteria for lh.
  • NK cells were fixed using Phosflow Fix Buffer I (BD), permeabilized with PhosflowTM Perm Buffer III (BD Biosciences, Franklin Lakes, NJ), blocked with normal mouse immunoglobulin, and then stained with anti- CD 3 ⁇ (pY142) and anti CD3 ⁇ antibodies.
  • Phosphatase inhibitor (Roche, South San Francisco, CA) was supplemented in all the staining steps.
  • Transfected glioma cells or bacteria were first incubated for 30min on ice with PBS with or without IgGlFc(ACD16), IgGlFc (Scripps).
  • mice 8-to-12 weeks old female C57BL/6 and BALB/c mice (Jackson Laboratory, CITY) were used for all the studies.
  • BALB/c mice were injected intraperitoneally (i.p.) with 3x l0 6 pfu HSV1 F strain virus.
  • PBS 200 ⁇ g human IgG3 (Sigma-Aldrich, , St. Louis, MO), 200ug human IgG Fc (Scripps Laboratories, San Diego, CA), 200 ⁇ g Rituximab or 200 ⁇ g Darzalex were given via i.p. injection at 4 hours prior to virus challenge, and at 24 hours and 72 hours after virus challenge.
  • mice were injected i.p with 1.2 x lO 5 pfu of R8411 virus (Zerboni, L. et al. J Virol 87, 2791-2802 (2013)).
  • BALB/c mice were injected i.p with 200 ⁇ g rituximab at 4 hours prior to virus challenge, and at 24 hours after virus challenge. Each mouse was given 3mg luciferin potassium 10 minutes prior to isoflurane anesthesia to ensure consistent photon flux. Images were taken using an IVIS Spectrum (Perkin Elmer, Waltham, MA) at 18h and 84h post infection. Each group was recorded for 4 sections of 2 minute exposure.
  • Bioluminescence values were measured from the whole mouse and calculated as photon flux (photons/s) using Living Image 4.0 (Perkin Elmer, Waltham, MA).
  • Living Image 4.0 Perkin Elmer, Waltham, MA.
  • mice were injected intravenously (i.v.) with 40 ⁇ g silicone beads and protein A conjugated beads (AlphaBio, Racho Santa Margarita, CA). 24-48h after beads completed this inoculation, blood, spleen and lung were collected and mononuclear cells were isolated from these tissues and stained using antibodies against mouse antigens.
  • NK cells were enriched from spleens of 8 to 12 weeks old C57BL/6 and BALB/c mice using an NK cell isolation kit (Miltenyi Biotec, Cambridge, MA) following manufacturer's instruction.
  • the HSV1 genome contains 84 open reading frames, encoding 74 unique viral proteins (Szpara et al, 2010, J Virol 84, 5303-5313), however very few of them have been studied for their roles in immune recognition or evasion (Imai et al, 2013, PLoS One 8, e72050; Chisholm ei a/., 2007, The Journal of Infectious Diseases 195, 1160- 1168; Huard & Fruh, 2000, Eur J Immunol 30, 509-515).
  • DC-MEGE were developed to measure how NK cells respond to glioma cells expressing a single HSV1 gene (Fig. 1A).
  • GFP green fluorescence protein
  • HSVl Us8 encodes gE, which alone is a low affinity human IgG Fc receptor, binding human IgGl, IgG2 and IgG4 at the CH2-CH3 interface (Sprague et al, 2006, PLoS Biol 4, el48).
  • DC-MEGE results were validated using a 51 Cr release assay against a human mesenchymal glioma cell line #1123 and a human proneural glioma cell line #84 (Mao et al , 2013, Proc Natl Acad Sci USA 110, 8644-8649), shown in Fig. ID.
  • Glioma cells expressing Us8 also induced human primary NK cells to secret IFN- ⁇ (Fig. IE), express CD69 and CD 107a (Fig. IF), and cleave CD62L and CD 16a (Fig. 1G), which are characteristic phenotypes of activated human NK cells.
  • NK cytotoxicity towards glioma Us8 was attenuated by a gE specific mouse monoclonal antibody (Abeam) (Fig. lh).
  • Wild type (wt) HSVl F strain viruses (of which gE is a major protein component) and a mutant HSVl F strain with targeted-deletion of Us 8 (Us 8 ) (Suenaga et al. , 2014, Microbiology and Immunology 58, 513-522) were purified.
  • NK cells were cultured in plates coated with inactivated pure viruses. NK cells were only activated by wild-type (wt) but not Us8 ⁇ F strain viruses (Figs. II, 6), and activation of NK cells by wt HSVl was also inhibited by the anti-Us8 antibody (Figs. II, 6). Taken together, these results demonstrated that direct interaction between gE and human NK cells contributed to the functional enhancement of NK cells.
  • HSVl gE can form heterodimers with glycoprotein I (gl), encoded by HSVl Us7, and the resultant gE/gl complex is the high affinity viral Fc receptor for human IgG (Sprague et al., 2006, PLoS Biol 4, el48; Johnson et al., 1988, J Virol 62, 1347-1354).
  • Glioma cells expressing Us7 did not activate NK cells (Figs.
  • glioma cells expressing both Us7 and Us8 activated NK cells much more potently than glioma Us8 (Figs. 2A 2B, 7), suggesting IgG-binding function of gE may be involved in NK cell activation.
