WO2018116267A2 - Methods of treatment with anti-factor xi/xia antibodies - Google Patents
Methods of treatment with anti-factor xi/xia antibodies Download PDFInfo
- Publication number
- WO2018116267A2 WO2018116267A2 PCT/IB2017/058345 IB2017058345W WO2018116267A2 WO 2018116267 A2 WO2018116267 A2 WO 2018116267A2 IB 2017058345 W IB2017058345 W IB 2017058345W WO 2018116267 A2 WO2018116267 A2 WO 2018116267A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- seq
- fxi
- amino acid
- subject
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/36—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against blood coagulation factors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/02—Antithrombotic agents; Anticoagulants; Platelet aggregation inhibitors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/545—Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- Thrombosis refers to thrombus formation inside blood vessels, subsequent to a combination of hereditary and acquired risk factors, known as thrombophilia or
- thrombosis can occur in both venous and arterial circulation and can result in the development of deep vein thrombosis (DVT), pulmonary embolism, and stroke. If a thrombus occurs in the arterial system, down-stream ischemia can occur, leading to acute coronary syndromes (ACS), ischemic stroke, and acute limb ischemia. Thrombus formation in the venous system typically leads to deep venous thrombosis, pulmonary embolism and chronic thromboembolic pulmonary hypertension. Clots may also form in the left atrial appendage in patients with AF (AF), and dislodged thrombi may result in potentially devastating complications, i.e.
- AF AF
- thromboembolic stroke and systemic embolism The currently available antithrombotic medications, including low molecular weight heparin (LMWH), thrombin inhibitors, and Factor Xa (FXa) inhibitors, are all associated with a significant risk of bleeding (Weitz J.I. (2010) Thromb. Haemost. 103, 62). The development of an antithrombotic agent that does not affect hemostasis, and therefore does not result in bleeding complications, would be highly desirable.
- LMWH low molecular weight heparin
- FXa Factor Xa
- LMWH injectable anticoagulant
- LMWH injectable anticoagulant
- Warfarin has a narrow therapeutic window that requires frequent monitoring of the coagulation status, and shows a variety of drug-drug interactions.
- More recently, orally available direct FXa and thrombin inhibitors entered the anticoagulant market and are increasingly applied.
- LMWHs, FXa inhibitors, and thrombin inhibitors are all efficacious in the prevention of post-operative venous thromboembolic disease, in the treatment of spontaneous DVT and pulmonary embolism, and in the stroke prevention in atrial fibrillation.
- Atrial fibrillation remains the most common cardiac arrhythmia in clinical practice, accounting for approximately one third of hospitalizations for cardiac dysrhythmias.
- AF Atrial fibrillation
- AF risk factors such as hypertension, congestive heart failure, left ventricular hypertrophy, coronary artery disease and diabetes mellitus, and obstructive sleep apnea are also on the rise.
- AF The principal risk of AF is a four- to five fold increase in embolic stroke.
- the attributable risk for stroke associated with AF increases steeply with age to 23.5% at ages 80 to 89.
- AF is associated with a doubling of mortality in both genders (Kannel and Benjamin 2008).
- AF is also independently associated with cognitive decline and all forms of dementia (Marzona, et al. (2012) CMAJ 2012; 184: 329-36; Geita et al 2013; Bunch et al 2012).
- CHA 2 DS 2 -VASc risk score is a validated and widely used stratification tool to predict thromboembolic risk in AF patients and to identify patients who should benefit from anticoagulation therapy (LIP 201 1 ; Camm, et al. (2012) Eur Heart J 2012; 33: 2719-2747); the accumulated evidence shows that CHA 2 DS 2 -VASc is at least as accurate as or possibly better than, scores such as CHADS2 in identifying patients who develop stroke and thromboembolism and definitively better at identifying 'truly low-risk' patients with AF. It is estimated that 85 to 90% of AF patients will require anticoagulation therapy.
- NOAC oral anticoagulants
- DOAC direct oral anticoagulants
- AF is a highly prevalent comorbidity in patients with ESRD (Zimmerman et al. (2012) Nephrol Dial Transplant, 27: 3816-3822).
- AF is associated with a higher stroke risk and mortality in patients with ESRD (Zimmerman et al. (2012) Nephrol Dial Transplant, 27: 3816-3822)).
- a high unmet medical need for a safe anticoagulant with a non-renal clearance exists in patients with ESRD, and in particular, AF and ESRD undergoing dialysis.
- the present disclosure relates to methods of preventing, treating or managing, or reducing the risk of thrombosis or thromboembolism associated with treatment of subjects afflicted with end stage renal disease (ESRD).
- the methods include administering to the subject a monoclonal antibody or antigen binding fragment thereof that binds to human coagulation Factor XI and Xla (activated Factor XI) (hereinafter, sometimes referred to as "FXI", “FXIa,” and similar terms).
- an anti-thrombotic agent that is efficacious in the prevention and treatment of thrombosis or thromboembolic disease/disorder associated with treatment of end stage renal disease (e.g., thrombic stroke, AF, stroke prevention in AF (SPAF), deep vein thrombosis, venous thromboembolism, pulmonary embolism, ischemic stroke, acute limb ischemia, chronic thromboembolic pulmonary hypertension, systemic embolism) but carries no or only minimal bleeding risk would meet a sizable unmet medical need.
- end stage renal disease e.g., thrombic stroke, AF, stroke prevention in AF (SPAF)
- end stage renal disease e.g., thrombic stroke, AF, stroke prevention in AF (SPAF)
- deep vein thrombosis venous thromboembolism
- pulmonary embolism ischemic stroke
- acute limb ischemia acute limb ischemia
- the subject is receiving dialysis.
- the subject has end stage renal disease and AF (e.g., non-valvular AF) and is receiving dialysis.
- AF e.g., non-valvular AF
- the present disclosure relates to methods of preventing, treating or managing, or reducing the risk of thrombosis or thromboembolism in subjects with end stage renal disease (ESRD) and AF (e.g., non-valvular AF) undergoing dialysis, said method comprises administering to subjects an anti-FXI/FXIa antibody (e.g., those described in Table 1) ⁇
- ESRD end stage renal disease
- AF e.g., non-valvular AF
- the subject is obese.
- the subject is administered an antibody or fragment (e.g., human, chimeric, humanized monoclonal antibody or fragment) provided herein that binds with similarly high affinity to the catalytic domain (CD) of human FXIa and FXI and induces an inactive protease domain conformation in FXIa.
- the antibody, or antigen binding fragments thereof, for use in the methods described herein binds within the catalytic domain of FXI and/or FXIa, specifically to the surface of the active site region.
- the methods described herein can comprise administering an antibody, or antigen binding fragment thereof, that binds FXI and/or FXIa and competes for binding with an antibody described in Table 1 (e.g., NOV1401).
- “competition” between antibodies and/or antigen binding fragments thereof signifies that both antibodies (or binding fragments thereof) bind to the same, or overlapping, FXI and/or FXIa epitope (e.g., as determined by a competitive binding assay, by any of the methods well known to those of skill in the art).
- an antibody or antigen binding fragment thereof does not "compete" with an FXI and/or FXIa antibody or antigen binding fragment of the present disclosure (e.g., NOV1401 or NOV1090) unless said competing antibody or antigen binding fragment thereof binds the same FXI and/or FXIa epitope, or an overlapping FXI and/or FXIa epitope, as an antibody or antigen binding fragment of the present disclosure.
- a competing antibody or antigen binding fragment thereof does not include one which (i) sterically blocks an antibody or antigen binding fragment of the present disclosure from binding its target (e.g., if said competing antibody binds to a nearby, non-overlapping FXI and/or FXIa epitope and physically prevents an antibody or antigen binding fragment of the present disclosure from binding its target); and/or (ii) binds to a different, non-overlapping FXI and/or FXIa epitope and induces a conformational change to the FXI and/or FXIa protein such that said protein can no longer be bound by an FXI and/or FXIa antibody or antigen binding fragment of the present disclosure in a way that would occur absent said conformational change.
- the method comrpises administering an antibody, or antigen binding fragment thereof, that binds to active FXI (FXIa) and leads upon binding to the active FXI (FXIa) catalytic domain to FXIa changing its conformation to an inactive conformation.
- the antibody or antigen binding fragment thereof further induce a change in which the N-terminal 4 residues, loops 145, 188 and 220 of the inactive conformation are shifted and/or disordered compared to the active conformation.
- the method comprises administering an antibody, or antigen binding fragment thereof, that binds to FXI (e.g., human FXI) and upon binding to FXI prevents the FXI catalytic domain from assuming an active conformation, in which loops 145, 188 and 220 are ordered as in the structure of the FXIa catalytic domain.
- FXI e.g., human FXI
- the method comprises administering an antibody, or antigen binding fragment thereof, that binds to FXI and, upon binding to FXI, prevents the FXI catalytic domain from assuming an active conformation, in which the N-terminal 4 residues, loops 145, 188 and 220 are ordered as in the structure of the FXIa catalytic domain.
- the method comprises administering an antibody, or antigen binding fragment thereof, that binds to FXI and, upon binding to FXI, prevents the FXI catalytic domain from assuming an active conformation by inducing conformational changes in the zymogen structure, further leading to an inhibited FXI conformation closely related to that observed when binding to FXIa.
- the method comprises administering an antibody, or antigen binding fragment thereof, that binds to FXI and prevents the catalytic domain from assuming an active conformation by inducing a conformational changes in the zymogen structure, thereby leading to an inhibited FXI conformation closely related to that observed when binding to FXIa.
- the methods described herein can comprise administering an antibody, or antigen binding fragment thereof, that binds the same epitope as an antibody as described in Table 1 (e.g., NOV1401).
- the anti-FXI and/or FXIa antibody or antigen binding fragment used in the methods described can inhibit the direct or indirect activation of Factor IX (also known as FIX), Factor X (FX), and/or thrombin with an IC 50 of less than or equal to 100 nM, less than or equal to 50 nM, less than or equal to 35 nM, less than or equal to 25 nM, less than or equal to 10 nM, or less than or equal to 5.2 nM.
- Factor IX also known as FIX
- FX Factor X
- thrombin with an IC 50 of less than or equal to 100 nM, less than or equal to 50 nM, less than or equal to 35 nM, less than or equal to 25 nM, less than or equal to 10 nM, or less than or equal to 5.2 nM.
- the antibody or antigen binding fragment thereof can inhibit the direct or indirect activation of Factor IX (also known as FIX), Factor X (FX), and/or thrombin with an IC 50 of less than or equal to 100 nM, less than or equal to 50 nM, less than or equal to 35 nM, less than or equal to 25 nM, less than or equal to 10 nM, or less than or equal to 5.2 nM.
- Factor IX also known as FIX
- FX Factor X
- thrombin with an IC 50 of less than or equal to 100 nM, less than or equal to 50 nM, less than or equal to 35 nM, less than or equal to 25 nM, less than or equal to 10 nM, or less than or equal to 5.2 nM.
- the antibody or antigen binding fragment thereof can inhibit the direct or indirect activation of Factor IX (also known as FIX), Factor X (FX), and/or thrombin with an IC 50 of less than or equal to 100 nM, less than or equal to 50 nM, less than or equal to 35 nM, less than or equal to 25 nM, less than or equal to 20 nM, or less than or equal to 18 nM.
- Factor IX also known as FIX
- FX Factor X
- thrombin with an IC 50 of less than or equal to 100 nM, less than or equal to 50 nM, less than or equal to 35 nM, less than or equal to 25 nM, less than or equal to 20 nM, or less than or equal to 18 nM.
- the antibody or antigen binding fragment thereof can inhibit the direct or indirect activation of Factor IX (also known as FIX), Factor X (FX), and/or thrombin with an IC 50 of less than or equal to 100 nM, less than or equal to 50 nM, less than or equal to 35 nM, less than or equal to 25 nM, less than or equal to 10 nM, or less than or equal to 5 nM.
- the anti-FXI/FXIa antibody, or antigen binding fragment thereof inhibits FXIa-mediated activation of its native substrate FIX with an IC 50 of less than or equal to 2 nM, e.g., 1 .8 nM.
- the method comprises administering an antibody, or antigen binding fragment thereof, that prolongs the clotting time (e.g., time until a blood clot starts to form) of human plasma in a concentration-dependent manner as determined by an aPTT assay, for example as described in the Examples Section.
- clotting time e.g., time until a blood clot starts to form
- aPTT clotting time
- NOV1401 total anti-FXI antibody
- the antibody, or antigen binding fragment thereof prolongs the clotting time of human plasma in a concentration-dependent manner with an IC50 in the range of 5 nM to 20 nM, for example approximately 13 nM, as determined by the aPTT assay, for example as described in the Examples Section.
- the method comprises administering an antibody, or antigen binding fragment thereof, that prolongs the clotting time (e.g., time until a blood clot starts to form) of human plasma by at least 1 .1 fold, 1 .2 fold, 1 .3 fold, 1 .4 fold, 1 .5 fold, 1 .6 fold, 1 .7 fold, 1 .8 fold, 1 .9 fold, or 2 fold, e.g., in a concentration-dependent manner, as determined by an aPTT assay, for example as described in the Examples Section.
- an antibody, or antigen binding fragment thereof that prolongs the clotting time (e.g., time until a blood clot starts to form) of human plasma by at least 1 .1 fold, 1 .2 fold, 1 .3 fold, 1 .4 fold, 1 .5 fold, 1 .6 fold, 1 .7 fold, 1 .8 fold, 1 .9 fold, or 2 fold, e.g., in a concentration-dependent manner,
- the antibody, or antigen binding fragment thereof prolongs the clotting time (e.g., time until a blood clot starts to form) of human plasma by at least 1 .4 fold, 1 .5 fold, 1 .6 fold, or 1 .7 fold, as determined by an aPTT assay, for example as described in the Examples Section.
- the method comprises administering an antibody, or antigen binding fragment thereof, that reduces the amount of thrombin, in a concentration-dependent manner, in a thrombin generation assay (TGA) in human plasma, which measures the effect of FXIa inhibition on the thrombin ⁇ FXIa feed-forward loop in the presence of very low tissue factor (TF) concentrations.
- TGA thrombin generation assay
- the antibody, or antigen binding fragment thereof reduces the amount of thrombin in a thrombin generation assay (TGA) in human plasma with an IC 50 value in the range of 10 nM to 30 nM, for example approximately 20 nM or 24 nM, and a residual thrombin concentration of approximately 159 nM.
- the method comprises administering an antibody (e.g., an antibody in Table 1 such as NOV1401 or an antibody comprising the HCDRs 1 -3 and LCDRs 1 -3 of NOV1401 ), or antigen binding fragment thereof, which specifically binds to the catalytic domain of human FXI and/or FXIa, and which has a terminal elimination half-life (t 1 ⁇ 2 ) of total antibodies in cynomolgus monkeys as approximately 14-15 days.
- the antibody or antigen binding fragment thereof exhibits an absolute subcutaneous (s.c.) bioavailability of approximately 61 -66%.
- the method comprises administering an antibody or antigen binding fragment thereof (e.g., an antibody described in Table 1 , such as NOV1401), which specifically binds to human FXI and/or FXIa, and exhibits one or more (e.g., two, or three, or four, or five, or six, or seven), or all, of the following characteristics:
- an antibody or antigen binding fragment thereof e.g., an antibody described in Table 1 , such as NOV1401
- NOV1401 an antibody or antigen binding fragment thereof
- FXIIa activated factor XII
- thrombin thrombin
- (viii) contacts one or more (e.g., two, three, four, five, six, or seven, or more), or some, or all, of the following residues of human FXI (Swissprot numbering): Pro410, Arg413, Leu415, Cys416, His431 , Cys432, Tyr434, Gly435, Glu437, Tyr472-Glu476, Tyr521 -Lys527, Arg548, His552, Ser575, Ser594-Glu597, and Arg602-Arg604.
- the antibody, or antigen binding fragment thereof, used in the methods described herein can be a monoclonal antibody, a human or humanized antibody, a chimeric antibody, a single chain antibody, a Fab fragment, a Fv fragment, a F(ab')2 fragment, or a scFv fragment, and/or an IgG isotype (e.g., lgG1 such as human lgG1).
- the antibody can be a recombinant human antibody.
- the antibody is a human lgG1/lambda ( ⁇ ) antibody.
- the antibody is a human lgG1 /lambda ( ⁇ ) antibodies comprising an Fc domain engineered to reduce the potential for effector function (e.g., ADCC and/or CDC), for example a human Fc domain comprising D265A and/or P329A substitutions.
- an Fc domain engineered to reduce the potential for effector function e.g., ADCC and/or CDC
- a human Fc domain comprising D265A and/or P329A substitutions.
- the antibody, or antigen binding fragment thereof, for use in the methods described herein can also include a framework in which an amino acid has been substituted into the antibody framework from the respective human VH or VL germline sequences.
- the methods described herein can comrpise administering an antibody or antigen binding fragment thereof having the heavy and light chain sequences of an antibody described in Table 1 . More specifically, the antibody or antigen binding fragment thereof can have the heavy and light chain sequences of NOV1090 or NOV1401 .
- the methods described herein can comrpise administering an antibody or antigen binding fragment thereof having the heavy and light chain variable domain sequences of Fabs described in Table 1 . More specifically, the isolated antibody or antigen binding fragment thereof can have the heavy and light chain variable domain sequence of NOV1090 and NOV1401 .
- the methods described herein can comrpise administering an antibody or antigen binding fragment thereof comprising the heavy chain variable domain CDR (i.e., HCDR1 , HCDR2, and HCDR3) and light chain variable domain CDR (i.e., LCDR1 , LCDR2, and LCDR3) sequences of antibodies described in Table 1 , such as Kabat CDRs, IMGT CDRs, Chothia CDRs, or combined CDRs.
- CDR heavy chain variable domain
- HCDR2 i.e., HCDR2, and HCDR3
- LCDR1 , LCDR2, and LCDR3 light chain variable domain CDR sequences of antibodies described in Table 1 , such as Kabat CDRs, IMGT CDRs, Chothia CDRs, or combined CDRs.
- the isolated antibody or antigen binding fragment thereof can have the HCDR1 , HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3 sequences of NOV1090 and NOV1401 , for example as presented in Table 1 , such as Kabat CDRs, IMGT CDRs, Chothia CDRs, or combined CDRs.
- the methods described herein can comrpise administering an antibody or antigen binding fragment thereof comprising HCDR1 , HCDR2, and HCDR3 of the variable heavy chain of SEQ ID NOs: 9 and 29, and the LCDR1 , LCDR2 and LCDR3 of the variable light chain of SEQ ID NOs: 19 and 39, as defined by Chothia.
- the antibody or antigen binding fragment may have the HCDR1 , HCDR2, and HCDR3 of the heavy chain variable domain sequence of SEQ ID NOs: 9 and 29, and the LCDR1 , LCDR2 and LCDR3 of the light chain variable domain sequence of SEQ ID NOs: 19 and 39, as defined by Kabat.
- the methods described herein can comrpise administering an antibody or antigen binding fragment thereof comprising HCDR1 , HCDR2, and HCDR3 of the variable heavy chain of SEQ ID NOs: 9 and 29, and the LCDR1 , LCDR2 and LCDR3 of the variable light chain of SEQ ID NOs: 19 and 39, as defined by IMGT.
- the antibody or antigen binding fragment may have the HCDR1 , HCDR2, and HCDR3 of the heavy chain variable domain sequence of SEQ ID NOs: 9 and 29, and the LCDR1 , LCDR2 and LCDR3 of the light chain variable domain sequence of SEQ ID NOs: 19 and 39, as defined by Combined.
- the methods described herein comrpise administering an antibody or antigen binding fragment thereof that includes a heavy chain variable domain sequence selected from the group consisting of SEQ ID NOs: 9 and 29.
- the isolated antibody or antigen binding fragment further can comprise a light chain variable domain sequence wherein the heavy chain variable domain and light chain variable domain combine to form an antigen binding site for FXIa.
- the light chain variable domain sequence can be selected from SEQ ID NOs: 19 and 39 wherein said isolated antibody or antigen binding fragments thereof binds FXI and/or FXIa.
- the methods described herein comrpise administering an antibody or antigen binding fragment thereof that includes a light chain variable domain sequence selected from the group consisting of SEQ ID NOs: 19 and 39, wherein said isolated antibody or antigen binding fragments thereof binds to human FXI and/or FXIa.
- the isolated antibody or antigen binding fragment may further comprise a heavy chain variable domain sequence wherein the light chain variable domain and heavy chain variable domain combine to form and antigen binding site for FXI and/or FXIa.
- the methods described herein comrpise administering an antibody or antigen binding fragment thereof that binds FXI and/or FXIa may have heavy and light chain variable domains comprising the sequences of SEQ ID NOs: 9 and 19; or 19 and 39, respectively.
- the methods described herein comrpise administering an antibody or antigen binding fragment thereof that includes a heavy chain variable domain having at least 80%, 85%, 90%, 95%, 97%, 98%, or 99% sequence identity to a sequence selected from the group consisting of SEQ ID NOs: 9 and 29, wherein said antibody binds to FXI and/or FXIa.
- the isolated antibody or antigen binding fragments thereof also includes a light chain variable domain having at least 80%, 85%, 90%, 95%, 97%, 98%, or 99% sequence identity to a sequence selected from the group consisting of SEQ ID NOs: 19 and 39.
- the isolated antibody or antigen binding fragment has an HCDR1 , HCDR2, HCDR3, LCDR1 , LCDR2 and LCDR3 as defined by Kabat and as described in Table 1 .
- the isolated antibody or antigen binding fragment has an HCDR1 , HCDR2, HCDR3, LCDR1 , LCDR2 and LCDR3 as defined by Chothia, IMGT, or Combined and as described in Table 1 .
- the methods described herein comrpise administering an antibody or antigen binding fragment thereof having a light chain variable domain having at least 80%, 85%, 90%, 95%, 97%, 98%, or 99% sequence identity to a sequence selected from the group consisting of SEQ ID NOs: 19 and 39 , wherein said antibody binds FXI and/or FXIa.
- the methods described herein comrpise administering an antibody or antigen binding fragment thereof that bind to FXI and/or FXIa may have a heavy chain comprising the sequence of SEQ ID NOs: 1 1 or 31 .
- the isolated antibody can also include a light chain that can combine with the heavy chain to form an antigen binding site to human FXI and/or FXIa.
- the light chain may have a sequence comprising SEQ ID NOs: 21 or 41 .
