WO2018119196A1 - Immunoconjugates targeting adam9 and methods of use thereof - Google Patents
Immunoconjugates targeting adam9 and methods of use thereof Download PDFInfo
- Publication number
- WO2018119196A1 WO2018119196A1 PCT/US2017/067823 US2017067823W WO2018119196A1 WO 2018119196 A1 WO2018119196 A1 WO 2018119196A1 US 2017067823 W US2017067823 W US 2017067823W WO 2018119196 A1 WO2018119196 A1 WO 2018119196A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- domain
- ala
- cdr
- immunoconjugate
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 0 C[C@@](C(O)=O)N(C)C(C(C)(C)CC(*)(*)S*)=O Chemical compound C[C@@](C(O)=O)N(C)C(C(C)(C)CC(*)(*)S*)=O 0.000 description 8
- CVZSDGNYSYQXFK-UHFFFAOYSA-N CC(C)C(CC(N1CCCC(NCC(NCC(NCC(NCCC(C)=O)=O)=O)=O)=O)=O)C1=O Chemical compound CC(C)C(CC(N1CCCC(NCC(NCC(NCC(NCCC(C)=O)=O)=O)=O)=O)=O)C1=O CVZSDGNYSYQXFK-UHFFFAOYSA-N 0.000 description 3
- HGHWLXSFWFQDBY-UHFFFAOYSA-N CC(CC(N1CCC(C)=O)=O)C1=O Chemical compound CC(CC(N1CCC(C)=O)=O)C1=O HGHWLXSFWFQDBY-UHFFFAOYSA-N 0.000 description 3
- AKANYSOTAGFEOL-UHFFFAOYSA-N CC(CC(N1CCCC(C)=O)=O)C1=O Chemical compound CC(CC(N1CCCC(C)=O)=O)C1=O AKANYSOTAGFEOL-UHFFFAOYSA-N 0.000 description 3
- YCKRVGKVZGBWHU-UHFFFAOYSA-N CC(CC(N1CC(CC2)CCC2C(C)=O)=O)C1=O Chemical compound CC(CC(N1CC(CC2)CCC2C(C)=O)=O)C1=O YCKRVGKVZGBWHU-UHFFFAOYSA-N 0.000 description 1
- NWJOYXBNUGIINM-UHFFFAOYSA-N COc(c(OC)c1)cc2c1N=CC(Cc1c3cccc1)N3C2=O Chemical compound COc(c(OC)c1)cc2c1N=CC(Cc1c3cccc1)N3C2=O NWJOYXBNUGIINM-UHFFFAOYSA-N 0.000 description 1
- MJEKMYYSIWOILD-FIVVQALRSA-N C[C@@H]([C@@H]1O[C@@]1(C)CCC(N(C)c1cc(C/C(/C)=C/C=C/[C@H]([C@@](C2)(N3)O)OC)cc(OC)c1Cl)=O)[C@H]2OC3=O Chemical compound C[C@@H]([C@@H]1O[C@@]1(C)CCC(N(C)c1cc(C/C(/C)=C/C=C/[C@H]([C@@](C2)(N3)O)OC)cc(OC)c1Cl)=O)[C@H]2OC3=O MJEKMYYSIWOILD-FIVVQALRSA-N 0.000 description 1
- BUZCOPORJIAUAF-KGQVFIBDSA-M C[C@H]([C@H](C[C@]([C@@H](/C=C/C=C(\C)/Cc(cc1N2C)cc(OC)c1Cl)OC)(N1)O)OC1=O)[C@]1(C[C@@H](C([O-])=O)N(C)C(CCC(C)(C)S)=O)O[C@@]1(C)CCC2=O Chemical compound C[C@H]([C@H](C[C@]([C@@H](/C=C/C=C(\C)/Cc(cc1N2C)cc(OC)c1Cl)OC)(N1)O)OC1=O)[C@]1(C[C@@H](C([O-])=O)N(C)C(CCC(C)(C)S)=O)O[C@@]1(C)CCC2=O BUZCOPORJIAUAF-KGQVFIBDSA-M 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6871—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting an enzyme
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/68033—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a maytansine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/68035—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a pyrrolobenzodiazepine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2896—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/40—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against enzymes
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/524—CH2 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/526—CH3 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/71—Decreased effector function due to an Fc-modification
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/72—Increased effector function due to an Fc-modification
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/77—Internalization into the cell
Definitions
- the present invention is directed to immunoconjugates comprising an antibody or fragment thereof capable of specifically binding to "Disintegrin and Metalloproteinase Domain-containing Protein 9" ("ADAM9") conjugated to at least one pharmacological agent.
- the invention particularly concerns such immunoconjugates that are cross-reactive with human ADAM9 and the ADAM9 of a non-human primate (e.g., a cynomolgus monkey).
- the invention additionally pertains to all such immunoconjugates that comprise a Light Chain Variable (VL) Domain and/or a Heavy Chain Variable (VH) Domain that has been humanized and/or deimmunized so as to exhibit reduced immunogenicity upon administration of such immunoconjugates to a recipient subject.
- the invention is also directed to pharmaceutical compositions that contain any of such immunoconjugates, and to methods involving the use of any of such immunoconjugates in the treatment of cancer and other diseases and conditions.
- ADAM is a family of proteins involved in various physiologic and pathologic processes (Amendola, R.S. et al. (2015) "ADAM9 Disintegrin Domain Activates Human Neutrophils Through An Autocrine Circuit Involving Integrins And CXCR2," J. Leukocyte Biol. 97(5):951-962; Edwars, D.R. et al. (2008) “The ADAM Metalloproteases " Molec. Aspects Med. 29:258-289). At least 40 gene members of the family have been identified, and at least 21 of such members are believed to be functional in humans (Li, J. et al. (2016) "Overexpression of ADAM9 Promotes Colon Cancer Cells Invasion " J. Invest. Surg.
- ADAM family members have a well-conserved structure with 8 domains, among which are a metalloprotease domain and an integrin-binding (disintegrin) domain (Duffy, M.J. et al. (2009) “The Role Of ADAM s In Disease Pathophysiology " Clin. Chim. Acta 403:31-36).
- the ADAM metalloprotease domain acts as a sheddase and has been reported to modulate a series of biologic processes by cleaving transmembrane proteins, which then can act as soluble ligands and regulate cellular signaling (Amendola, R.S. et al. (2015) "ADAM9 Disintegrin Domain Activates Human Neutrophils Through An Autocrine Circuit Involving Integrins And CXCR2 " J. Leukocyte Biol. 97(5):951-962; Ito, N. et al. (2004) “ADAMs, A Disintegrin And Metalloproteinases, Mediate Shedding Of Oxytocinase " Biochem. Biophys. Res. Commun. 314 (2004) 1008-1013).
- ADAM9 is a member of the ADAM family of molecule. It is synthesized as an inactive form which is proteolytic ally cleaved to generate an active enzyme. Processing at the upstream site is particularly important for activation of the proenzyme. ADAM9 is expressed in fibroblasts (Zigrino, P. et al. (2011) “The Disintegrin-Like And Cysteine-Rich Domains Of ADAM -9 Mediate Interactions Between Melanoma Cells And Fibroblasts " J. Biol. Chem. 286:6801-6807), activated vascular smooth muscle cells (Sun, C. et al.
- ADAM9's metalloprotease activity participates in the degradation of matrix components, to thereby allow migration of tumor cells (Amendola, R.S. et al. (2015) "ADAM9 Disintegrin Domain Activates Human Neutrophils Through An Autocrine Circuit Involving Integrins And CXCR2 " J. Leukocyte Biol. 97(5):951-962). Its disintegrin domain, which is highly homologous to many snake-venom disintegrins, allows the interaction between ADAM9 and integrins, and enables ADAM9 to modulate, positively or negatively, cell adhesion events (Zigrino, P. et al.
- ADAM9 disintegrin domain has been shown to interact with the ⁇ , ⁇ 6 ⁇ 4, ⁇ 5 and ⁇ 9 ⁇ 1 integrins.
- ADAM9 has been found to be relevant to disease, especially cancer. ADAM9 has been found to cleave and release a number of molecules with important roles in tumorigenesis and angiogenesis, such as TEK, KDR, EPHB4, CD40, VCAM1 and CDH5. ADAM9 is expressed by many types of tumor cells, including tumor cells of breast cancers, colon cancers, gastric cancers, gliomas, liver cancers, non-small cell lung cancers, melanomas, myelomas, pancreatic cancers and prostate cancers (Yoshimasu, T. et al. (2004) "Overexpression Of ADAM9 In Non-Small Cell Lung Cancer Correlates With Brain Metastasis " Cancer Res.
- ADAM9 expression has been found to correlate positively with tumor malignancy and metastatic potential (Amendola, R.S. et al. (2015) "ADAM9 Disintegrin Domain Activates Human Neutrophils Through An Autocrine Circuit Involving Integrins And CXCR2," J. Leukocyte Biol. 97(5):951-962; Fan, X. et al. (2016) "ADAM9 Expression Is Associate with Glioma Tumor Grade and Histological Type, and Acts as a Prognostic Factor in Lower-Grade Gliomas,” Int. J. Mol. Sci. 17: 1276: 1-11; Li, J. et al.
- ADAM9 and its secreted soluble isoform seem to be crucial for cancer cells to disseminate (Amendola, R.S. et al. (2015) "ADAM9 Disintegrin Domain Activates Human Neutrophils Through An Autocrine Circuit Involving Integrins And CXCR2 " J. Leukocyte Biol. 97(5):951-962; Fry, J.L. et al. (2010) "Secreted And Membrane-Bound Isoforms Of Protease ADAM9 Have Opposing Effects On Breast Cancer Cell Migration;' Cancer Res.
- ADAM9 As a potential target for anticancer therapy (Peduto, L. (2009) "ADAM9 As A Potential Target Molecule In Cancer " Curr. Pharm. Des. 15:2282-2287; Duffy, M.J. et al. (2009) “Role Of ADAM s In Cancer Formation And Progression,” Clin. Cancer Res. 15: 1140-1144; Duffy, M.J. et al. (2011) "The ADAMs Family Of Proteases: New Biomarkers And Therapeutic Targets For Cancer!," Clin. Proteomics 8:9: 1-13; Josson, S. et al.
- Prostate 71(3):232-240 see also US Patent Publication Nos. 2016/0138113, 2016/0068909, 2016/0024582, 2015/0368352, 2015/0337356, 2015/0337048, 2015/0010575, 2014/0342946, 2012/0077694, 2011/0151536, 2011/0129450, 2010/0291063, 2010/0233079, 2010/0112713, 2009/0285840, 2009/0203051, 2004/0092466, 2003/0091568, and 2002/0068062, and PCT Publication Nos.
- ADAM9 has also been found to be relevant to pulmonary disease and inflammation (see, e.g., US Patent Publication Nos. 2016/0068909; 2012/0149595; 2009/0233300; 2006/0270618; and 2009/0142301).
- Antibodies that bind to ADAM9 are commercially available from Abeam, Thermofisher, Sigma- Aldrich, and other companies.
- the present invention is directed to immunoconjugates comprising an antibody or fragment thereof capable of specifically binding to "Disintegrin and Metalloproteinase Domain-containing Protein 9" ("ADAM9") conjugated to at least one pharmacological agent.
- the invention particularly concerns such immunoconjugates that are cross-reactive with human ADAM9 and the ADAM9 of a non-human primate (e.g. , a cynomolgus monkey).
- the invention additionally pertains to all such immunoconjugates that comprise a Light Chain Variable (VL) Domain and/or a Heavy Chain Variable (VH) Domain that have been humanized and/or deimmunized so as to exhibit reduced immunogenicity upon administration of such immunoconjugates to a recipient subject.
- the invention is also directed to pharmaceutical compositions that contain any of such immunoconjugates, and to methods involving the use of any of such immunoconjugates in the treatment of cancer and other diseases and conditions.
- the present invention provides an immunoconjugate comprising an anti-ADAM9 antibody or ADAM9-binding fragment thereof:
- the anti-ADAM9 antibody or ADAM9-binding fragment thereof comprises a Light Chain Variable (VL) Domain and a Heavy Chain Variable (VH) Domain
- VL Light Chain Variable
- VH Heavy Chain Variable Domain
- the Heavy Chain Variable Domain comprises a CDR H 1 Domain, a CDR H 2 Domain and a CDRR3 Domain
- the Light Chain Variable Domain comprises a CDRLI Domain, a CDRL2 Domain, and a CDRL3 Domain
- said CDR H 1 Domain, CDR H 2 Domain and CDR H 3 Domain have the amino acid sequence of the CDR H 1 Domain, CDR H 2 Domain and CDR H 3 Domain of a Heavy Chain Variable (VH) Domain of an optimized variant of MAB-A; and said CDRLI Domain, CDRL2 Domain, and CDRL3 Domain have the amino acid sequence of the CDR L 1 Domain, CDR L 2 Domain, and CDR L 3 Domain of the Light Chain Variable (VL) Domain of MAB-A; or
- said CDRRI Domain, CDRR2 Domain and CDRR3 Domain have the amino acid sequence of the CDRRI Domain, CDRR2 Domain and CDRR3 Domain of the Heavy Chain Variable (VH) Domain of MAB-A; and said CDR L 1 Domain, CDR L 2 Domain, and CDR L 3 Domain have the amino acid sequence of the CDR L I Domain, CDR L 2 Domain, and CDR L 3 Domain of a Light Chain Variable (VL) Domain of an optimized variant of MAB-A; or
- C said CDR H 1 Domain, CDR H 2 Domain and CDR H 3 Domain have the amino acid sequence of the CDR H 1 Domain, CDR H 2 Domain and CDR H 3 Domain of a Heavy Chain Variable (VH) Domain of an optimized variant of MAB-A; and said CDR L I Domain, CDR L 2 Domain, and CDR L 3 Domain have the amino acid sequence of the CDR L 1 Domain, CDR L 2 Domain, and CDR L 3 Domain of a Light Chain Variable (VL) Domain of an optimized variant of MAB-A
- the anti-ADAM9 antibody or ADAM9-binding fragment thereof comprises:
- C (1) the CDR H 1 Domain, CDR H 2 Domain and CDR H 3 Domain of a Heavy Chain Variable (VH) Domain of an optimized variant of MAB-A; and (2) the FR1, FR2, FR3 and FR4 of the VH Domain of a humanized variant of MAB-A; or
- VL Light Chain Variable Domain of a humanized/optimized variant of MAB-A.
- CDR H 1 Domain, CDR H 2 Domain and CDR H 3 Domain of the Heavy Chain Variable (VH) Domain of the optimized variant of MAB-A respectively have the amino acid sequences of:
- X 2 , X3 , X 4 , and X 5 are independently selected, and wherein: X2 is N or F; X 3 is K or R;
- X 4 is K or Q
- X 5 is S or G
- ⁇ is P, F, Y, W, I, L, V, T, G or D, and X 7 , X 8 , X9, X10, and Xn are selected such that:
- X10 is W or F; and Xn is M, L or K;
- X10 is T or V; and Xn is M, L or K;
- X10 is V; and Xn is M, L or K;
- X 7 is G
- X 8 is K, M or N
- X 9 is G
- X10 is V or T; and Xn is L or M;
- X10 is V; and Xn is L;
- X10 is V; and Xn is L.
- the Heavy Chain Variable (VH) Domain of the optimized variant of MAB-A comprises the amino acid sequence of SEQ ID NO: 15: EVQLVESGGG LVKPGGSLRL SCAASGFTFS SYWXiHWVRQA PGKGLEWVGE IIP IX 2 GHTNY NEX3FX4X5RFT I SLDNSKNTLY LQMGSLRAED TAVYYCARGG YYYYX 6 X 7 X 8 X 9 XioXii
- Xi, X2, X3 , X 4 , X5, and ⁇ are independently selected, wherein: Xi is M or I; X 2 is N or F;
- X 5 is S or G
- X 6 is P, F, Y, W, I, L, V, T, G or D;
- X 7 , Xs, X 9 , X 10 , and Xn are selected such that:
- V; and Xn is M, L or K;
- X6 when X6 is T; X 7 is G; Xs is K, M or N; X 9 is G; X 10 is V or T; and Xn is L or M;
- the Heavy Chain Variable (VH) Domain of the optimized variant of MAB-A is selected from the group consisting of:
- the CDR L 1 Domain, CDR L 2 Domain and CDR L 3 Domain of the Light Chain Variable (VL) Domain of the optimized variant of MAB-A respectively have the amino acid sequences of:
- Xi 2 , X 13 , X 14 are independently selected, and wherein: Xi 2 is K or R; X 13 is D or S; and X 14 is M or L;
- X 15 , Xi 6 , and Xi 7 are independently selected, and wherein: X 15 is H or Y; Xi 6 is E or S; and Xi 7 is D or T.
- the Light Chain Variable (VL) Domain comprises the amino acid sequence of SEQ ID NO:53:
- YCQQSXi 5 Xi 6 Xi 7 PF TFGQGTKLEI K wherein: Xi 2 , X 13 , X 14 , X 15 , Xi 6 , and Xi 7 , are independently selected, and wherein: Xi 2 isKorR; Xi 3 isDorS;
- Xi 4 is M or L; X 15 is H or Y;
- Xi 6 is E or S; and Xi 7 is D or T.
- the Light Chain Variable (VL) Domain of the optimized variant of MAB-A is selected from the group consisting of:
- the CDR H 1 Domain comprises the amino acid sequence SYWMH (SEQ ID NO:8)
- the CDR R 2 Domain comprises the amino acid sequence E I I P I FGHTNYNEKFKS (SEQ ID NO:35)
- the CDR H 3 Domain comprises the amino acid sequence GGYYYYPRQGFLDY (SEQ ID NO:45)
- the CDR L 1 Domain comprises the amino acid sequence KAS Q SVDY S GD S YMN (SEQ ID NO:62), the CDR L 2 Domain comprises the amino acid sequence AASDLE S (SEQ ID NO:13), and the CDR L 3 Domain comprises the amino acid sequence QQ S HEDPF T (SEQ ID NO:14).
- the immunoconjugate comprises:
- the immunoconjugate comprises an Fc Region.
- the Fc Region is a variant Fc Region that comprises: (a) one or more amino acid modification(s) that reduce(s) the affinity of the variant Fc Region for an FcyR; and/or (b) one or more amino acid modification(s) that introduces a cysteine residue.
- the one or more amino acid modification(s) that reduce(s) the affinity of the variant Fc Region for an FcyR comprise: (A) L234A; (B) L235A; or (C) L234A and L235A; wherein said numbering is that of the EU index as in Kabat.
- the one or more amino acid modification(s) that that introduces a cysteine residue comprises S442C, wherein said numbering is that of the EU index as in Kabat.
- the immunoconjugate of the present invention comprises a humanized anti-ADAM9 antibody or ADAM9-binding fragment thereof that specifically binds to human ADAM9 and cyno ADAM9, wherein the humanized anti- ADAM9 antibody or ADAM9-binding fragment thereof is conjugated to the pharmacological agent.
- the humanized anti-ADAM9 antibody or ADAM9- binding fragment thereof comprises a CDR H 1 domain, a CDR H 2 domain, and a CDR H 3 domain and a CDR L 1 domain, a CDR L 2 domain, and a CDR L 3 domain having the sequences selected from the group consisting of:
- the humanized anti-ADAM9 antibody or ADAM9- binding fragment thereof comprises a heavy chain variable domain (VH) and a light chain variable domain (VL) having sequences that are at least 90%, at least 95%, or at least 99% identical to sequences selected from the group consisting of:
- the humanized anti-ADAM9 antibody or ADAM9- binding fragment thereof comprises a heavy chain variable domain (VH) and a light chain variable domain (VL) having the sequences selected from the group consisting of:
- the humanized anti-ADAM9 antibody or ADAM9- binding fragment thereof is optimized to have at least a 100-fold enhancement in binding affinity to cyno ADAM9 and retains high affinity binding to human ADAM9 as compared to the chimeric or murine parental antibody.
- the anti-ADAM9 antibody or AD AM9 -binding fragment thereof comprises a CDR R I domain, a CDR R 2 domain, and a CDR R 3 domain and a CDR L I domain, a CDR L 2 domain, and a CDR L 3 domain having the sequences selected from the group consisting of:
- the humanized anti-ADAM9 antibody or ADAM9- binding fragment thereof comprises a heavy chain variable domain (VH) and a light chain variable domain (VL) having sequences that are at least 90%, at least 95%, or at least 99% identical to sequences selected from the group consisting of:
- the humanized anti-ADAM9 antibody or ADAM9- binding fragment thereof comprises a heavy chain variable domain (VH) and a light chain variable domain (VL) having the sequences selected from the group consisting of:
- the humanized anti-ADAM9 antibody is a full length antibody comprising an Fc region.
- the Fc region is a variant Fc region that comprises: (a) one or more amino acid modification(s) that reduces(s) the affinity of the variant Fc region for an FcyR selected from the group consisting of: L234A, L235A, and L234A and L235A; and/or (b) an amino acid modification that introduces a cysteine residue at S442, wherein said numbering is that of the EU index as in Kabat.
- the humanized anti-ADAM9 antibody comprises a heavy chain and a light chain having the sequences selected from the group consisting of:
- the humanized anti-ADAM9 antibody comprises a heavy chain and a light chain having the sequences selected from the group consisting of:
- the immunoconjugate of the present invention is represented by the following formula:
- CBA is an anti-ADAM9 antibody or ADAM9-binding fragment thereof of the present invention described herein that is covalently linked to Cy L1 through a lysine residue;
- W L is an integer from 1 to 20;
- W is -NR e ,
- R e' is -(CH 2 -CH 2 -0) folk-R k ;
- n is an integer from 2 to 6;
- R k is -H or -Me
- R x3 is a (Ci-C 6 )alkyl
- L' is represented by the following formula:
- R 5 is -H or a (Ci-C 3 )alkyl
- P is an amino acid residue or a peptide containing between 2 to 20 amino acid residues
- R a and R are each independently -H, (Ci-C 3 )alkyl, or a charged substituent or an ionizable group Q;
- n is an integer from 1 to 6;
- Z sl is selected from any one of the following formulas:
- q is an integer from 1 to 5.