  • NK cells B cells, monocytes and granulocytes were shown to be naturally coated with human IgG molecules, via non-covalent binding, revealed by acidic media treatment which removed most of the IgG from the cell surface (Fig. 27 A). These surface IgG molecules provide interaction sites for protein A binding (Fig. 27B).
  • NK cells The response (measured by the percentage of CD69+ or CD107a+ NK cells) of human NK cells towards glioma Us8 correlated with the level of surface IgG; and the correlation became even stronger when NK cells were cultured with glioma Us7+Us8 (Fig. 2G).
  • NK cells to K562 cells, which are leukemia cells negative for MHC I molecule and widely used as an activating control for NK cells, showed no correlation with surface IgG (Fig. 2G).
  • human IgG was shown to link gE and NK cell activation.
  • CD 16a, IgG Fc andHSVl gE form a ternary complex essential for NK cell activation.
  • Human CD 16a binding sites on IgG Fc are located far apart from the CH2- CH3 interface where gE binds IgG (Sondermann et al, 2000, Nature 406, 267-273; Sprague et al. 2006, PLoS Biol 4, el 48), leading to the hypothesis that IgG, gE and CD 16a could form a ternary complex.
  • Structure modeling using the known gE-IgG Fc and CD16a-IgG Fc crystal structure supported the conclusion that gE and CD 16a could bind the same IgG Fc molecule without interfering with each other (Fig.
  • IgGl Fc(ACD16) is a recombinant human IgGl Fc fragment without the CD 16a binding sites; while IgGl Fc has intact CD 16a binding sites. Consistent with the crystal structure (Fig. 3 A), CD 16a binding sites played no role in the binding between Fc and HSV1 gE as both IgGl Fc(ACD16) and IgGl Fc bound to glioma Us7+Us8 efficiently (Fig. 3B, left and middle left).
  • CD16a was found to bound glioma Us7+Us8 when IgGlFc was present and this interaction was dependent on the CD 16a binding sites on IgGlFc (Fig. 3C middle left and middle), thus proving the formation of CD16a-IgGFc-gE complex.
  • Human HSV1 specific IgG contains antibodies that specifically recognize gE or gl (Fig. 3B, middle right), and its presence allowed CD 16a to bind glioma cells expressing an HSV1 gene via the classical interaction between CD16a and antigen- antibody complex (Fig. 3C, middle right). Similar CD16a binding tests were also performed using Rituximab (a humanized IgGl monoclonal antibody against human CD20) (Edwards et al, 2004, N Engl J Med 350, 2572-2581) (Fig. 3B and 3C, right), or glioma cells infected with Us8- HSV1 or wild type HSV1 (Fig.
  • CD 16a, IgG Fc and HSV1 gE formed a ternary complex. Furthermore, phosphorylation of CD3 ⁇ specifically occurred when NK cells were stimulated with H2O2 (positive control) or in culture with glioma Us7+Us8, but not with IL12+IL18 (Fig. 3E), demonstrating gE activated NK cells through CD16a-CD3 ⁇ axis.
  • IgG-binding proteins protein A from Staphylococcus aureus and protein G from group G streptococcus, bind IgG mainly at the CH2-CH3 interface (Sauer- Eriksson ei a/., 1995, Structure 3, 265-278; Deis et al , 2015 , Proc Natl Acad Sci US A ⁇ ⁇ 2, 9028-9033).
  • Protein A and protein G were shown to also bind primary human NK cells via IgG present on the membrane of NK cells (Fig. 3F and 3G), which also suggested that surface IgG coated on primary NK cells were fully accessible for gE to bind.
  • NK cell by gE Figs. 3H-3J and 9
  • This treatment did not change human NK cells' responses to K562 cells or IL12+IL18 (Fig. 9).
  • plates coated with pure and inactivated wt HSV1 virus could no longer activate NK cells that were pre-incubated with protein A or protein G (Figs. 10A and 10B).
  • IgG Fc bridged the interaction between NK cells and target cells expressing HSVl gE, and resulted in NK cell activation.
  • NK cell activation by gE represents a previously unappreciated immunostimulation mechanism which is solely bridged by IgG Fc, and differs from classical IgG functions by requiring no antigen-specific antibody (Fig 3K). This type of NK cell activation was named passive ADCC (Fig 3K).
  • the above experiments were all conducted without adding human IgG to the interaction, and NK cell activation by gE was mediated by IgG already present on primary NK cells (Figs. 3H-3J).
  • infected cells are likely to be coated with human IgG due to the expression of gE and the abundance of IgG in human serum.
  • non-HSVl non-immune plasma [(-) plasma] or IgGl Fc fragments were added in culture. Both (-) plasma and IgGl Fc further enhanced activation of NK cells by infected or transfected glioma cells in a gE dependent manner (Figs. 11 A-l ID).