- the isolated antibody or antigen binding fragments thereof that binds FXI and/or FXIa may have a heavy chain and a light chain comprising the sequences of SEQ ID NOs: 1 1 and 21 ; or 31 and 41 , respectively.
- the methods described herein comrpise administering an antibody or antigen binding fragment thereof that includes a heavy chain having at least 90% sequence identity to a sequence selected from the group consisting of SEQ ID NOs: 1 1 or 31 , wherein said antibody binds to FXI and/or FXIa.
- the isolated antibody or antigen binding fragments thereof also includes a light chain having at least 80%, 85%, 90%, 95%, 97%, 98%, or 99% sequence identity to a sequence selected from the group consisting of SEQ ID NOs: 21 or 41 .
- the methods described herein comrpise administering an antibody or antigen binding fragment thereof that includes a light chain having at least 80%, 85%, 90%, 95%, 97%, 98%, or 99% sequence identity to a sequence selected from the group consisting of SEQ ID NOs: 21 or 41 , wherein said antibody binds FXI and/or FXIa.
- compositions comprising an antibody or antigen binding fragments thereof of Table 1 , such as, for example antibody NOV1090 and NOV1401 .
- the methods described herein comrpise administering pharmaceutical compositions comprising a combination of two or more of the isolated antibodies or antigen binding fragments thereof of Table 1 .
- the present disclosure also relates to a method of treating, improving, or preventing a thromboembolic disease in a subject, wherein the method includes the step of administering to the subject an effective amount of a composition comprising an antibody that binds FXI and/or FXIa or antigen binding fragments thereof described herein.
- the thromboembolic disease is a thrombotic disorder (e.g., thrombosis, thrombic stroke, AF, stroke prevention in AF (SPAF), deep vein thrombosis, venous thromboembolism, and pulmonary embolism). It is contemplated that the subject is human.
- any of the foregoing isolated antibodies or antigen binding fragments thereof may be a monoclonal antibody or antigen binding fragments thereof.
- a method of preventing, treating or managing or reducing the risk of stroke or thromboembolism comprising administering to a subject afflicated with end stage renal disease, an effective amount of a pharmaceutical composition comprising an antibody or antigen-binding fragment that binds within the catalytic domain of FXI and/or FXIa.
- a method of preventing or reducing the risk of stroke or thromboembolism comprising administering to a subject afflicated with atrial fibrillation and end stage renal disease and who is undergoing dialysis or extracorporeal membrane oxygenation, an effective amount of a pharmaceutical composition comprising an antibody or antigen-binding fragment that binds within the catalytic domain of FXI and/or FXIa.
- any one of aspects 1 -7 wherein the antibody or fragment thereof binds to one or more epitopes of FXI and/or FXIa, wherein the epitope comprises two or more amino acid residues of Pro410, Arg413, Leu415, Cys416, His431 , Cys432, Tyr434, Gly435, Glu437, Tyr472, Lys473, Met474, Ala475, Glu476, Tyr521 , Arg522, Lys523, Leu524, Arg525, Asp526, Lys527, Arg548, His552, Ser575, Ser594, Trp595, Gly596, Glu597, Arg602, Glu603, and Arg604.
- the antibody or fragment thereof binds to one or more epitopes of anti-FXI and/or FXIa and the epitope comprises four or more amino acid residues of Pro410, Arg413, Leu415, Cys416, His431 , Cys432, Tyr434, Gly435, Glu437, Tyr472, Lys473, Met474, Ala475, Glu476, Tyr521 , Arg522, Lys523, Leu524, Arg525, Asp526, Lys527, Arg548, His552, Ser575, Ser594, Trp595, Gly596, Glu597, Arg602, Glu603, and Arg604.
- the antibody or fragment thereof binds to one or more epitopes of anti-FXI and/or FXIa and the the epitope comprises six or more amino acid residues of Pro410, Arg413, Leu415, Cys416, His431 , Cys432, Tyr434, Gly435, Glu437, Tyr472, Lys473, Met474, Ala475, Glu476, Tyr521 , Arg522, Lys523, Leu524, Arg525, Asp526, Lys527, Arg548, His552, Ser575, Ser594, Trp595, Gly596, Glu597, Arg602, Glu603, and Arg604.
- the antibody or fragment thereof binds to one or more epitopes of anti-FXI and/or FXIa and the the epitope comprises eight or more amino acid residues of Pro410, Arg413, Leu415, Cys416, His431 , Cys432, Tyr434, Gly435, Glu437, Tyr472, Lys473, Met474, Ala475, Glu476, Tyr521 , Arg522, Lys523, Leu524, Arg525, Asp526, Lys527, Arg548, His552, Ser575, Ser594, Trp595, Gly596, Glu597, Arg602, Glu603, and Arg604.
- the antibody or fragment thereof binds to one or more epitopes of anti-FXI and/or FXIa and the epitope comprises the residues of Pro410, Arg413, Leu415, Cys416, His431 , Cys432, Tyr434, Gly435, Glu437, Tyr472, Lys473, Met474, Ala475, Glu476, Tyr521 , Arg522, Lys523, Leu524, Arg525, Asp526, Lys527, Arg548, His552, Ser575, Ser594, Trp595, Gly596, Glu597, Arg602, Glu603, and Arg604. 13.
- the antibody or fragment thereof binds to one or more epitopes of anti-FXI and/or FXIa and the epitope comprises amino acid residues of Pro410, Arg413, Lys527 and one or more amino acid residues of Leu415, Cys416, His431 , Cys432, Tyr434, Gly435, Glu437, Tyr472, Lys473, Met474, Ala475, Glu476, Tyr521 , Arg522, Lys523, Leu524, Arg525, Asp526, Arg548, His552, Ser575, Ser594, Trp595, Gly596, Glu597, Arg602, Glu603, and Arg604.
- the antibody or fragment thereof binds to one or more epitopes of anti-FXI and/or FXIa and the epitope comprises amino acid residues of Pro410, Arg413, Lys527 and four or more amino acid residues of Leu415, Cys416, His431 , Cys432, Tyr434, Gly435, Glu437, Tyr472, Lys473, Met474, Ala475, Glu476, Tyr521 , Arg522, Lys523, Leu524, Arg525, Asp526, Arg548, His552, Ser575, Ser594, Trp595, Gly596, Glu597, Arg602, Glu603, and Arg604.
- the antibody or fragment thereof binds to one or more epitopes of anti-FXI and/or FXIa and the epitope comprises amino acid residues of Pro410, Arg413, Lys527 and six or more amino acid residues of Leu415, Cys416, His431 , Cys432, Tyr434, Gly435, Glu437, Tyr472, Lys473, Met474, Ala475, Glu476, Tyr521 , Arg522, Lys523, Leu524, Arg525, Asp526, Arg548, His552, Ser575, Ser594, Trp595, Gly596, Glu597, Arg602, Glu603, and Arg604.
- the antibody or fragment comprises a VH selected from the group consisting of SEQ ID NO: 9 and 29 or an amino acid sequence with 95% identity thereof; and a VL selected from the group consisting of SEQ ID NO: 19 and 39 or an amino acid sequence with 95% identity thereof.
- the antibody or fragment comprises a VH selected from the group consisting of SEQ ID NO: 9 and 29 or an amino acid sequence with 97% identity thereof; and a VL selected from the group consisting of SEQ ID NO: 19 and 39 or an amino acid sequence with 97% identity thereof.
- the antibody or fragment comprises a variable heavy chain selected from the group consisting of SEQ ID NO: 9 and 29; and variable light chain sequence selected from the group consisting of SEQ ID NO: 19 and 39.
- the antibody or fragment is selected from the group consisting of: (i) an antibody or fragment comprising a variable heavy chain of SEQ ID NO: 9 and a variable light chain sequence of SEQ ID NO: 19; (ii) an antibody or fragment comprising a variable heavy chain of SEQ ID NO: 29 and a variable light chain sequence of SEQ ID NO: 39; (iii) an antibody comprising a heavy chain comprising the amino acid sequence of SEQ ID NO: 29 and a light chain comprising the amino acid sequence of SEQ ID NO: 39; and (iv) an antibody comprising a heavy chain comprising the amino acid sequence of SEQ ID NO: 9 and a light chain comprising the amino acid sequence of SEQ ID NO: 19.
- the antibody or fragment comprises (i) a heavy chain variable region CDR1 comprises the amino acid sequence of SEQ ID NO: 46; CDR2 comprises the amino acid sequence of SEQ ID NO: 4; CDR3 comprises the amino acid sequence of SEQ ID NO: 5; and (ii) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 33; CDR2 comprising the amino acid sequence of SEQ ID NO: 14; and CDR3 comprising the amino acid sequence of SEQ ID NO: 15.
- the antibody or fragment comprises (i) a heavy chain variable region CDR1 selected from the group consisting of SEQ ID NO: 3 and 23; CDR2 selected from the group consisting of SEQ ID NO: 4 and 24; CDR3 selected from the group consisting of 5 and 25; and (ii) a light chain variable region CDR1 selected from the group consisting of SEQ ID NO: 13 and 33; CDR2 selected from the group consisting of SEQ ID NO: 14 and 34; and CDR3 selected from the group consisting of SEQ ID NO: 15 and 35.
- the antibody or fragment comprises (i) a heavy chain variable region CDR1 selected from the group consisting of SEQ ID NO: 6 and 26; CDR2 selected from the group consisting of SEQ ID NO: 7 and 27; CDR3 selected from the group consisting of 8 and 28; and (ii) a light chain variable region CDR1 selected from the group consisting of SEQ ID NO: 16 and 36; CDR2 selected from the group consisting of SEQ ID NO: 17 and 37; and CDR3 selected from the group consisting of SEQ ID NO: 18 and 38.
- the antibody or fragment comprises a heavy chain variable region CDR1 of SEQ ID NO: 3; a heavy chain variable region CDR2 of SEQ ID NO: 4; a heavy chain variable region CDR3 of SEQ ID NO: 5; a light chain variable region CDR1 of SEQ ID NO: 13; a light chain variable region CDR2 of SEQ ID NO: 14; and a light chain variable region CDR3 of SEQ ID NO: 15.
- the antibody or fragment comprises a heavy chain variable region CDR1 of SEQ ID NO: 23; a heavy chain variable region CDR2 of SEQ ID NO: 24; a heavy chain variable region CDR3 of SEQ ID NO: 25; a light chain variable region CDR1 of SEQ ID NO: 33; a light chain variable region CDR2 of SEQ ID NO: 34; and a light chain variable region CDR3 of SEQ ID NO: 35.
- the antibody or fragment comprises a heavy chain variable region CDR1 of SEQ ID NO: 6; a heavy chain variable region CDR2 of SEQ ID NO: 7; a heavy chain variable region CDR3 of SEQ ID NO: 8; a light chain variable region CDR1 of SEQ ID NO: 16; a light chain variable region CDR2 of SEQ ID NO: 17; and a light chain variable region CDR3 of SEQ ID NO: 18.
- the antibody or fragment comprises a heavy chain variable region CDR1 of SEQ ID NO: 26; a heavy chain variable region CDR2 of SEQ ID NO: 27; a heavy chain variable region CDR3 of SEQ ID NO: 28; a light chain variable region CDR1 of SEQ ID NO: 36; a light chain variable region CDR2 of SEQ ID NO: 37; and a light chain variable region CDR3 of SEQ ID NO: 38.
- any one of aspects 1 -30 wherein the antibody or fragment competes for binding to a human FXI and/or FXIa protein with an antibody comprising a variable heavy chain of SEQ ID NO: 9 and a variable light chain sequence of SEQ ID NO: 19 or an antibody comprising a variable heavy chain of SEQ ID NO: 29 and a variable light chain sequence of SEQ ID NO: 39.
- a method of managing or reducing bleeding or bleeding risk in a subject afflicted with end stage renal disease who has been treated or administered an anti-FXI/FXIa antibody or antigen-biniding fragment that binds within the catalytic domain of FXI and/or FXIa comprising the step of administering to the subject in need thereof, an anti-idiotype antibody or fragment thereof that specifically binds to the anti-FXI/FXIa antibody and blocks the anti-FXI/FXIa antibody from binding to FXI and/or FXIa, and wherein the anti-idiotype antibody or fragment thereof reverses the anticoagulant activity of the anti-FXI/FXIa antibody.
- a method of managing or reducing bleeding or bleeding risk in a subject afflicted with end stage renal disease who has been treated or administered an anti-FXI/FXIa antibody or antigen-biniding fragment that binds within the catalytic domain of FXI and/or FXIa comprises temporarily reversing of the anticoagulant effect for a sufficient time to manage the bleeding by one of the following: (i) fluid replacement using colloids, crystalloids, human plasma or plasma proteins such as albumin; (ii) transfusion with packed red blood or whole blood; or (iii) administration of fresh frozen plasma (FFP), prothrombin complex concentrates (PCC), activated PCC (APCC), such as, factor VIII inhibitor, and/or recombinant activated factor VII.
- FFP fresh frozen plasma
- PCC prothrombin complex concentrates
- APCC activated PCC
- anti-FXI/FXIa antibody or antigen-biniding fragment comprises a VH selected from the group consisting of SEQ ID NO: 9 and 29 or an amino acid sequence with 90% identity thereof; and a VL selected from the group consisting of SEQ ID NO: 19 and 39 or an amino acid sequence with 90% identity thereof.
- An antibody or antigen-binding fragment thereof that binds within the catalytic domain of FXI and/or FXIa, or a pharmaceutical composition comprising the antibody or antigen-binding fragment thereof, for use in preventing, treating or managing or reducing the risk of catheter-related thrombosis in a subject afflicated with end stage renal disease and initiated on hemodialysis with a catheter, wherein the antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 31 and a light chain comprising the amino acid sequence of SEQ ID NO: 41 .
- antibody or antigen-binding fragment thereof that binds within the catalytic domain of FXI and/or FXIa for the manufacture of a medicament for preventing, treating or managing or reducing the risk of stroke or thromboembolism in a subject afflicated with end stage renal disease, wherein the antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 31 and a light chain comprising the amino acid sequence of SEQ ID NO: 41 .
- an antibody or antigen-binding fragment thereof that binds within the catalytic domain of FXI and/or FXIa for the manufacture of a medicament for preventing or reducing the risk of stroke or thromboembolism in a subject afflicated with atrial fibrillation and end stage renal disease and who is undergoing dialysis, such as hemodialysis, wherein the antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 31 and a light chain comprising the amino acid sequence of SEQ ID NO: 41 .
- an antibody or antigen-binding fragment thereof that binds within the catalytic domain of FXI and/or FXIa for the manufacture of a medicament for preventing, treating or managing or reducing the risk of catheter-related thrombosis in a subject afflicated with end stage renal disease and initiated on hemodialysis with a catheter, wherein the antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 31 and a light chain comprising the amino acid sequence of SEQ ID NO: 41 .
- an antibody or antigen-binding fragment thereof that binds within the catalytic domain of FXI and/or FXIa for the manufacture of a medicament for preventing or reducing the risk of stroke or thromboembolism, such as systemic embolism, in a subject afflicated with atrial fibrillation, wherein the subject has a demonstrated high risk of bleeding which is characterized by a CHA 2 DS 2 VASc risk score > 2, and wherein the antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 31 and a light chain comprising the amino acid sequence of SEQ ID NO: 41 .
- the method of any one of aspects 1 -40 further comprises administering to the subject one or more therapeutically active agents.
- the one or more therapeutically active agents is selected from the group consisting of: thromboxane inhibitors (e.g., aspirin), adenosine diphosphate receptor antagonists (or P2Y12 inhibitors) such as the thienopyridines (e.g., clopidogrel and prasugrel) and the nonthienopyridines (e.g., ticagrelor and cangrelor), and protease-activated receptor-1 (PARI ) antagonists (e.g., Vorapaxar).
- thromboxane inhibitors e.g., aspirin
- adenosine diphosphate receptor antagonists or P2Y12 inhibitors
- P2Y12 inhibitors such as the thienopyridines (e.g., clopidogrel and prasugrel) and the nonthienopyridines (e.g., ticagrelor and cangrelor)
- PARI protease-activated receptor-1
- the one or more therapeutic active agents is a proton pump inhibitor (PPI) and wherein the subject has or has a history of a Gl disorder, such as previous Gl bleed or antecedent of peptic ulcer.
- PPI proton pump inhibitor
- the antibody or antigen-binding fragment thereof or a pharmaceutical composition according to any one of aspects 51 -64, which is for use in combination with one or more therapeutically active agents.
- the one or more therapeutically active agents is selected from the group consisting of: thromboxane inhibitors (e.g., aspirin), adenosine diphosphate receptor antagonists (or P2Y12 inhibitors) such as the thienopyridines (e.g., clopidogrel and prasugrel) and the nonthienopyridines (e.g., ticagrelor and cangrelor), and protease-activated receptor-1 (PARI ) antagonists (e.g., Vorapaxar).
- thromboxane inhibitors e.g., aspirin
- adenosine diphosphate receptor antagonists or P2Y12 inhibitors
- P2Y12 inhibitors such as the thienopyridines (e.g., clopidogrel and prasugrel) and the nonthienopyridines (e.g., ticagrelor and cangrelor)
- PARI protease-activated receptor-1
- a method of preventing, treating or managing or reducing the risk of stroke or thromboembolism, such as systemic embolism comprising administering to a subject in need thereof about 100 mg to about 250 mg of an anti-Factor XI (“FXI”) antibody or antigen-binding fragment thereof that specifically binds within the catalytic domain of FXI, wherein the subject has one, two, or more, or all, of the following characteristics: (i) Male and female subjects > 55 and ⁇ 85 years old;
- Atrial fibrillation AF
- atrial flutter as documented by
- anti-FXI antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 31 and a light chain comprising the amino acid sequence of SEQ ID NO: 41 .
- Factor XI protein refers to the Factor XI protein in different species.
- Factor XI is the mammalian plasma coagulation factor XI, a glycoprotein present in human plasma at a concentration of 25-30 nM as a zymogen that when converted by limited proteolysis to an active serine protease, participates in the intrinsic pathway of blood coagulation.
- FXIa protein refers to the activated FXI protein in different species.
- the zymogen Factor XI is converted into its active form, the coagulation factor XIa (FXIa), either via the contact phase of blood coagulation or through thrombin-mediated activation on the platelet surface.
- FXIa coagulation factor XIa
- an internal peptide bond is cleaved in each of the two chains, resulting in the activated factor XIa, a serine protease composed of two heavy and two light chains held together by disulfide bonds.
- This serine protease FXIa converts the coagulation Factor IX into IXa, which subsequently activates coagulation Factor X (Xa). Xa then can mediate coagulation Factor ll/Thrombin activation.
- human FXI has the sequence as set out in Table 1 (SEQ ID NO:1), and has been described in previous reports and literature (Mandle RJ Jr, et al. (1979) Blood;54(4):850; NCBI Reference Sequence: AAA51985).
- FXI and FXIa include mutants and variants of the natural FXI and FXIa protein, respectively, which have substantially the same amino acid sequence as that of the native primary structure (amino acid sequence) described in the above-mentioned reports.
- catalytic domain means amino acids Ile370 to Val607, as counted from the Glu1 at the N-terminus of the mature protein that is in circulation. It can also be described as residues 388-625 at the C-terminus of FXI.
- active site means the catalytic triad comprised of the amino acids His413, Asp462 and Se557. (Bane and Gailani (2014) Drug Disc. 19(9)).
- antibody as used herein means a whole antibody and any antigen binding fragment (i.e., "antigen-binding portion") or single chain thereof.
- a whole antibody is a glycoprotein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds. Each heavy chain is comprised of a heavy chain variable region
- VH a heavy chain constant region
- the heavy chain constant region is comprised of three domains, CH1 , CH2 and CH3.
- Each light chain is comprised of a light chain variable region (abbreviated herein as VL) and a light chain constant region.
- the light chain constant region is comprised of one domain, CL.
- the VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR).
- CDR complementarity determining regions
- Each VH and VL is composed of three CDRs and four FRs arranged from amino- terminus to carboxy-terminus in the following order: FR1 , CDR1 , FR2, CDR2, FR3, CDR3, FR4.
- the variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
- the constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system.
- an antibody can be a monoclonal antibody, human antibody, humanized antibody, camelised antibody, or chimeric antibody.
- Antibodies can be of any isotype (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., lgG1 , lgG2, lgG3, lgG4, lgA1 and lgA2) or subclass.
- isotype e.g., IgG, IgE, IgM, IgD, IgA and IgY
- class e.g., lgG1 , lgG2, lgG3, lgG4, lgA1 and lgA2 or subclass.
- antigen binding portion or "antigen binding fragment” of an antibody, as used herein, refers to one or more fragments of an intact antibody that retain the ability to specifically bind to a given antigen (e.g., Factor Xla (FXIa)).
- Antigen binding functions of an antibody can be performed by fragments of an intact antibody.
- binding fragments encompassed within the term antigen binding portion or antigen binding fragment of an antibody include a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; a F(ab) 2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; an Fd fragment consisting of the VH and CH1 domains; an Fv fragment consisting of the VL and VH domains of a single arm of an antibody; a single domain antibody (dAb) fragment (Ward et ai, 1989 Nature 341 :544-546), which consists of a VH domain or a VL domain; and an isolated complementarity determining region (CDR).
- Fab fragment a monovalent fragment consisting of the VL, VH, CL and CH1 domains
- F(ab) 2 fragment a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region
- an Fd fragment consisting of
- the two domains of the Fv fragment, VL and VH are coded for by separate genes, they can be joined, using recombinant methods, by an artificial peptide linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (known as single chain Fv (scFv); see, e.g., Bird et ai, 1988 Science 242:423-426; and Huston et al., 1988 Proc. Natl. Acad. Sci. 85:5879-5883).
- Such single chain antibodies include one or more antigen binding portions or fragments of an antibody. These antibody fragments are obtained using conventional techniques known to those of skill in the art, and the fragments are screened for utility in the same manner as are intact antibodies.
- Antigen binding fragments can also be incorporated into single domain antibodies, maxibodies, minibodies, intrabodies, diabodies, triabodies, tetrabodies, v-NAR and bis-scFv (see, e.g., Hollinger and Hudson, 2005, Nature Biotechnology, 23, 9, 1 126-1 136).
- Antigen binding portions of antibodies can be grafted into scaffolds based on polypeptides such as Fibronectin type III (Fn3) (see U.S. Pat. No. 6,703,199, which describes fibronectin polypeptide monobodies).