- the immunoconjugate of the present invention is represented by the following formula:
- CBA is an anti-ADAM9 antibody or ADAM9-binding fragment thereof of the present invention described herein that is covalently linked to Cy through a lysine residue;
- WL is an integer from 1 to 20;
- the double line— between N and C represents a single bond or a double bond, provided that when it is a double bond, X is absent and Y is -H or a (Ci-C 4 )alkyl; and when it is a single bond, X is -H or an amine protecting moiety, and Y is -OH or -SO 3 H;
- R xl and R x2 are independently (Ci-Ce)alkyl
- R e is -H or a (Ci-C 6 )alkyl
- W is -NR e ,
- R e' is -(CH 2 -CH 2 -0) folk-R k ;
- n is an integer from 2 to 6;
- R k is -H or -Me
- Z sl is selected from any one of the following formulas:
- the immunoconjugate of the present invention is represented by the following formula:
- CBA is an anti-ADAM9 antibody or ADAM9-binding fragment thereof of the present invention that is covalently linked to Cy L3 through a lysine residue;
- W L is an integer from 1 to 20;
- Cy L3 is represented by the following formula:
- n' is 1 or 2;
- Ri and R 2 are each independently H or a (Ci-C 3 )alkyl
- Z sl is selected from any one of the following formulas:
- q is an integer from 1 to 5.
- the immunoconjugate of the present invention comprises an humanized anti-ADAM9 antibody or ADAM9-binding fragment thereof linked to the maytansinoid DM4 via N-succinimidyl-4-(2-pyridyldithio)2-sulfo butanoate (sulfo-SPDB), wherein an humanized anti-ADAM9 antibody or ADAM9-binding fragment thereof comprising a CDR H 1 domain, a CDR H 2 domain, and a CDR H 3 domain and a CDR L 1 domain, a CDR L 2 domain, and a CDR L 3 domain having the sequences of SEQ ID NOs: 8, 35, and 45 and SEQ ID NOs: 62, 13, 14, respectively.
- the humanized anti-ADAM9 antibody or ADAM9-binding fragment thereof comprises a heavy chain variable domain (VH) and a light chain variable domain (VL) having sequences of SEQ ID NO:28 and SEQ ID NO:55, respectively.
- the humanized anti-ADAM9 antibody comprises a heavy chain and a light chain having the sequences of SEQ ID NO:52 and SEQ ID NO:68, respectively.
- the humanized anti-ADAM9 antibody comprises a heavy chain and a light chain having the sequences of SEQ ID NO: 151 and SEQ ID NO:68, respectively.
- X in SEQ ID NO:52 or SEQ ID NO: 151 is lysine.
- X in SEQ ID NO:52 or SEQ ID NO: 151 is absent.
- the immunoconjugate of the present invention is represented by the following formula:
- W L is an integer from 1 to 10;
- CBA is an humanized anti-ADAM9 antibody or ADAM9-binding fragment thereof comprising a CDR H 1 domain, a CDR H 2 domain, and a CDR H 3 domain and a CDRLI domain, a CDRL2 domain, and a CDRL3 domain having the sequences of SEQ ID NOs: 8, 35, and 45 and SEQ ID NOs: 62, 13, 14, respectively.
- the humanized anti-ADAM9 antibody or ADAM9-binding fragment thereof comprises a heavy chain variable domain (VH) and a light chain variable domain (VL) having sequences of SEQ ID NO:28 and SEQ ID NO:55, respectively.
- the humanized anti-ADAM9 antibody comprises a heavy chain and a light chain having the sequences of SEQ ID NO:52 and SEQ ID NO:68, respectively. In some embodiments, the humanized anti-ADAM9 antibody comprises a heavy chain and a light chain having the sequences of SEQ ID NO: 151 and SEQ ID NO:68, respectively. In some embodiments, X in SEQ ID NO:52 or SEQ ID NO: 151 is lysine. In some embodiments, In some embodiments, X in SEQ ID NO:52 or SEQ ID NO: 151 is absent. In some embodiments, the DAR value for a composition (e.g.
- compositions comprising the immunoconjugate is in the range of 1.0 to 5.0, 1.0 to 4.0, 1.0 to 3.4, 1.0 to 3.0, 1.5 to 2.5, 2.0 to 2.5, or 1.8 to 2.2.
- the DAR is less than 4.0, less than 3.8, less than 3.6, less than 3.5, less than 3.0 or less than 2.5.
- the immunoconjugate of the present invention is represented by the following formula
- CBA is an anti-ADAM9 antibody or ADAM9-binding fragment thereof of the
- Wc is 1 or 2
- the double line— between N and C represents a single bond or a double bond, provided that when it is a double bond, X is absent and Y is -H or a (Ci-C 4 )alkyl; and when it is a single bond, X is -H or an amine protecting moiety, Y is -OH or -SO 3 H or a pharmaceutically acceptable salt thereof;
- R 5 is -H or a (Ci-C 3 )alkyl
- P is an amino acid residue or a peptide containing 2 to 20 amino acid residues
- R a and R b are independently -H, (Ci-C 3 )alkyl, or a charged substituent or an ionizable group Q;
- W is -NR e ,
- R e' is -(CH 2 -CH 2 -0) folk-R k ;
- n is an integer from 2 to 6;
- R k is -H or -Me
- R x3 is a (Ci-C 6 )alkyl
- R19 and R 2 o are independently -H or a (Ci-C 3 )alkyl
- n is an integer between 1 and 10;
- R h is -H or a (Ci-C 3 )alkyl.
- the immunoconjugate of the present invention is represented by the following formula:
- CBA is an humanized anti-ADAM9 antibody or ADAM9-binding fragment thereof comprising a CDR H 1 domain, a CDR H 2 domain, and a CDR H 3 domain and a CDR L I domain, a CDR L 2 domain, and a CDR L 3 domain having the sequences of SEQ ID NOs: 8, 35, and 45 and SEQ ID NOs: 62, 13, 14, respectively.
- the humanized anti-ADAM9 antibody or ADAM9-binding fragment thereof comprises a heavy chain variable domain (VH) and a light chain variable domain (VL) having sequences of SEQ ID NO:28 and SEQ ID NO:55, respectively.
- humanized anti- ADAM9 antibody comprises a heavy chain and a light chain having the sequences of SEQ ID NO: 142 and SEQ ID NO:68, respectively.
- X in SEQ ID NO: 142 is lysine.
- the humanized anti-ADAM9 antibody comprises a heavy chain and a light chain having the sequences of SEQ ID NO: 152 and SEQ ID NO:68, respectively.
- X in SEQ ID NO: 142 or SEQ ID NO: 152 is lysine.
- X in SEQ ID NO: 142 or SEQ ID NO: 152 is absent.
- the immunoconjugate is represented by the following formula:
- CBA is an anti-ADAM9 antibody or ADAM9-binding fragment thereof of the present invention described herein covalently linked to Cy through a cysteine residue;
- W c is 1 or 2;
- Cy C2 is re resented by the following formula:
- R xl is a (Ci-C 6 )alkyl
- R e is -H or a (Ci-C 6 )alkyl
- W is -NR e ;
- R e' is -(CH 2 -CH 2 -0) n -R k ;
- n is an integer from 2 to 6;
- R k is -H or -Me
- R x2 is a (Ci-C 6 )alkyl
- Lc' is represented by the following formula:
- si is the site covalently linked to the CBA and s2 is the site covalently linked to -S- group on Cy C2 ;
- Q is -H, a charged substituent, or an ionizable group
- R9, Rio, R11, R12, Ri3, R19, R20, R21 and R 22 , for each occurrence, are independently - H or a (Ci-C 3 )alkyl;
- q and r are independently an integer between 0 and 10;
- n are each independently an integer between 0 and 10;
- R h is -H or a (Ci-C 3 )alkyl
- P' is an amino acid residue or a peptide containing 2 to 20 amino acid residues.
- the immunoconjugate of the present invention is represented by the following formula
- CBA is an anti-ADAM9 antibody or ADAM9-binding fragment thereof of the present invention described herein covalently linked to Cy C3 through a cysteine residue;
- Wc is 1 or 2
- Cy C3 is represented by the following formula:
- n' is 1 or 2;
- Ri and R 2 are each independently -H or a (Ci-C 3 )alkyl
- Lc' is represented by the following formula:
- si is the site covalently linked to the CBA and s2 is the site covalently linked to -S- group on Cy C3 ;
- Q is H, a charged substituent, or an ionizable group
- R9, Rio, R11, Ri 2 , Ri3, R19, R 2 o, R21 and R 22 , for each occurrence, are independently - H or a (Ci-C 3 )alkyl;
- q and r are independently an integer between 0 and 10;
- n are each independently an integer between 0 and 10;
- R h is -H or a (Ci-C 3 )alkyl
- P' is an amino acid residue or a peptide containing 2 to 20 amino acid residues.
- the immunoconjugate of the present invention is represented by the followin formula:
- DM is a drug moiety represented by the following formula:
- Wc is 1 or 2
- CBA is an humanized anti-ADAM9 antibody or ADAM9-binding fragment thereof comprising a CDR H 1 domain, a CDR H 2 domain, and a CDR H 3 domain and a CDR L I domain, a CDR L 2 domain, and a CDR L 3 domain having the sequences of SEQ ID NOs: 8, 35, and 45 and SEQ ID NOs: 62, 13, 14, respectively.
- the humanized anti-ADAM9 antibody or ADAM9-binding fragment thereof comprises a heavy chain variable domain (VH) and a light chain variable domain (VL) having sequences of SEQ ID NO:28 and SEQ ID NO:55, respectively.
- the humanized anti-ADAM9 antibody comprises a heavy chain and a light chain having the sequences of SEQ ID NO: 142 and SEQ ID NO:68, respectively. In some embodiments, the humanized anti-ADAM9 antibody comprises a heavy chain and a light chain having the sequences of SEQ ID NO: 152 and SEQ ID NO:68, respectively.
- X in SEQ ID NO: 142 or SEQ ID NO: 152 is lysine. In some embodiments, X in SEQ ID NO: 142 or SEQ ID NO: 152 is absent. In some embodiments, Wc is 2.
- the immunoconjugate of the present invention is represented by the followin formula:
- DM is a drug moiety represented by the following formula:
- CBA is an humanized anti-ADAM9 antibody or ADAM9-binding fragment thereof comprising a CDR H 1 domain, a CDR H 2 domain, and a CDR H 3 domain and a CDR L 1 domain, a CDR L 2 domain, and a CDR L 3 domain having the sequences of SEQ ID NOs: 8, 35, and 45 and SEQ ID NOs: 62, 13, 14, respectively.
- the humanized anti-ADAM9 antibody or ADAM9-binding fragment thereof comprises a heavy chain variable domain (VH) and a light chain variable domain (VL) having sequences of SEQ ID NO:28 and SEQ ID NO:55, respectively.
- the humanized anti-ADAM9 antibody comprises a heavy chain and a light chain having the sequences of SEQ ID NO: 142 and SEQ ID NO:68, respectively. In some embodiments, the humanized anti-ADAM9 antibody comprises a heavy chain and a light chain having the sequences of SEQ ID NO: 152 and SEQ ID NO:68, respectively; and
- Wc is 1 or 2. In some embodiments, Wc is 2.
- Another aspect of the present invention provides a pharmaceutical composition
- a pharmaceutical composition comprising an effective amount of the immunoconjugate of the present invention described herein and a pharmaceutically acceptable carrier, excipient or diluent.
- the present invention provides a method for treating a disease or condition associated with, or characterized by, the expression of ADAM9 in a subject comprising administering to said subject an effective amount of the immunoconjugate or the pharmaceutical composition of the present invention described herein. Also provided in the present invention is the use of the immunoconjugate or the pharmaceutical composition of the present invention described herein in the treatment of a disease or condition associated with, or characterized by, the expression of ADAM9 in a subject. The present invention also provides the use of the immunoconjugate or the pharmaceutical composition of the present invention described herein for the manufacture of a medicament for treating a disease or condition associated with, or characterized by, the expression of ADAM9 in a subject.
- the disease or condition associated with, or characterized by, the expression of ADAM9 is cancer.
- the cancer is selected from the group consisting of non- small-cell lung cancer, colorectal cancer, gastric cancer, pancreatic cancer, renal cell carcinoma, prostate cancer, esophageal cancer, breast cancer, head and neck cancer, ovarian cancer, liver cancer, cervical cancer, thyroid cancer, testicular cancer, myeloid cancer, melanoma, and lymphoid cancer.
- the non-small-cell lung cancer is squamous cell carcinoma, adenocarcinoma, or large-cell undifferentiated carcinoma.
- the colorectal cancer is adenocarcinoma, gastrointestinal carcinoid tumors, gastrointestinal stromal tumors, primary colorectal lymphoma, leiomyosarcoma, or squamous cell carcinoma.
- FIGs. 1A-1C present the results of an immunohistochemistry (IHC) studies and show the ability of MAB-A to specifically label a variety of non- small cell lung cancer types (FIG. 1A), breast cancer cells, prostate cancer cells, gastric cancer cells (FIG. IB), and colon cancer cells (FIG. 1C) while the isotype control failed to specifically label any of these cancer cell types (FIGs. 1A-1C).
- IHC immunohistochemistry
- FIG. 2 presents the results of cell staining studies and show that MAB-A binds to human ADAM9, and to a lesser extent, cynomolgus monkey ADAM9, transiently expressed on the surface of 293-FT and CHO-K cells (top and bottom panels respectively).
- FIGs. 3A-3B depict the amino acid sequences of the murine anti-ADAM9-VH Domain aligned with several humanized/optimized variants of MAB-A (FIG. 3A, SEQ ID NOs:7, 16, 17, 18, 19, 21, 22, 23 and 28) and the murine anti-ADAM9-VL Domain aligned with several humanized/optimized variants of MAB-A (FIG. 3B, SEQ ID NOs:ll, 51, 52, 53 and 54).
- Positions substituted within the CDRs during the initial optimization are underlined as follows: potential deamidation and isomeration sites are indicated with a single underline, lysine residues are indicated with double underline, additional labile residues are indicated with a double dashed underline.
- FIGs. 4A-4B present the ELISA binding curves of the ten selected optimized hMAB-A clones comprising CDR H 3 variants, the parental hMAB-A (2.2), and an isotype control antibody.
- FIG. 4A presents the binding curves for cynoADAM9 and
- FIG. 4B presents the binding curves for huADAM9.
- FIGs. 5A-5B present the ELISA binding curves of the Fc variants.
- FIG. 5A presents the binding curves for cynoADAM9 and
- FIG. 5B presents the binding curves for huADAM9.
- FIGs. 6A-6B show ADAM9 IHC membrane staining in a 20 carcinoma tissue microarray and ADAM IHC membrane and cytoplasmic staining in eight selected indications, respectively.
- FIGs. 7A-7B show pulse internalization and continuous internalization of various anti-ADAM9 antibody conjugates.
- FIGs. 8A-8D show FACS binding curves of chMAB-A, hMAB-A(2.2), hMAB-A(2C.2), and hMAB-A(2I.2) antibodies and their corresponding immunoconjugates.
- FIGs. 9A-9H show in vitro cytotoxicity of various anti-ADAM9
- immunoconjugates (hMAB-A(2.2)-sSPDB-DM4, hMAB-A(2I.2)-sSPDB-DM4, hMAB- A(2.2)-DGN549, and hMAB-A(2I.2)-S442C-DGN549) on a broad panel of ADAM9 positive tumor cell lines.
- the non-targeting IgGl based conjugates are included as negative controls.
- FIG. 10 shows the anti-tumor activity of hMAB-A(2.2)-sSPDB-DM4 (1.25 mg/kg, 2.5 mg/kg, 5 mg/kg, by antibody) and chMAB-A-DGN549 (l(Vg/kg, by payload) in the Calu-3 human non-small cell lung adenocarcinoma xenograft model.
- FIG. 11 shows the anti-tumor activity of hMAB-A(2I.2)-S442C-DGN549 (0 ⁇ g/kg, ⁇ g/kg, 3 ⁇ g/kg, and li ⁇ g/kg, by payload) in the Calu-3 human non-small cell lung adenocarcinoma xenograft model.
- FIG. 12 shows the anti-tumor activity of hMAB-A(2.2)-sSPDB-DM4 (1.25 mg/kg, 2.5 mg/kg, 5 mg/kg, by antibody) in the H1703 non-small cell lung squamous cell carcinoma xenograft model.
- FIG. 13 shows the anti-tumor activity of chMAB - A- sSPDB -DM4 (1.25 mg/kg, 2.5 mg/kg, 5 mg/kg) in the Detroit562 head and neck squamous cell carcinoma model (tumor volume 95.76 to 450.83 mm ).
- FIG. 14 shows the anti-tumor activity of chM AB - A- sSPDB -DM4 (1.25 mg/kg and 5 mg/kg) in the Detroi562 head and neck squamous cell carcinoma model (tumor volume 277.51 to 503.49 mm 3 ).
- FIG. 15 shows the anti-tumor activity of huMAB-A(2I.2)-S442C-DGN549 in the SNU-5 gastric carcinoma xenograft model.
- FIG. 16 shows the anti-tumor activity of huMAB-A(2.2)-sSPDB-DM4 in the SNU-5 gastric carcinoma xenograft model.
- FIG. 17 shows the anti-tumor activity of huMAB-A(2I.2)-S442C-DGN549 in the SW48 colorectal cancer xenograft model.
- FIG. 18 shows the anti-tumor activity of huMAB-A(2.2)-sSPDB-DM4 in the SW48 colorectal cancer xenograft model.
- FIG. 19A shows the binding of 250nM & ⁇ huFcRn to captured anti- ADAM9 antibodies with and without the YTE mutation at pH 6.0.
- FIG. 19B shows the binding of 25nM & ⁇ anti-ADAM9 antibodies with and without the YTE mutation to immobilized FcRn at pH 6.0.
- FIG. 20 shows the antibody-drug conjugate PK data for hMAB-A(2I.2)- sSPDB-DM4 and hMAB-A(2I.2)-YTE-sSPDB-DM4 in cynomolgus monkey at both 4 mg/kg and 12 mg/kg (antibody dose).
- the present invention is directed to immunoconjugates comprising an antibody or fragment thereof capable of specifically binding to "Disintegrin and Metalloproteinase Domain-containing Protein 9" ("ADAM9") conjugated to at least one pharmacological agent.
- the invention particularly concerns such immunoconjugates that are cross-reactive with human ADAM9 and the ADAM9 of a non-human primate (e.g. , a cynomolgus monkey).
- the invention additionally pertains to all such immunoconjugates that comprise a Light Chain Variable (VL) Domain and/or a Heavy Chain Variable (VH) Domain that has been humanized and/or deimmunized so as to exhibit reduced immunogenicity upon administration of such immunoconjugates to a recipient subject.
- the invention is also directed to pharmaceutical compositions that contain any of such immunoconjugates, and to methods involving the use of any of such immunoconjugates in the treatment of cancer and other diseases and conditions.
- the immunoconjugates of the present invention comprise an antibody that binds to ADAM9 or an AD AM9 -binding fragment thereof.
- Antibodies are immunoglobulin molecules capable of specific binding to a target, such as a carbohydrate, polynucleotide, lipid, polypeptide, etc. , through at least one antigen recognition site, located in the Variable Domain of the immunoglobulin molecule.
- antibody and “antibodies” refer to monoclonal antibodies, multispecific antibodies, human antibodies, humanized antibodies, synthetic antibodies, chimeric antibodies, polyclonal antibodies, camelized antibodies, single-chain Fvs (scFv), single-chain antibodies, Fab fragments, F(ab') fragments, intrabodies, and epitope-binding fragments of any of the above.
- antibody includes immunoglobulin molecules and immunologically active fragments of immunoglobulin molecules, i.e., molecules that contain an epitope-binding site.
- Immunoglobulin molecules can be of any type (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., Igd, IgG 2 , IgG 3 , IgG 4 , IgAi and IgA 2 ) or subclass.
- class e.g., Igd, IgG 2 , IgG 3 , IgG 4 , IgAi and IgA 2
- antibodies have become one of the leading classes of biotechnology-derived drugs (Chan, C.E. et al. (2009) "The Use Of Antibodies In The Treatment Of Infectious Diseases," Singapore Med. J. 50(7):663-666).
- antibodies In addition to their use in diagnostics, antibodies have been shown to be useful as therapeutic agents. Over 200 antibody-based drugs have been approved for use or are under development.
- Antibodies are capable of "immunospecifically binding" to a polypeptide or protein or a non-protein molecule due to the presence on such molecule of a particular domain or moiety or conformation (an “epitope").
- An epitope-containing molecule may have immunogenic activity, such that it elicits an antibody production response in an animal; such molecules are termed "antigens.”
- an antibody is said to "immunospecifically” bind a region of another molecule (i.e., an epitope) if it reacts or associates more frequently, more rapidly, with greater duration and/or with greater affinity with that epitope relative to alternative epitopes.
- an antibody that immunospecifically binds to a viral epitope is an antibody that binds that viral epitope with greater affinity, avidity, more readily, and/or with greater duration than it immunospecifically binds to other viral epitopes or to non-viral epitopes. It is also understood by reading this definition that, for example, an antibody (or moiety or epitope) that immunospecifically binds to a first target may or may not specifically or preferentially bind to a second target.