  • NK cytotoxicity toward glioma cells infected with wt or us8 ⁇ F was enhanced by HSVl -specific IgG (classical ADCC, Fig 3K), however human IgGl Fc and an antibody targeting an irrelevant antigen (i.e rituximab) also enhanced NK cell cytotoxicity to glioma cells infected with wt F but not Us8 F strain (Fig. 4A), or glioma cells expressing gE (Fig. 4B).
  • HSVl gE does not bind mouse IgG (Chapman et al , 1999, J Biol Chem 274, 6911-6919), however mouse FcyR binds human IgG with high affinity (Ober et al., 2001, Int Immunol 13, 1551-1559), and thus supplementing human IgG should be able to bridge mouse NK cells and HSVl infected cells, promote immune activation and clearance of HSVl infection. Consistent with this hypothesis, NK cells isolated from C57BL/6 and BALB/c mice displayed enhanced cytotoxicity towards glioma Us7+Us8 in the presences of human IgG Fc fragments (Fig. 4C).
  • HSV1 gE is required for the cell-to-cell spread of HSV1 in vivo (Polcicova et al, 2005, J Virol 79, 11990-12001), therefore the Us8 ⁇ F strain was not used in vivo to confirm dependence on gE for this kind of protection.
  • human IgG3, which does not bind HSV1 gE (Sprague et al , 2006, PLoS Biol 4, el48), failed to provide any protection against HSV1 infection (Fig.
  • CD16a-Fc-protein A complex was tested using wild type Staphylococcus aureus (S. A.) newman strain (wt) and a protein A deficient newman strain (Spa) (Patel et al, 1987, Infect Immun 55, 3103-3110) (Fig. 13A).
  • S. A. newman strain
  • Spa protein A deficient newman strain
  • NK cells cultured with S.A slightly enhanced ⁇ 3 ⁇ phosphorylation (Fig. 5D).
  • Phenotypes of NK cells cultured with S.A mirrored the result of ⁇ 3 ⁇ phosphorylation.
  • Activation of NK cells by wt S.A was inhibited by pre-incubating wt S.A with mouse serum, and enhanced by human IgG (Fig. 5E).
  • NK cell activation by wt S.A was also abolished if primary human NK cells were pretreated with either soluble monomeric protein A or protein G (Fig. 5E).
  • NK cells were activated by streptococcus protein G in a similar fashion (Figs. 14A-14C). Taken together, these results demonstrate that bacterial IgG binding proteins activated human NK cells through Fc bridge and CD 16a.
  • mouse NK cells cultured with wildtype S.A produced more IFNy than spa- S.A (Fig. 5F), and expressed more early activation marker CD27 and CD62L (in contrast to a loss of CD62L in activated human NK cells) (Peng, H. et al. J Immunol 190, 4255-4262 (2013); Hayakawa & Smyth, 2006, J Immunol 176, 1517- 1524) (Fig. 15 A).
  • a similar phenotype was observed when mouse NK cells were cultured in protein A-coated plates (Figs. 5G and 15B).
  • S.A produces many inflammatory factors (Fournier & Philpott, 2005, Clin Microbiol Rev 18, 521-540 (2005)).
  • mice were injected with protein A-coated silicone beads to study if oligomeric protein A could activate NK cell in vivo.
  • NK cells from mice injected with protein A conjugated silicone beads adopted a more activating phenotype compared with NK cells from mice injected with control silicon beads (Fig. 5H and 15C).
  • injection of soluble protein A did not cause any phenotypic changes on mouse NK cells compared to PBS control (Fig. 15D).
  • DC-MEGE an unbiased cytotoxicity assay, DC-MEGE, illustrated interactions of human NK cells and host tumor cells following HSV1 infection (Fig. 1A). With the exception of Usl2 (Huard & Fruh, 2000, Eur J Immunol 30, 509-515) and Us3 (Imai et al, 2013, PLoS One 8, e72050), this is the first time the remaining viral genes have been reported as significant for their regulation of NK cell cytotoxicity. DC-MEGE is therefore useful to study how NK cells interact with other pathogens.
  • HSVl gE/gl complexes have been shown to participate in "antibody bipolar bridging", whereby a single HSVl -specific IgG antibody simultaneously binds to a HSVl -antigen using its Fab region and to gE/gl via its Fc region (Frank & Friedman, 1989, Journal of virology 63, 4479-4488).
  • This disclosure has also established a functional role for surface IgG, anchored by its Fc domain to CD 16a expressed on the NK cell surface, and a new mechanism by which NK cells are able to recognize pathogens in the absence of specific antigen recognition.
  • HSVl infected host cells as well as protein A and protein G, are capable of activating human NK cells by binding NK cell surface IgG.
  • Protein A has long been proposed as a virulent factor for Staphylococcus aureus newman strain, and Spa ⁇ Staphylococcus aureus newman strain, causes milder symptoms in mice than wt S.A (Palmqvist et al, 2002, Microb Pathog 33, 239-249).