- Fn3 Fibronectin type III
- Antigen binding fragments can be incorporated into single chain molecules comprising a pair of tandem Fv segments (VH-CH1 -VH-CH1 ) which, together with complementary light chain polypeptides, form a pair of antigen binding regions (Zapata et al., 1995 Protein Eng. 8(10):1057-1062; and U.S. Pat. No. 5,641 ,870).
- affinity refers to the strength of interaction between antibody and antigen at single antigenic sites. Within each antigenic site, the variable region of the antibody “arm” interacts through weak non-covalent forces with antigen at numerous sites; the more interactions, the stronger the affinity.
- the term "high affinity" for an antibody or antigen binding fragments thereof generally refers to an antibody, or antigen binding fragment, having a K D of 10 "9 M or less (e.g., a K D of 10 "10 M or less, a K D of 10 "11 M or less, a K D of 10 "12 M or less, a K D of 10 "13 M or less, a K D of 10 "14 M or less, etc.).
- the term “amino acid” refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids.
- Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, v- carboxyglutamate, and O-phosphoserine.
- Amino acid analogs refer to compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e., an alpha carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid.
- Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions in a manner similar to a naturally occurring amino acid.
- binding specificity refers to the ability of an individual antibody combining site to react with only one antigenic determinant.
- an antibody e.g., a FXI and/or FXIa - binding antibody
- an antibody refers to a binding reaction that is determinative of the presence of a cognate antigen (e.g., a human FXI and/or FXIa or cynomolgus FXI and/or FXIa) in a heterogeneous population of proteins and other biologies.
- a cognate antigen e.g., a human FXI and/or FXIa or cynomolgus FXI and/or FXIa
- an antibody recognizing an antigen and “an antibody specific for an antigen” are used interchangeably herein with the term “an antibody which binds specifically to an antigen”.
- FXI and/or FXIa mediated refers to the fact that FXI and/or FXIa mediates the intrinsic and/or common coagulation pathways by directly or indirectly activating Factor IX (also known as FIX), Factor X (FX), and/or thrombin, and/or by binding to platelet receptors.
- Factor IX also known as FIX
- FX Factor X
- thrombin thrombin
- hemostasis represents the principal mechanisms for arresting the flow of blood at sites of injury and restoring vascular patency during wound healing, respectively.
- three mechanisms become activated simultaneously: primary hemostasis meaning the interactions of activated platelets with the vessel wall, the formation of fibrin, and a process termed as fibrinolysis.
- coagulation and coagulation cascade refer to the protein based system which serves to stabilize a clot that has formed to seal up a wound.
- the coagulation pathway is a proteolytic cascade.
- Each enzyme of the pathway is present in the plasma as a Zymogen (in an inactive form), which on activation undergoes proteolytic cleavage to release the active factor from the precursor molecule.
- the coagulation cascade functions as a series of positive and negative feedback loops which control the activation process.
- the ultimate goal of the pathway is to produce thrombin, which can then convert soluble fibrinogen into fibrin that forms a clot.
- the process of generation of thrombin can be divided into three phases: the intrinsic and extrinsic pathways, which provide alternative routes for the generation of an active clotting factor: FXa (Activated Factor-X), and the final common pathway, which results in thrombin formation (Hoffman M.M. and Monroe D.M. (2005) Curr Hematol Rep. 4:391 -396; Johne J, et al. (2006) Biol Chem. 387:173-178).
- FXa Active Factor-X
- Platelet aggregation refers to the process whereby when a break in a blood vessel occurs, substances are exposed that normally are not in direct contact with the blood flow. These substances (primarily collagen and von Willebrand factor) allow the platelets to adhere to the broken surface. Once a platelet adheres to the surface, it releases chemicals that attract additional platelets to the damaged area, referred to as platelet aggregation. These two processes are the first responses to stop bleeding.
- a "thromboembolic disorder,” or similar terms as used herein, refer to any number of conditions or diseases in which the intrinsic and/or common coagulation pathways are aberrantly activated or are not naturally deactivated (e.g., without therapeutic means). These conditions include but are not limited to thromboemolic stroke and other types of stroke of ischemicorigin, atrial fibrillation, stroke prevention in atrial fibrillation (SPAF), deep vein thrombosis, venous thromboembolism, and pulmonary embolism.
- thromboembolic disorder refer to any number of conditions or diseases in which the intrinsic and/or common coagulation pathways are aberrantly activated or are not naturally deactivated (e.g., without therapeutic means). These conditions include but are not limited to thromboemolic stroke and other types of stroke of ischemicorigin, atrial fibrillation, stroke prevention in atrial fibrillation (SPAF), deep vein thrombosis, venous thromboembolism, and pulmonary embolism.
- catheter-related thromobsis e.g., Hickman catheter in oncology patients
- ECMO extracorporeal membrane oxygenation
- a "thromboembolic,” or similar terms as used herein, can also refer to any number of the following, which the anti-FXI and/or FXIa antibodies or antigen binding fragments thereof of the present disclosure can be used to prevent or treat:
- SPAF atrial fibrillation
- PCI percutaneous coronary interventions
- VTE acute venous thromboembolic events
- - venous thrombosis this includes but not exclusively, treatment and secondary prevention of deep or superficial veins thrombosis in the lower members or upper member, thrombosis in the abdominal and thoracic veins, sinus thrombosis and thrombosis of jugular veins;
- any artificial surface in the veins or arteries like catheter, pacemaker wires, synthetic arterial grafts; mechanical or biological heart valves or left ventricular assist device;
- CTEPH Chronic Thromboembolic Pulmonary Hypertension
- thrombosis on ruptured atherosclerotic plaque thrombosis on intra-arterial prosthesis or catheter and thrombosis in apparently normal arteries, this includes but not limited to acute coronary syndromes, ST elevation myocardial infarction, non ST elevation myocardial infarction, unstable angina, stent thrombosis, thrombosis of any artificial surface in the arterial system and thrombosis of pulmonary arteries in subjects with or without pulmonary hypertension;
- PCI percutaneous coronary interventions
- cardiac thrombosis and thromboembolism this includes but not exclusively cardiac thrombosis after myocardial infarction, cardiac thrombosis related to condition such as cardiac aneurysm, myocardial fibrosis, cardiac enlargement and insufficiency, myocarditis and artificial surface in the heart;
- thrombophilia including but not exclusively factor V Leiden, prothrombin mutation, antithrombin III, protein C and protein S deficiencies, factor XIII mutation, familial dysfibrinogenemia, congenital deficiency of plasminogen, increased levels of factor XI, sickle cell disease, antiphospholipid syndrome, autoimmune disease, chronic bowel disease, nephrotic syndrome, hemolytic uremia, myeloproliferative disease, disseminated intra vascular coagulation, paroxysmal nocturnal hemoglobinuria and heparin induced
- chimeric antibody is an antibody molecule in which (a) the constant region, or a portion thereof, is altered, replaced or exchanged so that the antigen binding site (variable region) is linked to a constant region of a different or altered class, effector function and/or species, or an entirely different molecule which confers new properties to the chimeric antibody, e.g., an enzyme, toxin, hormone, growth factor, drug, etc.; or (b) the variable region, or a portion thereof, is altered, replaced or exchanged with a variable region having a different or altered antigen specificity.
- a mouse antibody can be modified by replacing its constant region with the constant region from a human immunoglobulin. Due to the replacement with a human constant region, the chimeric antibody can retain its specificity in recognizing the antigen while having reduced antigenicity in human as compared to the original mouse antibody.
- conservatively modified variants refers to those nucleic acids which encode identical or essentially identical amino acid sequences, or where the nucleic acid does not encode an amino acid sequence, to essentially identical sequences. Because of the degeneracy of the genetic code, a large number of functionally identical nucleic acids encode any given protein. For instance, the codons GCA, GCC, GCG and GCU all encode the amino acid alanine. Thus, at every position where an alanine is specified by a codon, the codon can be altered to any of the corresponding codons described without altering the encoded polypeptide.
- nucleic acid variations are "silent variations," which are one species of conservatively modified variations. Every nucleic acid sequence herein which encodes a polypeptide also describes every possible silent variation of the nucleic acid.
- each codon in a nucleic acid except AUG, which is ordinarily the only codon for methionine, and TGG, which is ordinarily the only codon for tryptophan
- TGG which is ordinarily the only codon for tryptophan
- conservatively modified variants include individual substitutions, deletions or additions to a polypeptide sequence which result in the substitution of an amino acid with a chemically similar amino acid. Conservative substitution tables providing functionally similar amino acids are well known in the art. Such conservatively modified variants are in addition to and do not exclude polymorphic variants, interspecies homologs, and alleles of the present disclosure.
- the following eight groups contain amino acids that are conservative substitutions for one another: 1) Alanine (A), Glycine (G); 2) Aspartic acid (D), Glutamic acid (E); 3) Asparagine (N), Glutamine (Q); 4) Arginine (R), Lysine (K); 5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W); 7) Serine (S), Threonine (T); and 8) Cysteine (C), Methionine (M) (see, e.g., Creighton, Proteins (1984)).
- the term "conservative sequence modifications” are used to refer to amino acid modifications that do not significantly affect or alter the binding characteristics of the antibody containing the amino acid sequence.
- epitope means a protein determinant capable of specific binding to an antibody.
- Epitopes usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three dimensional structural characteristics, as well as specific charge characteristics. Conformational and
- nonconformational epitopes are distinguished in that the binding to the former but not the latter is lost in the presence of denaturing solvents.
- Two antibodies are said to "compete” if one antibody is shown to bind the same epitope as the second antibody in a competitive binding assay, by any of the methods well known to those of skill in the art.
- human antibody is intended to include antibodies having variable regions in which both the framework and CDR regions are derived from sequences of human origin. Furthermore, if the antibody contains a constant region, the constant region also is derived from such human sequences, e.g., human germline sequences, or mutated versions of human germline sequences.
- the human antibodies of the present disclosure may include amino acid residues not encoded by human sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo).
- human monoclonal antibody refers to antibodies displaying a single binding specificity which have variable regions in which both the framework and CDR regions are derived from human sequences.
- the human monoclonal antibodies are prepared using phage display methods for screening libraries of human immunoglobulin genes.
- a “humanized” antibody is an antibody that retains the reactivity of a non-human antibody while being less immunogenic in humans. This can be achieved, for instance, by retaining the non-human CDR regions and replacing the remaining parts of the antibody with their human counterparts (i.e., the constant region as well as the framework portions of the variable region). See, e.g., Morrison et al., Proc. Natl. Acad. Sci. USA, 81 :6851 -6855, 1984; Morrison and Oi, Adv. Immunol., 44:65-92, 1988; Verhoeyen et al., Science, 239:1534-1536, 1988; Padlan, Molec.
- Two sequences are "substantially identical” if two sequences have a specified percentage of amino acid residues or nucleotides that are the same (i.e., 60% identity, optionally 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identity over a specified region, or, when not specified, over the entire sequence), when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection.
- the identity exists over a region that is at least about 50 nucleotides (or 10 amino acids) in length, or more preferably over a region that is 100 to 500 or 1000 or more nucleotides (or 20, 50, 200 or more amino acids) in length.
- sequence comparison typically one sequence acts as a reference sequence, to which test sequences are compared.
- test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated.
- sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
- a “comparison window”, as used herein, includes reference to a segment of any one of the number of contiguous positions selected from the group consisting of from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned.
- Methods of alignment of sequences for comparison are well known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith and Waterman (1970) Adv. Appl. Math. 2:482c, by the homology alignment algorithm of Needleman and Wunsch, J. Mol. Biol.
- BLAST and BLAST 2.0 algorithms Two examples of algorithms that are suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al., (1977) Nuc. Acids Res. 25:3389-3402; and Altschul et al., (1990) J. Mol. Biol. 215:403-410, respectively.
- Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information. This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold (Altschul et ai, supra).
- initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them.
- the word hits are extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always > 0) and N (penalty score for mismatching residues; always ⁇ 0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached.
- the BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment.
- the BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin and Altschul, Proc. Natl. Acad. Sci. USA 90:5873-5787, 1993).
- One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance.
- P(N) the smallest sum probability
- a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.2, more preferably less than about 0.01 , and most preferably less than about 0.001 .
- the percent identity between two amino acid sequences can also be determined using the algorithm of E. Meyers and W. Miller (Comput. Appl. Biosci., 4:1 1 -17, 1988) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
- the percent identity between two amino acid sequences can be determined using the Needleman and Wunsch (J. Mol, Biol.
- a polypeptide is typically substantially identical to a second polypeptide, for example, where the two peptides differ only by conservative substitutions.
- Another indication that two nucleic acid sequences are substantially identical is that the two molecules or their complements hybridize to each other under stringent conditions, as described below.
- Yet another indication that two nucleic acid sequences are substantially identical is that the same primers can be used to amplify the sequence.
- isolated antibody refers to an antibody that is substantially free of other antibodies having different antigenic specificities (e.g., an isolated antibody that specifically binds FXI and/or FXIa is substantially free of antibodies that specifically bind antigens other than FXI and/or FXIa).
- An isolated antibody that specifically binds FXI and/or FXIa may, however, have cross-reactivity to other antigens.
- an isolated antibody may be substantially free of other cellular material and/or chemicals.
- isotype refers to the antibody class (e.g., IgM, IgE, IgG such as lgG1 or lgG4) that is provided by the heavy chain constant region genes. Isotype also includes modified versions of one of these classes, where modifications have been made to alter the Fc function, for example, to enhance or reduce effector functions or binding to Fc receptors.
- K asS oc or "k a ", as used herein, is intended to refer to the association rate of a particular antibody-antigen interaction
- k dis or "k d ,” as used herein, is intended to refer to the dissociation rate of a particular antibody-antigen interaction
- K D is intended to refer to the dissociation constant, which is obtained from the ratio of k d to k a (i.e. k d /k a ) and is expressed as a molar concentration (M).
- K D values for antibodies can be determined using methods well established in the art. Methods for determining the K D of an antibody include measuring surface plasmon resonance using a biosensor system such as a BIACORETM system, or measuring affinity in solution by solution equilibrium titration (SET).
- monoclonal antibody or “monoclonal antibody composition” as used herein refer to a preparation of antibody molecules of single molecular composition.
- a monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope.
- nucleic acid is used herein interchangeably with the term “polynucleotide” and refers to deoxyribonucleotides or ribonucleotides and polymers thereof in either single- or double-stranded form.
- the term encompasses nucleic acids containing known nucleotide analogs or modified backbone residues or linkages, which are synthetic, naturally occurring, and non-naturally occurring, which have similar binding properties as the reference nucleic acid, and which are metabolized in a manner similar to the reference nucleotides.
- Examples of such analogs include, without limitation, phosphorothioates, phosphoramidates, methyl phosphonates, chiral-methyl phosphonates, 2-O-methyl ribonucleotides, peptide-nucleic acids (PNAs).
- nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions) and complementary sequences, as well as the sequence explicitly indicated.
- degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et ai, Nucleic Acid Res. 19:5081 , 1991 ; Ohtsuka ef a/., J. Biol. Chem. 260:2605-2608, 1985; and Rossolini et al., Mol. Cell. Probes 8:91 -98, 1994).
- operably linked refers to a functional relationship between two or more polynucleotide (e.g., DNA) segments.
- the term refers to the functional relationship of a transcriptional regulatory sequence to a transcribed sequence.
- a promoter or enhancer sequence is operably linked to a coding sequence if it stimulates or modulates the transcription of the coding sequence in an appropriate host cell or other expression system.
- promoter transcriptional regulatory sequences that are operably linked to a transcribed sequence are physically contiguous to the transcribed sequence, i.e., they are cis-acting.
- some transcriptional regulatory sequences, such as enhancers need not be physically contiguous or located in close proximity to the coding sequences whose transcription they enhance.
- the term, "optimized" means that a nucleotide sequence has been altered to encode an amino acid sequence using codons that are preferred in the production cell or organism, generally a eukaryotic cell, for example, a cell of Pichia, a Chinese Hamster Ovary cell (CHO) or a human cell.
- the optimized nucleotide sequence is engineered to retain completely or as much as possible the amino acid sequence originally encoded by the starting nucleotide sequence, which is also known as the "parental" sequence.
- the optimized sequences herein have been engineered to have codons that are preferred in mammalian cells. However, optimized expression of these sequences in other eukaryotic cells or prokaryotic cells is also envisioned herein.
- the amino acid sequences encoded by optimized nucleotide sequences are also referred to as optimized.
- polypeptide and "protein” are used interchangeably herein to refer to a polymer of amino acid residues.
- the terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymer. Unless otherwise indicated, a particular polypeptide sequence also implicitly encompasses conservatively modified variants thereof.
- recombinant human antibody includes all human antibodies that are prepared, expressed, created or isolated by recombinant means, such as antibodies isolated from an animal (e.g., a mouse) that is transgenic or transchromosomal for human immunoglobulin genes or a hybridoma prepared therefrom, antibodies isolated from a host cell transformed to express the human antibody, e.g., from a transfectoma, antibodies isolated from a recombinant, combinatorial human antibody library, and antibodies prepared, expressed, created or isolated by any other means that involve splicing of all or a portion of a human immunoglobulin gene, sequences to other DNA sequences.
- Such recombinant human antibodies have variable regions in which the framework and CDR regions are derived from human germline immunoglobulin sequences.
- such recombinant human antibodies can be subjected to in vitro mutagenesis (or, when an animal transgenic for human Ig sequences is used, in vivo somatic mutagenesis) and thus the amino acid sequences of the VH and VL regions of the recombinant antibodies are sequences that, while derived from and related to human germline VH and VL sequences, may not naturally exist within the human antibody germline repertoire in vivo.
- recombinant host cell refers to a cell into which a recombinant expression vector has been introduced. It should be understood that such terms are intended to refer not only to the particular subject cell but to the progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term “host cell” as used herein.
- subject includes human and non-human animals.
- Non-human animals include all vertebrates (e.g.: mammals and non-mammals) such as, non-human primates (e.g.: cynomolgus monkey), sheep, rabbit, dog, cow, chickens, amphibians, and reptiles. Except when noted, the terms “patient” or “subject” are used herein interchangeably.
- cyno or “cynomolgus” refer to the cynomolgus monkey (Macaca fascicularis). In specific aspects, a patient or subject is a human.
- the term “treating” or “treatment” of any disease or disorder refers in one embodiment, to ameliorating the disease or disorder (i.e., slowing or arresting or reducing the development of the disease or at least one of the clinical symptoms thereof).
- “treating” or “treatment” refers to alleviating or ameliorating at least one physical parameter including those which may not be discernible by the patient.
- “treating” or “treatment” refers to modulating the disease or disorder, either physically, (e.g., stabilization of a discernible symptom), physiologically, (e.g., stabilization of a physical parameter), or both.
- “treating” or “treatment” refers to preventing or delaying the onset or development or progression of the disease or disorder. "Prevention" as it relates to indications described herein, including, e.g., a thromboembolic disorder)
- thromboembolic disorder means any action that prevents or slows a worsening in e.g., a thromboembolic disease parameters, as described below, in a patient at risk for said worsening.
- vector is intended to refer to a polynucleotide molecule capable of transporting another polynucleotide to which it has been linked.
- plasmid refers to a circular double stranded DNA loop into which additional DNA segments may be ligated.
- viral vector such as an adeno- associated viral vector (AAV, or AAV2), wherein additional DNA segments may be ligated into the viral genome.
- AAV adeno- associated viral vector
- Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors).
- vectors e.g., non-episomal mammalian vectors
- vectors can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome.
- certain vectors are capable of directing the expression of genes to which they are operatively linked.
- Such vectors are referred to herein as "recombinant expression vectors" (or simply, "expression vectors”).
- expression vectors of utility in recombinant DNA techniques are often in the form of plasmids.
- plasmid and vector may be used interchangeably as the plasmid is the most commonly used form of vector.
- the present disclosure is intended to include such other forms of expression vectors, such as viral vectors (e.g., replication defective retroviruses, adenoviruses and adeno-associated viruses), which serve equivalent functions.
- Figures 1A-C show the effect of NOV1401 on FeCI 3 -induced thrombosis in FXI -/" mice reconstituted with human FXI protein. NOV1401 dose-dependently inhibited thrombosis. The antibody prolonged aPTT to the same extent as in untreated FXI _/" mice.
- a single dose of 3 mg/kg led to ⁇ 2x aPTT that was maintained for 5-6 weeks. All doses tested prolonged aPTT to a similar extent, and the higher doses tested did not seem to increase the magnitude of aPTT prolongation observed at the 3 mg/kg dose.
- a single dose of 3 mg/kg reduced free FXI by approximately 90% for 5-6 weeks. All doses tested reduced free FXI to a similar extent, and the higher doses tested did not seem to increase the magnitude of reduction of free FXI observed at the 3 mg/kg dose.
- Figures 4A-C show compound response curves of an anti-FXI/FXIa antibody.
- Figure 4A shows inhibition of Factor Xla activity by NOV1401 .
- the assay measures the cleavage of a fluorescently labelled peptide as is described in example 2.
- y A2+ (A1- A2)/ (1 + (x IC50) A p)
- y is the %-inhibition at the inhibitor concentration
- x is the lowest inhibition value
- A2 the maximum inhibition value.
- FIG. 4B shows an aPTT compound response curve.
- the assay measures the time to coagulation after initiating the intrinsic clotting cascade in presence of different concentrations of NOV1401 , as described in Example 3.
- the black line represents a fit using a logistics non-linear fit model.
- the dotted line represents the baseline coagulation time of pooled human plasma in absence of NOV1401 .
- the baseline coagulation time is 32.3 seconds, and is indicated with a grey dashed line in the graph.
- FIG. 4C shows a TGA response curve. A representative compound response curve of antibody NOV1401 inhibiting thrombin generation in the TGA with pooled human plasma is shown. The assay measures the effects of different
- thrombin ⁇ FXIa feed-forward loop that can be triggered by very low tissue factor (TF) concentrations as described in Example 3.
- the black line represents a fit using a four- parameter dose-response curve model.
- the dotted line represents the residual thrombin concentration due to thrombin generation induced by small amounts of TF.
- An IC 50 value of 24 nM and a residual thrombin concentration of 159 nM (dotted line) were calculated for this compound response curve.
- Figure 5A shows the effect on aPTT, measured on study days 2, 23, and 79. aPTT increased by 2.1 - to 3-fold in all animals receiving NOV1401 and remained elevated throughout the dosing phase of the study. No dose-dependency was observed and no gender-related differences were noted.
- Figure 5B shows the effect on FXI:C, measured on study days 2, 23 and 79 and depicted as percent of plasma FXI activity.