- “immuno specific binding" to a particular epitope does not necessarily require (although it can include) exclusive binding to that epitope.
- reference to binding means “immuno specific" binding. Two molecules are said to be capable of binding to one another in a "physiospecific" manner, if such binding exhibits the specificity with which receptors bind to their respective ligands.
- the term "monoclonal antibody” refers to a homogeneous antibody population wherein the monoclonal antibody is comprised of amino acids (naturally occurring or non-naturally occurring) that are involved in the selective binding of an antigen. Monoclonal antibodies are highly specific, being directed against a single epitope (or antigenic site).
- the term "monoclonal antibody” encompasses not only intact monoclonal antibodies and full-length monoclonal antibodies, but also fragments thereof (such as Fab, Fab', F(ab') 2 Fv), single-chain (scFv), mutants thereof, fusion proteins comprising an antibody portion, humanized monoclonal antibodies, chimeric monoclonal antibodies, and any other modified configuration of the immunoglobulin molecule that comprises an antigen recognition site of the required specificity and the ability to bind to an antigen.
- the term is not intended to be limited as regards to the source of the antibody or the manner in which it is made (e.g., by hybridoma, phage selection, recombinant expression, transgenic animals, etc.).
- the term includes whole immunoglobulins as well as the fragments etc. described above under the definition of "antibody.”
- Methods of making monoclonal antibodies are known in the art. One method which may be employed is the method of Kohler, G. et al. (1975) "Continuous Cultures Of Fused Cells Secreting Antibody Of Predefined Specificity " Nature 256:495-497, or a modification thereof.
- monoclonal antibodies are developed in mice, rats or rabbits.
- the antibodies are produced by immunizing an animal with an immunogenic amount of cells, cell extracts, or protein preparations that contain the desired epitope.
- the immunogen can be, but is not limited to, primary cells, cultured cell lines, cancerous cells, proteins, peptides, nucleic acids, or tissue.
- Cells used for immunization may be cultured for a period of time (e.g., at least 24 hours) prior to their use as an immunogen.
- Cells may be used as immunogens by themselves or in combination with a non-denaturing adjuvant, such as Ribi (see, e.g., Jennings, V.M. (1995) "Review of Selected Adjuvants Used in Antibody Production " ILAR J. 37(3): 119-125).
- a non-denaturing adjuvant such as Ribi (see, e.g., Jennings, V.M. (1995) "Review of Selected Adjuvants Used in Antibody Production " ILAR J. 37(3): 119-125).
- Ribi see, e.g., Jennings, V.M. (1995) "Review of Selected Adjuvants Used in Antibody Production " ILAR J. 37(3): 119-125).
- cells should be kept intact and preferably viable when used as immunogens. Intact
- the immunogen may be administered multiple times at periodic intervals such as, bi weekly, or weekly, or may be administered in such a way as to maintain viability in the animal (e.g., in a tissue recombinant).
- existing monoclonal antibodies and any other equivalent antibodies that are immuno specific for a desired pathogenic epitope can be sequenced and produced recombinantly by any means known in the art.
- such an antibody is sequenced and the polynucleotide sequence is then cloned into a vector for expression or propagation.
- the sequence encoding the antibody of interest may be maintained in a vector in a host cell and the host cell can then be expanded and frozen for future use.
- the polynucleotide sequence of such antibodies may be used for genetic manipulation to generate an affinity optimized, a chimeric antibody, a humanized antibody, and/or a caninized antibody, to improve the affinity, or other characteristics of the antibody, as well as the immunoconjugates of the invention.
- the general principle in humanizing an antibody involves retaining the basic sequence of the antigen-binding portion of the antibody, while swapping the non-human remainder of the antibody with human antibody sequences.
- Natural antibodies are composed of two “Light Chains” complexed with two "Heavy Chains.” Each Light Chain contains a Variable Domain (“VL”) and a Constant Domain (“CL”). Each Heavy Chain contains a Variable Domain (“VH”), three Constant Domains ("CHI,” “CH2” and “CH3”), and a “Hinge” Region (“H”) located between the CHI and CH2 Domains.
- VL Variable Domain
- CL Constant Domain
- H Hinge” Region
- scFvs are single chain molecules made by linking Light and Heavy Chain Variable Domains together via a short linking peptide.
- the basic structural unit of naturally occurring immunoglobulins is thus a tetramer having two light chains and two heavy chains, usually expressed as a glycoprotein of about 150,000 Da.
- the amino -terminal (“N-terminal") portion of each chain includes a Variable Domain of about 100 to 110 or more amino acids primarily responsible for antigen recognition.
- the carboxy-terminal (“C-terminal”) portion of each chain defines a constant region, with light chains having a single Constant Domain and heavy chains usually having three Constant Domains and a Hinge Region.
- the structure of the light chains of an IgG molecule is n-VL-CL-c and the structure of the IgG heavy chains is n-VH-CHl-H-CH2-CH3-c (where n and c represent, respectively, the N-terminus and the C-terminus of the polypeptide).
- the Variable Domains of an IgG molecule consist of 1, 2, and most commonly 3, complementarity determining regions ("CDR", i.e., CDR1, CDR2 and CDR3, respectively), which contain the residues in contact with epitope, and non-CDR segments, referred to as framework regions ("FR"), which in general maintain the structure and determine the positioning of the CDR regions so as to permit such contacting (although certain framework residues may also contact the epitope).
- CDR complementarity determining regions
- FR framework regions
- the VL and VH Domains typically have the structure: n-FRl-CDRl-FR2-CDR2-FR3-CDR3-FR4-c (where "n” denotes the N-terminus and "c" denotes the C-terminus).
- Polypeptides that are (or may serve as) the first, second, third, and fourth FR of the Light Chain of an antibody are herein respectively designated as: FRLI Domain, FRL2 Domain, FRL3 Domain, and FRL4 Domain.
- polypeptides that are (or may serve as) the first, second, third and fourth FR of the Heavy Chain of an antibody are herein respectively designated as: FRHI Domain, FRH2 Domain, FRH3 Domain and FRH4 Domain.
- Polypeptides that are (or may serve as) the first, second and third CDR of the Light Chain of an antibody are herein respectively designated as: CDRLI Domain, CDRL2 Domain, and CDRL3 Domain.
- polypeptides that are (or may serve as) the first, second and third CDR of the Heavy Chain of an antibody are herein respectively designated as: CDRHI Domain, CDRH2 Domain, and CDRH3 Domain.
- CDRHI Domain CDRH2 Domain
- CDRH3 Domain polypeptides that are (or may serve as) the first, second and third CDR of the Heavy Chain of an antibody.
- CDR L I Domain, CDR L 2 Domain, CDR L 3 Domain, CDR R I Domain, CDR R 2 Domain, and CDR R 3 Domain are directed to polypeptides that when incorporated into an antibody causes the antibody to be able to bind to a specific epitope.
- the numbering of the residues in the Variable Domains of the mature heavy and light chains of immunoglobulins are designated by the position of an amino acid in the chain. Kabat described numerous amino acid sequences for antibodies, identified an amino acid consensus sequence for each subgroup, and assigned a residue number to each amino acid, and the CDRs are identified as defined by Kabat (it will be understood that CDR R I as defined by Chothia, C. & Lesk, A. M. ((1987) "Canonical structures for the hypervariable regions of immunoglobulins " J. Mol. Biol. 196:901-917) begins five residues earlier).
- Kabat's numbering scheme is extendible to antibodies not included in his compendium by aligning the antibody in question with one of the consensus sequences in Kabat by reference to conserved amino acids.
- This method for assigning residue numbers has become standard in the field and readily identifies amino acids at equivalent positions in different antibodies, including chimeric or humanized variants. For example, an amino acid at position 50 of a human antibody light chain occupies the equivalent position to an amino acid at position 50 of a mouse antibody light chain.
- an antibody to bind an epitope of an antigen depends upon the presence and amino acid sequence of the antibody's VL and VH Domains. Interaction of an antibody's Light Chain and Heavy Chain and, in particular, interaction of its VL and VH Domains forms one of the two epitope-binding sites of a natural antibody, such as an IgG. Natural antibodies are capable of binding to only one epitope species ⁇ i.e., they are monospecific), although they can bind multiple copies of that epitope species ⁇ i.e., exhibiting bivalency or multivalency).
- epitope-binding fragment means a fragment of an antibody capable of immunospecifically binding to an epitope
- epitope-binding site refers to a portion of a molecule comprising an epitope-binding fragment.
- An epitope-binding fragment may contain any 1, 2, 3, 4, or 5 the CDR Domains of an antibody, or may contain all 6 of the CDR Domains of an antibody and, although capable of immunospecifically binding to such epitope, may exhibit an immunospecificity, affinity or selectivity toward such epitope that differs from that of such antibody.
- an epitope-binding fragment will contain all 6 of the CDR Domains of such antibody.
- An epitope-binding fragment of an antibody may be a single polypeptide chain ⁇ e.g., an scFv), or may comprise two or more polypeptide chains, each having an amino terminus and a carboxy terminus ⁇ e.g., a Fab fragment, an Fab 2 fragment, etc.).
- the order of domains of the protein molecules described herein is in the "N-terminal to C-terminal" direction.
- the invention also encompasses immunoconjugates comprising single-chain Variable Domain fragments ("scFv") comprising an anti-ADAM9-VL and/or VH Domain of the invention.
- Single-chain Variable Domain fragments comprise VL and VH Domains that are linked together using a short "Linker" peptide.
- Linkers can be modified to provide additional functions, such as to permit the attachment of a drug or to permit attachment to a solid support.
- the single-chain variants can be produced either recombinantly or synthetically. For synthetic production of scFv, an automated synthesizer can be used.
- a suitable plasmid containing polynucleotide that encodes the scFv can be introduced into a suitable host cell, either eukaryotic, such as yeast, plant, insect or mammalian cells, or prokaryotic, such as E. coli.
- a suitable host cell either eukaryotic, such as yeast, plant, insect or mammalian cells, or prokaryotic, such as E. coli.
- Polynucleotides encoding the scFv of interest can be made by routine manipulations such as ligation of polynucleotides.
- the resultant scFv can be isolated using standard protein purification techniques known in the art.
- the invention also particularly encompasses immunoconjugates comprising the CDR H 1, CDR h 2, CDR h 3, CDR l 1, CDRL2, and CDR L 3 Domains of humanized/optimized variants of the anti-ADAM9 antibodies of the invention, as well as VL Domains that contain any 1, 2, or 3 of such CDR L s and VH Domains that contain any 1, 2, or 3 of such CDRRS, as well as multispecific-binding molecules comprising the same.
- the term "humanized” antibody refers to a chimeric molecule having an epitope-binding site of an immunoglobulin from a non-human species and a remaining immunoglobulin structure that is based upon the structure and /or sequence of a human immunoglobulin.
- Humanized antibodies are generally prepared using recombinant techniques.
- the immunoconjugates of the present invention may comprise humanized, chimeric or caninized variants of an antibody that is designated herein as "MAB-A.”
- the polynucleotide sequences that encode the Variable Domains of MAB-A may be used for genetic manipulation to generate MAB-A derivatives possessing improved or altered characteristics (e.g. , affinity, cross-reactivity, specificity, etc.).
- the general principle in humanizing an antibody involves retaining the basic sequence of the epitope-binding portion of the antibody, while swapping the non-human remainder of the antibody with human antibody sequences. There are four general steps to humanize a monoclonal antibody.
- the term “optimized” antibody refers to an antibody having at least one amino acid which is different from the parent antibody in at least one complementarity determining region (CDR) in the light or heavy chain variable region, which confers a higher binding affinity, (e.g., a 2-fold or more fold) higher binding affinity, to human ADAM9 and/or cynomolgus monkey ADAM9 as compared to the parental antibody.
- CDR complementarity determining region
- the epitope-binding site may comprise either a complete Variable Domain fused to one or more Constant Domains or only the CDRs of such Variable Domain grafted to appropriate framework regions.
- Epitope-binding sites may be wild- type or may be modified by one or more amino acid substitutions, insertions or deletions. Such action partially or completely eliminates the ability of the Constant Region to serve as an immunogen in recipients (e.g., human individuals), however, the possibility of an immune response to the foreign Variable Domain remains (LoBuglio, A.F. et al. (1989) "Mouse/Human Chimeric Monoclonal Antibody In Man: Kinetics And Immune Response," Proc. Natl. Acad. Sci.
- variable domains can be "reshaped” or “humanized” by grafting CDRs derived from non-human antibody on the FRs present in the human antibody to be modified.
- humanized antibodies preserve all CDR sequences (for example, a humanized murine antibody which contains all six of the CDRs present in the murine antibody).
- humanized antibodies have one or more CDRs (one, two, three, four, five, or six) that differ in sequence relative to the CDRs of the original antibody.
- a number of humanized antibody molecules comprising an epitope-binding site derived from a non-human immunoglobulin have been described, including chimeric antibodies having rodent or modified rodent Variable Domain and their associated complementarity determining regions (CDRs) fused to human constant domains (see, for example, Winter et al. (1991) "Man-made Antibodies," Nature 349:293-299; Lobuglio et al. (1989) "Mouse/Human Chimeric Monoclonal Antibody In Man: Kinetics And Immune Response," Proc. Natl. Acad. Sci. (U.S.A.) 86:4220-4224; Shaw et al.
- CDRs complementarity determining regions
- the numbering of the residues in the constant region of an IgG heavy chain is that of the EU index as in Kabat et al., SEQUENCES OF PROTEINS OF IMMUNOLOGICAL INTEREST, 5 th Ed. Public Health Service, NH1, MD (1991) ("Kabat”), expressly incorporated herein by reference.
- the term "the EU index as set forth in Kabat” refers to the numbering of the Constant Domains of human IgGl EU antibody provided in Kabat. This method for assigning residue numbers has become standard in the field and readily identifies amino acids at equivalent positions in the constant regions of different antibody isotypes.
- each Light Chain of an antibody contains a Variable Domain ("VL”) and a Constant Domain (“CL").
- VL Variable Domain
- CL Constant Domain
- a preferred CL Domain is a human IgG CL Kappa Domain.
- the amino acid sequence of an exemplary human CL Kappa Domain is (SEQ ID NO:69):
- an exemplary CL Domain is a human IgG CL Lambda Domain.
- amino acid sequence of an exemplary human CL Lambda Domain is (SEQ ID NO:70):
- the immunoconjugates of the invention may comprise an Fc Region.
- the Fc Region of such immunoconjugates the invention may be of any isotype (e.g. , IgGl, IgG2, IgG3, or IgG4).
- the immunoconjugates of the invention may further comprise a CHI Domain and/or a Hinge Region.
- the CHI Domain and/or Hinge Region may be of any isotype (e.g. , IgGl, IgG2, IgG3, or IgG4), and is preferably of the same isotype as the desired Fc Region.
- the Fc Region of the Fc Region-containing immunoconjugates of the present invention may be either a complete Fc Region (e.g. , a complete IgG Fc Region) or only a fragment of an Fc Region.
- the Fc Region of the Fc Region-containing immunoconjugates of the present invention lacks the C-terminal lysine amino acid residue.
- CHI Domains of the two heavy chains of an antibody complex with the antibody' s Light Chain' s "CL" constant region are attached to the heavy chains CH2 Domains via an intervening Hinge Domain.
- An exemplary CHI Domain is a human IgGl CHI Domain.
- the amino acid sequence of an exemplary human IgGl CHI Domain is (SEQ ID NO:71):
- An exemplary CHI Domain is a human IgG2 CHI Domain.
- the amino acid sequence of an exemplary human IgG2 CHI Domain is (SEQ ID NO:72):
- An exemplary CHI Domain is a human IgG4 CHI Domain.
- the amino acid sequence of an exemplary human IgG4 CHI Domain is (SEQ ID NO:73):
- One exemplary Hinge Region is a human IgGl Hinge Region.
- the amino acid sequence of an exemplary human IgGl Hinge Region is (SEQ ID NO:74):
- Another exemplary Hinge Region is a human IgG2 Hinge Region.
- the amino acid sequence of an exemplary human IgG2 Hinge Region is (SEQ ID NO: 75):
- Another exemplary Hinge Region is a human IgG4 Hinge Region.
- the amino acid sequence of an exemplary human IgG4 Hinge Region is (SEQ ID NO: 76): ESKYGPPCPSCP.
- an IgG4 Hinge Region may comprise a stabilizing mutation, such as the S228P substitution.
- the amino acid sequence of an exemplary stabilized IgG4 Hinge Region is (SEQ ID NO:77): ESKYGPPCPPCP.
- Fc Region is a domain that is recognized by cellular “Fc Receptors,” including but not limited to Fc gamma Receptors ("FcyRs").
- FcyRs Fc gamma Receptors
- Fc Region is used to define the C-terminal region of an IgG Heavy Chain that comprises the CH2 and CH3 Domains of that chain.
- An Fc Region is said to be of a particular IgG isotype, class or subclass if its amino acid sequence is most homologous to that isotype, relative to other IgG isotypes.
- IgGl is (SEQ ID NO:l):
- ALHNHYTQKS LSLSPGX as numbered by the EU index as set forth in Kabat, wherein X is a lysine (K) or is absent.
- amino acid sequence of the CH2-CH3 Domain of an exemplary human IgG2 is (SEQ ID NO:2): 231 240 250 260 270 280
- amino acid sequence of the CH2-CH3 Domain of an exemplary human IgG3 is (SEQ ID NO:3):
- amino acid sequence of the CH2-CH3 Domain of an exemplary human IgG4 is (SEQ ID NO:4):
- Polymorphisms have been observed at a number of different positions within antibody constant regions (e.g., Fc positions, including but not limited to positions 270, 272, 312, 315, 356, and 358 as numbered by the EU index as set forth in Kabat), and thus slight differences between the presented sequence and sequences in the prior art can exist. Polymorphic forms of human immunoglobulins have been well-characterized.
- Gm Glm (1, 2, 3, 17) or Glm (a, x, f, z), G2m (23) or G2m (n), G3m (5, 6, 10, 11, 13, 14, 15, 16, 21, 24, 26, 27, 28) or G3m (bl, c3, b3, bO, b3, b4, s, t, gl, c5, u, v, g5)
- Glm 1, 2, 3, 17
- Glm a, x, f, z
- G2m G2m (23) or G2m (n)
- G3m 5, 6, 10, 11, 13, 14, 15, 16, 21, 24, 26, 27, 28
- G3m bl, c3, b3, bO, b3, b4, s, t, gl, c5, u, v, g5)
- Lefranc, et al. "The Human IgG Subclasses: Molecular Analysis of Structure, Function And Regulation.” Pergamon, Oxford, pp. 43-
- the antibodies of the present invention may incorporate any allotype, isoallotype, or haplotype of any immunoglobulin gene, and are not limited to the allotype, isoallotype or haplotype of the sequences provided herein.
- the C-terminal amino acid residue (bolded above) of the CH3 Domain may be post-translationally removed. Accordingly, the C- terminal residue of the CH3 Domain is an optional amino acid residue in the immunoconjugates of the invention.
- immunoconjugates lacking the C-terminal residue of the CH3 Domain.
- constructs comprising the C-terminal lysine residue of the CH3 Domain.
- FcyRI CD64
- FcyRII CD32
- FcyRIII CD16
- FcyRI CD64
- FcyRIIA CD32A
- FcyRIII CD16
- FcyRIIB CD32B
- FcRn neonatal Fc Receptor
- ITAM Immunoreceptor Tyrosine-Based Activation Motif
- ITIM Immunoreceptor Tyrosine-Based Inhibitory Motif
- FcyRIIB is the only currently known natural ITIM- containing FcyR; it acts to dampen or inhibit the immune system when bound to aggregated Fc Regions.
- Human neutrophils express the FcyRIIA gene.
- FcyRIIA clustering via immune complexes or specific antibody cross-linking serves to aggregate ITAMs with receptor- associated kinases which facilitate ITAM phosphorylation.
- ITAM phosphorylation serves as a docking site for Syk kinase, the activation of which results in the activation of downstream substrates (e.g. , PI 3 K). Cellular activation leads to release of pro-inflammatory mediators.
- the FcyRIIB gene is expressed on B lymphocytes; its extracellular domain is 96% identical to FcyRIIA and binds IgG complexes in an indistinguishable manner.
- the presence of an ITIM in the cytoplasmic domain of FcyRIIB defines this inhibitory subclass of FcyR. Recently the molecular basis of this inhibition was established.
- the ITIM in FcyRIIB becomes phosphorylated and attracts the SH2 domain of the inositol polyphosphate 5 '-phosphatase (SHIP), which hydrolyzes phosphoinositol messengers released as a consequence of ITAM-containing FcyR- mediated tyrosine kinase activation, consequently preventing the influx of intracellular Ca ++ .
- SHIP inositol polyphosphate 5 '-phosphatase
- cross-linking of FcyRIIB dampens the activating response to FcyR ligation and inhibits cellular responsiveness. B-cell activation, B-cell proliferation and antibody secretion is thus aborted.
- Modification of the Fc Region may lead to an altered phenotype, for example altered serum half-life, altered stability, altered susceptibility to cellular enzymes or altered effector function. It may therefore be desirable to modify an Fc Region-containing molecule of the present invention with respect to effector function, for example, so as to enhance the effectiveness of such molecule in treating cancer. Reduction or elimination of effector function is desirable in certain cases, for example in the case of antibodies whose mechanism of action involves blocking or antagonism, but not killing of the cells bearing a target antigen.