  • Example 2 Use of IgG-binding proteins protein A and protein G to capture monocytes and increase the efficacy of generating dendritic cells and
  • Dendritic cells and macrophages are highly specialized antigen-presenting cells (APC), which account for a very small percentage (-0.2%) of human blood mononuclear cells. Accordingly, dendritic cells and macrophages are generated from in vitro culture of monocytes for numerous therapeutic purposes.
  • APC antigen-presenting cells
  • primary monocytes are also coated on the surface with IgG molecules, which are anchored on monocytes by Fey receptors, including CD64, CD32 and CD 16a and provide interaction sites for protein A to bind.
  • Binding of human Fey receptor CD32 and CD64 to staphylococcus aureus (S.A) required the presence of human IgG and protein A. Wild type (wt) or protein A deficient (Spa-) S.A bacteria were incubated with fluorescent labeled human Fey receptor CD32 and CD64 in the absence or presence of humanized antibody rituximab (Ritu) (Figs. 23A and 23B).
  • CD64 the high affinity FcyR, is majorly expressed by monocytes, macrophages and dendritic cells.
  • Protein A and protein G can bind IgG coated on NK cells and monocytes. Therefore, protein A or protein G molecule coated on a plate should be able to bind surface IgG of monocytes and thus increase adhesion of monocytes. By plating the same amount of monocytes in different plates, monocytes were found to attach more firmly to protein A or protein G treated plates than to bovine serum treated plates during the first few hours, and monocytes culture in plate A or protein G coated plates started to form colonies, an indication of activation (Fig. 17A).
  • EBV Epstein Barr Virus
  • Both CMV gp34 and gp68 are IgG-binding proteins capable of binding both humanized antibody rituximab and human IgG through portions of their Fc (Figs. 28 A and 28B).
  • CD 16a does not directly interact with glioma cells expressing either gp34 or gp68 (Fig. 28C), however it can bind glioma cells expressing gp68 in the presence of rituximab or human IgGl Fc fragment, but does not bind to the glioma cells expressing gp34 even when human IgG Fc is present (Figs. 28D and 28E).
  • gp68 is capable of forming a ternary complex with human IgGl Fc and CD 16a. Additionally, primary human NK cells cultured with glioma cells expressing gp68 showed activated phenotypes, which was represented by the increase of CD69 and CD107a, and the decrease of CD62L and CD16a (Fig. 29A and 29B).
  • MCMV infection also allowed 3T3 to bind non immune mouse IgG (Fig. 30), indicating that MCMV produce IgG-binding protein(s).
  • SEQ ID NO: 1 EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPE IgGl Fc (binds VTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN both human STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK FcyR and AKGQPREPQ V YTLPP S RDELTKNQ V S LTCL VKGF YP SDI AVE pathogen IgG WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG binding NVFSCSVMHEALHNHYTQKSLSLSP GK
  • SEQ ID NO: 2 FPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE IgGl Fc (binds VHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCK only pathogen V SNKALP APIEKTI S KAKGQP REPQVYTLPPS RDELTKNQ V S IgG binding LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL protein) YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
  • SEQ ID NO: 3 MKKKNIYSIR KLGVGIASVT LGTLLISGGV TPAANAAQHD IgG binding EAQQNAFYQV LNMPNLNADQ RNGFIQSLKD protein A DPSQSANVLG EAQKLNDSQA PKADAQQNNF
  • SEQ ID NO: 4 MEKEKKVKYF LRKSAFGLAS VSAAFLVGST VFAVDSPIED IgG binding TPIIRNGGEL TNLLGNSETT LALRNEESAT
  • ADALAKAKAD ALKEFNKYGV SDYYKNLINN AKTVEGIKDL QAQVVESAKK ARISEATDGL SDFLKSQTPA EDTVKSIELA EAKVLANREL DKYGVSDYHK NLINNAKTVE GVKELIDEIL AALPKTDTYK LILNGKTLKG ETTTEAVDAA TAEKVFKQYA NDNGVDGEWT YDDATKTFTV TEKPEVIDAS ELTPAVTTYK LVINGKTLKG ETTTKAVDAE TAEKAFKQYA NDNGVDGVWT YDDATKTFTV TEMVTEVPGD APTEPEKPEA SIPLVPLTPA TPIAKDDAKK DDTKKEDAKK PEAKKDDAKK AETLPTTGEG SNPFFTAAAL AVMAGAGALA VASKRKED
  • SEQ ID NO: 5 MARGAGLVFFVGVWVVSCLAAAPRTSWKRVTSGEDVVLL Glycoprotein E PAPAGPEERTRAHKLLWAAEPLDACGPLRPSWVALWPPRR
  • SEQ ID NO: 6 ASTKGPSVFP LAPSSKSTSG GTAALGCLVK DYFPEPVTVS IgGl WNSGALTSGV HTFPAVLQSS
  • SEQ ID NO: 7 ASTKGPSVFP LAPCSRSTSE STAALGCLVK DYFPEPVTVS IgG2 WNSGALTSGV HTFPAVLQSS
  • SEQ ID NO: 8 ASTKGPSVFP LAPCSRSTSG GTAALGCLVK DYFPEPVTVS IgG3 WNSGALTSGV HTFPAVLQSS
  • VLQEDSVTLT CRGTHSPESD SIQWFHNGNL IPTHTQPSYR FKANNNDSGE YTCQTGQTSL SDPVHLTVLS EWLVLQTPHL EFQEGETIVL RCHSWKDKPL VKVTFFQNGK SKKFSRSDPN FSIPQANHSH SGDYHCTGNI GYTLYSSKPV TITVQAPSSS PMGIIVAVVT GIAVAAIVAA VVALIYCRKK RISALPGYPE CREMGETLPE KPANPTNPDE ADKVGAENTI TYSLLMHPDA LEEPDDQNRI