- FXI:C decreased in all animals receiving NOV1401 to levels of 5-12% and remained at these levels throughout the dosing phase of the study. No dose-dependency was observed and no gender-related differences were noted.
- the present disclosure is based, in part, on the discovery of antibody molecules (e.g., NOV1090 or NOV1401) that specifically bind to FXIa and inhibit its biological activities for use in preventing or reducing the risk of thrombosis or thromboembolism, such as stroke, in subjects with ESRD, such as subjects with ESRD undergoing hemodialysis.
- antibody molecules e.g., NOV1090 or NOV1401
- such subjects are at high risk of bleeding.
- the present disclosure relates to uses of both full IgG format antibodies (e.g., human antibodies) as well as antigen binding fragments thereof, such as Fab fragments (e.g., antibodies NOV1090 and NOV1401 ).
- full IgG format antibodies e.g., human antibodies
- antigen binding fragments thereof such as Fab fragments (e.g., antibodies NOV1090 and NOV1401 ).
- FXI holds important roles in both intrinsic and extrinsic coagulation pathways and in bridging the initiation and amplification phases of plasmatic hemostasis. Both Factor Xlla and thrombin can activate FXI, resulting in a sustained thrombin generation and fibrinolysis inhibition. FXI plays a minor role in normal hemostasis in a high tissue factor environment "after vessel injury" whereas it appears to play a key role in thrombosis. Severe Factor XI deficiency is associated with a lower incidence of ischemic stroke and venous
- Bleeding manifestations in subjects with severe factor XI deficiency are infrequent, often mild, injury-induced and affect preferably tissues with increased fibrinolytic activity such as the oral mucosa, nasal mucosa and urinary tract (Salomon et al 201 1).
- Plasma coagulation is a sequential process by which coagulation factors in the blood interact and are activated, ultimately resulting in fibrin generation and clot formation.
- the process of fibrin generation can be initiated by two distinct pathways, i.e., the intrinsic and the extrinsic pathway, respectively (Mackman, 2008).
- TF extravascular tissue factor
- FVII factor VII
- the active thrombin ultimately converts soluble fibrinogen into fibrin.
- the extrinsic pathway is central for hemostasis, interfering with coagulation factors in this pathway results in a risk of bleeding.
- factor XII may in some cases be activated by a process referred to as contact activation.
- Generation of activated factor Xlla leads to the sequential activations of factor XI and factor IX.
- factor IXa activates factor X
- the extrinsic and intrinsic pathways converge at this stage (at the common pathway).
- Thrombin activity is boosted by amplifying its own generation through a feed-forward loop in which thrombin activates factor XI independently of factor XII.
- This feed-forward loop contributes to sustained thrombus growth but is only minimally involved in hemostasis, as the strong activation by extravascular tissue factor is sufficient to clot formation.
- the intrinsic pathway therefore is not substantially involved in hemostasis (Gailani and Renne (2007) Arterioscler Thromb Vase Biol. 2007, 27(12):2507-13, Muller, Gailiani, and Renne 201 1).
- FXI-/- mice are resistant to experimental venous (Wang, et al. (2006) J Thromb Haemost; 4:1982-8) and arterial (Wang, et al. (2005) J Thromb Haemost; 3:695-702) thrombosis.
- Treatment of mice with an antibody (Ab, 14E1 1) that blocks the activation of FXI by FXIIa resulted in inhibition of experimental thrombosis (Cheng, et al. (2010) Blood, 1 16:3981 -9) and reduced cerebral infarct size in a mouse model of ischemic stroke (Leung, et al.
- the present disclosure provides antibodies that specifically bind to FXI and/or FXIa for use in treating, preventing or reducing the risk of thrombosis or thromboembolism, such as stroke.
- the present disclosure provides antibodies that specifically bind to human, rabbit, and cynomolgus monkey FXI and/or FXIa.
- Antibodies of the present disclosure include, but are not limited to, the human monoclonal antibodies and Fabs, isolated as described in the Examples.
- the present disclosure provides antibodies that specifically bind a FXI and/or FXIa protein (e.g., human, rabbit, and cynomolgus monkey FXI and/or FXIa), wherein the antibodies comprise a VH domain having an amino acid sequence of SEQ ID NOs: 9 and 29.
- the present disclosure also provides antibodies that specifically bind to a FXI and/or FXIa protein, wherein the antibodies comprise a VH CDR having an amino acid sequence of any one of the VH CDRs listed in Table 1 , infra.
- the present disclosure provides antibodies that specifically bind to an FXI and/or FXIa protein (e.g., human, rabbit, and cynomolgus monkey FXI and/or FXIa), wherein the antibodies comprise (or alternatively, consist of) one, two, three, or more VH CDRs having an amino acid sequence of any of the VH CDRs listed in Table 1 , infra, (see PCT International Patent Application No.
- FXI and/or FXIa protein e.g., human, rabbit, and cynomolgus monkey FXI and/or FXIa
- the antibodies comprise (or alternatively, consist of) one, two, three, or more VH CDRs having an amino acid sequence of any of the VH CDRs listed in Table 1 , infra, (see PCT International Patent Application No.
- the present disclosure provides antibodies that specifically bind to a FXIa protein, said antibodies comprising a VL domain having an amino acid sequence of SEQ ID NOs: 19 or 39, for use in the methods described herein (e.g., methods for reducing the risk of stroke and/or systemic embolism in subjects with ESRD and/or AF).
- the present disclosure also provides antibodies that specifically bind to an FXI and/or FXIa protein (e.g., human, rabbit, and cynomolgus monkey FXI and/or FXIa), said antibodies comprising a VL CDR having an amino acid sequence of any one of the VL CDRs listed in Table 1 , infra, for use in the methods described herein (e.g., methods for reducing the risk of stroke and/or systemic embolism in subjects with ESRD and/or AF).
- FXI and/or FXIa protein e.g., human, rabbit, and cynomolgus monkey FXI and/or FXIa
- VL CDR having an amino acid sequence of any one of the VL CDRs listed in Table 1 , infra
- the present disclosure provides antibodies that specifically bind to an FXIa protein (e.g., human, rabbit, and cynomolgus monkey FXI and/or FXIa), said antibodies comprising (or alternatively, consisting of) one, two, three or more VL CDRs having an amino acid sequence of any of the VL CDRs listed in Table 1 , infra.
- an FXIa protein e.g., human, rabbit, and cynomolgus monkey FXI and/or FXIa
- said antibodies comprising (or alternatively, consisting of) one, two, three or more VL CDRs having an amino acid sequence of any of the VL CDRs listed in Table 1 , infra.
- antibodies for use in the methods described herein include amino acids that have been mutated, yet have at least 60, 70, 80, 85, 90 or 95 percent identity in the CDR regions with the CDR regions depicted in the sequences described in Table 1 . In some embodiments, it includes mutant amino acid sequences wherein no more than 1 , 2, 3, 4 or 5 amino acids have been mutated in the CDR regions when compared with the CDR regions depicted in the sequence described in Table 1 .
- HCDR1 (Rabat) TAA
- HCDR2 (Rabat) 4 GISGSGSSTYYADSVRG
- HCDR3 (IMGT) 45 ARELSYLYSGYYFDY
- VL 19 DIVLTQPPSVSGAPGQRVTISCSGSSSNIGSNDVSWYQQLPGT
- HCDR2 (Rabat) 24 GISGSGSSTYYADSVRG
- HCDR3 (IMGT) 45 ARELSYLYSGYYFDY
- VL 39 QSVLTQPPSASGTPGQRVTISCSGSSSNIGSNDVSWYQQLPGT
- antibodies for use in the methods described herein include those where the amino acids or nucleic acids encoding the amino acids have been mutated, yet have at least 60, 65, 70, 75, 80, 85, 90, or 95 percent identity to the sequences described in Table 1 .
- Some embodiments include mutant amino acid sequences wherein no more than 1 , 2, 3, 4 or 5 amino acids have been mutated in the variable regions when compared with the variable regions depicted in the sequence described in Table 1 , while retaining substantially the same antigen binding activity.
- each of these antibodies can bind to FXI and/or FXIa
- the VH, VL, full length light chain, and full length heavy chain sequences (amino acid sequences and the nucleotide sequences encoding the amino acid sequences) can be "mixed and matched" to create other FXI and/or FXIa-binding antibodies of the present disclosure.
- Such "mixed and matched" FXI and/or FXIa-binding antibodies can be tested using the binding assays known in the art (e.g., ELISAs, and other assays described in the Example section). When these chains are mixed and matched, a VH sequence from a particular VH/VL pairing should be replaced with a structurally similar VH sequence.
- a full length heavy chain sequence from a particular full length heavy chain / full length light chain pairing should be replaced with a structurally similar full length heavy chain sequence.
- a VL sequence from a particular VH/VL pairing should be replaced with a structurally similar VL sequence.
- a full length light chain sequence from a particular full length heavy chain / full length light chain pairing should be replaced with a structurally similar full length light chain sequence.
- the present disclosure provides an isolated antibody or antigen binding region thereof having: a heavy chain variable domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 9 and 29, and a light chain variable domain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 19 and 39, wherein the antibody specifically binds to FXI and/or FXIa (e.g., human, rabbit, and cynomolgus monkey FXIa).
- FXI and/or FXIa e.g., human, rabbit, and cynomolgus monkey FXIa
- the present disclosure provides an isolated antibody or antigen binding region thereof having a heavy chain variable domain and a light chain variable domain comprising amino acid sequences selected from SEQ ID NOs: 9 and 29; or 19 and 39, respectively.
- an antibody or antigen binding fragment thereof provided herein which specifically binds to human FXI and/or FXIa, comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 9, and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 19.
- an antibody or antigen binding fragment thereof provided herein which specifically binds to human FXI and/or FXIa, comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 29, and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 39.
- the present disclosure provides (i) an isolated antibody having: a full length heavy chain comprising an amino acid sequence that has been optimized for expression in a mammalian cell selected from the group consisting of SEQ ID NOs: 1 1 or 31 , and a full length light chain comprising an amino acid sequence that has been optimized for expression in a mammalian cell selected from the group consisting of SEQ ID NOs: 21 or 41 ; or (ii) a functional protein comprising an antigen binding portion thereof. More specifically, in certain aspects, the present disclosure provides an isolated antibody or antigen binding region thereof having a heavy chain and a light chain comprising amino acid sequences selected from SEQ ID NOs: 1 1 and 31 ; or 19 and 39, respectively.
- an antibody or antigen binding fragment thereof provided herein which specifically binds to human FXI and/or FXIa comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 1 1 , and a light chain comprising the amino acid sequence of SEQ ID NO: 21 .
- an antibody or antigen binding fragment thereof provided herein which specifically binds to human FXI and/or FXIa comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 31 , and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 41 .
- CDR complementarity determining region
- the CDR amino acid residues of antibody NOV1090 in the heavy chain variable domain (VH) are numbered 31 -35 (HCDR1), 50-66 (HCDR2), and 99- 1 1 1 (HCDR3); and the CDR amino acid residues in the light chain variable domain (VL) are numbered 22-35 (LCDR1), 51 -57 (LCDR2), and 90-100 (LCDR3).
- the CDR amino acids in the VH are numbered 26-32 (HCDR1 ), 52-57 (HCDR2), and 99-1 1 1 (HCDR3); and the amino acid residues in VL are numbered 25-33 (LCDR1), 51 -53 (LCDR2), and 92-99 (LCDR3).
- the CDRs consist of amino acid residues 26-35 (HCDR1), 50-66 (HCDR2), and 99-1 1 1 (HCDR3) in human VH and amino acid residues 22-35 (LCDR1), 51 -57 (LCDR2), and 90-100 (LCDR3) in human VL.
- the "Combined" CDRs consist of amino acid residues 26-35 (HCDR1), 50-66 (HCDR2), and 99-108 (HCDR3) in human VH and amino acid residues 24-38 (LCDR1), 54-60 (LCDR2), and 93-101 (LCDR3) in human VL.
- the CDR amino acid residues in the heavy chain variable domain (VH) are numbered 26-33 (HCDR1), 51 -58 (HCDR2), and 97-108 (HCDR3); and the CDR amino acid residues in the light chain variable domain (VL) are numbered 27-36 (LCDR1), 54-56 (LCDR2), and 93-101 (LCDR3).
- Table 1 provides exemplary Kabat, Chothia, Combined, and IMGT HCDR1 , HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3 for anti- FXI/FXIa antibodies, e.g., NOV1090 and NOV1401 .
- the present disclosure provides FXIa binding antibodies that comprise the heavy chain and light chain CDR1 s, CDR2s, and CDR3s as described in Table 1 , or combinations thereof.
- the amino acid sequences of the VH CDR1 s of the antibodies are shown in SEQ ID NOs: 3 and 23.
- the amino acid sequences of the VH CDR2s of the antibodies and are shown in SEQ ID NOs: 4 and 24.
- the amino acid sequences of the VH CDR3s of the antibodies are shown in SEQ ID NOs: 5 and 25.
- the amino acid sequences of the VL CDR1 s of the antibodies are shown in SEQ ID NOs: 13 and 33.
- the amino acid sequences of the VL CDR2s of the antibodies are shown in SEQ ID NOs: 14 and 34.
- the amino acid sequences of the VL CDR3s of the antibodies are shown in SEQ ID NOs: 15 and 35.
- the amino acid sequences of the VH CDR1 s of the antibodies are shown in SEQ ID NOs: 6 and 26.
- the amino acid sequences of the VH CDR3s of the antibodies are shown in SEQ ID NOs: 8 and 28.
- the amino acid sequences of the VL CDR1 s of the antibodies are shown in SEQ ID NOs: 16 and 36.
- the amino acid sequences of the VL CDR2s of the antibodies are shown in SEQ ID NOs: 17 and 37.
- the amino acid sequences of the VL CDR3s of the antibodies are shown in SEQ ID NOs: 18 and 38.
- the amino acid sequences of the VH CDR1 of the antibodies are shown in SEQ ID NO: 46.
- the amino acid sequences of the VH CDR2 of the antibodies are shown in SEQ ID NO: 4.
- the amino acid sequences of the VH CDR3 of the antibodies are shown in SEQ ID NO: 5.
- the amino acid sequences of the VL CDR1 of the antibodies are shown in SEQ ID NO: 33.
- the amino acid sequences of the VL CDR2 of the antibodies are shown in SEQ ID NO: 14.
- the amino acid sequences of the VL CDR3 of the antibodies are shown in SEQ ID NO: 15.
- the amino acid sequences of the VH CDR1 of the antibodies are shown in SEQ ID NO: 43.
- the amino acid sequences of the VH CDR3 of the antibodies are shown in SEQ ID NO: 45.
- the amino acid sequences of the VL CDR1 of the antibodies are shown in SEQ ID NO: 47.
- the amino acid sequences of the VL CDR2 of the antibodies are shown in SEQ ID NO: 37.
- the amino acid sequences of the VL CDR3 of the antibodies are shown in SEQ ID NO: 15.
- VH CDR1 , 2 and 3 sequences and VL CDR1 , 2 and 3 sequences can be "mixed and matched" (i.e., CDRs from different antibodies can be mixed and matched, although each antibody preferably contains a VH CDR1 , 2 and 3 and a VL CDR1 , 2 and 3 to create other FXI and/or FXIa binding molecules of the present disclosure.
- Such “mixed and matched" FXI and/or FXIa binding antibodies can be tested using the binding assays known in the art and those described in the Examples (e.g., ELISAs, SET, BIACORETM assays).
- VH CDR sequences are mixed and matched, the CDR1 , CDR2 and/or CDR3 sequence from a particular VH sequence should be replaced with a structurally similar CDR sequence(s).
- VL CDR sequences are mixed and matched, the CDR1 , CDR2 and/or CDR3 sequence from a particular VL sequence should be replaced with a structurally similar CDR sequence(s).
- the antigen binding fragments of the antibodies described herein can comprise a VH CDR1 , 2, and 3, or a VL CDR 1 , 2, and 3, wherein the fragment binds to FXI and/or FXIa as a single variable domain.
- the antibodies or antigen binding fragments thereof may have the heavy and light chain sequences of the Fabs described in Table 1 . More specifically, the antibody or antigen binding fragments thereof may have the heavy and light sequence of NOV1090 and NOV1401 .
- the antibody or antigen binding fragment in that specifically binds FXI and/or FXIa comprises a heavy chain variable region CDR1 , a heavy chain variable region CDR2, a heavy chain variable region CDR3, a light chain variable region CDR1 , a light chain variable region CDR2, and a light chain variable region CDR3 as defined by Kabat and described in Table 1 .
- the antibody or antigen binding fragment in that specifically binds FXI and/or FXIa comprises a heavy chain variable region CDR1 , a heavy chain variable region CDR2, a heavy chain variable region CDR3, a light chain variable region CDR1 , a light chain variable region CDR2, and a light chain variable region CDR3 as defined by Chothia and described in Table 1 .
- the antibody or antigen binding fragment in that specifically binds FXI and/or FXIa comprises a heavy chain variable region CDR1 , a heavy chain variable region CDR2, a heavy chain variable region CDR3, a light chain variable region CDR1 , a light chain variable region CDR2, and a light chain variable region CDR3 as defined by the Combined system and described in Table 1 .
- the antibody or antigen binding fragment in that specifically binds FXI and/or FXIa comprises a heavy chain variable region CDR1 , a heavy chain variable region CDR2, a heavy chain variable region CDR3, a light chain variable region CDR1 , a light chain variable region CDR2, and a light chain variable region CDR3 as defined by IMGT and described in Table 1 .
- the present disclosure includes an antibody that specifically binds to FXI and/or FXIa comprising a heavy chain variable region CDR1 of SEQ ID NO: 3; a heavy chain variable region CDR2 of SEQ ID NO: 4; a heavy chain variable region CDR3 of SEQ ID NO: 5; a light chain variable region CDR1 of SEQ ID NO: 13; a light chain variable region CDR2 of SEQ ID NO: 14; and a light chain variable region CDR3 of SEQ ID NO: 15.
- the present disclosure includes an antibody that specifically binds to FXI and/or FXIa comprising a heavy chain variable region CDR1 of SEQ ID NO: 23; a heavy chain variable region CDR2 of SEQ ID NO: 24; a heavy chain variable region CDR3 of SEQ ID NO: 25; a light chain variable region CDR1 of SEQ ID NO: 33; a light chain variable region CDR2 of SEQ ID NO: 34; and a light chain variable region CDR3 of SEQ ID NO: 35.
- the present disclosure includes an antibody that specifically binds to FXI and/or FXIa comprising a heavy chain variable region CDR1 of SEQ ID NO: 6; a heavy chain variable region CDR2 of SEQ ID NO: 7; a heavy chain variable region CDR3 of SEQ ID NO: 8; a light chain variable region CDR1 of SEQ ID NO: 16; a light chain variable region CDR2 of SEQ ID NO: 17; and a light chain variable region CDR3 of SEQ ID NO: 18.
- the present disclosure includes an antibody that specifically binds to FXI and/or FXIa comprising a heavy chain variable region CDR1 of SEQ ID NO: 26; a heavy chain variable region CDR2 of SEQ ID NO: 27; a heavy chain variable region CDR3 of SEQ ID NO: 28; a light chain variable region CDR1 of SEQ ID NO: 36; a light chain variable region CDR2 of SEQ ID NO: 37; and a light chain variable region CDR3 of SEQ ID NO: 38.
- an antibody that specifically binds to FXI and/or FXIa comprising a heavy chain variable region CDR1 of SEQ ID NO: 43; a heavy chain variable region CDR2 of SEQ ID NO: 44; a heavy chain variable region CDR3 of SEQ ID NO: 45; a light chain variable region CDR1 of SEQ ID NO: 47; a light chain variable region CDR2 of SEQ ID NO: 37 and a light chain variable region CDR3 of SEQ ID NO: 15.
- an antibody that specifically binds to FXI and/or FXIa comprising a heavy chain variable region CDR1 of SEQ ID NO: 46; a heavy chain variable region CDR2 of SEQ ID NO: 4; a heavy chain variable region CDR3 of SEQ ID NO: 5; a light chain variable region CDR1 of SEQ ID NO: 33; a light chain variable region CDR2 of SEQ ID NO: 14 and a light chain variable region CDR3 of SEQ ID NO: 15.
- the present disclosure includes antibodies or antigen binding fragments that specifically bind to FXI and/or FXIa as described in Table 1 .
- the antibody, or antigen binding fragment, that binds FXI and/or FXIa is NOV1090 and NOV1401 .
- a human antibody comprises heavy or light chain variable regions or full length heavy or light chains that are "the product of or "derived from” a particular germline sequence if the variable regions or full length chains of the antibody are obtained from a system that uses human germline immunoglobulin genes.
- Such systems include immunizing a transgenic mouse carrying human immunoglobulin genes with the antigen of interest or screening a human immunoglobulin gene library displayed on phage with the antigen of interest.
- a human antibody that is "the product of or "derived from” a human germline immunoglobulin sequence can be identified as such by comparing the amino acid sequence of the human antibody to the amino acid sequences of human germline immunoglobulins and selecting the human germline immunoglobulin sequence that is closest in sequence (i.e., greatest % identity) to the sequence of the human antibody.
- a human antibody that is "the product of or "derived from” a particular human germline immunoglobulin sequence may contain amino acid differences as compared to the germline sequence, due to, for example, naturally occurring somatic mutations or intentional introduction of site-directed mutations.
- a selected human antibody typically is at least 90% identical in amino acids sequence to an amino acid sequence encoded by a human germline immunoglobulin gene and contains amino acid residues that identify the human antibody as being human when compared to the germline immunoglobulin amino acid sequences of other species (e.g., murine germline sequences).
- a human antibody may be at least 60%, 70%, 80%, 90%, or at least 95%, or even at least 96%, 97%, 98%, or 99% identical in amino acid sequence to the amino acid sequence encoded by the germline immunoglobulin gene.
- a recombinant human antibody will display no more than 10 amino acid differences from the amino acid sequence encoded by the human germline immunoglobulin gene in the VH or VL framework regions. In certain cases, the human antibody may display no more than 5, or even no more than 4, 3, 2, or 1 amino acid difference from the amino acid sequence encoded by the germline immunoglobulin gene.
- human germline immunoglobulin genes include, but are not limited to the variable domain germline fragments described below, as well as DP47 and DPK9.
- the present disclosure provides an antibody, or an antigen binding fragment thereof, comprising amino acid sequences that are homologous to the sequences described in Table 1 (e.g., SEQ ID NOs: 29, 31 , 39, or 41), and the antibody binds to an FXI and/or FXIa protein (e.g., human, rabbit, and cynomolgus monkey FXIa), and retains the desired functional properties of those antibodies described in Table 1 such as NOV1090 and NOV1401 .