- Increased effector function is generally desirable when directed to undesirable cells, such as tumor and foreign cells, where the FcyRs are expressed at low levels, for example, tumor- specific B cells with low levels of FcyRIIB (e.g. , non-Hodgkin's lymphoma, CLL, and Burkitt' s lymphoma).
- Immunoconjugates of the invention possessing such conferred or altered effector function activity are useful for the treatment and/or prevention of a disease, disorder or infection in which an enhanced efficacy of effector function activity is desired.
- the Fc Region of the Fc Region- containing immunoconjugates of the present invention may be an engineered variant Fc Region.
- the Fc Region of immunoconjugates of the present invention may possess the ability to bind to one or more Fc receptors (e.g. , FcyR(s)), more preferably such variant Fc Region have altered binding to FcyRIA (CD64), FcyRIIA (CD32A), FcyRIIB (CD32B), FcyRIIIA (CD 16a) or FcyRIIIB (CD16b) (relative to the binding exhibited by a wild-type Fc Region), e.g.
- the Fc Region of the immunoconjugates of the present invention may include some or all of the CH2 Domain and/or some or all of the CH3 Domain of a complete Fc Region, or may comprise a variant CH2 and/or a variant CH3 sequence (that may include, for example, one or more insertions and/or one or more deletions with respect to the CH2 or CH3 domains of a complete Fc Region).
- Such Fc Regions may comprise non-Fc polypeptide portions, or may comprise portions of non-naturally complete Fc Regions, or may comprise non- naturally occurring orientations of CH2 and/or CH3 Domains (such as, for example, two CH2 domains or two CH3 domains, or in the N-terminal to C-terminal direction, a CH3 Domain linked to a CH2 Domain, etc.).
- Fc Region modifications identified as altering effector function are known in the art, including modifications that increase binding to activating receptors (e.g., FcyRIIA (CD16A) and reduce binding to inhibitory receptors (e.g., FcyRIIB (CD32B) (see, e.g., Stavenhagen, J.B. et al. (2007) "Fc Optimization Of Therapeutic Antibodies Enhances Their Ability To Kill Tumor Cells In Vitro And Controls Tumor Expansion In Vivo Via Low- Affinity Activating Fcgamma Receptors," Cancer Res. 57(18):8882-8890).
- Table 1 lists exemplary single, double, triple, quadruple and quintuple substitutions (numbering is that of the EU index as in Kabat, and substitutions are relative to the amino acid sequence of SEQ ID NO:l) of exemplary modification that increase binding to activating receptors and/or reduce binding to inhibitory receptors.
- Exemplary variants of human IgGl Fc Regions with reduced binding to CD32B and/or increased binding to CD16A contain F243L, R292P, Y300L, V305I or P396L substitutions, wherein the numbering is that of the EU index as in Kabat. These amino acid substitutions may be present in a human IgGl Fc Region in any combination.
- the variant human IgGl Fc Region contains a F243L, R292P and Y300L substitution.
- the variant human IgGl Fc Region contains a F243L, R292P, Y300L, V305I and P396L substitution.
- the Fc Regions of the immunoconjugates of the present invention it is preferred for the Fc Regions of the immunoconjugates of the present invention to exhibit decreased (or substantially no) binding to FcyRIA (CD64), FcyRIIA (CD32A), FcyRIIB (CD32B), FcyRIIIA (CD16a) or FcyRIIIB (CD 16b) (relative to the binding exhibited by the wild-type IgGl Fc Region (SEQ ID NO:l).
- the immunoconjugates of the present invention comprise an IgG Fc Region that exhibits reduced ADCC effector function.
- the CH2-CH3 Domains of immunoconjugates include any 1, 2, 3, or 4 of the substitutions: L234A, L235A, D265A, N297Q, and N297G, wherein the numbering is that of the EU index as in Kabat.
- the CH2-CH3 Domains contain an N297Q substitution, an N297G substitution, L234A and L235A substitutions or a D265A substitution, as these mutations abolish FcR binding.
- the immunoconjugates of the present invention comprise an IgG2 Fc Region (SEQ ID NO:2) or an IgG4 Fc Region (SEQ ID:NO:4).
- the instant invention also encompasses the introduction of a stabilizing mutation, such as the Hinge Region S228P substitution described above (see, e.g., SEQ ID NO:77). Since the N297G, N297Q, L234A, L235A and D265A substitutions abolish effector function, in circumstances in which effector function is desired, these substitutions would preferably not be employed.
- a stabilizing mutation such as the Hinge Region S228P substitution described above (see, e.g., SEQ ID NO:77). Since the N297G, N297Q, L234A, L235A and D265A substitutions abolish effector function, in circumstances in which effector function is desired, these substitutions would preferably not be employed.
- a preferred IgGl sequence for the CH2 and CH3 Domains of the Fc Region- containing immunoconjugates of the present invention having reduced or abolished effector function will comprise the substitutions L234A/L235A (shown underlined) (SEQ ID NO:78):
- X is a lysine (K) or is absent.
- Region-containing immunoconjugates of the present invention comprises an S442C substitution (shown underlined), that permits two CH3 domains to be covalently bonded to one another via a disulfide bond or conjugation of a pharmaceutical agent.
- the amino acid sequence of such molecule is (SEQ ID NO:79):
- X is a lysine (K) or is absent.
- Region-containing immunoconjugates of the present invention comprises the L234A/L235A substitutions (shown underlined) that reduce or abolish effector function and the S442C substitution (shown underlined) that permits two CH3 domains to be covalently bonded to one another via a disulfide bond or conjugation of a pharmaceutical agent.
- the amino acid sequence of such molecule is (SEQ ID NO:80):
- X is a lysine (K) or is absent.
- the serum half-life of proteins comprising Fc Regions may be increased by increasing the binding affinity of the Fc Region for FcRn.
- the term "half-life" as used herein means a pharmacokinetic property of a molecule that is a measure of the mean survival time of the molecules following their administration.
- Half-life can be expressed as the time required to eliminate fifty percent (50%) of a known quantity of the molecule from a subject' s (e.g. , a human patient or other mammal) body or a specific compartment thereof, for example, as measured in serum, i.e. , circulating half-life, or in other tissues.
- an increase in half-life results in an increase in mean residence time (MRT) in circulation for the administered molecule.
- MRT mean residence time
- the immunoconjugates of the present invention comprise a variant Fc Region that comprises at least one amino acid modification relative to a wild-type Fc Region, such that said molecule has an increased half-life (relative to a molecule comprising a wild-type Fc Region).
- the immunoconjugates of the present invention comprise a variant IgG Fc Region, wherein said variant Fc Region comprises a half-life extending amino acid substitution at one or more positions selected from the group consisting of 238, 250, 252, 254, 256, 257, 256, 265, 272, 286, 288, 303, 305, 307, 308, 309, 311, 312, 317, 340, 356, 360, 362, 376, 378, 380, 382, 413, 424, 428, 433, 434, 435, and 436, wherein the numbering is that of the EU index as in Kabat.
- Immunoconjugates with enhanced half-life also include those possessing variant Fc Regions comprising substitutions at two or more of Fc Region residues 250, 252, 254, 256, 257, 288, 307, 308, 309, 311, 378, 428, 433, 434, 435 and 436, wherein the numbering is that of the EU index as in Kabat.
- two or more substitutions selected from: T250Q, M252Y, S254T, T256E, K288D, T307Q, V308P, A378V, M428L, N434A, H435K, and Y436I, wherein the numbering is that of the EU index as in Kabat.
- an immunoconjugate of the present invention possesses a variant IgG Fc Region comprising the substitutions:
- the immunoconjugate of the present invention possesses a variant IgG Fc Region comprising any 1, 2, or 3 of the substitutions: M252Y, S254T and T256E.
- the invention further encompasses immunoconjugates possessing variant Fc Regions comprising:
- Region-containing immunoconjugates of the present invention comprises the M252Y,
- amino acid sequence of such molecule is (SEQ ID NO: 147):
- X is a lysine (K) or is absent.
- a fifth preferred IgGl sequence for the CH2 and CH3 Domains of the Fc Region-containing immunoconjugates of the present invention comprises the M252Y, S254T and T256E substitutions (shown underlined), so as to extend the serum half-life, and the S442C substitution (shown underlined), so as to permit two CH3 domains to be covalently bonded to one another via a disulfide bond or to permit conjugation of a drug moiety.
- amino acid sequence of such molecule is (SEQ ID NO: 148): APELLGGPSV FLFPPKPKDT LYITREPEVT CVVVDVSHED PEVKFNWYVD GVEVHNAKTK PREEQYNSTY RVVSVLTVLH QDWLNGKEYK CKVSNKALPA PIEKTISKAK GQPREPQVYT LPPSREEMTK NQVSLTCLVK GFYPSDIAVE WESNGQPENN YKTTPPVLDS DGSFFLYSKL TVDKSRWQQG NVFSCSVMHE ALHNHYTQKS LCLSPGX
- X is a lysine (K) or is absent.
- Region-containing immunoconjugates of the present invention comprises the L234A/L235A substitutions (shown underlined) that reduce or abolish effector function and the M252Y,
- amino acid sequence of such molecule is (SEQ ID NO: 149):
- X is a lysine (K) or is absent.
- Region-containing immunoconjugates of the present invention comprises the L234A/L235A substitutions (shown underlined) that reduce or abolish effector function and the M252Y,
- X is a lysine (K) or is absent.
- the invention provides particular antibodies and antigen-binding fragments thereof capable of specifically binding to ADAM9 useful in the generation of the immunoconjugates of the invention.
- a representative human ADAM9 polypeptide (NCBI Sequence NP_003807, including a 28 amino acid residue signal sequence, shown underlined) has the amino acid sequence (SEQ ID NO:5):
- residues 1-28 are a signal sequence
- residues 29-697 are the Extracellular Domain
- residues 698-718 are the Transmembrane Domain
- residues 719-819 are the Intracellular Domain.
- Three structural domains are located within the Extracellular Domain: a Reprolysin (M12B) Family Zinc Metalloprotease Domain (at approximately residues 212-406); a Disintegrin Domain (at approximately residues 423-497); and an EGF-like Domain (at approximately residues 644-697).
- a number of post-translational modifications and isoforms have been identified and the protein is proteolytically cleaved in the trans-Golgi network before it reaches the plasma membrane to generate a mature protein.
- the removal of the pro-domain occurs via cleavage at two different sites. Processed most likely by a pro-protein convertase such as furin, at the boundary between the pro-domain and the catalytic domain (Arg- 205/Ala-206).
- An additional upstream cleavage pro-protein convertase site (Arg-56/Glu-57) has an important role in the activation of ADAM9.
- a representative cynomolgus monkey ADAM9 polypeptide (NCBI Sequence XM_005563126.2, including a possible 28 amino acid residue signal sequence, shown underlined) has the amino acid sequence (SEQ ID NO: 6): MGSGVGSPSG TLRVRWLLLL CLVGPVLGAA RPGFQQTSHL SSYEIITPWR
- the Reprolysin (M12B) Family Zinc Metalloprotease Domain of the protein is at approximately residues 212-406); the Disintegrin Domain of the protein is at approximately residues 423-497.
- anti-ADAM9 antibodies and ADAM9-binding fragments thereof of the invention are characterized by any one, two, three, four, five, six, seven, eight, or nine of the following criteria:
- ADAM9 e.g. , ADAM9 of cynomolgus monkey
- At least 100-fold enhancement e.g., at least 100-fold, at least 150-fold, at least 200-fold, at least 250-fold, at least 300-fold, at least 350-fold, at least 400-fold, at least 450-fold, at least 500-fold, at least 550- fold, or at least 600-fold enhancement
- binding affinity e.g., as measured by BIACORE® analysis
- human ADAM9 e.g., BIACORE® analysis
- the binding constants of an anti-ADAM9 antibody or ADAM9-binding fragment thereof may be determined using surface plasmon resonance e.g. , via a BIACORE® analysis.
- Surface plasmon resonance data may be fitted to a 1 : 1 Langmuir binding model (simultaneous ka kd) and an equilibrium binding constant K D calculated from the ratio of rate constants kd/ka.
- Such binding constants may be determined for a monovalent anti-ADAM9 antibody or ADAM9-binding fragment thereof (i.e., a molecule comprising a single ADAM9 epitope-binding site), a bivalent anti-ADAM9 antibody or ADAM9-binding fragment thereof (i.e.
- a molecule comprising two ADAM9 epitope-binding sites a molecule comprising two ADAM9 epitope-binding sites
- anti-ADAM9 antibodies and ADAM9-binding fragments thereof having higher valency e.g., a molecule comprising three, four, or more ADAM9 epitope- binding sites.
- the present invention particularly encompasses immunoconjugates possessing an anti-ADAM9 antibody or an ADAM9-binding fragment thereof comprising an anti- ADAM9 Light Chain Variable (VL) Domain and an anti-ADAM9 Heavy Chain Variable (VH) Domain that immunospecifically bind to an epitope of a human ADAM9 polypeptide.
- VL Light Chain Variable
- VH Anti-ADAM9 Heavy Chain Variable
- all such anti-ADAM9 antibodies and AD AM9 -binding fragment thereof are capable of immunospecifically binding to human ADAM9.
- ADAM9 Variable Domains are referred to as "anti-ADAM9-VL" and “anti-ADAM9- VH,” respectively.
- a murine anti-ADAM9 antibody that blocks the target protein processing activity of ADAM9, is internalized and having anti-tumor activity was identified (see, e.g. , US Patent No. 8,361,475).
- This antibody designated in US Patent Nos. 7,674,619 and 8,361,475 as an "anti-KID24" antibody produced by hybridoma clone ATCC PTA-5174, is designated herein as "MAB-A.”
- MAB-A exhibits strong preferential binding to tumors over normal tissues (see, FIGs. 7A-7C).
- MAB-A exhibited little or no staining across a large panel of normal cell types (Table 2).
- Tissue MAB-A (1.25 Mg/mL)
- Interstitial cells (possibly Leydig cells) 2-3+ (gr c) ⁇ 5% and
- MAB-A binds human ADAM9 with high affinity, but binds non-human primate ⁇ e.g. , cynomolgus monkey) ADAM9 to a lesser extent.
- VH and VL Domains of MAB-A are provided below.
- the VH and VL Domains of MAB-A were humanized and the CDRs optimized to improve affinity and/or to remove potential amino acid liabilities.
- the CDR R 3 was further optimized to enhance binding to non-human primate ADAM9 while maintaining its high affinity for human ADAM9.
- the preferred immunoconjugates of the present invention comprising 1, 2 or all 3 of the CDR H s of a VH Domain and/or 1, 2 or all 3 of the CDR L s of the VL Domain of an optimized variant of MAB-A, and preferably further possess the humanized framework regions ("FRs") of the VH and/or VL Domains of humanized MAB-A.
- FRs humanized framework regions
- Other preferred immunoconjugates of the present invention possess the entire VH and/or VL Domains of a humanized/optimized variant of MAB-A.
- the invention particularly relates to immunoconjugates comprising:
- amino acid sequence of the VH Domain of the murine anti-ADAM9 antibody MAB-A is SEQ ID NO:7 (the CDR H residues are shown underlined):
- amino acid sequence of the CDR H 2 Domain of MAB-A is (SEQ ID NO:
- the amino acid sequence of the CDR H 3 Domain of MAB-A is (SEQ ID NO:10): GGYYYYGSRDYFDY.
- amino acid sequence of the VL Domain of the murine anti-ADAM9 antibody MAB-A is SEQ ID NO: 11 (the CDR L residues are shown underlined):
- amino acid sequence of the CDR L 1 Domain of MAB-A is (SEQ ID NO:12): KASQSVDYDGDSYMN.
- amino acid sequence of the CDR L 2 Domain of MAB-A is (SEQ ID NO:13): AASDLES.
- amino acid sequence of the CDR L 3 Domain of MAB-A is (SEQ ID NO:14): QQSHEDPFT.
- amino acid sequences of certain preferred humanized/optimized anti- ADAM9-VH Domains of MAB-A are variants of the ADAM9-VH Domain of MAB-A (SEQ ID NO: 7) and are represented by SEQ ID NO: 15 (CDR H residues are shown underlined):
- Xi is M or I
- X2 is N or F
- X 3 is K or R;
- X 4 is K or Q;
- X 5 is S or G, and
- X 6 is P, F, Y, W, I, L, V, T, G or D;
- X 7 , X 8 , X 9 , X 10 , and Xn are selected such that:
- X 7 is K or R; X 7 is N or H;
- X 8 is F or M; X 8 is S or K;
- X 9 is G; X9 is G or A;
- X 10 is W or F; and X 10 is T or V; and
- X 11 is M, L or K; Xn is M, L or K; when X6 is I, L or V: when X6 is T:
- X 8 is K; X 8 is K, M or N;
- X 9 is G or A; X 9 is G;
- X 10 is V; and X 10 is V or T; and Xn is M, L or K; Xn is L or M; when X6 is G: and (F) when X6 is D:
- X 7 is G; X 7 is S;
- X 8 is S; X 8 is N;
- X 9 is G; X 9 is A;
- X 10 is V; and X 10 is V; and
- Xn is L; Xn is L.
- hMAB-A VH(2) (SEQ ID NO:17) hMAB-A VH(2D) (SEQ ID NO:23) hMAB-A VH(3) (SEQ ID NO:18) hMAB-A VH(2E) (SEQ ID NO:24) hMAB-A VH(4) (SEQ ID NO:19) hMAB-A VH(2F) (SEQ ID NO:25) hMAB-A VH(2A) (SEQ ID NO:20) hMAB-A VH(2G) (SEQ ID NO:26) hMAB-A VH(2B) (SEQ ID NO:21) hMAB-A VH(2H) (SEQ ID NO:27) hMAB-A VH(2C) (SEQ ID NO:22) hMAB-A VH(2I) (SEQ ID NO:28) and hMAB-A VH(2J) (SEQ ID NO:29)
- Suitable amino acid sequences for the FRs of a humanized and/or optimized anti-ADAM9-VH Domain of MAB-A are: FR H 1 Domain (SEQ ID NO:30): EVQLVESGGGLVKPGGSLRLSCAASGFTFS FR H 2 Domain (SEQ ID NO:31): WVRQ AP GKGLE WVG
- Suitable alternative amino acid sequences for the CDR H 1 Domain of an anti- ADAM9-VH Domain include:
- Suitable alternative amino acid sequences for the CDR H 2 Domain of an anti- ADAM9-VH Domain include:
- SEQIDNO:36 EI IP IFGHTNYNERFQG
- Suitable alternative amino acid sequences for the CDR H 3 Domain of an anti- ADAM9-VH Domain include:
- SEQ ID NO:40 GGYYYYTGKGVLDY
- SEQ ID NO:42 GGYYYYFHSGTLDY
- SEQ ID NO:45 GGYYYYPRQGFLDY
- ADAM9 binding molecules having a VH domain comprising:
- X 2 , X3 , X 4 , and X 5 are independently selected, and wherein: X 2 is N or F; X 3 is K or R;
- X 4 is K or Q; and X 5 is S or G.
- X 6 is P, F, Y, W, I, L, V, T, G or D, and X 7 , X 8 , X 9 , X10, and selected such that:
- X 7 is K or R; X 7 is N or H; X 8 is F or M; Xs is S or K; X 9 is G; X 9 is G or A;
- X10 is W or F; and X10 is T or V; and X11 is M, L or K; X11 is M, L or K; when X6 is I, L or V: (D) when X 6 is T:
- X10 is V; and X10 is V or T; and X11 is M, L or K; X11 is L or M; when X 6 is G: and (F) when ⁇ is D:
- X 7 is G; X 7 is S;
- X 8 is S; X 8 is N;
- X 9 is G; X 9 is A;
- a first exemplary humanized/optimized IgGl Heavy Chain of a derivative/variant of MAB-A contains the hMAB-A VH (2) Domain (SEQ ID NO:17), and has the amino acid sequence (SEQ ID NO:50):
- X is a lysine (K) or is absent.
- a second exemplary humanized/optimized IgGl Heavy Chain of a derivative/variant of MAB-A contains the hMAB-A VH (2C) Domain (SEQ ID NO:22), and has the amino acid sequence (SEQ ID NO:51):
- X is a lysine (K) or is absent.
- a third exemplary humanized/optimized IgGl Heavy Chain of a derivative/variant of MAB-A contains the hMAB-A VH (21) Domain (SEQ ID NO:28), and has the amino acid sequence (SEQ ID NO: 52):
- EPQVYTLPPS REEMTKNQVS LTCLVKGFYP SDIAVEWESN GQPENNYKTT PPVLDSDGSF FLYSKLTVDK SRWQQGNVFS CSVMHEALHN HYTQKSLSLS PGX
- X is a lysine (K) or is absent.
- the CH2-CH3 Domains of the Fc Region may be engineered for example, to reduce effector function and/or to introduce a conjugation site and/or to extend the serum half-life.
- the CH2-CH3 Domains of the exemplary humanized/optimized IgGl Heavy Chains of the invention comprise one or more substitutions selected from: L234A, L235A, M252Y, S254T, T256E and S442C.
- a fourth exemplary humanized/optimized IgGl Heavy Chain of a derivative/variant of MAB-A contains the hMAB-A VH (21) Domain (SEQ ID NO:28), and further comprises the substitutions L234A, and L235A in the CH2-CH3 Domains of the
- Fc Region (SEQ ID NO:78) and has the amino acid sequence (SEQ ID NO: 141)
- X is a lysine (K) or is absent.
- a fifth exemplary humanized/optimized IgGl Heavy Chain of a derivative/variant of MAB-A contains the hMAB-A VH (21) Domain (SEQ ID NO:28), and further comprises the S442C substitution in the CH2-CH3 Domains of the Fc Region
- a sixth exemplary humanized/optimized IgGl Heavy Chain of a derivative/variant of MAB-A contains the hMAB-A VH (21) Domain (SEQ ID NO:28), and further comprises the substitutions L234A, L235A and S442C in the CH2-CH3 Domains of the Fc Region (SEQ ID NO: 80) and has the amino acid sequence (SEQ ID NO:143):
- X is a lysine (K) or is absent.