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Immunology (AREA)
  • Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Virology (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Biomedical Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Biotechnology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Cell Biology (AREA)
  • General Engineering & Computer Science (AREA)
  • Microbiology (AREA)
  • Hematology (AREA)
  • Epidemiology (AREA)
  • Communicable Diseases (AREA)
  • Neurosurgery (AREA)
  • Neurology (AREA)
  • Rheumatology (AREA)
  • Pain & Pain Management (AREA)
  • Oncology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
PCT/US2018/016035 2017-01-30 2018-01-30 Passive antibody dependent cell-mediated activation Ceased WO2018140974A1 (en)

Priority Applications (5)

Application Number Priority Date Filing Date Title
US16/480,293 US11459378B2 (en) 2017-01-30 2018-01-30 Passive antibody dependent cell-mediated activation
CN201880007963.0A CN110536699A (zh) 2017-01-30 2018-01-30 被动抗体依赖性细胞介导的活化
JP2019541246A JP2020505418A (ja) 2017-01-30 2018-01-30 受動抗体依存性細胞媒介活性化
EP18744927.7A EP3573640A4 (en) 2017-01-30 2018-01-30 PASSIVE ANTIBODY DEPENDENT CELLULAR MEDIATION ACTIVATION
AU2018213418A AU2018213418A1 (en) 2017-01-30 2018-01-30 Passive antibody dependent cell-mediated activation