- FXI and/or FXIa protein e.g., human, rabbit, and cynomolgus monkey FXIa
- such homologous antibodies retain the CDR amino acid sequences described in Table 1 (e.g., Kabat CDRs, Chothia CDRs, IMGT CDRs, or Combined CDRs).
- the present disclosure provides an isolated antibody, or a functional antigen binding fragment thereof, comprising a heavy chain variable domain and a light chain variable domain, wherein the heavy chain variable domain comprises an amino acid sequence that is at least 80%, at least 90%, or at least 95% identical to an amino acid sequence selected from the group consisting of SEQ ID NOs: 9 and 29; the light chain variable domain comprises an amino acid sequence that is at least 80%, at least 90%, or at least 95% identical to an amino acid sequence selected from the group consisting of SEQ ID NOs: 19 and 39; and the antibody specifically binds to FXI and/or FXIa (e.g., human, rabbit, and cynomolgus monkey FXIa).
- FXI and/or FXIa e.g., human, rabbit, and cynomolgus monkey FXIa
- an isolated antibody, or a functional antigen binding fragment thereof comprises a heavy chain variable domain and a light chain variable domain, wherein the heavy chain variable domain comprises an amino acid sequence that is at least 80%, at least 90%, or at least 95% identical to the amino acid sequence of SEQ ID NO: 9; the light chain variable domain comprises an amino acid sequence that is at least 80%, at least 90%, or at least 95% identical to the amino acid sequence of SEQ ID NO: 19; and the antibody specifically binds to FXI and/or FXIa (e.g., human, rabbit, and cynomolgus monkey FXIa).
- FXI and/or FXIa e.g., human, rabbit, and cynomolgus monkey FXIa
- an isolated antibody, or a functional antigen binding fragment thereof comprises a heavy chain variable domain and a light chain variable domain, wherein the heavy chain variable domain comprises an amino acid sequence that is at least 80%, at least 90%, or at least 95% identical to the amino acid sequence of SEQ ID NO: 29; the light chain variable domain comprises an amino acid sequence that is at least 80%, at least 90%, or at least 95% identical to the amino acid sequence of SEQ ID NO: 39; and the antibody specifically binds to FXI and/or FXIa (e.g., human, rabbit, and cynomolgus monkey FXIa).
- FXI and/or FXIa e.g., human, rabbit, and cynomolgus monkey FXIa
- the heavy and light chain sequences further comprise HCDR1 , HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3 sequences as defined by Kabat, for example SEQ ID NOs: 3, 4, 5, 13, 14, and 15, respectively.
- the heavy and light chain sequences further comprise HCDR1 , HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3 sequences as defined by Chothia, for example SEQ ID NOs: 6, 7, 8, 16, 17, and 18, respectively.
- the heavy and light chain sequences further comprise HCDR1 , HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3 sequences as defined by the Combined system, for example SEQ ID NOs: 46, 4, 5, 33, 14, and 15, respectively.
- the heavy and light chain sequences further comprise HCDR1 , HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3 sequences as defined by IMGT, for example SEQ ID NOs: 43, 44, 45, 47, 37, and 15, respectively.
- the VH and/or VL amino acid sequences may be 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98% or 99% identical to the sequences set forth in Table 1 .
- the VH and/or VL amino acid sequences may be identical except for an amino acid substitution in no more than 1 ,2,3,4 or 5 amino acid positions.
- the full length heavy chain and/or full length light chain amino acid sequences may be 50% 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98% or 99% identical to the sequences set forth in Table 1 (e.g., SEQ ID NOs: 1 1 and/or 21 , or 31 and/or 41 ).
- An antibody having a full length heavy chain and full length light chain having high (i.e., 80% or greater) identity to the full length heavy chains of any of SEQ ID NOs : 1 1 or 31 , and full length light chains of any of SEQ ID NOs: 21 or 41 can be obtained by mutagenesis (e.g., site-directed or PCR-mediated mutagenesis) of nucleic acid molecules encoding such polypeptides, followed by testing of the encoded altered antibody for retained function using the functional assays described herein.
- mutagenesis e.g., site-directed or PCR-mediated mutagenesis
- an isolated antibody, or a functional antigen binding fragment thereof comprising a heavy chain and a light chain, wherein the heavy chain comprises an amino acid sequence that is at least 80%, at least 90%, or at least 95% identical to an amino acid sequence selected from the group consisting of SEQ ID NOs: 1 1 and 31 ; the light chain comprises an amino acid sequence that is at least 80%, at least 90%, or at least 95% identical to an amino acid sequence selected from the group consisting of SEQ ID NOs: 21 and 41 ; and the antibody specifically binds to FXI and/or FXIa (e.g., human, rabbit, and cynomolgus monkey FXIa).
- FXI and/or FXIa e.g., human, rabbit, and cynomolgus monkey FXIa
- an isolated antibody, or a functional antigen binding fragment thereof comprises a heavy chain and a light chain, wherein the heavy chain comprises an amino acid sequence that is at least 80%, at least 90%, or at least 95% identical to the amino acid sequence of SEQ ID NO: 1 1 ; the light chain comprises an amino acid sequence that is at least 80%, at least 90%, or at least 95% identical to the amino acid sequence of SEQ ID NO: 21 ; and the antibody specifically binds to FXI and/or FXIa (e.g., human, rabbit, and cynomolgus monkey FXIa).
- FXI and/or FXIa e.g., human, rabbit, and cynomolgus monkey FXIa
- an isolated antibody, or a functional antigen binding fragment thereof comprises a heavy chain and a light chain, wherein the heavy chain comprises an amino acid sequence that is at least 80%, at least 90%, or at least 95% identical to the amino acid sequence of SEQ ID NO: 31 ; the light chain comprises an amino acid sequence that is at least 80%, at least 90%, or at least 95% identical to the amino acid sequence of SEQ ID NO: 41 ; and the antibody specifically binds to FXI and/or FXIa (e.g., human, rabbit, and cynomolgus monkey FXIa).
- FXI and/or FXIa e.g., human, rabbit, and cynomolgus monkey FXIa
- the heavy and light chain sequences further comprise HCDR1 , HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3 sequences as defined by Kabat, for example SEQ ID NOs: 3, 4, 5, 13, 14, and 15, respectively.
- the heavy and light chain sequences further comprise HCDR1 , HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3 sequences as defined by Chothia, for example SEQ ID NOs: 6, 7, 8, 16, 17, and 18, respectively.
- the heavy and light chain sequences further comprise HCDR1 , HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3 sequences as defined by the Combined system, for example SEQ ID NOs: 46, 4, 5, 33, 14, and 15, respectively.
- the heavy and light chain sequences further comprise HCDR1 , HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3 sequences as defined by IMGT, for example SEQ ID NOs: 43, 44, 45, 47, 37, and 15, respectively.
- the full length heavy chain and/or full length light chain nucleotide sequences may be 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98% or 99% identical to the sequences set forth in Table 1 (e.g., SEQ ID NOs: 12 and/or 22, or 32 and/or 42).
- variable regions of heavy chain and/or the variable regions of light chain nucleotide sequences may be 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98% or 99% identical to the sequences set forth in Table 1 (e.g., SEQ ID NOs: 10 and/or 20, or 30 and/or 40).
- the percent identity between the two sequences is a function of the number of identical positions shared by the sequences (i.e., % identity equals number of identical positions/total number of positions x 100), taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.
- the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm, as described in the non- limiting examples below.
- protein sequences of the present disclosure can further be used as a "query sequence" to perform a search against public databases to, for example, identify related sequences.
- search can be performed using the BLAST program (version 2.0) of Altschul, et al., 1990 J. Mol. Biol. 215:403-10.
- an antibody of the present disclosure for use in the methods described herein has a heavy chain variable region comprising CDR1 , CDR2, and CDR3 sequences and a light chain variable region comprising CDR1 , CDR2, and CDR3 sequences, wherein one or more of these CDR sequences have specified amino acid sequences based on the antibodies described herein or conservative
- the present disclosure provides an isolated antibody, or an antigen binding fragment thereof, consisting of a heavy chain variable region comprising CDR1 , CDR2, and CDR3 sequences and a light chain variable region comprising CDR1 , CDR2, and CDR3 sequences, wherein: the heavy chain variable region CDR1 amino acid sequences are selected from the group consisting of SEQ ID NOs: 3 and 23, and conservative modifications thereof; the heavy chain variable region CDR2 amino acid sequences are selected from the group consisting of SEQ ID NOs: 4 and 24, and conservative modifications thereof; the heavy chain variable region CDR3 amino acid sequences are selected from the group consisting of SEQ ID NOs: 5 and 25, and
- the light chain variable regions CDR1 amino acid sequences are selected from the group consisting of SEQ ID NOs: 13 and 33, and conservative modifications thereof; the light chain variable regions CDR2 amino acid sequences are selected from the group consisting of SEQ ID NOs: 14 and 34, and conservative modifications thereof; the light chain variable regions of CDR3 amino acid sequences are selected from the group consisting of SEQ ID NOs: 15 and 35, and conservative modifications thereof; and the antibody or antigen binding fragments thereof specifically binds to FXIa.
- an isolated antibody, or an antigen binding fragment thereof consisting of a heavy chain variable region comprising CDR1 , CDR2, and CDR3 sequences and a light chain variable region comprising CDR1 , CDR2, and CDR3 sequences
- the heavy chain variable region CDR1 amino acid sequences are selected from the group consisting of those described in Table 1 , and conservative modifications thereof
- the heavy chain variable region CDR2 amino acid sequences are selected from the group consisting of those described in Table 1 , and conservative modifications thereof
- the heavy chain variable region CDR3 amino acid sequences are selected from the group consisting of those described in Table 1 , and conservative modifications thereof
- the light chain variable regions CDR1 amino acid sequences are selected from the group consisting of those described in Table 1 , and conservative modifications thereof
- the light chain variable regions CDR2 amino acid sequences are selected from the group consisting of those described in Table 1 , and conservative modifications thereof
- the light chain variable regions of CDR3 amino acid sequences are selected from the group consisting of those described
- the antibody of the present disclosure is optimized for expression in a mammalian cell has a full length heavy chain sequence and a full length light chain sequence, wherein one or more of these sequences have specified amino acid sequences based on the antibodies described herein or conservative modifications thereof, and wherein the antibodies retain the desired functional properties of the FXIa binding antibodies of the present disclosure.
- the present disclosure provides an isolated antibody optimized for expression in a mammalian cell consisting of a full length heavy chain and a full length light chain wherein the full length heavy chain has amino acid sequences selected from the group of SEQ ID NOs: 1 1 or 31 , and conservative modifications thereof; and the full length light chain has amino acid sequences selected from the group of SEQ ID NOs: 21 or 41 , and conservative modifications thereof; and the antibody specifically binds to FXI and/or FXIa (e.g., human, rabbit, and cynomolgus monkey FXIa).
- FXI and/or FXIa e.g., human, rabbit, and cynomolgus monkey FXIa
- the present disclosure provides antibodies that bind to the same epitope as the FXI and/or FXIa binding antibodies described in Table 1 , for use in the methods described herein (e.g., methods for reducing or preventing the risk of stroke and/or system embolism in subjects with ESRD and/or AF). Additional antibodies can therefore be identified based on their ability to compete (e.g., to competitively inhibit the binding of, in a statistically significant manner, by binding to the same or overlapping epitope) with other antibodies of the present disclosure in FXI and/or FXIa binding assays (such as those described in the Examples Section).
- test antibody to inhibit the binding of antibodies of the present disclosure to a FXI and/or FXIa protein demonstrates that the test antibody can compete with that antibody for binding to FXI and/or FXIa; such an antibody may, according to non-limiting theory, bind to the same or a related (e.g., a structurally similar or spatially proximal) epitope on the FXI and/or FXIa protein as the antibody with which it competes.
- the antibody that binds to the same epitope on FXI and/or FXIa as the antibodies of the present disclosure is a human monoclonal antibody. Such human monoclonal antibodies can be prepared and isolated as described herein.
- an antibody competes" for binding when the competing antibody binds to the same FXI and/or FXIa epitope as an antibody or antigen binding fragment of the present disclosure (e.g., NOV1401 or NOV1090) and inhibits FXI and/or FXIa binding of an antibody or antigen binding fragment of the present disclosure by more than 50% (for example, 80%, 85%, 90%, 95%, 98% or 99%) in the presence of an equimolar concentration of competing antibody. This may be determined, for instance, in a competitive binding assay, by any of the methods well known to those of skill in the art.
- an antibody or antigen binding fragment thereof does not "compete" with an FXI and/or FXIa antibody or antigen binding fragment of the present disclosure (e.g., NOV1401 or NOV1090) unless said competing antibody or antigen binding fragment thereof binds the same FXI and/or FXIa epitope, or an overlapping FXI and/or FXIa epitope, as an antibody or antigen binding fragment of the present disclosure.
- a competing antibody or antigen binding fragment thereof does not include one which (i) sterically blocks an antibody or antigen binding fragment of the present disclosure from binding its target (e.g., if said competing antibody binds to a nearby, non-overlapping FXI and/or FXIa epitope and physically prevents an antibody or antigen binding fragment of the present disclosure from binding its target); and/or (ii) binds to a different, non-overlapping FXI and/or FXIa epitope and induces a conformational change to the FXI and/or FXIa protein such that said protein can no longer be bound by an FXI and/or FXIa antibody or antigen binding fragment of the present disclosure in a way that would occur absent said conformational change.
- An antibody of the present disclosure for use in the methods described herein, further can be prepared using an antibody having one or more of the VH and/or VL sequences shown herein as starting material to engineer a modified antibody, which modified antibody may have altered properties from the starting antibody.
- An antibody can be engineered by modifying one or more residues within one or both variable regions (/ ' . e., VH and/or VL), for example within one or more CDR regions and/or within one or more framework regions. Additionally or alternatively, an antibody can be engineered by modifying residues within the constant region(s), for example to alter the effector function(s) of the antibody.
- variable region engineering One type of variable region engineering that can be performed is CDR grafting.
- Antibodies interact with target antigens predominantly through amino acid residues that are located in the six heavy and light chain complementarity determining regions (CDRs). For this reason, the amino acid sequences within CDRs are more diverse between individual antibodies than sequences outside of CDRs. Because CDR sequences are responsible for most antibody-antigen interactions, it is possible to express recombinant antibodies that mimic the properties of specific naturally occurring antibodies by constructing expression vectors that include CDR sequences from the specific naturally occurring antibody grafted onto framework sequences from a different antibody with different properties (see, e.g.,
- an isolated antibody, or an antigen binding fragment thereof comprising a heavy chain variable region comprising CDR1 sequences having an amino acid sequence selected from the group consisting of SEQ ID NOs: 3 and 23; CDR2 sequences having an amino acid sequence selected from the group consisting of SEQ ID NOs: 4 and 24; CDR3 sequences having an amino acid sequence selected from the group consisting of SEQ ID NOs: 5 and 25, respectively; and a light chain variable region having CDR1 sequences having an amino acid sequence selected from the group consisting of SEQ ID NOs: 13 and 33; CDR2 sequences having an amino acid sequence selected from the group consisting of SEQ ID NOs: 14 and 34; and CDR3 sequences consisting of an amino acid sequence selected from the group consisting of SEQ ID NOs: 15 and 35, respectively.
- such antibodies contain the VH and VL CDR sequences of monoclonal antibodies, yet may contain different framework sequences from these antibodies.
- Such framework sequences can be obtained from public DNA databases or published references that include germline antibody gene sequences.
- germline DNA sequences for human heavy and light chain variable region genes can be found in the "VBase" human germline sequence database (available on the world wide web at mrc- cpe.cam.ac.uk/vbase), as well as in Kabat, E. A., et ai, 1991 Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91 -3242; Tomlinson, I. M., et al., 1992 J. Mol. Biol. 227:776-798; and Cox, J. P. L. et al., 1994 Eur. J Immunol. 24:827-836; the contents of each of which are expressly incorporated herein by reference.
- framework sequences for use in the antibodies of the present disclosure are those that are structurally similar to the framework sequences used by selected antibodies of the present disclosure, e.g., consensus sequences and/or framework sequences used by monoclonal antibodies of the present disclosure.
- the VH CDR1 , 2 and 3 sequences, and the VL CDR1 , 2 and 3 sequences can be grafted onto framework regions that have the identical sequence as that found in the germline immunoglobulin gene from which the framework sequence derive, or the CDR sequences can be grafted onto framework regions that contain one or more mutations as compared to the germline sequences.
- an embodiment of the present disclosure relates to isolated FXIa binding antibodies, or antigen binding fragments thereof, comprising a heavy chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 9 and 29, or an amino acid sequence having one, two, three, four or five amino acid substitutions, deletions or additions in the framework region of such sequences, and further comprising a light chain variable region having an amino acid sequence selected from the group consisting of SEQ ID NOs: 19 or 39, or an amino acid sequence having one, two, three, four or five amino acid substitutions, deletions or additions in the framework region of such sequences.
- variable region modification is to mutate amino acid residues within the VH and/or VL CDR1 , CDR2 and/or CDR3 regions to thereby improve one or more binding properties (e.g., affinity) of the antibody of interest, known as "affinity maturation.”
- Site- directed mutagenesis or PCR-mediated mutagenesis can be performed to introduce the mutation(s) and the effect on antibody binding, or other functional property of interest, can be evaluated in in vitro or in vivo assays as described herein and provided in the Examples Section. Conservative modifications (as discussed above) can be introduced.
- the mutations may be amino acid substitutions, additions or deletions. Moreover, typically no more than one, two, three, four or five residues within a CDR region are altered.
- the present disclosure provides isolated FXIa-binding antibodies, or antigen binding fragments thereof, consisting of a heavy chain variable region having a VH CDR1 region consisting of an amino acid sequence selected from the group having SEQ ID NOs: 3 and 23 or an amino acid sequence having one, two, three, four or five amino acid substitutions, deletions or additions as compared to SEQ ID NOs: 3 and 23; a VH CDR2 region having an amino acid sequence selected from the group consisting of SEQ ID NOs: 4 and 24 or an amino acid sequence having one, two, three, four or five amino acid substitutions, deletions or additions as compared to SEQ ID NOs: 4 and 24; a VH CDR3 region having an amino acid sequence selected from the group consisting of SEQ ID NOs: 5 and 25, or an amino acid sequence having one, two, three, four or five amino acid substitutions, deletions or additions as compared to SEQ ID NOs: 5 and 25; a VL
- the present disclosure provides isolated FXIa-binding antibodies, or antigen binding fragments thereof, consisting of a heavy chain variable region having a VH CDR1 region consisting of an amino acid sequence selected from the group having SEQ ID NOs: 6 and 26 or an amino acid sequence having one, two, three, four or five amino acid substitutions, deletions or additions as compared to SEQ ID NOs: 6 and 26; a VH CDR2 region having an amino acid sequence selected from the group consisting of SEQ ID NOs: 7 and 27 or an amino acid sequence having one, two, three, four or five amino acid substitutions, deletions or additions as compared to SEQ ID NOs: 7 and 27; a VH CDR3 region having an amino acid sequence selected from the group consisting of SEQ ID NOs: 8 and 28, or an amino acid sequence having one, two, three, four or five amino acid substitutions, deletions or additions as compared to SEQ ID NOs: 8 and 28; a VL
- the present disclosure provides for antibodies that specifically bind to FXIa protein which have an extended half-life in vivo, for use in the methods described herein.
- kidney filtration kidney filtration, metabolism in the liver, degradation by proteolytic enzymes (proteases), and immunogenic responses (e.g., protein neutralization by antibodies and uptake by macrophages and dendritic cells).
- proteolytic enzymes proteolytic enzymes
- immunogenic responses e.g., protein neutralization by antibodies and uptake by macrophages and dendritic cells.
- a variety of strategies can be used to extend the half-life of the antibodies of the present disclosure.
- PEG polyethyleneglycol
- PSA polysialic acid
- HES hydroxyethyl starch
- albumin- binding ligands and carbohydrate shields
- genetic fusion to proteins binding to serum proteins such as albumin, IgG, FcRn, and transferring
- other binding moieties that bind to serum proteins, such as nanobodies, Fabs, DARPins, avimers, affibodies, and anticalins
- genetic fusion to rPEG, albumin, domain of albumin, albumin-binding proteins, and Fc or by incorporation into nanocarriers, slow release formulations, or medical devices.
- inert polymer molecules such as high molecular weight PEG can be attached to the antibodies or a fragment thereof with or without a multifunctional linker either through site-specific conjugation of the PEG to the N- or C-terminus of the antibodies or via epsilon-amino groups present on lysine residues.
- PEG polyethylene glycol
- the antibody, or fragment thereof typically is reacted with polyethylene glycol (PEG), such as a reactive ester or aldehyde derivative of PEG, under conditions in which one or more PEG groups become attached to the antibody or antibody fragment.
- the pegylation can be carried out by an acylation reaction or an alkylation reaction with a reactive PEG molecule (or an analogous reactive water-soluble polymer).
- a reactive PEG molecule or an analogous reactive water-soluble polymer.
- polyethylene glycol is intended to encompass any of the forms of PEG that have been used to derivatize other proteins, such as mono (C1 -C10) alkoxy- or aryloxy-polyethylene glycol or polyethylene glycol-maleimide.
- the antibody to be pegylated is an aglycosylated antibody. Linear or branched polymer derivatization that results in minimal loss of biological activity will be used.
- the degree of conjugation can be closely monitored by SDS-PAGE and mass spectrometry to ensure proper conjugation of PEG molecules to the antibodies. Unreacted PEG can be separated from antibody-PEG conjugates by size- exclusion or by ion-exchange chromatography. PEG-derivatized antibodies can be tested for binding activity as well as for in vivo efficacy using methods well-known to those of skill in the art, for example, by immunoassays described herein. Methods for pegylating proteins are known in the art and can be applied to the antibodies of the present disclosure. See for example, EP 0 154 316 by Nishimura et al. and EP 0 401 384 by Ishikawa et al.
- modified pegylation technologies include reconstituting chemically orthogonal directed engineering technology (ReCODE PEG), which incorporates chemically specified side chains into biosynthetic proteins via a reconstituted system that includes tRNA synthetase and tRNA.
- ReCODE PEG chemically orthogonal directed engineering technology
- This technology enables incorporation of more than 30 new amino acids into biosynthetic proteins in E.coli, yeast, and mammalian cells.