- a seventh exemplary humanized/optimized IgGl Heavy Chain of a derivative/variant of MAB-A contains the hMAB-A VH (21) Domain (SEQ ID NO:28), and further comprises the substitutions M252Y, S254T and T256E in the CH2-CH3 Domains of the Fc Region (SEQ ID NO: 147) and has the amino acid sequence (SEQ ID NO:151):
- X is a lysine (K) or is absent.
- An eighth exemplary humanized/optimized IgGl Heavy Chain of a derivative/variant of MAB-A contains the hMAB-A VH (21) Domain (SEQ ID NO:28), and further comprises the substitutions M252Y, S254T, T256E, and S442C in the CH2-CH3 Domains of the Fc Region (SEQ ID NO: 148) and has the amino acid sequence (SEQ ID NO:152): EVQLVESGGG LVKPGGSLRL SCAASGFTFS SYWMHWVRQA PGKGLEWVGE I IP IFGHTNY NEKFKSRFTI SLDNSKNTLY LQMGSLRAED TAVYYCARGG YYYYPRQGFL DYWGQGTTVT VSSASTKGPS VFPLAPSSKS TSGGTAALGC LVKDYFPEPV TVSWNSGALT SGVHTFPAVL QSSGLYSLSS VVTVPSSSLG TQTYICNVNH KPSNTKVDK
- X is a lysine (K) or is absent.
- a ninth exemplary humanized/optimized IgGl Heavy Chain of a derivative/variant of MAB-A contains the hMAB-A VH (21) Domain (SEQ ID NO:28), and further comprises the substitutions L234A, L235A, M252Y, S254T and T256E in the CH2-CH3 Domains of the Fc Region (SEQ ID NO: 149) and has the amino acid sequence (SEQ ID NO: 153):
- X is a lysine (K) or is absent.
- a tenth exemplary humanized/optimized IgGl Heavy Chain of a derivative/variant of MAB-A contains the hMAB-A VH (21) Domain (SEQ ID NO:28), and further comprises the substitutions L234A, L235A, M252Y, S254T, T256E, and S442C in the CH2-CH3 Domains of the Fc Region (SEQ ID NO: 150) and has the amino acid sequence (SEQ ID NO:154):
- X is a lysine (K) or is absent.
- amino acid sequences of preferred humanized/optimized anti-ADAM9-VL Domains of MAB-A are variants of the ADAM9-VL Domain of MAB-A (SEQ ID NO: 11) and are represented by SEQ ID NO:53 (CDR L residues are shown underlined):
- Xi 2 is K or R
- Xi 3 is D or S
- Xi 4 is M or L; X 15 is H or Y;
- Xi 6 is E or S; and Xi 7 is D or T.
- suitable amino acid sequences for the FRs of a humanized and/or optimized anti-ADAM9-VL Domain of MAB-A are:
- Suitable alternative amino acid sequences for the CDR L 1 Domain of an anti- ADAM9-VL Domain include:
- Suitable alternative amino acid sequences for the CDR L 3 Domain of an anti- ADAM9-VL Domain include:
- the present invention encompasses anti-ADAM9 antibody VL Domain comprising:
- An exemplary humanized/optimized IgGl Light Chain of a derivative/variant of MAB-A contains the hMAB-A VL (2) Domain (SEQ ID NO: 55), and has the amino acid sequence (SEQ ID NO:68):
- the present invention additionally expressly contemplates immunoconjugates that immunospecifically bind to an epitope of a human ADAM9 polypeptide, and that comprise any of the above-provided MAB-A CDR H 1, CDR H 2, CDR H 3, CDR L 1, CDR L 2, or CDR L 3, and particularly contemplates such immunoconjugates that comprise one of the above-provided MAB-A CDR H 1, one of the above-provided MAB-A CDR H 2, one of the above-provided MAB-A CDR H 3, one of the above-provided MAB-A CDR L 1, one of the above-provided MAB-A CDR L 2, and one of the above-provided MAB-A CDR L 3.
- the invention further contemplates such immunoconjugates that further comprise any of the above-provided humanized MAB-A FR H 1, FR H 2, FR H 3, or FR H 4, FR L 1, FR L 2, FR L 3, or FR L 4, and particularly contemplates such immunoconjugates that comprise FR H 1, FR H 2, FR H 3, and FR H 4, and/or that comprise FR L 1, FR L 2, FR L 3, FR L 4 and FR H 1.
- the humanized/optimized anti-ADAM9 antibody or ADAM9-binding fragment thereof includes a CDR R I domain, a CDR R 2 domain, and a CDR H 3 domain and a CDR L 1 domain, a CDR L 2 domain, and a CDR L 3 domain having the sequences selected from the group consisting of:
- the humanized/optimized anti-ADAM9 antibody or ADAM9-binding fragment thereof includes a CDR R I domain, a CDR R 2 domain, and a CDR R 3 domain and a CDR L I domain, a CDR L 2 domain, and a CDR L 3 domain having the sequences of SEQ ID NOs: 8, 35, and 45 and SEQ ID NOs: 62, 13, 14, respectively.
- the humanized/optimized anti-ADAM9 antibody or ADAM9-binding fragment thereof includes a heavy chain variable domain (VH) and a light chain variable domain (VL) having sequences that are at least 90%, at least 95%, at least 99%, or are 100% identical to the sequences as follows:
- polypeptide exhibiting at least 50% identity to a reference amino acid sequence (for example, any one of the amino acid sequences described herein).
- a reference amino acid sequence for example, any one of the amino acid sequences described herein.
- such a sequence is at least 60%, more preferably at least 80% or at least 85%, and more preferably at least 90%, at least 95% at least 99%, or even 100% identical at the amino acid level or nucleic acid to the sequence used for comparison.
- Sequence identity is typically measured using sequence analysis software (for example, Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, Wis. 53705, BLAST, BESTFIT, GAP, or PILEUP/PRETTYBOX programs). Such software matches identical or similar sequences by assigning degrees of homology to various substitutions, deletions, and/or other modifications. Conservative substitutions typically include substitutions within the following groups: glycine, alanine; valine, isoleucine, leucine; aspartic acid, glutamic acid, asparagine, glutamine; serine, threonine; lysine, arginine; and phenylalanine, tyrosine. In an exemplary approach to determining the degree of identity, a BLAST program may be used, with a probability score between e "3 and e "100 indicating a closely related sequence.
- sequence analysis software for example, Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology
- the humanized/optimized anti-ADAM9 antibody or ADAM9-binding fragment thereof includes a heavy chain variable domain (VH) and a light chain variable domain (VL) having sequences that are at least 90%, at least 95%, at least 99%, or are 100% identical to the sequences of SEQ ID NO:28 and SEQ ID NO:55, respectively.
- VH heavy chain variable domain
- VL light chain variable domain
- the humanized/optimized anti-ADAM9 antibody comprises a heavy chain and a light chain sequence as follows:
- the humanized/optimized anti-ADAM9 antibody comprises a heavy chain having the sequence of SEQ ID NO:52 and a light chain having the sequence of SEQ ID NO:68.
- the humanized/optimized anti-ADAM9 antibody comprises a heavy chain having the sequence of SEQ ID NO: 142 and a light chain having the sequence of SEQ ID NO:68.
- the humanized/optimized anti-ADAM9 antibody is engineered for extended serum half life and comprises a heavy chain having the sequence of SEQ ID NO: 151 and a light chain having the sequence of SEQ ID NO:68.
- the humanized/optimized anti-ADAM9 antibody is engineered for extended serum half life and for site specific conjugation and comprises a heavy chain having the sequence of SEQ ID NO: 152 and a light chain having the sequence of SEQ ID NO:68.
- the present invention also expressly contemplates immunoconjugates that immunospecifically bind to an epitope of a human ADAM9 polypeptide, and that comprise any of the above-provided humanized/optimized anti-ADAM9 MAB-A VL or VH Domains.
- the present invention particularly contemplates such anti-ADAM9 antibodies and ADAM9-binding fragments thereof that comprise any of the following combinations of humanized/optimized anti-ADAM9 VL or VH Domains:
- the present invention specifically encompasses immunoconjugates comprising a humanized/optimized anti-ADAM9-VL and/or VH Domain as provided above.
- the immunoconjugates of the present invention comprise (i) a humanized/optimized anti-ADAM9-VL and/or VH Domain as provided above, and (ii) an Fc Region.
- immunoconjugate refers to a compound or a derivative thereof (e.g., a pharmacological agent) that is linked to or conjugated to a cell binding agent ⁇ e.g., an anti-ADAM9 antibody or ADAM9-binding fragment thereof described herein).
- a cell binding agent e.g., an anti-ADAM9 antibody or ADAM9-binding fragment thereof described herein.
- a "linker” is any chemical moiety that is capable of linking a compound, usually a drug, such as a cytotoxic agent or pharmacological agent described herein ⁇ e.g., maytansinoid or (indolinobenzodiazepine) compounds), to a cell-binding agent, such as an anti-ADAM9 antibody or ADAM9-binding fragment thereof in a stable, covalent manner.
- Linkers can be susceptible to or be substantially resistant to acid-induced cleavage, light- induced cleavage, peptidase-induced cleavage, esterase-induced cleavage, and disulfide bond cleavage, at conditions under which the compound or the antibody remains active.
- Suitable linkers are well known in the art and include, for example, disulfide groups, thioether groups, acid labile groups, photolabile groups, peptidase labile groups and esterase labile groups. Linkers also include charged linkers, and hydrophilic forms thereof as described herein and know in the art.
- alkyl refers to a saturated linear or branched-chain monovalent hydrocarbon radical of one to twenty carbon atoms.
- alkyl include, but are not limited to, methyl, ethyl, 1 -propyl, 2-propyl, 1 -butyl, 2-methyl- l -propyl, - CH 2 CH(CH 3 ) 2 ), 2-butyl, 2-methyl-2-propyl, 1-pentyl, 2-pentyl 3-pentyl, 2-methyl-2-butyl, 3-methyl-2-butyl, 3 -methyl- 1 -butyl, 2-methyl-l -butyl, 1-hexyl), 2-hexyl, 3-hexyl, 2-methyl- 2-pentyl, 3-methyl-2-pentyl, 4-methyl-2-pentyl, 3-methyl-3-pentyl, 2-methyl-3-pentyl, 2,3- dimethyl-2-butyl, 3,3-dimethyl-2
- C x _ xx The number of carbon atoms in a group can be specified herein by the prefix “C x _ xx ", wherein x and xx are integers.
- Ci_ 4 alkyl is an alkyl group having from 1 to 4 carbon atoms.
- cytotoxic compound or "cytotoxic agent” are used interchangeably. They are intended to include compounds for which a structure or formula or any derivative thereof has been disclosed in the present invention or a structure or formula or any derivative thereof that has been incorporated by reference.
- the term also includes, stereoisomers, geometric isomers, tautomers, solvates, metabolites, and salts (e.g. , pharmaceutically acceptable salts) of a compound of all the formulae disclosed in the present invention.
- salts e.g. , pharmaceutically acceptable salts
- the term also includes any solvates, hydrates, and polymorphs of any of the foregoing.
- stereoisomer refers to compounds that have identical chemical constitution and connectivity, but different orientations of their atoms in space that cannot be interconverted by rotation about single bonds.
- Diastereomer refers to a stereoisomer with two or more centers of chirality and whose molecules are not mirror images of one another. Diastereomers have different physical properties, e.g. melting points, boiling points, spectral properties, and reactivities. Mixtures of diastereomers can separate under high resolution analytical procedures such as crystallization, electrophoresis and chromatography.
- Enantiomers refer to two stereoisomers of a compound that are non- superimposable mirror images of one another.
- optically active compounds i.e., they have the ability to rotate the plane of plane-polarized light.
- the prefixes D and L, or R and S are used to denote the absolute configuration of the molecule about its chiral center(s).
- the prefixes d and I or (+) and (-) are employed to designate the sign of rotation of plane-polarized light by the compound, with (-) or 1 meaning that the compound is levorotatory.
- a compound prefixed with (+) or d is dextrorotatory. For a given chemical structure, these stereoisomers are identical except that they are mirror images of one another.
- a specific stereoisomer can also be referred to as an enantiomer, and a mixture of such isomers is often called an enantiomeric mixture.
- a 50:50 mixture of enantiomers is referred to as a racemic mixture or a racemate, which can occur where there has been no stereoselection or stereospecificity in a chemical reaction or process.
- the terms "racemic mixture” and “racemate” refer to an equimolar mixture of two enantiomeric species, devoid of optical activity.
- tautomer or "tautomeric form” refers to structural isomers of different energies that are interconvertible via a low energy barrier.
- proton tautomers also known as prototropic tautomers
- Valence tautomers include interconversions by reorganization of some of the bonding electrons.
- imine reactive reagent refers to a reagent that is capable of reacting with an imine group.
- imine reactive reagent includes, but is not limited to, sulfites (H 2 S0 3 , H 2 S0 2 or a salt of HS0 3 " , S0 3 2 ⁇ or HS0 2 " formed with a cation), metabisulfite (H 2 S 2 O 5 or a salt of S 2 O 5 " formed with a cation), mono, di, tri, and tetra- thiophosphates (P0 3 SH 3 , P0 2 S 2 H 3 , POS 3 H 3 , PS 4 H 3 or a salt of P0 3 S 3 ⁇ , P0 2 S 2 3 ⁇ , POS 3 3 ⁇ or PS 4 3 ⁇ formed with a cation), thio phosphate esters ((R i O) 2 PS(OR i ), R ⁇ H, R ⁇ OH, R ⁇ C ⁇ H, R'SC
- the cation is a monovalent cation, such as Na + or K + .
- the imine reactive reagent is selected from sulfites, hydroxyl amine, urea and hydrazine. More preferably, the imine reactive reagent is NaHS0 3 or KHS0 3 .
- the term "cation" refers to an ion with positive charge.
- the cation can be monovalent (e.g., Na+, K+, NH4+ etc.), bi-valent (e.g., Ca2+, Mg2+, etc.) or multi-valent (e.g., A13+ etc.).
- the cation is monovalent
- salts refers to pharmaceutically acceptable organic or inorganic salts of a compound of the invention.
- Exemplary salts include, but are not limited, to sulfate, citrate, acetate, oxalate, chloride, bromide, iodide, nitrate, bisulfate, phosphate, acid phosphate, isonicotinate, lactate, salicylate, acid citrate, tartrate, oleate, tannate, pantothenate, bitartrate, ascorbate, succinate, maleate, gentisinate, fumarate, gluconate, glucuronate, saccharate, formate, benzoate, glutamate, methanesulfonate "mesylate,” ethanesulfonate, benzenesulfonate, p-toluenesulfonate, pamoate (i.e.
- a pharmaceutically acceptable salt can involve the inclusion of another molecule such as an acetate ion, a succinate ion or other counter ion.
- the counter ion can be any organic or inorganic moiety that stabilizes the charge on the parent compound.
- a pharmaceutically acceptable salt can have more than one charged atom in its structure. Instances where multiple charged atoms are part of the pharmaceutically acceptable salt can have multiple counter ions. Hence, a pharmaceutically acceptable salt can have one or more charged atoms and/or one or more counter ion.
- the desired pharmaceutically acceptable salt can be prepared by any suitable method available in the art, for example, treatment of the free base with an inorganic acid, such as hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, methanesulfonic acid, phosphoric acid and the like, or with an organic acid, such as acetic acid, maleic acid, succinic acid, mandelic acid, fumaric acid, malonic acid, pyruvic acid, oxalic acid, glycolic acid, salicylic acid, a pyranosidyl acid, such as glucuronic acid or galacturonic acid, an alpha hydroxy acid, such as citric acid or tartaric acid, an amino acid, such as aspartic acid or glutamic acid, an aromatic acid, such as benzoic acid or cinnamic acid, a sulfonic acid, such as p-toluenesulfonic acid or ethanes
- an inorganic acid such as hydrochloric acid
- the desired pharmaceutically acceptable salt can be prepared by any suitable method, for example, treatment of the free acid with an inorganic or organic base, such as an amine (primary, secondary or tertiary), an alkali metal hydroxide or alkaline earth metal hydroxide, or the like.
- an inorganic or organic base such as an amine (primary, secondary or tertiary), an alkali metal hydroxide or alkaline earth metal hydroxide, or the like.
- suitable salts include, but are not limited to, organic salts derived from amino acids, such as glycine and arginine, ammonia, primary, secondary, and tertiary amines, and cyclic amines, such as piperidine, morpholine and piperazine, and inorganic salts derived from sodium, calcium, potassium, magnesium, manganese, iron, copper, zinc, aluminum and lithium.
- amino acids such as glycine and arginine
- ammonia such as glycine and arginine
- primary, secondary, and tertiary amines such as piperidine, morpholine and piperazine
- inorganic salts derived from sodium, calcium, potassium, magnesium, manganese, iron, copper, zinc, aluminum and lithium.
- solvate means a compound that further includes a stoichiometric or non- stoichiometric amount of solvent such as water, isopropanol, acetone, ethanol, methanol, DMSO, ethyl acetate, acetic acid, and ethanolamine dichloromethane, 2-propanol, or the like, bound by non-covalent intermolecular forces.
- Solvates or hydrates of the compounds are readily prepared by addition of at least one molar equivalent of a hydroxylic solvent such as methanol, ethanol, 1-propanol, 2-propanol or water to the compound to result in solvation or hydration of the imine moiety.
- a “metabolite” or “catabolite” is a product produced through metabolism or catabolism in the body of a specified compound, a derivative thereof, or a conjugate thereof, or salt thereof. Metabolites of a compound, a derivative thereof, or a conjugate thereof, can be identified using routine techniques known in the art and their activities determined using tests such as those described herein. Such products can result for example from the oxidation, hydroxylation, reduction, hydrolysis, amidation, deamidation, esterification, deesterification, enzymatic cleavage, and the like, of the administered compound.
- the invention includes metabolites of compounds, a derivative thereof, or a conjugate thereof, of the invention, including compounds, a derivative thereof, or a conjugate thereof, produced by a process comprising contacting a compound, a derivative thereof, or a conjugate thereof, of this invention with a mammal for a period of time sufficient to yield a metabolic product thereof.
- phrases "pharmaceutically acceptable” indicates that the substance or composition must be compatible chemically and/or toxicologically, with the other ingredients comprising a formulation, and/or the mammal being treated therewith.
- protecting group refers to a substituent that is commonly employed to block or protect a particular functionality while reacting other functional groups on the compound, a derivative thereof, or a conjugate thereof.
- an "amine-protecting group” or an “amino-protecting moiety” is a substituent attached to an amino group that blocks or protects the amino functionality in the compound.
- Such groups are well known in the art (see for example P. Wuts and T. Greene, 2007, Protective Groups in Organic Synthesis, Chapter 7, J.
- carbamates such as methyl and ethyl carbamate, FMOC, substituted ethyl carbamates, carbamates cleaved by l,6-P-elimination (also termed "self immolative"), ureas, amides, peptides, alkyl and aryl derivatives.
- Suitable amino-protecting groups include acetyl, trifluoroacetyl, t-butoxycarbonyl (BOC), benzyloxycarbonyl (CBZ) and 9- fluorenylmethylenoxycarbonyl (Fmoc).
- amino acid refers to naturally occurring amino acids or non- naturally occurring amino acid.
- peptide refers to short chains of amino acid monomers linked by peptide (amide) bonds. In some embodiments, the peptides contain 2 to 20 amino acid residues. In other embodiments, the peptides contain 2 to 10 amino acid residus. In yet other embodiments, the peptides contain 2 to 5 amino acid residues. As used herein, when a peptide is a portion of a cytotoxic agent or a linker described herein represented by a specific sequence of amino acids, the peptide can be connected to the rest of the cytotoxic agent or the linker in both directions. For example, a dipeptide XI -X2 includes XI -X2 and X2-X1.
- a tripeptide X1-X2-X3 includes X1-X2-X3 and X3-X2-X1 and a tetrapeptide X1-X2-X3-X4 includes X1-X2-X3-X4 and X4-X2-X3-X1.
- XI, X-.2, X3 and X4 represents an amino acid residue.
- reactive ester group refers to a group an ester group that can readily react with an amine group to form amide bond.
- exemplary reactive ester groups include, but are not limited to, N-hydroxysuccinimide esters, N-hydroxyphthalimide esters, N-hydroxy sulfo-succinimide esters, para-nitrophenyl esters, dinitrophenyl esters, pentafluorophenyl esters and their derivatives, wherein said derivatives facilitate amide bond formation.
- the reactive ester group is a N-hydroxysuccinimide ester or a N-hydroxy sulfo-succinimide ester.
- amine reactive group refers to a group that can react with an amine group to form a covalent bond.
- exemplary amine reactive groups include, but are not limited to, reactive ester groups, acyl halides, sulfonyl halide, imidoester, or a reactive thioester groups.
- the amine reactive group is a reactive ester group.
- the amine reactive group is a N-hydroxysuccinimide ester or a N- hydroxy sulfo-succinimide ester.
- thiol-reactive group refers to a group that can react with a thiol (- SH) group to form a covalent bond.
- exemplary thiol-reactive groups include, but are not limited to, maleimide, haloacetyl, aloacetamide, vinyl sulfone, vinyl sulfonamide or vinyal pyridine.
- the thiol-reactive group is maleimide.
- the present invention relates to immunoconjugates comprising an anti-ADAM9 antibody or an ADAM9-binding fragment thereof conjugated to at least one pharmacological agent.