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201762452111P 2017-01-30 2017-01-30
US62/452,111 2017-01-30

Publications (1)

Publication Number Publication Date
WO2018140974A1 true WO2018140974A1 (en) 2018-08-02

Family

ID=62979661

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2018/016035 Ceased WO2018140974A1 (en) 2017-01-30 2018-01-30 Passive antibody dependent cell-mediated activation

Country Status (6)

Country Link
US (1) US11459378B2 (https=)
EP (1) EP3573640A4 (https=)
JP (1) JP2020505418A (https=)
CN (1) CN110536699A (https=)
AU (1) AU2018213418A1 (https=)
WO (1) WO2018140974A1 (https=)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN114206909A (zh) * 2019-07-21 2022-03-18 葛兰素史克生物有限公司 治疗性病毒疫苗
WO2024254444A1 (en) * 2023-06-09 2024-12-12 Cornell University Vaccines for human cytomegalovirus

Families Citing this family (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2018316166A1 (en) 2017-08-07 2020-02-06 The Regents Of The University Of California Platform for generating safe cell therapeutics
CN111411079B (zh) * 2020-03-27 2025-12-12 北京时合生物科技有限公司 细胞培养方法、改造抗体、细胞培养基、细胞产品及其应用
CN114621356A (zh) * 2022-05-17 2022-06-14 康希诺生物股份公司 以il18为分子佐剂的带状疱疹亚单位疫苗
US20260097088A1 (en) * 2022-10-17 2026-04-09 Research Institute At Nationwide Children's Hospital Macrophage polarizing oncolytic herpes simplex virus for cancer therapy

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20150368668A1 (en) * 2008-04-22 2015-12-24 Rutgers, The State University Of New Jersey Hcv e2 construct compositions and methods

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
HUE029465T2 (en) 2005-08-10 2017-02-28 Macrogenics Inc Identification and engineering of antibodies with variant Fc regions and methods of using same
ES2688978T3 (es) * 2009-11-23 2018-11-07 Amgen Inc. Anticuerpo monomérico Fc
CA2808154A1 (en) * 2010-08-13 2012-02-16 Medimmmune Limited Monomeric polypeptides comprising variant fc regions and methods of use
GB201013989D0 (en) * 2010-08-20 2010-10-06 Univ Southampton Biological materials and methods of using the same
US9676857B2 (en) * 2012-03-16 2017-06-13 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Soluble engineered monomeric Fc
CN105669838B (zh) * 2014-12-04 2020-10-16 厦门大学 来自水痘-带状疱疹病毒gE蛋白的中和表位及针对其的抗体

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20150368668A1 (en) * 2008-04-22 2015-12-24 Rutgers, The State University Of New Jersey Hcv e2 construct compositions and methods

Non-Patent Citations (8)