- the tRNA incorporates a nonnative amino acid any place an amber codon is positioned, converting the amber from a stop codon to one that signals incorporation of the chemically specified amino acid.
- Recombinant pegylation technology can also be used for serum halflife extension.
- This technology involves genetically fusing a 300-600 amino acid unstructured protein tail to an existing pharmaceutical protein. Because the apparent molecular weight of such an unstructured protein chain is about 15-fold larger than its actual molecular weight, the serum half-life of the protein is greatly increased.
- traditional PEGylation which requires chemical conjugation and repurification, the manufacturing process is greatly simplified and the product is homogeneous.
- PSA polymer polysialic acid
- PSA polysialic acid
- sialic acid a sugar
- polysialic acid provides a protective microenvironment on conjugation. This increases the active life of the therapeutic protein in the circulation and prevents it from being recognized by the immune system.
- the PSA polymer is naturally found in the human body. It was adopted by certain bacteria which evolved over millions of years to coat their walls with it. These naturally polysialylated bacteria were then able, by virtue of molecular mimicry, to foil the body's defense system. PSA, nature's ultimate stealth technology, can be easily produced from such bacteria in large quantities and with predetermined physical
- Bacterial PSA is completely non-immunogenic, even when coupled to proteins, as it is chemically identical to PSA in the human body.
- HES hydroxyethyl starch
- Another technology includes the use of hydroxyethyl starch (“HES”) derivatives linked to antibodies.
- HES is a modified natural polymer derived from waxy maize starch and can be metabolized by the body's enzymes.
- HES solutions are usually administered to substitute deficient blood volume and to improve the rheological properties of the blood.
- Hesylation of an antibody enables the prolongation of the circulation half-life by increasing the stability of the molecule, as well as by reducing renal clearance, resulting in an increased biological activity.
- a wide range of HES antibody conjugates can be customized.
- Antibodies having an increased half-life in vivo can also be generated introducing one or more amino acid modifications (i.e., substitutions, insertions or deletions) into an IgG constant domain, or FcRn binding fragment thereof (preferably a Fc or hinge Fc domain fragment). See, e.g., International Publication No. WO 98/23289; International Publication No. WO 97/34631 ; and U.S. Patent No. 6,277,375.
- antibodies can be conjugated to albumin (e.g., human serum albumin; HSA) in order to make the antibody or antibody fragment more stable in vivo or have a longer half life in vivo.
- albumin e.g., human serum albumin; HSA
- the techniques are well-known in the art, see, e.g., International Publication Nos. WO 93/15199, WO 93/15200, and WO 01 /77137; and European Patent No. EP 413,622.
- the specificities of the antibody can be designed such that one binding domain of the antibody binds to FXIa while a second binding domain of the antibody binds to serum albumin, preferably HSA.
- the strategies for increasing half-life is especially useful in nanobodies, fibronectin- based binders, and other antibodies or proteins for which increased in vivo half-life is desired.
- the present disclosure provides antibodies or fragments thereof, for use in the methods described herein, that specifically bind to a FXIa protein recombinantly fused or chemically conjugated (including both covalent and non-covalent conjugations) to a heterologous protein or polypeptide (or fragment thereof, preferably to a polypeptide of at least 10, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90 or at least 100 amino acids) to generate fusion proteins.
- the present disclosure provides fusion proteins comprising an antigen-binding fragment of an antibody described herein (e.g., a Fab fragment, Fd fragment, Fv fragment, F(ab)2 fragment, a VH domain, a VH CDR, a VL domain or a VL CDR) and a heterologous protein, polypeptide, or peptide.
- an antibody described herein e.g., a Fab fragment, Fd fragment, Fv fragment, F(ab)2 fragment, a VH domain, a VH CDR, a VL domain or a VL CDR
- Methods for fusing or conjugating proteins, polypeptides, or peptides to an antibody or an antibody fragment are known in the art. See, e.g., U.S. Patent Nos. 5,336,603, 5,622,929, 5,359,046, 5,349,053, 5,447,851 , and 5,1 12,946; European Patent Nos.
- EP 307,434 and EP 367,166 International Publication Nos. WO 96/04388 and WO 91/06570; Ashkenazi et al., 1991 , Proc. Natl. Acad. Sci. USA 88: 10535-10539; Zheng et al., 1995, J. Immunol. 154:5590-5600; and Vil et al., 1992, Proc. Natl. Acad. Sci. USA 89:1 1337- 1 1341 .
- DNA shuffling may be employed to alter the activities of antibodies of the present disclosure or fragments thereof (e.g., antibodies or fragments thereof with higher affinities and lower dissociation rates). See, generally, U.S. Patent Nos. 5,605,793, 5,81 1 ,238, 5,830,721 , 5,834,252, and 5,837,458; Patten et al., 1997, Curr. Opinion Biotechnol. 8:724-33; Harayama, 1998, Trends Biotechnol.
- Antibodies or fragments thereof, or the encoded antibodies or fragments thereof may be altered by being subjected to random mutagenesis by error-prone PCR, random nucleotide insertion or other methods prior to recombination.
- a polynucleotide encoding an antibody or fragment thereof that specifically binds to a FXIa protein may be recombined with one or more components, motifs, sections, parts, domains, fragments, etc. of one or more heterologous molecules.
- the antibodies or fragments thereof can be fused to marker sequences, such as a peptide to facilitate purification.
- the marker amino acid sequence is a hexa-histidine peptide (SEQ ID NO: 48), such as the tag provided in a pQE vector (QIAGEN, Inc., 9259 Eton Avenue, Chatsworth, CA, 9131 1), among others, many of which are commercially available.
- hexa-histidine provides for convenient purification of the fusion protein.
- peptide tags useful for purification include, but are not limited to, the hemagglutinin ("HA") tag, which corresponds to an epitope derived from the influenza hemagglutinin protein (Wilson et ai, 1984, Cell 37:767), and the "flag" tag.
- HA hemagglutinin
- antibodies of the present disclosure or fragments thereof conjugated to a diagnostic or detectable agent can be useful for monitoring or prognosing the onset, development, progression and/or severity of a disease or disorder as part of a clinical testing procedure, such as determining the efficacy of a particular therapy.
- Such diagnosis and detection can accomplished by coupling the antibody to detectable substances including, but not limited to, various enzymes, such as, but not limited to, horseradish peroxidase, alkaline phosphatase, beta-galactosidase, or acetylcholinesterase; prosthetic groups, such as, but not limited to, streptavidinlbiotin and avidin/biotin; fluorescent materials, such as, but not limited to, umbelliferone, fluorescein, fluorescein isothiocynate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; luminescent materials, such as, but not limited to, luminol; bioluminescent materials, such as but not limited to, luciferase, luciferin, and aequorin; radioactive materials, such as, but not limited to, iodine (131 1, 1251, 1231, and 121 1,), carbon
- the present disclosure further encompasses uses of antibodies or fragments thereof conjugated to a therapeutic moiety.
- An antibody or fragment thereof may be conjugated to a therapeutic moiety such as a cytotoxin, e.g., a cytostatic or cytocidal agent, a therapeutic agent or a radioactive metal ion, e.g., alpha-emitters.
- a cytotoxin or cytotoxic agent includes any agent that is detrimental to cells.
- an antibody or fragment thereof may be conjugated to a therapeutic moiety or drug moiety that modifies a given biological response.
- Therapeutic moieties or drug moieties are not to be construed as limited to classical chemical therapeutic agents.
- the drug moiety may be a protein, peptide, or polypeptide possessing a desired biological activity.
- Such proteins may include, for example, a toxin such as abrin, ricin A, pseudomonas exotoxin, cholera toxin, or diphtheria toxin; a protein such as tumor necrosis factor, a- interferon, ⁇ -interferon, nerve growth factor, platelet derived growth factor, tissue plasminogen activator, an apoptotic agent, an anti-angiogenic agent; or, a biological response modifier such as, for example, a lymphokine.
- a toxin such as abrin, ricin A, pseudomonas exotoxin, cholera toxin, or diphtheria toxin
- a protein such as tumor necrosis factor, a- interferon, ⁇ -interferon, nerve growth factor, platelet derived growth factor, tissue plasminogen activator, an apoptotic agent, an anti-angiogenic agent
- a biological response modifier such as, for example, a lymphokine.
- an antibody can be conjugated to therapeutic moieties such as a radioactive metal ion, such as alph-emiters such as 213Bi or macrocyclic chelators useful for conjugating radiometal ions, including but not limited to, 131 In, 131 LU, 131Y, 131 Ho, 131 Sm, to polypeptides.
- the macrocyclic chelator is 1 ,4,7,10- tetraazacyclododecane-N,N',N",N"'-tetraacetic acid (DOTA) which can be attached to the antibody via a linker molecule.
- linker molecules are commonly known in the art and described in Denardo et al., 1998, Clin Cancer Res.
- Antibodies may also be attached to solid supports, which are particularly useful for immunoassays or purification of the target antigen.
- solid supports include, but are not limited to, glass, cellulose, polyacrylamide, nylon, polystyrene, polyvinyl chloride or polypropylene.
- the present disclosure provides substantially purified nucleic acid molecules which encode polypeptides comprising segments or domains of the FXIa-binding antibody chains described above, as well as vectors and host cells for producing antibodies.
- Some of the nucleic acids of the present disclosure comprise the nucleotide sequence encoding the heavy chain variable region shown in SEQ ID NO: 10 or 30, and/or the nucleotide sequence encoding the light chain variable region shown in SEQ ID NO: 20 or 40.
- the nucleic acid molecules are those identified in Table 1 .
- nucleic acid molecules of the present disclosure comprise nucleotide sequences that are substantially identical (e.g., at least 65, 80%, 95%, or 99%) to the nucleotide sequences of those identified in Table 1 .
- polypeptides encoded by these polynucleotides are capable of exhibiting FXI and/or FXIa antigen binding capacity.
- a variety of nucleic acid sequences will encode each of the immunoglobulin amino acid sequences.
- nucleic acid molecules can encode both a variable region and a constant region of the antibody.
- nucleic acid sequences of the present disclosure comprise nucleotides encoding a heavy chain sequence that is substantially identical (e.g., at least 80%, 90%, or 99%) to the heavy chain sequence set forth in SEQ ID NO: 1 1 or 31 .
- nucleic acid sequences comprising nucleotide encoding a light chain sequence that is substantially identical (e.g., at least 80%, 90%, or 99%) to the light chain sequence set forth in SEQ ID NO: 21 or 41 .
- Polynucleotide sequences can be produced by de novo solid-phase DNA synthesis or by PCR mutagenesis of an existing sequence (e.g., sequences as described in the Examples below) encoding a FXIa-binding antibody or its binding fragment.
- Direct chemical synthesis of nucleic acids can be accomplished by methods known in the art, such as the phosphotriester method of Narang et al., 1979, Meth. Enzymol. 68:90; the phosphodiester method of Brown et al., Meth. Enzymol. 68:109, 1979; the diethylphosphoramidite method of Beaucage et ai, Tetra. Lett., 22:1859, 1981 ; and the solid support method of U.S. Patent No. 4,458,066.
- PCR Technology Principles and Applications for DNA Amplification, H.A. Erlich (Ed.), Freeman Press, NY, NY, 1992; PCR Protocols: A Guide to Methods and Applications, Innis et al. (Ed.), Academic Press, San Diego, CA, 1990; Mattila et ai, Nucleic Acids Res. 19:967, 1991 ; and Eckert et al., PCR Methods and Applications 1 :17, 1991 .
- Nonviral vectors and systems include plasmids, episomal vectors, typically with an expression cassette for expressing a protein or RNA, and human artificial chromosomes (see, e.g., Harrington et al., Nat Genet 15:345, 1997).
- nonviral vectors useful for expression of the FXIa-binding polynucleotides and polypeptides in mammalian (e.g., human) cells include pThioHis A, B & C, pcDNA3.1/His, pEBVHis A, B & C, (Invitrogen, San Diego, CA), MPSV vectors, and numerous other vectors known in the art for expressing other proteins.
- Useful viral vectors include vectors based on retroviruses, adenoviruses, adenoassociated viruses, herpes viruses, vectors based on SV40, papilloma virus, HBP Epstein Barr virus, vaccinia virus vectors and Semliki Forest virus (SFV).
- the expression vectors may also provide a secretion signal sequence position to form a fusion protein with polypeptides encoded by inserted FXIa-binding antibody sequences. More often, the inserted FXI and/or FXIa-binding antibody sequences are linked to a signal sequences before inclusion in the vector.
- Vectors to be used to receive sequences encoding FXI and/or FXIa-binding antibody light and heavy chain variable domains sometimes also encode constant regions or parts thereof. Such vectors allow expression of the variable regions as fusion proteins with the constant regions thereby leading to production of intact antibodies or fragments thereof. Typically, such constant regions are human.
- the host cells for harboring and expressing the FXI and/or FXIa-binding antibody chains can be either prokaryotic or eukaryotic.
- E. coli is one prokaryotic host useful for cloning and expressing the polynucleotides of the present disclosure.
- Other microbial hosts suitable for use include bacilli, such as Bacillus subtilis, and other enterobacteriaceae, such as Salmonella, Serratia, and various Pseudomonas species.
- prokaryotic hosts one can also make expression vectors, which typically contain expression control sequences compatible with the host cell (e.g., an origin of replication).
- any number of a variety of well-known promoters will be present, such as the lactose promoter system, a tryptophan (trp) promoter system, a beta-lactamase promoter system, or a promoter system from phage lambda.
- the promoters typically control expression, optionally with an operator sequence, and have ribosome binding site sequences and the like, for initiating and completing transcription and translation.
- Other microbes, such as yeast can also be employed to express FXIa-binding polypeptides of the present disclosure. Insect cells in combination with baculovirus vectors can also be used.
- mammalian host cells are used to express and produce the FXI and/or FXIa-binding polypeptides of the present disclosure. These include any normal mortal or normal or abnormal immortal animal or human cell.
- suitable host cell lines capable of secreting intact immunoglobulins have been developed including the CHO cell lines, various Cos cell lines, HeLa cells, myeloma cell lines, and transformed B-cells.
- the use of mammalian tissue cell culture to express polypeptides is discussed generally in, e.g., Winnacker, FROM GENES TO CLONES, VCH Publishers, N.Y., N.Y., 1987.
- Expression vectors for mammalian host cells can include expression control sequences, such as an origin of replication, a promoter, and an enhancer (see, e.g., Queen, et al., Immunol. Rev. 89:49-68, 1986), and necessary processing information sites, such as ribosome binding sites, RNA splice sites, polyadenylation sites, and transcriptional terminator sequences.
- expression control sequences such as an origin of replication, a promoter, and an enhancer (see, e.g., Queen, et al., Immunol. Rev. 89:49-68, 1986)
- necessary processing information sites such as ribosome binding sites, RNA splice sites, polyadenylation sites, and transcriptional terminator sequences.
- Methods for introducing expression vectors containing the polynucleotide sequences of interest vary depending on the type of cellular host. For example, calcium chloride transfection is commonly utilized for prokaryotic cells, whereas calcium phosphate treatment or electroporation may be used for other cellular hosts. (See generally Sambrook, et ai, supra).
- Other methods include, e.g., electroporation, calcium phosphate treatment, liposome- mediated transformation, injection and microinjection, ballistic methods, virosomes, immunoliposomes, polycation:nucleic acid conjugates, naked DNA, artificial virions, fusion to the herpes virus structural protein VP22 (Elliot and O'Hare, Cell 88:223, 1997), agent- enhanced uptake of DNA, and ex vivo transduction. For long-term, high-yield production of recombinant proteins, stable expression will often be desired.
- cell lines which stably express FXIa-binding antibody chains or binding fragments can be prepared using expression vectors of the invention which contain viral origins of replication or endogenous expression elements and a selectable marker gene. Following the introduction of the vector, cells may be allowed to grow for 1 -2 days in an enriched media before they are switched to selective media.
- the purpose of the selectable marker is to confer resistance to selection, and its presence allows growth of cells which successfully express the introduced sequences in selective media.
- Resistant, stably transfected cells can be proliferated using tissue culture techniques appropriate to the cell type.
- Antibodies that bind FXI and/or FXIa as described herein can be used at a therapeutically useful concentration for the treatment of a thromboembolic disease or disorder, such as, for reduce the risk of stroke and/or systemic embolism in patients with ESRD and/or AF, undergoing dialysis.
- the present disclosure provides a method of treating thromboembolic disorders by administering to a subject in need thereof an effective amount of antibodies of the present disclosure.
- the present disclosure provides a method of treating thromboembolic disorders (e.g., ischemic stroke (cardioembolic, thrombotic) or systemic embolism, AF, stroke prevention in AF (SPAF), deep vein thrombosis, venous thromboembolism, pulmonary embolism, acute coronary syndromes (ACS), acute limb ischemia, chronic thromboembolic pulmonary hypertension, or systemic embolism) by administering to a subject in need thereof an effective amount of an anti-FXI/FXIa antibody of the present disclosure.
- thromboembolic disorders e.g., ischemic stroke (cardioembolic, thrombotic) or systemic embolism
- AF stroke prevention in AF
- AF stroke prevention in AF
- AF stroke prevention in AF
- AF deep vein thrombosis
- venous thromboembolism venous thromboembolism
- pulmonary embolism pulmonary embolism
- antibodies described herein can be used, inter alia, to prevent treat, prevent, and improve thromboembolic conditions or disorders, including but not limited to thrombotic disorders, as described in greater detail herein.
- the antibodies provided herein can also be used in combination with other agents for the prevention, treatment, or improvement of thromboembolic disorders.
- statin therapies may be used in combination with the FXIa antibodies and antigen binding fragments of the present disclosure for the treatment of patients with thrombotic and/or thromboembolic disorders.
- a method of treating or preventing stroke in a patient with AF comprising administering to the patient in need hereof an effective amount of an anti-FXI/FXIa antibody described herein, for example, an anti-FXI/FXIa antibody described in Table 1 , such as, NOV1401 or anti-FXI/FXIa antibodies comprising VL CDRs and VHCDRs of NOV1401 .
- a method of managing or preventing risks or conditions associated with atrial fibrillation (AF), such as cardioembolic stroke and systemic embolism in a patient with AF comprising administering to the patient in need hereof an effective amount of an anti-FXI/FXIa antibody described herein, for example, an anti-FXI/FXIa antibody described in Table 1 , such as, NOV1401 or anti-FXI/FXIa antibodies comprising VL CDRs and VHCDRs of NOV1401 .
- AF atrial fibrillation
- an AF patient has a high bleeding risk.
- an AF patient has a high bleeding risk as determined by a CHA 2 DS 2 VASc risk score > 2.
- an AF patient has non- valvular AF and a high bleeding risk as determined by a CHA 2 DS 2 VASc risk score > 2.
- an AF patient is age 55 or older, and has non-valvular AF and a high bleeding risk as determined by a CHA 2 DS 2 VASc risk score > 2.
- a method of treating, managing or preventing deep vein thrombosis or conditions associated therewith, in a subject comprising administering to the subject in need hereof an effective amount of an anti-FXI/FXIa antibody described herein, for example, an anti-FXI/FXIa antibody described in Table 1 , such as, NOV1401 or anti-FXI/FXIa antibodies comprising VL CDRs and VHCDRs of NOV1401 .
- a method of treating, managing or preventing venous thromboembolism (VTE) or conditions associated therewith, in a subject comprising administering to the subject in need hereof an effective amount of an anti-FXI/FXIa antibody described herein, for example, an anti-FXI/FXIa antibody described in Table 1 , such as, NOV1401 or anti-FXI/FXIa antibodies comprising VL CDRs and VHCDRs of NOV1401 .
- subjects being treated with an anti-FXI/FXIa antibody provided herein have experienced 1) a first provoked or unprovoked VTE with low risk for bleeding, 2) recurrence of unprovoked VTE, or 3) VTE associated with thrombophilia including cancer patients.
- the subject being treated for VTE is between the age of 0 and 18 years old.
- the subject being treated for VTE is between the age of 1 and 18 years old.
- the subject being treated for VTE is between the age of 2 and 18 years old.
- the subject being treated for VTE is between the age of 0 and 12 years old.
- the subject being treated for VTE is between the age of 1 and 12 years old. In a particular aspect, the subject being treated for VTE is between the age of 2 and 12 years old. In a particular aspect, the subject being treated for VTE is between the age of 12 and 18 years old. In a particular aspect, the subject being treated for VTE is a child at least 2 years old and under 18 years old. In a particular aspect, the subject being treated for VTE is a child at least 12 years old and under 18 years old.
- a method for secondary prevention e.g., secondary prevention for a period in the range of 28 days to 18 years of venous
- an anti-FXI/FXIa antibody described herein for example, an anti-FXI/FXIa antibody described in Table 1 , such as, NOV1401 or anti-FXI/FXIa antibodies comprising VL CDRs and VHCDRs of NOV1401 .
- an anti-FXI/FXIa antibody described in Table 1 such as, NOV1401 or anti-FXI/FXIa antibodies comprising VL CDRs and VHCDRs of NOV1401 .
- secondary prevention e.g., secondary prevention for a period in the range of 28 days to 18 years
- the subject is between the age of 0 and 18 years old.
- methods for secondary prevention e.g., secondary prevention for a period in the range of 28 days to 18 years
- the subject is between the age of 0 and 12 years old.
- methods for secondary prevention of venous thromboembolism provided herein the subject is between the age of 12 and 18 years old.
- the subject is a child at least 2 years old and under 18 years old.
- the subject is a child at least 12 years old and under 18 years old.
- a method of treating, managing or preventing pulmonary embolism or conditions associated therewith, in a subject comprising administering to the subject in need hereof an effective amount of an anti-FXI/FXIa antibody described herein, for example, an anti-FXI/FXIa antibody described in Table 1 , such as, NOV1401 or anti-FXI/FXIa antibodies comprising VL CDRs and VHCDRs of NOV1401 .
- a method of treating, managing or preventing acute coronary syndromes (ACS) or conditions associated therewith, in a subject comprising administering to the subject in need hereof an effective amount of an anti-FXI/FXIa antibody described herein, for example, an anti-FXI/FXIa antibody described in Table 1 , such as, NOV1401 or anti-FXI/FXIa antibodies comprising VL CDRs and VHCDRs of NOV1401 .
- an anti-FXI/FXIa antibody described herein for example, an anti-FXI/FXIa antibody described in Table 1 , such as, NOV1401 or anti-FXI/FXIa antibodies comprising VL CDRs and VHCDRs of NOV1401 .