- Pharmacological agents include but are not limited to cytotoxins, (e.g. , a cytostatic or cytocidal agent), therapeutic agents, and radioactive metal ions, e.g. , alpha-emitters.
- Cytotoxins or cytotoxic agents include any agent that is detrimental to cells such as, for example, Pseudomonas exotoxin, Diptheria toxin, a botulinum toxin A through F, ricin abrin, saporin, and cytotoxic fragments of such agents.
- Therapeutic agents include any agent having a therapeutic effect to prophylactically or therapeutically treat a disorder.
- Such therapeutic agents may be may be chemical therapeutic agents, protein or polypeptide therapeutic agents, and include therapeutic agents that possess a desired biological activity and/or modify a given biological response.
- therapeutic agents include alkylating agents, angiogenesis inhibitors, antimitotic agents, hormone therapy agents, and antibodies useful for the treatment of cell proliferative disorders.
- the therapeutic agents are maytansinoid compounds, such as those described in US Patent Nos. 5,208,020 and 7,276,497, incorporated herein by reference in its entirety.
- the therapeutic agents are benzodiazepine compounds, such as pyrrolobenzodiazepine (PBD) (such as those described in WO2010/043880, WO2011/130616, WO2009/016516, WO 2013/177481 and WO 2012/112708) and indolinobenzodiazepine (IGN) compounds (such as those described in WO/2010/091150, and WO 2012/128868 and U.S. Application No. 15/195,269, filed on June 28, 2016, entitled “CONJUGATES OF CYSTEINE ENGINEERED ANTIBODIES ”) ⁇
- PBD pyrrolobenzodiazepine
- IGN indolinobenzodiazepine
- a "pyrrolobenzodiazepine” (PBD) compound is a compound having a pyrrolobenzodiazepine core structure.
- the pyrrolobenzodiazepine can be substituted or unsubstituted. It also includes a compound having two pyrrolobenzodiazepine core linked by a linker.
- the pyrrolobenzodiazepine compound comprises a
- the pyrrolobenzodiazepine compounds comprises a
- core structure represented which can be optionally substituted.
- a "indolinobenzodiazepine” (IGN) compound is a compound having an indolinobenzodiazepine core structure.
- zepine compound comprises a
- ine compound comprises a core
- the pharmacological agent may be coupled or conjugated either directly to the anti-ADAM9 antibody or AD AM9 -binding fragment thereof or indirectly, through a linker using techniques known in the art to produce an "immunoconjugate,” “conjugate,” or "ADC.”
- the immunoconjugate of the present invention comprises an anti-ADAM9 antibody or an ADAM9-binding fragment thereof described herein covalently linked to a pharmacological agent described herein through the ⁇ -amino group of one or more lysine residues located on the anti-ADAM9 antibody or an ADAM9-binding fragment thereof.
- the immunoconjugate of the present invention is represented by the following formula:
- CBA is an anti-ADAM9 antibody or an AD AM9 -binding fragment thereof described herein above, that is covalently linked to Cy L1 through a lysine residue;
- W L is an integer from 1 to 20;
- Cy L1 is a cytotoxic compound represented by the following formula:
- W is -NR e ,
- R e' is -(CH 2 -CH 2 -0) n -R k ;
- n is an integer from 2 to 6;
- R k is -H or -Me
- R x3 is a (Ci-C 6 )alkyl
- L' is represented by the following formula:
- R 5 is -H or a (Ci-C 3 )alkyl
- P is an amino acid residue or a peptide containing between 2 to 20 amino acid residues
- R a and R b are each independently -H, (Ci-C3)alkyl, or a charged substituent or an ionizable group Q;
- n is an integer from 1 to 6;
- Z sl is selected from any one of the following formulas:
- q is an integer from 1 to 5.
- Cy L1 is represented by formula (LI a) or (Llal); and the remaining variables are as described above in the 1 st specific embodiment.
- Cy L1 is represented by formula (Lib) or (Llbl); and the remaining variables are as described above in the 1 st specific embodiment. More specifically, R x3 is a (C2-C 4 )alkyl.
- Cy L1 is represented by formula (LI a); R a and R are both H; R 5 is H or Me, and the remaining variables are as described above in the 1 st specific embodiment.
- P is a peptide containing 2 to 5 amino acid residues; and the remaining variables are described above in the 1 st , 2 nd or 4 th specific embodiment.
- P is selected from the group consisting of Gly-Gly-Gly, Ala-Val, Val-Ala, Val-Cit, Val-Lys, Phe-Lys, Lys-Lys, Ala-Lys, Phe-Cit, Leu-Cit, Ile-Cit, Trp, Cit, Phe-Ala, Phe-N 9 -tosyl-Arg, Phe-N 9 -nitro-Arg, Phe-Phe-Lys, D-Phe-Phe-Lys, Gly-Phe-Lys, Leu-Ala-Leu, Ile-Ala-Leu, Val-Ala-Val, Ala-Leu-Ala-Leu (SEQ ID NO: 144, ⁇ -Ala-Leu-Ala-Leu (SEQ ID NO: 145), Gly-Phe-Leu-Gly (SEQ ID NO: 146), Val-Arg, Arg-Val, Arg-Arg,
- Q is -SO 3 H or a pharmaceutically acceptable salt thereof; and the remaining variables are as described above in the 1 st , 2 nd , 4 th or 5 th specific embodiment or any more specific embodiments described therein.
- the immunoconjugate of the first embodiment is represented b the following formula:
- Y is -OH or -SO 3 H or a pharmaceutically acceptable salt thereof.
- Y is -H.
- the double line— between N and C represents a single bond
- X is -H and Y is -SO 3 H or a pharmaceutically acceptable salt thereof.
- the immunoconjugate of the first embodiment is represented by the following formula:
- CBA is an anti-ADAM9 antibody or an AD AM9 -binding fragment thereof described herein above, that is covalently linked to Cy through a lysine residue;
- W L is an integer from 1 to 20;
- Cy is a cytotoxic compound represented by the following formula:
- R xl and R x2 are independently (Ci-Ce)alkyl
- R e is -H or a (Ci-C 6 )alkyl
- W is -NR e ,
- R e' is -(CH 2 -CH 2 -0) n -R k ;
- n is an integer from 2 to 6;
- R k is -H or -Me
- Z sl is selected from any one of the following formulas:
- Cy is represented by formula (L2a) or (L2al); and the remaining variables are as described above in the 8 th specific embodiment.
- Cy L2 is represented by formula (L2b) or (L2bl); and the remaining variables are as described above in the 8 th specific embodiment.
- R e is H or Me
- R xl and R x2 are independently -(CH 2 ) P -(CR f R g )-, wherein R f and R g are each independently -H or a (Ci-C 4 )alkyl; and p is 0, 1, 2 or 3; and the remaining variables are as described above in the 8 th , 9 th or 10 th specific embodiment. More specifically, R f and R g are the same or different, and are selected from -H and -Me.
- the immunoconjugate of the first embodiment is represented by the following formula:
- the immunoconjugates of the first embodiment is represented by the following formula:
- CBA is an anti-ADAM9 antibody or an AD AM9 -binding fragment thereof described herein above, which is covalently linked to Cy L3 through a Lys residue;
- W L is an integer from 1 to 20;
- n' is 1 or 2;
- Ri and R 2 are each independently H or a (Ci-C3)alkyl
- Z sl is selected from any one of the following formulas:
- q is an integer from 1 to 5
- Ri and R 2 are both Me; and the remaining variables are as described above in the 13 th specific embodiment.
- the immunoconjugates of the first embodiment is represented by the following formula:
- WL is an integer from 1 to 10.
- Y is -SO 3 H, -S0 3 Na or -S0 3 K; and the remaining variables are as described above in any one of the 1 st to 16 th specific embodiment or any more specific embodiments described therein.
- Y is -S0 3 Na.
- compositions comprising immunoconjugates of the first embodiment, or the 1 st , 2 nd , 3 rd , 4 th , 5 th , 6 th , 7 th , 8 th , 9 th , 10 th , 11 th , 12 th , 13 th , 14 th , 15 th , 16 th or 17 th specific embodiment
- the average number of the cytotoxic agent per antibody molecule i.e. , average value of wj, also known as Drug- Antibody Ratio (DAR) in the composition is in the range of 1.0 to 8.0.
- DAR Drug- Antibody Ratio
- DAR is in the range of 1.0 to 5.0, 1.0 to 4.0, 1.0 to 3.4, 1.0 to 3.0, 1.5 to 2.5, 2.0 to 2.5, or 1.8 to 2.2. In some embodiments, the DAR is less than 4.0, less than 3.8, less than 3.6, less than 3.5, less than 3.0 or less than 2.5.
- the immunoconjugates of the present invention comprises an anti-ADAM9 antibody or an ADAM9-binding fragment thereof described herein above covalently linked to a cytotoxic agent described herein through the thiol group (-SH) of one or more cysteine residues located on the anti-ADAM9 antibody or an ADAM9-binding fragment thereof.
- a cytotoxic agent described herein through the thiol group (-SH) of one or more cysteine residues located on the anti-ADAM9 antibody or an ADAM9-binding fragment thereof.
- the immunoconjugate of the second embodiment is represented by the following formula:
- CBA is anti-ADAM9 antibody or an ADAM9-binding fragment thereof described herein covalently linked to Cy through a cysteine residue;
- W c is 1 or 2;
- the double line— between N and C represents a single bond or a double bond, provided that when it is a double bond, X is absent and Y is -H or a (Ci-C 4 )alkyl; and when it is a single bond, X is -H or an amine protecting moiety, Y is -OH or -SO 3 H or a pharmaceutically acceptable salt thereof;
- R 5 is -H or a (Ci-C 3 )alkyl
- R a and R b are independently -H, (Ci-C 3 )alkyl, or a charged substituent or an ionizable group Q;
- W is -NR e ,
- R e' is -(CH 2 -CH 2 -0) n -R k ; n is an integer from 2 to 6;
- R k is -H or -Me
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Organic Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Epidemiology (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Cell Biology (AREA)
- Oncology (AREA)
- Hematology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicinal Preparation (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Priority Applications (14)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| MDE20191243T MD3558391T2 (ro) | 2016-12-23 | 2017-12-21 | Imunoconjugate care țintesc ADAM9 și procedee de utilizare a acestora |
| RS20220395A RS63154B1 (sr) | 2016-12-23 | 2017-12-21 | Imunokonjugati koji ciljano deluju na adam9 i postupci za njihovu upotrebu |
| EP17835533.5A EP3558391B1 (en) | 2016-12-23 | 2017-12-21 | Immunoconjugates targeting adam9 and methods of use thereof |
| CN201780079982.XA CN110267685B (zh) | 2016-12-23 | 2017-12-21 | 靶向adam9的免疫缀合物及其使用方法 |
| DK17835533.5T DK3558391T3 (da) | 2016-12-23 | 2017-12-21 | Immunkonjugater med adam9 som mål og fremgangsmåder til anvendelse deraf |
| JP2019533514A JP7170642B2 (ja) | 2016-12-23 | 2017-12-21 | Adam9を標的とする免疫コンジュゲート及びその使用 |
| LTEPPCT/US2017/067823T LT3558391T (lt) | 2016-12-23 | 2017-12-21 | Imunokonjugatai, kurių taikinys yra adam9, ir jų naudojimo būdai |
| SM20220182T SMT202200182T1 (it) | 2016-12-23 | 2017-12-21 | Immunoconiugati diretti contro adam9 e metodi di utilizzo degli stessi |
| US16/469,494 US20210388102A1 (en) | 2016-12-23 | 2017-12-21 | Immunoconjugates targeting adam9 and methods of use thereof |
| MA47234A MA47234B1 (fr) | 2016-12-23 | 2017-12-21 | Immunoconjugués ciblant l'adam9 et leurs méthodes d'utilisation |
| HRP20220550TT HRP20220550T1 (hr) | 2016-12-23 | 2017-12-21 | Imunokonjugati koji ciljaju adam9 i postupci njihove uporabe |
| ES17835533T ES2912266T3 (es) | 2016-12-23 | 2017-12-21 | Inmunoconjugados dirigidos a ADAM9 y procedimientos de uso de los mismos |
| SI201731135T SI3558391T1 (sl) | 2016-12-23 | 2017-12-21 | Imunokonjugati, ciljno usmerjeni na ADAM9, in načini njihove uporabe |
| PL17835533T PL3558391T3 (pl) | 2016-12-23 | 2017-12-21 | Immunokoniugaty skierowane wobec białka adam9 i sposoby ich stosowania |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201662438488P | 2016-12-23 | 2016-12-23 | |
| US62/438,488 | 2016-12-23 | ||
| US201762480201P | 2017-03-31 | 2017-03-31 | |
| US62/480,201 | 2017-03-31 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2018119196A1 true WO2018119196A1 (en) | 2018-06-28 |
| WO2018119196A8 WO2018119196A8 (en) | 2019-06-20 |
Family
ID=61025051
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2017/067823 Ceased WO2018119196A1 (en) | 2016-12-23 | 2017-12-21 | Immunoconjugates targeting adam9 and methods of use thereof |
Country Status (18)
| Country | Link |
|---|---|
| US (1) | US20210388102A1 (enExample) |
| EP (1) | EP3558391B1 (enExample) |
| JP (1) | JP7170642B2 (enExample) |
| CN (1) | CN110267685B (enExample) |
| CY (1) | CY1125181T1 (enExample) |
| DK (1) | DK3558391T3 (enExample) |
| ES (1) | ES2912266T3 (enExample) |
| HR (1) | HRP20220550T1 (enExample) |
| HU (1) | HUE058664T2 (enExample) |
| LT (1) | LT3558391T (enExample) |
| MD (1) | MD3558391T2 (enExample) |
| PL (1) | PL3558391T3 (enExample) |
| PT (1) | PT3558391T (enExample) |
| RS (1) | RS63154B1 (enExample) |
| SI (1) | SI3558391T1 (enExample) |
| SM (1) | SMT202200182T1 (enExample) |
| TW (1) | TWI783957B (enExample) |
| WO (1) | WO2018119196A1 (enExample) |
Cited By (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2020005945A1 (en) * | 2018-06-26 | 2020-01-02 | Immunogen, Inc. | Immunoconjugates targeting adam9 and methods of use thereof |
| WO2020191306A1 (en) | 2019-03-21 | 2020-09-24 | Immunogen, Inc. | Methods of preparing cell-binding agent-drug conjugates |
| WO2020205564A1 (en) | 2019-03-29 | 2020-10-08 | Immunogen, Inc. | Cytotoxic bis-benzodiazepine derivatives and conjugates thereof with cell-binding agents for inhibiting abnormal cell growth or for treating proliferative diseases |
| WO2020219287A1 (en) | 2019-04-26 | 2020-10-29 | Immunogen, Inc. | Camptothecin derivatives |
| US11274121B2 (en) | 2018-01-12 | 2022-03-15 | Immunogen, Inc. | Methods for antibody drug conjugation, purification, and formulation |
| WO2022192134A1 (en) | 2021-03-08 | 2022-09-15 | Immunogen, Inc. | Methods for increasing efficacy of immunoconjugates targeting adam9 for the treatment of cancer |
| WO2024193692A1 (zh) | 2023-03-22 | 2024-09-26 | 映恩生物制药(苏州)有限公司 | 连接子及其在配体药物偶联物中的应用 |
| WO2024199111A1 (zh) | 2023-03-24 | 2024-10-03 | 映恩生物制药(苏州)有限公司 | 靶向adam9的人源化抗体、其抗体药物偶联物及其应用 |
| WO2025094146A1 (en) | 2023-11-02 | 2025-05-08 | Immunogen Switzerland Gmbh | Vasconstrictors for reducing ocular toxicity of antibody-maytansinoid conjugates |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN110713983B (zh) * | 2019-11-04 | 2022-06-10 | 深圳市体内生物医药科技有限公司 | 一种表达透明质酸酶的免疫细胞及其应用 |
| CN120058950A (zh) * | 2023-11-28 | 2025-05-30 | 昆山新蕴达生物科技有限公司 | 抗adam9的抗体及其用途 |
| TW202540201A (zh) * | 2023-12-14 | 2025-10-16 | 大陸商四川科倫博泰生物醫藥股份有限公司 | Adam9結合蛋白及其用途 |
Citations (69)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| EP0519596A1 (en) | 1991-05-17 | 1992-12-23 | Merck & Co. Inc. | A method for reducing the immunogenicity of antibody variable domains |
| US5208020A (en) | 1989-10-25 | 1993-05-04 | Immunogen Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| US5565332A (en) | 1991-09-23 | 1996-10-15 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
| US5580717A (en) | 1990-05-01 | 1996-12-03 | Affymax Technologies N.V. | Recombinant library screening methods |
| US5733743A (en) | 1992-03-24 | 1998-03-31 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| WO1998023289A1 (en) | 1996-11-27 | 1998-06-04 | The General Hospital Corporation | MODULATION OF IgG BINDING TO FcRn |
| US5807715A (en) | 1984-08-27 | 1998-09-15 | The Board Of Trustees Of The Leland Stanford Junior University | Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin |
| US5866692A (en) | 1991-09-18 | 1999-02-02 | Kyowa Hakko Kogyo Co., Ltd. | Process for producing humanized chimera antibody |
| US5997867A (en) | 1991-07-16 | 1999-12-07 | Waldmann; Herman | Method of using humanized antibody against CD18 |
| US6054297A (en) | 1991-06-14 | 2000-04-25 | Genentech, Inc. | Humanized antibodies and methods for making them |
| US6180377B1 (en) | 1993-06-16 | 2001-01-30 | Celltech Therapeutics Limited | Humanized antibodies |
| US6265150B1 (en) | 1995-06-07 | 2001-07-24 | Becton Dickinson & Company | Phage antibodies |
| US6277375B1 (en) | 1997-03-03 | 2001-08-21 | Board Of Regents, The University Of Texas System | Immunoglobulin-like domains with increased half-lives |
| US20020068062A1 (en) | 2000-04-07 | 2002-06-06 | Jurgen Frey | Inhibitors of the formation of soluble human CD23 |
| US20020147311A1 (en) | 2000-02-11 | 2002-10-10 | Gillies Stephen D. | Enhancing the circulating half-life of antibody-based fusion proteins |
| US20030091568A1 (en) | 2000-04-07 | 2003-05-15 | Jurgen Frey | Inhibitors for the formation of soluble human CD23 |
| US6716821B2 (en) | 2001-12-21 | 2004-04-06 | Immunogen Inc. | Cytotoxic agents bearing a reactive polyethylene glycol moiety, cytotoxic conjugates comprising polyethylene glycol linking groups, and methods of making and using the same |
| US20040092466A1 (en) | 2002-11-11 | 2004-05-13 | Isis Pharmaceuticals Inc. | Modulation of ADAM9 expression |
| DE10337368A1 (de) * | 2003-08-08 | 2005-03-03 | Technische Universität Dresden | Verfahren und Mittel zur Diagnose und Behandlung von Pankreastumoren |
| US6913748B2 (en) | 2002-08-16 | 2005-07-05 | Immunogen, Inc. | Cross-linkers with high reactivity and solubility and their use in the preparation of conjugates for targeted delivery of small molecule drugs |
| US20050169933A1 (en) | 2003-10-10 | 2005-08-04 | Immunogen, Inc. | Method of targeting specific cell populations using cell-binding agent maytansinoid conjugates linked via a non-cleavable linker, said conjugates, and methods of making said conjugates |
| US7083784B2 (en) | 2000-12-12 | 2006-08-01 | Medimmune, Inc. | Molecules with extended half-lives, compositions and uses thereof |
| US20060270618A1 (en) | 2001-12-18 | 2006-11-30 | Dorian Bevec | Novel pharmaceutical composition of interferon gamma or pirfenidone with molecular diagnostics for the improved treatment of interstitial lung diseases |
| US7217797B2 (en) | 2002-10-15 | 2007-05-15 | Pdl Biopharma, Inc. | Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis |
| US20070148164A1 (en) | 2003-11-12 | 2007-06-28 | Biogen Idec Ma Inc. | Neonatal Fc receptor (FcRn)-binding polypeptide variants, dimeric Fc binding proteins and methods related thereto |
| US7276497B2 (en) | 2003-05-20 | 2007-10-02 | Immunogen Inc. | Cytotoxic agents comprising new maytansinoids |
| US20080050310A1 (en) | 2006-05-30 | 2008-02-28 | Genentech, Inc. | Antibodies and immunoconjugates and uses therefor |
| US20090023149A1 (en) | 2005-12-01 | 2009-01-22 | Steen Knudsen | Methods, kits and devices for identifying biomarkers of treatment response and use thereof to predict treatment efficacy |
| WO2009016516A2 (en) | 2007-07-19 | 2009-02-05 | Sanofi-Aventis | Cytotoxic agents comprising new tomaymycin derivatives and their therapeutic use |
| WO2009058492A2 (en) | 2007-10-31 | 2009-05-07 | Xencor, Inc | Fc variants with altered binding to fcrn |
| US20090203051A1 (en) | 2006-06-09 | 2009-08-13 | The Regents Of The University Of California | Targets in breast cancer for prognosis or therapy |
| US7585634B2 (en) | 2007-01-09 | 2009-09-08 | Samsung Electronics Co., Ltd. | Method of predicting risk of lung cancer recurrence, and a composition, kit and microarray for the same |
| US20090233300A1 (en) | 2008-03-10 | 2009-09-17 | Milene Saavedra | Markers for Diagnosis of Pulmonary Inflammation and Methods Related Thereto |
| US20090274713A1 (en) | 2008-04-30 | 2009-11-05 | Immunogen Inc. | Cross-linkers and their uses |
| US20090285840A1 (en) | 2008-04-29 | 2009-11-19 | New York Society For The Ruptured And Crippled Maintaining The Hospital For Special Surgery | Methods for treating pathological neovascularization |
| US7674619B2 (en) | 2005-02-02 | 2010-03-09 | Mather Jennie P | ADAM-9 modulators |
| WO2010033279A2 (en) | 2008-06-04 | 2010-03-25 | Macrogenics, Inc. | Antibodies with altered binding to fcrn and methods of using same |
| WO2010043880A1 (en) | 2008-10-17 | 2010-04-22 | Spirogen Limited | Unsymmetrical pyrrolobenzodiazepine-dimers for treatment of proliferative diseases |
| US20100112713A1 (en) | 2008-11-05 | 2010-05-06 | The Texas A&M University System | Methods For Detecting Colorectal Diseases And Disorders |
| US20100129314A1 (en) | 2008-04-30 | 2010-05-27 | Immunogen Inc. | Potent conjugates and hydrophilic linkers |
| WO2010091150A1 (en) | 2009-02-05 | 2010-08-12 | Immunogen, Inc. | Novel benzodiazepine derivatives |
| US20100233079A1 (en) | 2008-12-04 | 2010-09-16 | Abbott Laboratories | Dual Variable Domain Immunoglobulins and Uses Thereof |
| US7829277B2 (en) | 2004-03-01 | 2010-11-09 | The Regents Of The University Of California | Methods for identifying compounds that suppress chemically-induced carcinogenesis |
| US20100291063A1 (en) | 2007-10-12 | 2010-11-18 | Kings College London | Protease inhibition |
| US20110129450A1 (en) | 2008-08-01 | 2011-06-02 | Orly Lazarov | Method of promoting neurogenesis by modulating secretase activities |
| US20110151536A1 (en) | 2008-04-07 | 2011-06-23 | Zymogenetics, Inc. | Thrombin activator compositions and methods of making and using the same |
| WO2011100362A1 (en) | 2010-02-11 | 2011-08-18 | University Of Southern California | Modified adam disintegrin domain polypeptides and uses thereof |
| WO2011130616A1 (en) | 2010-04-15 | 2011-10-20 | Spirogen Limited | Pyrrolobenzodiazepines used to treat proliferative diseases |
| US8088376B2 (en) | 2004-11-12 | 2012-01-03 | Xencor, Inc. | Fc variants with altered binding to FcRn |
| WO2012112708A1 (en) | 2011-02-15 | 2012-08-23 | Immunogen, Inc. | Cytotoxic benzodiazepine derivatives and methods of preparation |
| WO2013049704A2 (en) | 2011-09-28 | 2013-04-04 | Armune Biosciences, Inc. | Method and system of particle-phage epitope complex |
| WO2013098797A2 (en) | 2011-12-31 | 2013-07-04 | Kuriakose Moni Abraham | Diagnostic tests for predicting prognosis, recurrence, resistance or sensitivity to therapy and metastatic status in cancer |
| WO2013119960A2 (en) | 2012-02-08 | 2013-08-15 | Stem Centrx, Inc. | Novel modulators and methods of use |
| WO2013177481A1 (en) | 2012-05-25 | 2013-11-28 | Immunogen, Inc. | Benzodiazepines and conjugates thereof |
| US8624003B2 (en) | 2009-06-03 | 2014-01-07 | Immunogen, Inc. | Methods for preparation of antibody-maytansinoid conjugates |
| WO2014108480A1 (en) | 2013-01-09 | 2014-07-17 | Friedrich-Alexander-Universitaet Erlangen-Nuernberg | Method for in vitro detection and monitoring of a disease by measuring disease-associated protease activity in extracellular vesicles |
| WO2014124326A1 (en) | 2013-02-08 | 2014-08-14 | Stem Centrx, Inc. | Novel multispecific constructs |
| WO2014186364A2 (en) | 2013-05-13 | 2014-11-20 | Tufts University | Methods and compositions for prognosis, diagnosis and treatment of adam8-expressing cancer |
| WO2014205293A1 (en) | 2013-06-19 | 2014-12-24 | Memorial Sloan-Kettering Cancer Center | Methods and compositions for the diagnosis, prognosis and treatment of brain metastasis |
| US20150010575A1 (en) | 2013-07-03 | 2015-01-08 | Samsung Electronics Co., Ltd. | Combination therapy for the treatment of cancer using an anti-c-met antibody |
| US9150656B2 (en) | 2010-03-04 | 2015-10-06 | Macrogenics, Inc. | Antibodies reactive with B7-H3, immunologically active fragments thereof and uses thereof |
| US20150337048A1 (en) | 2012-02-08 | 2015-11-26 | Stem Centrx, Inc. | Anti-cd324 monoclonal antibodies and uses thereof |
| US20160024582A1 (en) | 2013-04-08 | 2016-01-28 | Mitsubishi Rayon Co., Ltd. | Microarray for evaluating eye disease, and evaluation method of eye disease |
| US20160082114A1 (en) | 2014-09-03 | 2016-03-24 | Immunogen, Inc. | Cytotoxic benzodiazepine derivatives |
| US20160095938A1 (en) * | 2014-09-03 | 2016-04-07 | Immunogen, Inc. | Conjugates comprising cell-binding agents and cytotoxic agents |
| WO2016077505A2 (en) | 2014-11-11 | 2016-05-19 | Amunix Operating Inc. | Targeted xten conjugate compositions and methods of making same |
| US9381256B2 (en) | 2014-09-03 | 2016-07-05 | Immunogen, Inc. | Cytotoxic benzodiazepine derivatives |
| WO2017004025A1 (en) | 2015-06-29 | 2017-01-05 | Immunogen, Inc. | Conjugates of cysteine engineered antibodies |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| UA116189C2 (uk) * | 2011-05-02 | 2018-02-26 | Мілленніум Фармасьютікалз, Інк. | КОМПОЗИЦІЯ АНТИ-α4β7 АНТИТІЛА |
-
2017
- 2017-12-21 WO PCT/US2017/067823 patent/WO2018119196A1/en not_active Ceased
- 2017-12-21 CN CN201780079982.XA patent/CN110267685B/zh active Active
- 2017-12-21 JP JP2019533514A patent/JP7170642B2/ja active Active
- 2017-12-21 HU HUE17835533A patent/HUE058664T2/hu unknown
- 2017-12-21 TW TW106145085A patent/TWI783957B/zh active
- 2017-12-21 ES ES17835533T patent/ES2912266T3/es active Active
- 2017-12-21 MD MDE20191243T patent/MD3558391T2/ro unknown
- 2017-12-21 PL PL17835533T patent/PL3558391T3/pl unknown
- 2017-12-21 LT LTEPPCT/US2017/067823T patent/LT3558391T/lt unknown
- 2017-12-21 SM SM20220182T patent/SMT202200182T1/it unknown
- 2017-12-21 EP EP17835533.5A patent/EP3558391B1/en active Active
- 2017-12-21 RS RS20220395A patent/RS63154B1/sr unknown
- 2017-12-21 US US16/469,494 patent/US20210388102A1/en not_active Abandoned
- 2017-12-21 DK DK17835533.5T patent/DK3558391T3/da active
- 2017-12-21 HR HRP20220550TT patent/HRP20220550T1/hr unknown
- 2017-12-21 SI SI201731135T patent/SI3558391T1/sl unknown
- 2017-12-21 PT PT178355335T patent/PT3558391T/pt unknown
-
2022
- 2022-04-27 CY CY20221100306T patent/CY1125181T1/el unknown
Patent Citations (87)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6331415B1 (en) | 1983-04-08 | 2001-12-18 | Genentech, Inc. | Methods of producing immunoglobulins, vectors and transformed host cells for use therein |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US5807715A (en) | 1984-08-27 | 1998-09-15 | The Board Of Trustees Of The Leland Stanford Junior University | Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin |
| US5208020A (en) | 1989-10-25 | 1993-05-04 | Immunogen Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| US5580717A (en) | 1990-05-01 | 1996-12-03 | Affymax Technologies N.V. | Recombinant library screening methods |
| EP0519596A1 (en) | 1991-05-17 | 1992-12-23 | Merck & Co. Inc. | A method for reducing the immunogenicity of antibody variable domains |
| US6054297A (en) | 1991-06-14 | 2000-04-25 | Genentech, Inc. | Humanized antibodies and methods for making them |
| US5997867A (en) | 1991-07-16 | 1999-12-07 | Waldmann; Herman | Method of using humanized antibody against CD18 |
| US5866692A (en) | 1991-09-18 | 1999-02-02 | Kyowa Hakko Kogyo Co., Ltd. | Process for producing humanized chimera antibody |
| US5565332A (en) | 1991-09-23 | 1996-10-15 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
| US5733743A (en) | 1992-03-24 | 1998-03-31 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| US6180377B1 (en) | 1993-06-16 | 2001-01-30 | Celltech Therapeutics Limited | Humanized antibodies |
| US6265150B1 (en) | 1995-06-07 | 2001-07-24 | Becton Dickinson & Company | Phage antibodies |
| WO1998023289A1 (en) | 1996-11-27 | 1998-06-04 | The General Hospital Corporation | MODULATION OF IgG BINDING TO FcRn |
| US6277375B1 (en) | 1997-03-03 | 2001-08-21 | Board Of Regents, The University Of Texas System | Immunoglobulin-like domains with increased half-lives |
| US20020147311A1 (en) | 2000-02-11 | 2002-10-10 | Gillies Stephen D. | Enhancing the circulating half-life of antibody-based fusion proteins |
| US20020068062A1 (en) | 2000-04-07 | 2002-06-06 | Jurgen Frey | Inhibitors of the formation of soluble human CD23 |
| US20030091568A1 (en) | 2000-04-07 | 2003-05-15 | Jurgen Frey | Inhibitors for the formation of soluble human CD23 |
| US7083784B2 (en) | 2000-12-12 | 2006-08-01 | Medimmune, Inc. | Molecules with extended half-lives, compositions and uses thereof |
| US20090142301A1 (en) | 2001-12-18 | 2009-06-04 | Dorian Bevec | Novel pharmaceutical composition of interferon gamma or pirfenidone with molecular diagnostics for the improved treatment of interstitial lung diseases |
| US20060270618A1 (en) | 2001-12-18 | 2006-11-30 | Dorian Bevec | Novel pharmaceutical composition of interferon gamma or pirfenidone with molecular diagnostics for the improved treatment of interstitial lung diseases |
| US6716821B2 (en) | 2001-12-21 | 2004-04-06 | Immunogen Inc. | Cytotoxic agents bearing a reactive polyethylene glycol moiety, cytotoxic conjugates comprising polyethylene glycol linking groups, and methods of making and using the same |
| US6913748B2 (en) | 2002-08-16 | 2005-07-05 | Immunogen, Inc. | Cross-linkers with high reactivity and solubility and their use in the preparation of conjugates for targeted delivery of small molecule drugs |
| US7217797B2 (en) | 2002-10-15 | 2007-05-15 | Pdl Biopharma, Inc. | Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis |
| US20040092466A1 (en) | 2002-11-11 | 2004-05-13 | Isis Pharmaceuticals Inc. | Modulation of ADAM9 expression |
| US7276497B2 (en) | 2003-05-20 | 2007-10-02 | Immunogen Inc. | Cytotoxic agents comprising new maytansinoids |
| DE10337368A1 (de) * | 2003-08-08 | 2005-03-03 | Technische Universität Dresden | Verfahren und Mittel zur Diagnose und Behandlung von Pankreastumoren |
| US20050169933A1 (en) | 2003-10-10 | 2005-08-04 | Immunogen, Inc. | Method of targeting specific cell populations using cell-binding agent maytansinoid conjugates linked via a non-cleavable linker, said conjugates, and methods of making said conjugates |
| US20070148164A1 (en) | 2003-11-12 | 2007-06-28 | Biogen Idec Ma Inc. | Neonatal Fc receptor (FcRn)-binding polypeptide variants, dimeric Fc binding proteins and methods related thereto |
| US7829277B2 (en) | 2004-03-01 | 2010-11-09 | The Regents Of The University Of California | Methods for identifying compounds that suppress chemically-induced carcinogenesis |
| US8088376B2 (en) | 2004-11-12 | 2012-01-03 | Xencor, Inc. | Fc variants with altered binding to FcRn |
| US7674619B2 (en) | 2005-02-02 | 2010-03-09 | Mather Jennie P | ADAM-9 modulators |
| US8361475B2 (en) | 2005-02-02 | 2013-01-29 | Macrogenics West, Inc. | ADAM-9 modulators |
| US8445198B2 (en) | 2005-12-01 | 2013-05-21 | Medical Prognosis Institute | Methods, kits and devices for identifying biomarkers of treatment response and use thereof to predict treatment efficacy |
| US20090023149A1 (en) | 2005-12-01 | 2009-01-22 | Steen Knudsen | Methods, kits and devices for identifying biomarkers of treatment response and use thereof to predict treatment efficacy |
| US20080050310A1 (en) | 2006-05-30 | 2008-02-28 | Genentech, Inc. | Antibodies and immunoconjugates and uses therefor |
| US20090203051A1 (en) | 2006-06-09 | 2009-08-13 | The Regents Of The University Of California | Targets in breast cancer for prognosis or therapy |
| US20120077694A1 (en) | 2006-06-09 | 2012-03-29 | The Regents Of The University Of California | Targets in breast cancer for prognosis or therapy |
| US7585634B2 (en) | 2007-01-09 | 2009-09-08 | Samsung Electronics Co., Ltd. | Method of predicting risk of lung cancer recurrence, and a composition, kit and microarray for the same |
| WO2009016516A2 (en) | 2007-07-19 | 2009-02-05 | Sanofi-Aventis | Cytotoxic agents comprising new tomaymycin derivatives and their therapeutic use |
| US20100291063A1 (en) | 2007-10-12 | 2010-11-18 | Kings College London | Protease inhibition |
| WO2009058492A2 (en) | 2007-10-31 | 2009-05-07 | Xencor, Inc | Fc variants with altered binding to fcrn |
| US8101361B2 (en) | 2008-03-10 | 2012-01-24 | National Jewish Health | Markers for diagnosis of pulmonary inflammation and methods related thereto |
| US20160068909A1 (en) | 2008-03-10 | 2016-03-10 | National Jewish Health | Markers for diagnosis of pulmonary inflammation and methods related thereto |
| US20120149595A1 (en) | 2008-03-10 | 2012-06-14 | National Jewish Health | Markers for diagnosis of pulmonary inflammation and methods related thereto |
| US20090233300A1 (en) | 2008-03-10 | 2009-09-17 | Milene Saavedra | Markers for Diagnosis of Pulmonary Inflammation and Methods Related Thereto |
| US20110151536A1 (en) | 2008-04-07 | 2011-06-23 | Zymogenetics, Inc. | Thrombin activator compositions and methods of making and using the same |
| US20090285840A1 (en) | 2008-04-29 | 2009-11-19 | New York Society For The Ruptured And Crippled Maintaining The Hospital For Special Surgery | Methods for treating pathological neovascularization |
| US20100129314A1 (en) | 2008-04-30 | 2010-05-27 | Immunogen Inc. | Potent conjugates and hydrophilic linkers |
| US20090274713A1 (en) | 2008-04-30 | 2009-11-05 | Immunogen Inc. | Cross-linkers and their uses |
| WO2010033279A2 (en) | 2008-06-04 | 2010-03-25 | Macrogenics, Inc. | Antibodies with altered binding to fcrn and methods of using same |
| US20110129450A1 (en) | 2008-08-01 | 2011-06-02 | Orly Lazarov | Method of promoting neurogenesis by modulating secretase activities |
| WO2010043880A1 (en) | 2008-10-17 | 2010-04-22 | Spirogen Limited | Unsymmetrical pyrrolobenzodiazepine-dimers for treatment of proliferative diseases |
| US20100112713A1 (en) | 2008-11-05 | 2010-05-06 | The Texas A&M University System | Methods For Detecting Colorectal Diseases And Disorders |
| US20100233079A1 (en) | 2008-12-04 | 2010-09-16 | Abbott Laboratories | Dual Variable Domain Immunoglobulins and Uses Thereof |
| US8426402B2 (en) | 2009-02-05 | 2013-04-23 | Immunogen, Inc. | Benzodiazepine derivatives |
| WO2010091150A1 (en) | 2009-02-05 | 2010-08-12 | Immunogen, Inc. | Novel benzodiazepine derivatives |
| US8624003B2 (en) | 2009-06-03 | 2014-01-07 | Immunogen, Inc. | Methods for preparation of antibody-maytansinoid conjugates |
| WO2011100362A1 (en) | 2010-02-11 | 2011-08-18 | University Of Southern California | Modified adam disintegrin domain polypeptides and uses thereof |
| US20130045244A1 (en) | 2010-02-11 | 2013-02-21 | University Of Southern California | Modified adam disintegrin domain polypeptides and uses thereof |
| US9150656B2 (en) | 2010-03-04 | 2015-10-06 | Macrogenics, Inc. | Antibodies reactive with B7-H3, immunologically active fragments thereof and uses thereof |
| WO2011130616A1 (en) | 2010-04-15 | 2011-10-20 | Spirogen Limited | Pyrrolobenzodiazepines used to treat proliferative diseases |
| WO2012128868A1 (en) | 2011-02-15 | 2012-09-27 | Immunogen, Inc. | Cytotoxic benzodiazepine derivatives |
| WO2012112687A1 (en) | 2011-02-15 | 2012-08-23 | Immunogen, Inc. | Methods of preparation of conjugates |
| US9353127B2 (en) | 2011-02-15 | 2016-05-31 | Immunogen, Inc. | Methods of preparation of conjugates |
| US8765740B2 (en) | 2011-02-15 | 2014-07-01 | Immunogen, Inc. | Cytotoxic benzodiazepine derivatives |
| WO2012112708A1 (en) | 2011-02-15 | 2012-08-23 | Immunogen, Inc. | Cytotoxic benzodiazepine derivatives and methods of preparation |
| WO2013049704A2 (en) | 2011-09-28 | 2013-04-04 | Armune Biosciences, Inc. | Method and system of particle-phage epitope complex |
| WO2013098797A2 (en) | 2011-12-31 | 2013-07-04 | Kuriakose Moni Abraham | Diagnostic tests for predicting prognosis, recurrence, resistance or sensitivity to therapy and metastatic status in cancer |
| US20140342946A1 (en) | 2011-12-31 | 2014-11-20 | Moni Abraham Kuriakose | Diagnostic tests for predicting prognosis, recurrence, resistance or sensitivity to therapy and metastatic status in cancer |
| WO2013119960A2 (en) | 2012-02-08 | 2013-08-15 | Stem Centrx, Inc. | Novel modulators and methods of use |
| US20150337048A1 (en) | 2012-02-08 | 2015-11-26 | Stem Centrx, Inc. | Anti-cd324 monoclonal antibodies and uses thereof |
| WO2013177481A1 (en) | 2012-05-25 | 2013-11-28 | Immunogen, Inc. | Benzodiazepines and conjugates thereof |
| WO2014108480A1 (en) | 2013-01-09 | 2014-07-17 | Friedrich-Alexander-Universitaet Erlangen-Nuernberg | Method for in vitro detection and monitoring of a disease by measuring disease-associated protease activity in extracellular vesicles |