* Cited by examiner, † Cited by third party
Title
AWASTHI ET AL.: "Blocking herpes simplex virus 2 glycoprotein E immune evasion as an approach to enhance efficacy of a trivalent subunit antigen vaccine for genital herpes", J VIROL., vol. 88, no. 15, 2014, pages 8421 - 8432, XP055522982 *
GHIASI ET AL.: "Corneal macrophage infiltrates following ocular herpes simplex virus type 1 - challenge vary in BALB/c mice vaccinated with different vaccines", VACCINE, vol. 19, no. 9-10, 2000, pages 1266 - 1273, XP004227936 *
KEBRIAEI ET AL.: "Construction and immunogenicity of a new Fc-based subunit vaccine candidate ' against Mycobacterium tuberculosis", MOL BIOL REP., vol. 43, no. 9, 2016, pages 911 - 922, XP036035483 *
LUBINSKI ET AL.: "The Herpes Simplex Virus 1 IgG Fc Receptor Blocks Antibody-Mediated Complement Activation and Antibody-Dependent Cellular Cytotoxicity In Vivo", JOURNAL OF VIROLOGY, vol. 85, no. 7, 2011, pages 3239 - 3249, XP055522985 *
MOBERGSLIEN ET AL.: "Cancer cell-binding peptide fused Fc domain activates immune effector cells and blocks tumor growth", ONCOTARGET, vol. 7, no. 46, 2016, pages 75940 - 75953, XP055522995 *
See also references of EP3573640A4 *
WINES ET AL.: "The IgG Fc contains distinct Fc receptor (FcR) binding sites: the leukocyte receptors Fc gamma RI and Fc gamma Rlla bind to a region in the Fc distinct from that recognized by neonatal FcR and protein A", J IMMUNOL, vol. 164, no. 10, 2000, pages 5313 - 5318, XP002381581 *
YIN ET AL.: "Protein A immunoadsorption combined with rituximab in highly sensitized kidney transplant recipients", CHIN MED J, vol. 122, no. 22, 1 January 2009 (2009-01-01), pages 2752 - 2756, XP055613893, ISSN: 0366-6999 , DOI: 10.3760/cma.j.issn.0366-6999.2009.22.015 *

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN114206909A (zh) * 2019-07-21 2022-03-18 葛兰素史克生物有限公司 治疗性病毒疫苗
JP2022542032A (ja) * 2019-07-21 2022-09-29 グラクソスミスクライン バイオロジカルズ ソシエテ アノニム 治療用ウイルスワクチン
WO2024254444A1 (en) * 2023-06-09 2024-12-12 Cornell University Vaccines for human cytomegalovirus

Also Published As

Publication number Publication date
JP2020505418A (ja) 2020-02-20
EP3573640A4 (en) 2021-04-28
AU2018213418A1 (en) 2019-06-20
EP3573640A1 (en) 2019-12-04
CN110536699A (zh) 2019-12-03
US20200040064A1 (en) 2020-02-06
US11459378B2 (en) 2022-10-04

Similar Documents

Publication Publication Date Title
US11459378B2 (en) Passive antibody dependent cell-mediated activation
JP6895374B2 (ja) 免疫チェックポイントモジュレーターの発現用腫瘍溶解性ウイルス
CN106999577A (zh) 溶瘤病毒和免疫检查点调节因子组合
KR20170120104A (ko) 암 또는 감염의 치료를 위한 조합 제조물
JP2023126868A (ja) 改変オルトポックスウイルスベクター
JP2020529422A (ja) 急性骨髄性白血病を治療するためのflt3 car−t細胞及びflt3阻害剤の使用
CN113164538B (zh) 修饰的溶瘤病毒、其组合物和用途
US20230357793A1 (en) Oncolytic herpes simplex viruses (hsv) expressing immunomodulatory fusion proteins
US20240269203A1 (en) Oncolytic virus and uses thereof
CA3231396A1 (en) Novel combinations of antibodies and uses thereof
CN119233986A (zh) 包含抗体或者包含含有抗体的Fc部分的含Fc融合蛋白的疫苗
CN114657150A (zh) 用于改善免疫疗法的重组溶瘤腺病毒及其应用
JP2025526369A (ja) Pd-1/pd-l1阻害剤を有するインターロイキン12を発現する組換えウイルスの組み合わせ
TWI868410B (zh) 用於腦腫瘤治療的溶瘤性i型單純皰疹病毒
US20250339481A1 (en) Method of delivery of fusogenic oncolytic virus and therapeutic molecules
WO2025185740A1 (zh) 一种修饰的溶瘤病毒及其组合物
CN118176016A (zh) 抗体的新型组合及其用途
WO2024262576A1 (ja) 免疫刺激型ヘルペスウイルス
TW202540162A (zh) 含有結合至cldn18.2和cd3之雙特異性結合劑和抗vegfr2抗體之組合療法
HK40106416A (zh) 抗体的新型组合及其用途
EP4626446A1 (en) Multispecific antibody against cd40 and cd137 in combination therapy with anti-pd1 ab and chemotherapy
HK40000795A (en) Oncolytic virus and checkpoint inhibitor combination therapy

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18744927

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2018213418

Country of ref document: AU

Date of ref document: 20180130

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2019541246

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2018744927

Country of ref document: EP

Effective date: 20190830