- a method of treating, managing or preventing ischemic stroke, in a subject comprising administering to the subject in need hereof an effective amount of an anti- FXI/FXIa antibody described herein, for example, an anti-FXI/FXIa antibody described in Table 1 , such as, NOV1401 or anti-FXI/FXIa antibodies comprising VL CDRs and VHCDRs of NOV1401 .
- a method of treating, managing or preventing acute limb ischemia, in a subject comprising administering to the subject in need hereof an effective amount of an anti-FXI/FXIa antibody described herein, for example, an anti-FXI/FXIa antibody described in Table 1 , such as, NOV1401 or anti-FXI/FXIa antibodies comprising VL CDRs and VHCDRs of NOV1401 .
- a method of treating, managing or preventing chronic thromboembolic pulmonary hypertension, in a subject comprising administering to the subject in need hereof an effective amount of an anti-FXI/FXIa antibody described herein, for example, an anti-FXI/FXIa antibody described in Table 1 , such as, NOV1401 or anti-FXI/FXIa antibodies comprising VL CDRs and VHCDRs of NOV1401 .
- a method of treating, managing or preventing systemic embolism, in a subject comprising administering to the subject in need hereof an effective amount of an anti-FXI/FXIa antibody described herein, for example, an anti-FXI/FXIa antibody described in Table 1 , such as, NOV1401 or anti-FXI/FXIa antibodies comprising VL CDRs and VHCDRs of NOV1401 .
- thromboembolic conditions that are catheter-related conditions (e.g., Hickman catheter in cancer patients) in which catheters become thrombosed, or extracorporeal membrane oxygenation (ECMO), in which the tubing develops clots, comprising administering to the subject in need hereof an effective amount of an anti-FXI/FXIa antibody described herein, for example, an anti-FXI/FXIa antibody described in Table 1 , such as, NOV1401 or anti-FXI/FXIa antibodies comprising VL CDRs and VH CDRs of NOV1401 .
- catheter-related conditions e.g., Hickman catheter in cancer patients
- ECMO extracorporeal membrane oxygenation
- a method of preventing, treating or managing or reducing the risk of catheter-related thrombosis comprising administering to a subject in need thereof which is afflicated with ESRD initiated on hemodialysis with a catheter (e.g., inserted tunneled catheter), an effective amount of a pharmaceutical composition comprising an anti- FXI/FXIa antibody described herein, for example, an anti-FXI/FXIa antibody described in Table 1 , such as, NOV1401 or anti-FXI/FXIa antibodies comprising VL CDRs and VH CDRs of NOV1401 (e.g., VH CDRs of SEQ ID NO: 31 and VL CDRs of SEQ ID NO: 41).
- the subject has a demonstrated high risk of bleeding.
- the subject afflicted with ESRD has AF, such as non-valvular AF, and a high bleeding risk as determined by a CHA 2 DS 2 VASc risk score > 2.
- the subject afflicted with ESRD has AF, such as non-valvular AF, and a high bleeding risk as determined by a CHA 2 DS 2 VASc risk score > 2, and is 55 years old or older.
- vascular access survival e.g., tunneled catheter, arteriovenous graft and arteriovenous fistula
- said method or uses involve administering to patients an effective amount of an anti-FXI/FXIa antibody described herein, such as NOV1401 (e.g., antibody comprising SEQ ID NOs: 31 and 41).
- provided herein are methods for acute VTE treatment, primary and extended secondary prevention of VTE, prevention of major adverse thromboembolic events in patient undergoing dialysis (with or without AF), prevention of major cardiovascular and cerebral events (MACCE) in patients with CAD undergoing PCI and receiving single or dual antiplatelet therapy, post-acute coronary syndromes (ACS) patients, heparin induced thrombocytopenia (HIT), prevention of thromboembolic events in heart failure patients and secondary stroke prevention, wherein said methods comprise administering to a subject in need hereof an effective amount of an anti-FXI/FXIa antibody described herein, for example, an anti-FXI/FXIa antibody described in Table 1 , such as, NOV1401 or anti-FXI/FXIa antibodies comprising VL CDRs and VHCDRs of NOV1401 .
- subjects in need of treatment with an anti-FXI/FXIa antibody described herein for example, an anti-FXI/FXIa antibody described in Table 1 , such as, NOV1401 (e.g., antibody comprising a heavy chain comprising the amino acid sequence of SEQ ID NO: 31 and a light chain comprising the amino acid sequence of SEQ ID NO: 41) or anti-FXI/FXIa antibodies comprising VL CDRs and VHCDRs of NOV1401 , may include:
- one of the following conditions can be treated or managed with an anti-FXI/FXIa antibody described herein, for example, an anti-FXI/FXIa antibody described in Table 1 , such as, NOV1401 or anti-FXI/FXIa antibodies comprising VL CDRs and VHCDRs of NOV1401 :
- PAF stroke prevention in atrial fibrillation
- PCI percutaneous coronary interventions
- VTE acute venous thromboembolic events
- CTEPH Chronic Thromboembolic Pulmonary Hypertension
- arterial thrombosis on ruptured atherosclerotic plaque, thrombosis on intra-arterial prosthesis or catheter and thrombosis in apparently normal arteries this includes but not exclusively acute coronary syndromes, ST elevation myocardial infarction, non ST elevation myocardial infarction, unstable angina, stent thrombosis, thrombosis of any artificial surface in the arterial system and thrombosis of pulmonary arteries in subjects with or without pulmonary hypertension;
- PCI percutaneous coronary interventions
- cardiac thrombosis and thromboembolism this includes but not exclusively cardiac thrombosis after myocardial infarction, cardiac thrombosis related to condition such as cardiac aneurysm, myocardial fibrosis, cardiac enlargement and insufficiency, myocarditis and artificial surface in the heart;
- congenital or acquired thrombophilia including but not exclusively factor V Leiden, prothrombin mutation, antithrombin III, protein C and protein S deficiencies, factor XIII mutation, familial dysfibrinogenemia, congenital deficiency of plasminogen, increased levels of factor XI, sickle cell disease, antiphospholipid syndrome, autoimmune disease, chronic bowel disease, nephrotic syndrome, hemolytic uremia,
- myeloproliferative disease disseminated intra vascular coagulation, paroxysmal nocturnal hemoglobinuria and heparin induced thrombopenia;
- MALE major adverse limb event
- ESRD end stage renal disease
- GFR Glomerular Filtration Rate
- Symptoms of ESRD may include, but are not limited to, anemia, easy bleeding and bruising, headache, fatigue and drowsy feeling, weakness, mental symptoms (such as lowered mental alertness, trouble concentrating, confusion, seizures), nausea, vomiting, generally less desire to eat, muscle cramps, muscle twitching, nocturia (night-time urination), numb sensation in the extremities, diarrhea, itchy skin, itchy eyes, skin color changes (grayish complexion, sometimes yellowish-brownish tone), swelling and puffiness, difficulty breathing (due to fluid in the lungs, anemia), high blood pressure, and poor digestion.
- a treatment option for ESRD is dialysis (e.g., hemodialysis or peritoneal dialysis).
- a method of preventing, treating or managing or reducing the risk of stroke or thromboembolism comprising administering to a subject afflicated with end stage renal disease (ESRD), an effective amount of a pharmaceutical composition comprising an anti-FXI/FXIa antibody described herein, for example, an anti-FXI/FXIa antibody described in Table 1 , such as, NOV1401 or anti-FXI/FXIa antibodies comprising VL CDRs and VHCDRs of NOV1401 .
- the subject is receiving dialysis or extracorporeal membrane oxygenation.
- the subject is diagnosed with stage 4 chronic kidney disease.
- the subject is diagnosed with stage 3 or 4 chronic kidney disease.
- the subject is determined to have a creatinine clearance rate of approximately 15 to 60 mL/min (Cr C1 15 to 60 mL/min).
- a method of preventing, treating or managing or reducing the risk of stroke or thromboembolism comprising administering to a subject in need thereof who is afflicated with end stage renal disease (ESRD), an effective amount of a pharmaceutical composition comprising an anti-FXI/FXIa antibody comprising a VH and a VL comprising SEQ ID NOs: 29 and 39, respectively, or comprising a heavy chain comprising the amino acid sequence of SEQ ID NO: 31 and a light chain comprising the amino acid sequence of SEQ ID NO: 41 .
- the subject is receiving dialysis, such as hemodialysis, or extracorporeal membrane oxygenation.
- the subject is diagnosed with stage 4 chronic kidney disease. In certain aspects, the subject is diagnosed with stage 3 or 4 chronic kidney disease. In particular aspects, the subject is determined to have a creatinine clearance rate of approximately 15 to 60 mL/min (Cr C1 15 to 60 mL/min). In specific aspects, the subject also has atrial fibrillation (AF), such as, non-valvular AF.
- AF atrial fibrillation
- a method of preventing, treating or managing or reducing the risk of stroke or thromboembolism (e.g., systemic embolism) associated with hemodialysis for ESRD comprising administering to a subject in need thereof who is afflicated with end stage renal disease (ESRD), an effective amount of a
- the subject is receiving dialysis, such as hemodialysis, or extracorporeal membrane oxygenation.
- the subject is diagnosed with stage 4 chronic kidney disease.
- the subject is diagnosed with stage 3 or 4 chronic kidney disease.
- the subject is determined to have a creatinine clearance rate of approximately 15 to 60 mL/min (Cr C1 15 to 60 mL/min).
- the subject also has atrial fibrillation (AF), such as, non-valvular AF.
- AF atrial fibrillation
- a method of preventing or reducing the risk of stroke or thromboembolism comprising administering to a subject afflicated with atrial fibrillation (AF) and ESRD and who is undergoing dialysis, such as hemodialysis, or extracorporeal membrane oxygenation, an effective amount of a pharmaceutical composition comprising an anti-FXI/FXIa antibody described herein, for example, an anti-FXI/FXIa antibody described in Table 1 , such as, NOV1401 or anti-FXI/FXIa antibodies comprising VL CDRs and VHCDRs of NOV1401 .
- the subject is afflicted with non- valvular AF.
- the subject is afflicted with non-valvular AF with a demonstrated high risk of bleeding.
- the subject has a high bleeding risk as characterized by a CHA 2 DS 2 VASc risk score > 2.
- a method of preventing or reducing the risk of stroke or thromboembolism comprising administering to a subject afflicated with atrial fibrillation (AF) and ESRD and who is undergoing dialysis, such as hemodialysis, an effective amount of a pharmaceutical composition comprising an anti-FXI/FXIa antibody described herein, for example, an anti-FXI/FXIa antibody comprising a VH comprising the amino acid sequence of SEQ ID NO: 29 and a VL comprising the amino acid sequence of SEQ ID NO: 39, or a heavy chain comprising the amino acid sequence of SEQ ID NO: 31 and a light chain comprising the amino acid sequence of SEQ ID NO: 41 .
- the subject is afflicted with non-valvular AF.
- the subject is afflicted with non- valvular AF with a demonstrated high risk of bleeding.
- the subject has a high bleeding risk as characterized by a CHA 2 DS 2 VASc risk score > 2.
- a method of preventing, treating or managing or reducing the risk of stroke or thromboembolism, such as systemic embolism comprising administering to a subject in need thereof about 100 mg to about 250 mg of an anti-FXI/FXIa antibody (e.g.
- anti-FXI/FXIa antibody comprising a VH comprising the amino acid sequence of SEQ ID NO: 29 and a VL comprising the amino acid sequence of SEQ ID NO: 39, or a heavy chain comprising the amino acid sequence of SEQ ID NO: 31 and a light chain comprising the amino acid sequence of SEQ ID NO: 41), or antigen-binding fragment thereof that specifically binds within the catalytic domain of FXI, wherein the subject has one, two, or more, or all, of the following characteristics:
- Atrial fibrillation AF
- atrial flutter as documented by
- subjects with moderate to high risk for stroke and systemic embolism have a CHA 2 DS 2 VASc risk score > 2.
- subjects with a HAS BLED risk score > 3 is characterized as having a high risk of bleeding (see Gallego, et al., (2012) Care Arrhythm Electrophysiol.; 5:312-318, and Friberg et al., (2012) Circulation.; 125:2298-2307).
- thromboembolic events including stroke, systemic embolism, coronary or peripheral artery thrombosis, venous thrombosis and pulmonary embolism increases with presence of predisposing factors such as thrombophilia, vessel wall damage and stasis.
- Evaluation of medical history, familiar antecedents and associated co-morbidities can help to stratify patients according to their thromboembolic risks.
- several scoring systems e.g., CHADS2 and CHA 2 DS 2 -VASc have been developed to assess stroke risk.
- CHADS2 risk score was used stratification tool to predict thromboembolic risk in AF patients (LIP 201 1 ; Camm et al 2012); however, accumulated evidence shows that CHA 2 DS 2 -VASc is at least as good as or possibly better than, scores such as CHADS2 in identifying patients who develop stroke and thromboembolism and definitively better at identifying 'truly low-risk' patients with AF.
- CHA 2 DS 2 -VASc score is presently recommended by Guidelines (Camm et al Eur Heart J (2012) 33, 2719-2747; January et al, AHA/ACC/HRS Atrial Fibrillation Guideline; J Am Coll Cardiol 2014;64:2246-80) to guide the decision with regard to patients who should benefit of anticoagulant therapy and also to identify low risk patients in whom anticoagulation therapy is not warranted.
- Bleeding risk assessment tools specific to the AF patients e.g., HAS-BLED, ATRIA, HEMORR2HAGES; ORBIT and ABC risk score were developed to predict the bleeding risk in patients with AF.
- bleeding risk scores may become of considerable help to identify patients who can benefit of a new therapy with a reduced bleeding risk e.g. anti-FXI/FXIa antibody (e.g., antibody NOV1401).
- anti-FXI/FXIa antibody e.g., antibody NOV1401.
- subjects with demonstrated high risk of bleeding can be identified by previous medical history of bleeding, for example, bleeding during or after surgery or bleeding when treated with an anticoagulant (e.g. Warfarin).
- subjects with demonstrated high risk of bleeding can be identified by in vitro/ex vivo assays known in the art, for example, aPTT assay with a subject's plasma.
- Other non-limiting examples of bleeding risk factors include: history of previous stroke/TIA, previous major bleed or clinically relevant bleed, CKD stage 3 or 4 (Cr C1 15 to 60 Ml/min), treatment with dual antiplatelet therapy, e.g., post-ACS/PCI, and history of falls associated with hematoma bruise or other manifestations.
- a subject being treated by the methods provided herein is at least 18 years old. In another aspect, a subject being treated by the methods provided herein is at least 50 years old. In another aspect, a subject being treated by the methods provided herein is at least 55 years old. In another aspect, a subject being treated by the methods provided herein is at least 60 years old. In another aspect, a subject being treated by the methods provided herein is at least 65 years old.
- a subject being treated by the methods provided herein has a body mass index (BMI) that is greater than or equal to 18 kg/m 2 . In another aspect, a subject being treated by the methods provided herein has a BMI that is greater than or equal to 30 kg/m 2 . In another aspect, a subject being treated by the methods provided herein has a BMI that is greater than or equal to 35 kg/m 2 . In another aspect, a subject being treated by the methods provided herein has a BMI that is greater than or equal to 40 kg/m 2 . In a specific aspect, a subject being treated by the methods provided herein is a human subject.
- BMI body mass index
- methods provided herein results in one or more of the therapeutic benefits: (i) anticoagulation; (ii) reduction in hospital stay period, (iii) prolongation of clotting time, for example, as determined by aPTT; (iv) reduction in incidence of thrombosis or frequency of thrombosis; and (v) reduction in one or more symptoms associated with thromboembolic disorders (e.g., stroke, systemic embolism, myocardial infarction, deep venous thrombosis, pulmonary embolism, cardiovascular death, need for urgent
- methods provided herein results in prolongation of clotting time, for example, as determined by aPTT by 1 .2 fold, 1 .3 fold, 1 .4 fold, 1 .5 fold, 1 .6 fold, 1 .7 fold, 1 .8 fold, 1 .9 fold, or 2 fold.
- the present disclosure provides a method of treating, preventing, or managing or reducing the risk of thromboembolic disorders by administering to a subject in need thereof an effective amount of an anti-FXI/FXIa antibody described herein (e.g., NOV1401) in combination with another therapeutic active agent.
- combination therapies may be useful for treating thromboembolic disorders, such as, ischemic stroke (cardioembolic, thrombotic) or systemic embolism, AF, stroke prevention in AF (SPAF), deep vein thrombosis, venous thromboembolism, pulmonary embolism, acute coronary syndromes (ACS), acute limb ischemia, chronic thromboembolic pulmonary hypertension, or systemic embolism).
- non-limiting examples of therapeutic active agents suitable for use in combination with an anti-FXI/FXIa antibody described herein include thromboxane inhibitors (e.g., aspirin), adenosine diphosphate receptor antagonists (or P2Y12 inhibitors) such as thienopyridines (e.g., clopidogrel and prasugrel) and nonthienopyridines (e.g., ticagrelor and cangrelor), protease-activated receptor-1 (PARI) antagonists (e.g., vorapaxar and atopaxar), and proton pump inhibitors (PPIs) (e.g., omeprazole, diazepam, phenytoin, lansoprazole, dexlansoprazole, rabeprazole, pantoprazole, esomeprazole, and naproxen).
- PPIs proton pump inhibitors
- an anti-FXI/FXIa antibody provided herein (e.g., an antibody described in Table 1 , such as, an anti-FXI/FXIa antibody comprising VL CDRs and VHCDRs of NOV1401), for example, bleeding associated with trauma, surgery menstruation or post- delivery, said method comprises reversing of the anticoagulant effect.
- FXI deficiency is rarely associated with spontaneous bleeding manifestations; in specific aspects, bleeding is most typically associated with trauma, surgery, menstruation or post-delivery.
- Prolonged bleeding may occur after a major trauma or after surgery involving organs with high fibrinolytic area such as buccal, nasal, genital or urinary mucosa. Tooth extraction, tonsillectomy and ablation of the uterus or prostate are examples of surgeries that entail a high risk of bleeding. People with the disorder also have a strong tendency to develop epistaxis and ecchymoses, and more rarely, bleeding into the urine or intestines. Spontaneous muscle or joint and intracranial bleeding frequency is not increased in patients with FXI deficiency. Venous puncture is not usually associated with an extended bleeding. Other genetic mutations associated with FXI deficiency may contribute to the heterogeneous and unpredictable bleeding tendency in patients with severe FXI deficiency.
- a method of managing bleeding in a patient e.g., patient with ESRD and/or AF
- an anti-FXI/FXIa antibody provided herein (e.g., an antibody described in Table 1 , such as, an anti-FXI/FXIa antibody comprising VL CDRs and VHCDRs of NOV1401)
- said method comprises temporarily reversing of the anticoagulant effect for a sufficient time to manage the bleeding.
- the step of reversing of the anticoagulant effect comprises (i) fluid replacement using colloids, crystalloids, human plasma or plasma proteins such as albumin; or (ii) transfusion with packed red blood or whole blood.
- therapeutic agents for reversal of the effect of anticoagulants include, but are not limited to, prohemostasis blood components such as fresh frozen plasma (FFP), prothrombin complex concentrates (PCC) and activated PCC [(APCC); e.g. factor VIII inhibitor bypass activity (FEIBA)] and recombinant activated factor VII (rFVIIa).
- a regimen comprising administration of rFVIIa at a dose of 30 ⁇ g/kg followed by administration of rFVIIa at a dose of 15-30 ⁇ g/kg every 2-4 hours for 24-48 hours in addition to tranexamic acid 1 g every 6 hours for 5 to 7 days may have potential to recover hemostasis and stop bleeding in subjects treated with an anti-FXI/FXIa antibody provided herein (e.g., NOV1401 or an antibody comprising VL CDRs and VH CDRs of NOV1401 ) who are undergoing major surgery and in patients with an active non-accessible bleeding site.
- an anti-FXI/FXIa antibody provided herein (e.g., NOV1401 or an antibody comprising VL CDRs and VH CDRs of NOV1401 ) who are undergoing major surgery and in patients with an active non-accessible bleeding site.
- Riddell et al reported experience in 4 patients with severe FXI deficiency without inhibitor undergoing surgery (Riddell et al., 201 1 , Thromb. Haemost.; 106: 521-527); patients were administered rFVIIa 30 ⁇ g/kg and tranexamic acid 1 g i.v. at induction of anesthesia. Subsequent bolus doses of rFVIIa 15-30 ⁇ g/kg were administered at 2 to 4 hourly intervals as guided by rotational thromboelastometry (ROTEM) results. Patients were treated with rFVIIa at above mentioned doses for 24-48 hours. Tranexamic acid 1 g every six-hourly was continued for five days.
- ROTEM rotational thromboelastometry
- FVIIa Recombinant FVIIa at doses ranging from 15 to 30 ⁇ g/kg was infused at the completion of surgery. Subsequently, oral tranexamic acid 1 g was given every 6 hour for at least 7 days. Fibrin glue was sprayed at the bed of the extirpated gallbladder in one patient. This protocol secured normal hemostasis in patients with severe FXI deficiency with inhibitor. In one aspect, fibrin glue can be used to restore local hemostasis during dental surgery in patients with FXI deficiency (Bolton-Maggs (2000) Haemophilia; 6 (S1):100-9).
- a regimen consisting of tranexamic acid 1 g every 6 hours for 5 to 7 days associated with the use of fibrin glue could be used to establish local hemostasis in subjects undergoing minor surgery and in subjects with accessible bleeding site, including oral and nasal bleeding events.
- an anti-FXI antibody described herein e.g., antibody described in Table 1 such as NOV1401 or an anti- FXI antibody comprising HCDRs and LCDRs of NOV1401
- an anti-idiotype antibody, or antigen binding fragment thereof e.g., Fab
- an anti-idiotype antibody or antigen binding fragment thereof e.g., Fab
- an anti-idiotype antibody or antigen binding fragment thereof e.g., Fab
- Fab an anti-idiotype antibody or antigen binding fragment thereof (e.g., Fab) reverses the effects of an anti-FXI antibody described herein to mitigate bleeding risks, for example during urgent major surgery or trauma.
- an anti-idiotype antibody or antigen binding fragment thereof reverses or inhibits an anti-FXI antibody's anti-coagulant effects.