| US20150337356A1 (en) | 2013-01-09 | 2015-11-26 | Friedrich-Alexander-Universitaet Erlangen- Nuernberg | Method for in vitro detection and monitoring of a disease by measuring disease-associated protease activity in extracellular vesicles |
| WO2014124326A1 (en) | 2013-02-08 | 2014-08-14 | Stem Centrx, Inc. | Novel multispecific constructs |
| US20150368352A1 (en) | 2013-02-08 | 2015-12-24 | Stemcentrx, Inc. | Novel multispecific constructs |
| US20160024582A1 (en) | 2013-04-08 | 2016-01-28 | Mitsubishi Rayon Co., Ltd. | Microarray for evaluating eye disease, and evaluation method of eye disease |
| WO2014186364A2 (en) | 2013-05-13 | 2014-11-20 | Tufts University | Methods and compositions for prognosis, diagnosis and treatment of adam8-expressing cancer |
| WO2014205293A1 (en) | 2013-06-19 | 2014-12-24 | Memorial Sloan-Kettering Cancer Center | Methods and compositions for the diagnosis, prognosis and treatment of brain metastasis |
| US20160138113A1 (en) | 2013-06-19 | 2016-05-19 | Memorial Sloan-Kettering Cancer Center | Methods and compositions for the diagnosis, prognosis and treatment of brain metastasis |
| US20150010575A1 (en) | 2013-07-03 | 2015-01-08 | Samsung Electronics Co., Ltd. | Combination therapy for the treatment of cancer using an anti-c-met antibody |
| US20160082114A1 (en) | 2014-09-03 | 2016-03-24 | Immunogen, Inc. | Cytotoxic benzodiazepine derivatives |
| US20160095938A1 (en) * | 2014-09-03 | 2016-04-07 | Immunogen, Inc. | Conjugates comprising cell-binding agents and cytotoxic agents |
| US9381256B2 (en) | 2014-09-03 | 2016-07-05 | Immunogen, Inc. | Cytotoxic benzodiazepine derivatives |
| WO2016077505A2 (en) | 2014-11-11 | 2016-05-19 | Amunix Operating Inc. | Targeted xten conjugate compositions and methods of making same |
| WO2017004025A1 (en) | 2015-06-29 | 2017-01-05 | Immunogen, Inc. | Conjugates of cysteine engineered antibodies |
Non-Patent Citations (69)
| Title |
|---|
| "Dictionary of Chemical Terms", 1984, MCGRAW-HILL |
| AMENDOLA, R.S. ET AL.: "ADAM9 Disintegrin Domain Activates Human Neutrophils Through An Autocrine Circuit Involving Integrins And CXCR2", J. LEUKOCYTE BIOL., vol. 97, no. 5, 2015, pages 951 - 962 |
| BROWN ET AL.: "Tumor-Specific Genetically Engineered Murine/Human Chimeric Monoclonal Antibody", CANCER RES., vol. 47, 1987, pages 3577 - 3583 |
| CARTER, P. ET AL.: "Humanization Of An Anti-pl85her2 Antibody For Human Cancer Therapy", PROC. NATL. ACAD. SCI. (U.S.A., vol. 89, 1992, pages 4285 - 4289, XP000275844, DOI: doi:10.1073/pnas.89.10.4285 |
| CHAN, C.E. ET AL.: "The Use Of Antibodies In The Treatment Of Infectious Diseases", SINGAPORE MED. J., vol. 50, no. 7, 2009, pages 663 - 666 |
| CHANG, L. ET AL.: "Combined Rnai Targeting Human Stat3 And ADAM9 As Gene Therapy For Non -Small Cell Lung Cancer", ONCOLOGY LETTERS, vol. 11, 2016, pages 1242 - 1250 |
| CHOTHIA, C.; LESK, A. M.: "Canonical structures for the hypervariable regions of immunoglobulins", J. MOL. BIOL., vol. 196, 1987, pages 901 - 917, XP024010426, DOI: doi:10.1016/0022-2836(87)90412-8 |
| CO, M. S. ET AL.: "Humanized Antibodies For Antiviral Therapy", PROC. NATL. ACAD. SCI. (U.S.A., vol. 88, 1991, pages 2869 - 2873, XP000200583, DOI: doi:10.1073/pnas.88.7.2869 |
| CO, M.S. ET AL.: "Chimeric And Humanized Antibodies With Specificity For The CD33 Antigen", J. IMMUNOL., vol. 148, 1992, pages 1149 - 1154, XP000368716 |
| COMINETTI, M.R. ET AL.: "Inhibition Of Platelets And Tumor Cell Adhesion By The Disintegrin Domain Of Human ADAM9 To Collagen I Under Dynamic Flow Conditions", BIOCHIMIE, vol. 91, 2009, pages 1045 - 1052, XP026252649, DOI: doi:10.1016/j.biochi.2009.05.012 |
| DAUGHERTY ET AL.: "Polymerase Chain Reaction Facilitates The Cloning, CDR-Grafting, And Rapid Expression Of A Murine Monoclonal Antibody Directed Against The CDl8 Component Of Leukocyte Integrins", NUCL. ACIDS RES., vol. 19, 1991, pages 2471 - 2476, XP000256796 |
| DUFFY, M.J. ET AL.: "Role Of ADAMs In Cancer Formation And Progression", CLIN. CANCER RES., vol. 15, 2009, pages 1140 - 1144 |
| DUFFY, M.J. ET AL.: "The ADAMs Family Of Proteases: New Biomarkers And Therapeutic Targets For Cancer?", CLIN. PROTEOMICS, vol. 8, no. 9, 2011, pages 1 - 13 |
| DUFFY, M.J. ET AL.: "The Role Of ADAMs In Disease Pathophysiology", CLIN. CHIM. ACTA, vol. 403, 2009, pages 31 - 36, XP026021709, DOI: doi:10.1016/j.cca.2009.01.007 |
| EDWARS, D.R. ET AL.: "The ADAM Metalloproteases", MOLEC. ASPECTS MED., vol. 29, 2008, pages 258 - 289 |
| ELIEL, E.; WILEN, S.: "Stereochemistry of Organic Compounds", 1994, JOHN WILEY & SONS, INC. |
| FAN, X. ET AL.: "ADAM9 Expression Is Associate with Glioma Tumor Grade and Histological Type, and Acts as a Prognostic Factor in Lower-Grade Gliomas", INT. J. MOL. SCI., vol. 17, no. 1276, 2016, pages 1 - 11 |
| FRITZSCHE, F.R. ET AL.: "ADAM9 Is Highly Expressed In Renal Cell Cancer And Is Associated With Tumour Progression", BMC CANCER, vol. 8, no. 179, 2008, pages 1 - 9, XP021034614 |
| FRY, J.L. ET AL.: "Secreted And Membrane-Bound Isoforms Of Protease ADAM9 Have Opposing Effects On Breast Cancer Cell Migration", CANCER RES., vol. 70, 2010, pages 8187 - 8198 |
| GANESAN, A.: "Solid-Phase Synthesis In The Twenty-First Century", MINI REV. MED. CHEM., vol. 6, no. 1, 2006, pages 3 - 10 |
| GORMAN, S. D. ET AL.: "Reshaping A Therapeutic CD4 Antibody", PROC. NATL. ACAD. SCI. (U.S.A., vol. 88, 1991, pages 4181 - 4185, XP000368701, DOI: doi:10.1073/pnas.88.10.4181 |
| HOUGHTEN, R.A.: "General Method For The Rapid Solid-Phase Synthesis Of Large Numbers Of Peptides: Specificity Of Antigen-Antibody Interaction At The Level Of Individual Amino Acids", PROC. NATL. ACAD. SCI. (U.S.A., vol. 82, no. 15, 1985, pages 5131 - 5135, XP000611717, DOI: doi:10.1073/pnas.82.15.5131 |
| ISALM; DENT: "Bioconjugation", 1999, GROVES DICTIONARIES INC., pages: 218 - 363 |
| ITO, N. ET AL.: "ADAM , A Disintegrin And Metalloproteinases, Mediate Shedding Of Oxytocinase", BIOCHEM. BIOPHYS. RES. COMMUN., vol. 314, 2004, pages 1008 - 1013, XP004486111, DOI: doi:10.1016/j.bbrc.2003.12.183 |
| JENNINGS, V.M.: "Review of Selected Adjuvants Used in Antibody Production", ILAR J., vol. 37, no. 3, 1995, pages 119 - 125, XP055397292, DOI: doi:10.1093/ilar.37.3.119 |
| JONES ET AL.: "Replacing The Complementarity-Determining Regions In A Human Antibody With Those From A Mouse", NATURE, vol. 321, 1986, pages 522 - 525, XP002949266, DOI: doi:10.1038/321522a0 |
| JOSSON, S. ET AL.: "Inhibition of ADAM9 Expression Induces Epithelial Phenotypic Alterations and Sensitizes Human Prostate Cancer Cells to Radiation and Chemotherapy", PROSTATE, vol. 71, no. 3, 2011, pages 232 - 240 |
| JUNIPER A. SCRIBNER ET AL: "Abstract 38: Target validation, antibody discovery and preclinical data supporting ADAM9 as an antibody-drug conjugate therapeutic target for solid tumors", CANCER RESEARCH, vol. 77, no. 13 Supplement, 1 April 2017 (2017-04-01), US, pages 38 - 38, XP055464265, ISSN: 0008-5472, DOI: 10.1158/1538-7445.AM2017-38 * |
| KABAT ET AL.: "SEQUENCES OF PROTEINS OF IMMUNOLOGICAL INTEREST", 1991, PUBLIC HEALTH SERVICE |
| KARADAG, A. ET AL.: "ADAM-9 (MDC- 9/Meltringamma), A Member Of The A Disintegrin And Metalloproteinase Family, Regulates Myeloma-Cell-Induced Interleukin-6 Production In Osteoblasts By Direct Interaction With The Alpha(v)Beta5 Integrin", BLOOD, vol. 107, 2006, pages 3271 - 3278 |
| KETTLEBOROUGH, C. A. ET AL.: "Humanization Of A Mouse Monoclonal Antibody By CDR-Grafting: The Importance Of Framework Residues On Loop Conformation", PROTEIN ENGINEERING, vol. 4, 1991, pages 773 - 3783 |
| KOHLER, G. ET AL.: "Continuous Cultures Of Fused Cells Secreting Antibody Of Predefined Specificity", NATURE, vol. 256, 1975, pages 495 - 497, XP002024548 |
| LAI ET AL., PHARM RES., vol. 32, no. 11, November 2015 (2015-11-01), pages 3593 - 603 |
| LANGER: "New Methods Of Drug Delivery", SCIENCE, vol. 249, 1990, pages 1527 - 1533, XP000169082, DOI: doi:10.1126/science.2218494 |
| LEFRANC ET AL.: "The Human IgG Subclasses: Molecular Analysis of Structure, Function And Regulation", 1990, pages: 43 - 78 |
| LEFRANC, G. ET AL., HUM. GENET., vol. 50, 1979, pages 199 - 211 |
| LI, J. ET AL.: "Overexpression of ADAM9 Promotes Colon Cancer Cells Invasion", J. INVEST. SURG., vol. 26, no. 3, 2016, pages 127 - 133 |
| LOBUGLIO ET AL.: "Mouse/Human Chimeric Monoclonal Antibody In Man: Kinetics And Immune Response", PROC. NATL. ACAD. SCI. (U.S.A., vol. 86, 1989, pages 4220 - 4224, XP002100301, DOI: doi:10.1073/pnas.86.11.4220 |
| LOBUGLIO, A.F. ET AL.: "Mouse/Human Chimeric Monoclonal Antibody In Man: Kinetics And Immune Response", PROC. NATL. ACAD. SCI. (U.S.A., vol. 86, 1989, pages 4220 - 4224, XP002100301, DOI: doi:10.1073/pnas.86.11.4220 |
| LONBERG, N. ET AL.: "Human Antibodies From Transgenic Mice", INT. REV. IMMUNOL, vol. 13, 1995, pages 65 - 93 |
| LOPEZ-BERESTEIN: "LIPOSOMES IN THE THERAPY OF INFECTIOUS DISEASE AND CANCER", vol. 3, pages: 17 - 327 |
| MAEDA, H. ET AL.: "Construction Of Reshaped Human Antibodies With HIV-Neutralizing Activity", HUMAN ANTIBODIES HYBRIDOMA, vol. 2, 1991, pages 124 - 134 |
| MAZZOCCA, A.: "A Secreted Form Of ADAM9 Promotes Carcinoma Invasion Through Tumor-Stromal Interactions", CANCER RES., vol. 65, 2005, pages 4728 - 4738 |
| MERRIFIELD, B.: "Solid Phase Synthesis", SCIENCE, vol. 232, no. 4748, 1986, pages 341 - 347, XP002583629 |
| NAMBA, K. ET AL.: "Involvement Of ADAM9 In Multinucleated Giant Cell Formation Of Blood Monocytes", CELL. IMMUNOL., vol. 213, 2001, pages 104 - 113, XP002494736, DOI: doi:10.1006/cimm.2001.1873 |
| OKSALA, N. ET AL.: "ADAM-9, ADAM-15, And ADAM-17 Are Upregulated In Macrophages In Advanced Human Atherosclerotic Plaques In Aorta And Carotid And Femoral Arteries - Tampere Vascular Study", ANN. MED., vol. 41, 2009, pages 279 - 290, XP009173521, DOI: doi:10.1080/07853890802649738 |
| P. G.M. WUTS; T. W. GREENE: "Protective Groups in Organic Synthesis", 2007, JOHN WILEY & SONS |
| P. WUTS; T. GREENE: "Protective Groups in Organic Synthesis", 2007, J. WILEY & SONS, NJ |
| PEDUTO, L. ET AL.: "Critical Function For ADAM9 In Mouse Prostate Cancer", CANCER RES., vol. 65, 2005, pages 9312 - 9319 |
| PEDUTO, L.: "ADAM9 As A Potential Target Molecule In Cancer", CURR. PHARM. DES., vol. 15, 2009, pages 2282 - 2287 |
| PEETERS ET AL.: "Production Of Antibodies And Antibody Fragments In Plants", VACCINE, vol. 19, 2001, pages 2756, XP004231108, DOI: doi:10.1016/S0264-410X(00)00514-4 |
| POLLOCK ET AL.: "Transgenic Milk As A Method For The Production Of Recombinant Antibodies", J. IMMUNOL METHODS, vol. 231, 1999, pages 147 - 157, XP004187641, DOI: doi:10.1016/S0022-1759(99)00151-9 |
| RIECHMANN, L. ET AL.: "Reshaping Human Antibodies for Therapy", NATURE, vol. 332, 1988, pages 323 - 327, XP002007067, DOI: doi:10.1038/332323a0 |
| SATO, K. ET AL., CANCER RES, vol. 53, 1993, pages 851 - 856 |
| SHAW ET AL.: "Characterization Of A Mouse/Human Chimeric Monoclonal Antibody (17-lA) To A Colon Cancer Tumor-Associated Antigen", J. IMMUNOL., vol. 138, 1987, pages 4534 - 4538 |
| STAVENHAGEN, J.B. ET AL.: "Fc Optimization Of Therapeutic Antibodies Enhances Their Ability To Kill Tumor Cells In Vitro And Controls Tumor Expansion In Vivo Via Low-Affinity Activating Fcgamma Receptors", CANCER RES., vol. 57, no. 18, 2007, pages 8882 - 8890, XP002489883, DOI: doi:10.1158/0008-5472.CAN-07-0696 |
| STUART W HICKS ET AL: "Abstract #37: Novel Antibody-Drug Conjugates Targeting ADAM9-expressing Solid Tumors Demonstrate Potent Preclinical Activity Introduction", PROCEEDINGS OF THE AMERICAN ASSOCIATION FOR CANCER RESEARCH ANNUAL MEETING 2017, vol. 77, no. 13 Suppl, 1 April 2017 (2017-04-01), XP055464251, DOI: 10.1158/1538-7445.AM2017-37 * |
| STUART W HICKS ET AL: "Abstract 37: Novel antibody-drug conjugates targeting ADAM9-expressing solid tumors demonstrate potent preclinical activity | Cancer Research", PROCEEDINGS OF THE AMERICAN ASSOCIATION FOR CANCER RESEARCH ANNUAL MEETING 2017, vol. 77, no. 13 Suppl, 1 July 2017 (2017-07-01), XP055464261, DOI: 10.1158/1538-7445.AM2017-37 * |
| STUART W HICKS ET AL: "Abstract 38: Target validation, antibody discovery and preclinical data supporting ADAM9 as an antibody-drug conjugate therapeutic target for solid tumors | Cancer Research", PROCEEDINGS OF THE AMERICAN ASSOCIATION FOR CANCER RESEARCH ANNUAL MEETING 2017, vol. 77, no. 13 Suppl, 1 July 2017 (2017-07-01), XP055464262, DOI: 10.1158/1538-7445.AM2017-38 * |
| SUN, C. ET AL.: "ADAM15 Regulates Endothelial Permeability And Neutrophil Migration Via Src/ERKl/2 Signalling", CARDIOVASC. RES., vol. 87, 2010, pages 348 - 355, XP055407371, DOI: doi:10.1093/cvr/cvq060 |
| TEMPEST, P.R. ET AL.: "Reshaping A Human Monoclonal Antibody To Inhibit Human Respiratory Syncytial Virus Infection in vivo", BIO/TECHNOLOGY, vol. 9, 1991, pages 266 - 271, XP000986147, DOI: doi:10.1038/nbt0391-266 |
| TREAT ET AL.: "LIPOSOMES IN THE THERAPY OF INFECTIOUS DISEASE AND CANCER", 1989, LISS, pages: 353 - 365 |
| VERHOEYEN, M. ET AL.: "Reshaping Human Antibodies: Grafting An Antilysozyme Activity", SCIENCE, vol. 239, 1988, pages 1534 - 1536, XP002949269, DOI: doi:10.1126/science.2451287 |
| WINTER ET AL.: "Man-made Antibodies", NATURE, vol. 349, 1991, pages 293 - 299, XP002018878, DOI: doi:10.1038/349293a0 |
| WINTER, G. ET AL.: "Making Antibodies By Phage Display Technology", ANNU. REV. IMMUNOL., vol. 12, 1994, pages 433 - 455, XP000564245, DOI: doi:10.1146/annurev.iy.12.040194.002245 |
| WU ET AL.: "Receptor-Mediated In Vitro Gene Transformation By A Soluble DNA Carrier System", J. BIOL. CHEM., vol. 262, 1987, pages 4429 - 4432 |
| YOSHIMASU, T. ET AL.: "Overexpression Of ADAM9 In Non-Small Cell Lung Cancer Correlates With Brain Metastasis", CANCER RES., vol. 64, 2004, pages 4190 - 4196, XP003014839, DOI: doi:10.1158/0008-5472.CAN-03-3235 |
| ZIGRINO, P. ET AL.: "ADAM-9 Expression And Regulation In Human Skin Melanoma And Melanoma Cell Lines", INT. J. CANCER, vol. 116, 2005, pages 853 - 859 |
| ZIGRINO, P. ET AL.: "The Disintegrin-Like And Cysteine-Rich Domains Of ADAM-9 Mediate Interactions Between Melanoma Cells And Fibroblasts", J. BIOL. CHEM., vol. 286, 2011, pages 6801 - 6807 |
Cited By (13)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11274121B2 (en) | 2018-01-12 | 2022-03-15 | Immunogen, Inc. | Methods for antibody drug conjugation, purification, and formulation |
| WO2020005945A1 (en) * | 2018-06-26 | 2020-01-02 | Immunogen, Inc. | Immunoconjugates targeting adam9 and methods of use thereof |
| WO2020191306A1 (en) | 2019-03-21 | 2020-09-24 | Immunogen, Inc. | Methods of preparing cell-binding agent-drug conjugates |
| CN113631194A (zh) * | 2019-03-21 | 2021-11-09 | 伊缪诺金公司 | 制备细胞结合剂-药物缀合物的方法 |
| WO2020205564A1 (en) | 2019-03-29 | 2020-10-08 | Immunogen, Inc. | Cytotoxic bis-benzodiazepine derivatives and conjugates thereof with cell-binding agents for inhibiting abnormal cell growth or for treating proliferative diseases |
| EP4316524A2 (en) | 2019-04-26 | 2024-02-07 | ImmunoGen, Inc. | Camptothecin derivatives |
| WO2020219287A1 (en) | 2019-04-26 | 2020-10-29 | Immunogen, Inc. | Camptothecin derivatives |
| WO2022192134A1 (en) | 2021-03-08 | 2022-09-15 | Immunogen, Inc. | Methods for increasing efficacy of immunoconjugates targeting adam9 for the treatment of cancer |
| WO2024193692A1 (zh) | 2023-03-22 | 2024-09-26 | 映恩生物制药(苏州)有限公司 | 连接子及其在配体药物偶联物中的应用 |
| EP4684807A1 (en) | 2023-03-22 | 2026-01-28 | Duality Biologics (Shanghai) Co., Ltd. | Linker and use thereof in ligand drug conjugate |
| WO2024199111A1 (zh) | 2023-03-24 | 2024-10-03 | 映恩生物制药(苏州)有限公司 | 靶向adam9的人源化抗体、其抗体药物偶联物及其应用 |
| EP4692118A1 (en) | 2023-03-24 | 2026-02-11 | Duality Biologics (Shanghai) Co., Ltd. | Adam9-targeting humanized antibody and antibody-drug conjugate comprising same and use thereof |
| WO2025094146A1 (en) | 2023-11-02 | 2025-05-08 | Immunogen Switzerland Gmbh | Vasconstrictors for reducing ocular toxicity of antibody-maytansinoid conjugates |
Also Published As
| Publication number | Publication date |
|---|---|
| EP3558391B1 (en) | 2022-02-02 |
| CN110267685B (zh) | 2023-06-20 |
| EP3558391A1 (en) | 2019-10-30 |
| RS63154B1 (sr) | 2022-05-31 |
| US20210388102A1 (en) | 2021-12-16 |
| PT3558391T (pt) | 2022-05-05 |
| MD3558391T2 (ro) | 2022-05-31 |
| CY1125181T1 (el) | 2024-12-13 |
| TW201822821A (zh) | 2018-07-01 |
| PL3558391T3 (pl) | 2022-05-16 |
| ES2912266T3 (es) | 2022-05-25 |
| JP7170642B2 (ja) | 2022-11-14 |
| SI3558391T1 (sl) | 2022-06-30 |
| CN110267685A (zh) | 2019-09-20 |
| SMT202200182T1 (it) | 2022-05-12 |
| WO2018119196A8 (en) | 2019-06-20 |
| HRP20220550T1 (hr) | 2022-06-10 |
| TWI783957B (zh) | 2022-11-21 |
| LT3558391T (lt) | 2022-07-11 |
| JP2020504607A (ja) | 2020-02-13 |
| HUE058664T2 (hu) | 2022-09-28 |
| DK3558391T3 (da) | 2022-05-09 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP3558391B1 (en) | Immunoconjugates targeting adam9 and methods of use thereof | |
| JP7592009B2 (ja) | EpCAM抗体、活性化可能抗体、および免疫複合体、ならびにそれらの使用 | |
| JP7203497B2 (ja) | 抗cd123抗体、ならびにその複合体及び誘導体 | |
| TWI831797B (zh) | 靶向adam9之免疫接合物及其使用方法 | |
| KR20220004687A (ko) | 이중파라토프 fr-알파 항체 및 면역접합체 | |
| US20180230218A1 (en) | Met antibodies and immunoconjugates and uses thereof | |
| JP7313684B2 (ja) | 抗gp73抗体及びイムノコンジュゲート | |
| WO2020014306A1 (en) | Met antibodies and immunoconjugates and uses thereof | |
| HK40015128B (en) | Immunoconjugates targeting adam9 and methods of use thereof | |
| HK40015128A (en) | Immunoconjugates targeting adam9 and methods of use thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 17835533 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2019533514 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2017835533 Country of ref document: EP Effective date: 20190723 |