- the anti-idiotype antibody or antigen binding fragment thereof e.g., Fab
- an anti-FXI antibody such as NOV1401 (e.g., SEQ ID NOs: 31 and 41), comprising the step of administering to the patient in need thereof, an antiidiotype antibody, or antigen binding fragment thereof (e.g., Fab), of the anti-FXI antibody such as NOV1401 (e.g., SEQ ID NOs: 31 and 41), wherein the anti-idiotype, or antigen binding fragment thereof (e.g., Fab), specifically binds to the antigen-binding region of an anti- FXI antibody such as NOV1401 (e.g., SEQ ID NOs: 31 and 41) and blocks the anti-FXI antibody from binding to FXI and/or FXIa.
- an antiidiotype antibody, or antigen binding fragment thereof e.g., Fab
- the anti-idiotype antibody, or antigen binding fragment thereof (e.g., Fab), of an anti-FXI antibody such as NOV1401 (e.g., SEQ ID NOs: 31 and 41) reverses or inhibits one or more of the anti-coagulant effects of the anti-FXI antibody (e.g., NOV1401 ).
- NOV1401 e.g., SEQ ID NOs: 31 and 41
- a temporary reversal or inhibition of one or more of the anti-coagulant effects of the anti-FXI antibody (e.g., NOV1401 ) is achieved.
- the anti-FXI antibody e.g., NOV1401
- the anti-FXI antibody is again administered to the patient.
- Anti-ldiotype antibodies can be produced by various methods described previously, see, e.g., Pan et al., 1995, FASEB J. 9:43-49.
- Anti-idiotype antibodies are elicited by an antibody molecule (e.g., NOV1401) and are directed against antigenic determinants in or close to the antibody's combining site (idiotope).
- Anti-idiotype antibodies recognize antigenic determinants that overlap a portion of the combining site that is in contact with the original antigen and they can mimic the eliciting antigen.
- compositions comprising FXIa-binding antibodies (intact or binding fragments), e.g., anti-FXI/FXIa antibodies described in Table 1 , formulated together with a pharmaceutically acceptable carrier, for use in the methods described herein (e.g., methods of reducing the risk of stroke and/or systemic embolism).
- the compositions can additionally contain one or more other therapeutic agents that are suitable for treating or preventing, for example, thromboembolic disorders (e.g., thrombotic disorders).
- Pharmaceutically acceptable carriers enhance or stabilize the composition, or can be used to facilitate preparation of the composition.
- Pharmaceutically acceptable carriers include solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible.
- a pharmaceutical composition for use the present disclosure can be administered by a variety of methods known in the art.
- the route and/or mode of administration vary depending upon the desired results. It is preferred that administration be intravenous (i.v.), intramuscular (i.m.), intraperitoneal (i.p.), or subcutaneous (s.c), or administered proximal to the site of the target.
- the pharmaceutically acceptable carrier should be suitable for intravenous, intramuscular, subcutaneous, parenteral, spinal or epidermal administration (e.g., by injection or infusion).
- the active compound i.e., antibody, bispecific and multispecific molecule, may be coated in a material to protect the compound from the action of acids and other natural conditions that may inactivate the compound.
- anti-FXI/FXIa antibodies described herein are formulated at approximately 75 mg/1 ml_ to approximately 200 mg/1 ml_ concentration, in liquid vials for subcutaneous injections.
- the pharmaceutical composition comprises a pharmaceutical carrier or excipient, for example, sucrose, and polysorbate 20.
- the pharmaceutical composition comprises L-histidine and/or histidine HCI monohydrate.
- the pharmaceutical composition has a pH of approximately 4 to 7, or 5 to 6.
- anti-FXI/FXIa antibodies described herein are formulated at 150 mg/1 ml_ concentration, in liquid vials for subcutaneous injections.
- the composition should be sterile and fluid. Proper fluidity can be maintained, for example, by use of coating such as lecithin, by maintenance of required particle size in the case of dispersion and by use of surfactants.
- isotonic agents for example, sugars, polyalcohols such as mannitol or sorbitol, and sodium chloride in the composition.
- Long-term absorption of the injectable compositions can be brought about by including in the composition an agent which delays absorption, for example, aluminum monostearate or gelatin.
- compositions for use the present disclosure can be prepared in accordance with methods well known and routinely practiced in the art. See, e.g., Remington: The Science and Practice of Pharmacy, Mack Publishing Co., 20th ed., 2000; and Sustained and Controlled Release Drug Delivery Systems, J.R. Robinson, ed., Marcel Dekker, Inc., New York, 1978. Pharmaceutical compositions are preferably manufactured under GMP conditions. Typically, a therapeutically effective dose or efficacious dose of the FXIa-binding antibody is employed in the pharmaceutical compositions of the present disclosure. The FXIa-binding antibodies are formulated into pharmaceutically acceptable dosage forms by conventional methods known to those of skill in the art.
- Dosage regimens are adjusted to provide the optimum desired response (e.g., a therapeutic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage.
- Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
- Actual dosage levels of the active ingredients in the pharmaceutical compositions of the present disclosure can be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient.
- the selected dosage level depends upon a variety of pharmacokinetic factors including the activity of the particular compositions of the present disclosure employed, thereof, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors.
- a physician can start doses of the antibodies of the present disclosure employed in the pharmaceutical composition at levels lower than that required to achieve the desired therapeutic effect and gradually increase the dosage until the desired effect is achieved.
- effective doses of the compositions of the present disclosure, for the treatment of a thrombotic and/or thromboembolic disorders described herein vary depending upon many different factors, including means of administration, target site, physiological state of the patient, other medications administered, and whether treatment is prophylactic or therapeutic. Treatment dosages need to be titrated to optimize safety and efficacy. For systemic administration with an antibody, the dosage ranges from about 0.01 to 15 mg/kg of the host body weight.
- the dosage may range from 0.1 mg to 5 mg or from 1 mg to 600 mg.
- an anti- FXI/FXIa antibody described herein can be administered at a dose of 0.1 mg/kg, 0.2 mg/kg, 0.3 mg/kg, 0.4 mg/kg, 0.5 mg/kg, 0.6 mg/kg, 0.7 mg/kg, 0.8 mg/kg, 0.9 mg/kg, 1 .0 mg/kg, 1 .1 mg/kg, 1 .2 mg/kg, 1 .3 mg/kg, 1 .4 mg/kg, 1 .5 mg/kg, 1 .6 mg/kg, 1 .7 mg/kg, 1 .8 mg/kg, 1 .9 mg/kg, 2.0 mg/kg, 2.1 mg/kg, 2.2 mg/kg, 2.3 mg/kg, 2.4 mg/kg, 2.5 mg/kg, 2.6 mg/kg, 2.7 mg/kg, 2.8 mg/kg, 2.9 mg/kg, 3.0
- An exemplary treatment regime entails systemic administration once per every two weeks or once a month or once every 3 to 6 months.
- An exemplary treatment regime entails systemic administration once per week, once per every two weeks, once per every three weeks, once a month, or once every 3 to 6 months, or as needed (PRN).
- an anti-FXI/FXIa antibody described herein e.g., an antibody described in Table 1 , such as NOV1401 or an antibody comprising VL CDRs and VH CDRs of NOV1401
- is administered for example by i.v. or s.c, at a dose of 3 mg/kg.
- such anti-FXI/FXIa antibody is administered once every week, once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month).
- an anti-FXI/FXIa antibody described herein e.g., an antibody described in Table 1 , such as NOV1401 or an antibody comprising VL CDRs and VH CDRs of NOV1401
- is administered for example by i.v. or s.c, at a dose of 10 mg/kg.
- such anti-FXI/FXIa antibody is administered once every week, once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month).
- an anti-FXI/FXIa antibody described herein e.g., an antibody described in Table 1 , such as NOV1401 or an antibody comprising VL CDRs and VH CDRs of NOV1401
- such anti-FXI/FXIa antibody is administered once every week, once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month).
- an anti-FXI/FXIa antibody described herein e.g., an antibody described in Table 1 , such as NOV1401 or an antibody comprising VL CDRs and VH CDRs of NOV1401
- such anti-FXI/FXIa antibody is administered once every week, once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month).
- an anti-FXI/FXIa antibody described herein e.g., an antibody described in Table 1 , such as NOV1401 or an antibody comprising VL CDRs and VH CDRs of NOV1401
- such anti-FXI/FXIa antibody is administered once every week, once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month).
- an anti-FXI/FXIa antibody described herein e.g., an antibody described in Table 1 , such as NOV1401 or an antibody comprising VL CDRs and VH CDRs of NOV1401), for use in the methods provided herein (e.g., methods for preventing, treating or managing or reducing the risk of stroke or thromboembolism such as systemic embolism), is administered, for example by i.v. or s.c. route, at a dose in the range of 5 mg to 600 mg.
- an anti-FXI/FXIa antibody described herein e.g., an antibody described in Table 1 , such as NOV1401 or an antibody comprising VL CDRs and VH CDRs of
- NOV1401 for use in the methods provided herein (e.g., methods for preventing, treating or managing or reducing the risk of stroke or thromboembolism such as systemic embolism), is administered, for example by i.v. or s.c. route, at a dose in the range of 100 mg to 200 mg, for example, once every week, once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month).
- an anti-FXI/FXIa antibody described herein e.g., an antibody described in Table 1 , such as NOV1401 or an antibody comprising VL CDRs and VH CDRs of NOV1401), for use in the methods provided herein (e.g., methods for preventing, treating or managing or reducing the risk of stroke or thromboembolism such as systemic embolism), is administered, for example by i.v. or s.c.
- a subject in need thereof e.g., subject with atrial fibrillation and/or with ESRD
- such anti-FXI/FXIa antibody is administered once every week, once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month). In a particular aspect, such anti-FXI/FXIa antibody is administered once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month).
- an anti-FXI/FXIa antibody described herein e.g., an antibody described in Table 1 , such as NOV1401 or an antibody comprising VL CDRs and VH CDRs of NOV1401), for use in the methods provided herein (e.g., methods for preventing, treating or managing or reducing the risk of stroke or thromboembolism such as systemic embolism), is administered to a subject in need thereof (e.g., subject with atrial fibrillation and/or with ESRD), for example by s.c. route, at a dose of 5 mg.
- a subject in need thereof e.g., subject with atrial fibrillation and/or with ESRD
- such anti-FXI/FXIa antibody is administered once every week, once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month). In a particular aspect, such anti-FXI/FXIa antibody is administered once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month).
- an anti-FXI/FXIa antibody described herein e.g., an antibody described in Table 1 , such as NOV1401 or an antibody comprising VL CDRs and VH CDRs of NOV1401), for use in the methods provided herein (e.g., methods for preventing, treating or managing or reducing the risk of stroke or thromboembolism such as systemic embolism), is administered to a subject in need thereof (e.g., subject with atrial fibrillation and/or with ESRD), for example by s.c. route, at a dose of 15 mg.
- a subject in need thereof e.g., subject with atrial fibrillation and/or with ESRD
- such anti-FXI/FXIa antibody is administered once every week, once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month). In a particular aspect, such anti-FXI/FXIa antibody is administered once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month).
- an anti-FXI/FXIa antibody described herein e.g., an antibody described in Table 1 , such as NOV1401 or an antibody comprising VL CDRs and VH CDRs of NOV1401), for use in the methods provided herein (e.g., methods for preventing, treating or managing or reducing the risk of stroke or thromboembolism such as systemic embolism), is administered to a subject in need thereof (e.g., subject with atrial fibrillation and/or with ESRD), for example by s.c. route, at a dose of 50 mg.
- a subject in need thereof e.g., subject with atrial fibrillation and/or with ESRD
- such anti-FXI/FXIa antibody is administered once every week, once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month). In a particular aspect, such anti-FXI/FXIa antibody is administered once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month).
- an anti-FXI/FXIa antibody described herein e.g., an antibody described in Table 1 , such as NOV1401 or an antibody comprising VL CDRs and VH CDRs of NOV1401), for use in the methods provided herein (e.g., methods for preventing, treating or managing or reducing the risk of stroke or thromboembolism such as systemic embolism), is administered to a subject in need thereof (e.g., subject with atrial fibrillation and/or with ESRD), for example by s.c. route, at a dose of 120 mg.
- a subject in need thereof e.g., subject with atrial fibrillation and/or with ESRD
- such anti- FXI/FXIa antibody is administered once every week, once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month). In a particular aspect, such anti- FXI/FXIa antibody is administered once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month).
- an anti-FXI/FXIa antibody described herein e.g., an antibody described in Table 1 , such as NOV1401 or an antibody comprising VL CDRs and VH CDRs of NOV1401), for use in the methods provided herein (e.g., methods for preventing, treating or managing or reducing the risk of stroke or thromboembolism such as systemic embolism), is administered to a subject in need thereof (e.g., subject with atrial fibrillation and/or with ESRD), for example by s.c. route, at a dose of 150 mg.
- a subject in need thereof e.g., subject with atrial fibrillation and/or with ESRD
- such anti- FXI/FXIa antibody is administered once every week, once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month). In a particular aspect, such anti- FXI/FXIa antibody is administered once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month).
- an anti-FXI/FXIa antibody described herein e.g., an antibody described in Table 1 , such as NOV1401 or an antibody comprising VL CDRs and VH CDRs of NOV1401), for use in the methods provided herein (e.g., methods for preventing, treating or managing or reducing the risk of stroke or thromboembolism such as systemic embolism), is administered to a subject in need thereof (e.g., subject with atrial fibrillation and/or with ESRD), for example by s.c. route, at a dose of 180 mg.
- a subject in need thereof e.g., subject with atrial fibrillation and/or with ESRD
- such anti- FXI/FXIa antibody is administered once every week, once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month). In a particular aspect, such anti- FXI/FXIa antibody is administered once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month).
- an anti-FXI/FXIa antibody described herein e.g., an antibody described in Table 1 , such as NOV1401 or an antibody comprising VL CDRs and VH CDRs of NOV1401), for use in the methods provided herein (e.g., methods for preventing, treating or managing or reducing the risk of stroke or thromboembolism such as systemic embolism), is administered to a subject in need thereof (e.g., subject with atrial fibrillation and/or with ESRD), for example by s.c. route, at a dose of 210 mg.
- a subject in need thereof e.g., subject with atrial fibrillation and/or with ESRD
- such anti- FXI/FXIa antibody is administered once every week, once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month). In a particular aspect, such anti- FXI/FXIa antibody is administered once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month).
- an anti-FXI/FXIa antibody described herein e.g., an antibody described in Table 1 , such as NOV1401 or an antibody comprising VL CDRs and VH CDRs of NOV1401), for use in the methods provided herein (e.g., methods for preventing, treating or managing or reducing the risk of stroke or thromboembolism such as systemic embolism), is administered to a subject in need thereof (e.g., subject with atrial fibrillation and/or with ESRD), for example by s.c. route, at a dose of 300 mg.
- a subject in need thereof e.g., subject with atrial fibrillation and/or with ESRD
- such anti- FXI/FXIa antibody is administered once every week, once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month). In a particular aspect, such anti- FXI/FXIa antibody is administered once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month).
- an anti-FXI/FXIa antibody described herein e.g., an antibody described in Table 1 , such as NOV1401 or an antibody comprising VL CDRs and VH CDRs of NOV1401), for use in the methods provided herein (e.g., methods for preventing, treating or managing or reducing the risk of stroke or thromboembolism such as systemic embolism), is administered to a subject in need thereof (e.g., subject with atrial fibrillation and/or with ESRD), for example by s.c. route, at a dose of 600 mg.
- a subject in need thereof e.g., subject with atrial fibrillation and/or with ESRD
- such anti- FXI/FXIa antibody is administered once every week, once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month). In a particular aspect, such anti- FXI/FXIa antibody is administered once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month).
- an anti-FXI/FXIa antibody described herein e.g., an antibody described in Table 1 , such as NOV1401 or an antibody comprising VL CDRs and VH CDRs of NOV1401), for use in the methods provided herein (e.g., methods for preventing, treating or managing or reducing the risk of stroke or thromboembolism such as systemic embolism), is administered to a subject in need thereof (e.g., subject with atrial fibrillation and/or with ESRD), for example by s.c. route, at a dose of 5 mg or greater.
- a subject in need thereof e.g., subject with atrial fibrillation and/or with ESRD
- such anti- FXI/FXIa antibody is administered once every week, once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month). In a particular aspect, such anti- FXI/FXIa antibody is administered once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month).
- an anti-FXI/FXIa antibody described herein e.g., an antibody described in Table 1 , such as NOV1401 or an antibody comprising VL CDRs and VH CDRs of NOV1401), for use in the methods provided herein (e.g., methods for preventing, treating or managing or reducing the risk of stroke or thromboembolism such as systemic embolism), is administered to a subject in need thereof (e.g., subject with atrial fibrillation and/or with ESRD), for example by s.c. route, at a dose of 15 mg or greater.
- a subject in need thereof e.g., subject with atrial fibrillation and/or with ESRD
- such anti-FXI/FXIa antibody is administered once every week, once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month). In a particular aspect, such anti- FXI/FXIa antibody is administered once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month).
- an anti-FXI/FXIa antibody described herein e.g., an antibody described in Table 1 , such as NOV1401 or an antibody comprising VL CDRs and VH CDRs of NOV1401), for use in the methods provided herein (e.g., methods for preventing, treating or managing or reducing the risk of stroke or thromboembolism such as systemic embolism), is administered to a subject in need thereof (e.g., subject with atrial fibrillation and/or with ESRD), for example by s.c. route, at a dose of 50 mg or greater.
- a subject in need thereof e.g., subject with atrial fibrillation and/or with ESRD
- such anti-FXI/FXIa antibody is administered once every week, once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month). In a particular aspect, such anti- FXI/FXIa antibody is administered once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month).
- an anti-FXI/FXIa antibody described herein e.g., an antibody described in Table 1 , such as NOV1401 or an antibody comprising VL CDRs and VH CDRs of NOV1401), for use in the methods provided herein (e.g., methods for preventing, treating or managing or reducing the risk of stroke or thromboembolism such as systemic embolism), is administered to a subject in need thereof (e.g., subject with atrial fibrillation and/or with ESRD), for example by s.c. route, at a dose of 120 mg or greater.
- a subject in need thereof e.g., subject with atrial fibrillation and/or with ESRD
- such anti-FXI/FXIa antibody is administered once every week, once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month). In a particular aspect, such anti- FXI/FXIa antibody is administered once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month).
- an anti-FXI/FXIa antibody described herein e.g., an antibody described in Table 1 , such as NOV1401 or an antibody comprising VL CDRs and VH CDRs of NOV1401), for use in the methods provided herein (e.g., methods for preventing, treating or managing or reducing the risk of stroke or thromboembolism such as systemic embolism), is administered to a subject in need thereof (e.g., subject with atrial fibrillation and/or with ESRD), for example by s.c. route, at a dose of 150 mg or greater.
- a subject in need thereof e.g., subject with atrial fibrillation and/or with ESRD
- such anti-FXI/FXIa antibody is administered once every week, once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month). In a particular aspect, such anti- FXI/FXIa antibody is administered once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month).
- an anti-FXI/FXIa antibody described herein e.g., an antibody described in Table 1 , such as NOV1401 or an antibody comprising VL CDRs and VH CDRs of NOV1401), for use in the methods provided herein (e.g., methods for preventing, treating or managing or reducing the risk of stroke or thromboembolism such as systemic embolism), is administered to a subject in need thereof (e.g., subject with atrial fibrillation and/or with ESRD), for example by s.c. route, at a dose of 180 mg or greater.
- a subject in need thereof e.g., subject with atrial fibrillation and/or with ESRD
- such anti-FXI/FXIa antibody is administered once every week, once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month). In a particular aspect, such anti- FXI/FXIa antibody is administered once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month).
- an anti-FXI/FXIa antibody described herein e.g., an antibody described in Table 1 , such as NOV1401 or an antibody comprising VL CDRs and VH CDRs of NOV1401), for use in the methods provided herein (e.g., methods for preventing, treating or managing or reducing the risk of stroke or thromboembolism such as systemic embolism), is administered to a subject in need thereof (e.g., subject with atrial fibrillation and/or with ESRD), for example by s.c. route, at a dose of 210 mg or greater.
- a subject in need thereof e.g., subject with atrial fibrillation and/or with ESRD
- such anti-FXI/FXIa antibody is administered once every week, once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month). In a particular aspect, such anti- FXI/FXIa antibody is administered once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month).
- an anti-FXI/FXIa antibody described herein e.g., an antibody described in Table 1 , such as NOV1401 or an antibody comprising VL CDRs and VH CDRs of NOV1401), for use in the methods provided herein (e.g., methods for preventing, treating or managing or reducing the risk of stroke or thromboembolism such as systemic embolism), is administered to a subject in need thereof (e.g., subject with atrial fibrillation and/or with ESRD), for example by s.c. route, at a dose of 300 mg or greater.
- a subject in need thereof e.g., subject with atrial fibrillation and/or with ESRD
- such anti-FXI/FXIa antibody is administered once every week, once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month). In a particular aspect, such anti- FXI/FXIa antibody is administered once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month).
- an anti-FXI/FXIa antibody described herein e.g., an antibody described in Table 1 , such as NOV1401 or an antibody comprising VL CDRs and VH CDRs of NOV1401
- an anti-FXI/FXIa antibody described herein e.g., an antibody described in Table 1 , such as NOV1401 or an antibody comprising VL CDRs and VH CDRs of NOV1401
- antibody NOV1401 e.g., antibody comprising a heavy chain comprising the amino acid sequence of SEQ ID NO: 31 and a light chain comprising the amino acid sequence of SEQ ID NO: 41
- a pharmaceutical composition comprising NOV1401 and a pharmaceutically acceptable carrier is for use in preventing, treating, or managing or reducing the risk of stroke or thromboembolism, such as systemic embolism, associated with treatment for ESRD, such as hemodialysis, wherein the antibody is administered subcutaneously, at a dose in the range of 100 mg to 300 mg.
- antibody NOV1401 e.g., antibody comprising a heavy chain comprising the amino acid sequence of SEQ ID NO: 31 and a light chain comprising the amino acid sequence of SEQ ID NO: 41
- a pharmaceutical composition comprising NOV1401 and a pharmaceutically acceptable carrier is for use in preventing, treating, or managing or reducing the risk of stroke or thromboembolism, such as systemic embolism, associated with treatment for ESRD, such as hemodialysis, in a subject, wherein the antibody is administered subcutaneously, at a dose of approximately 100 mg, 120 mg, 150 mg, 180 mg, 210 mg, or 240 mg, once a month.
- the subject is afflicted with AF and ESRD.
- antibody NOV1401 e.g., antibody comprising a heavy chain comprising the amino acid sequence of SEQ ID NO: 31 and a light chain comprising the amino acid sequence of SEQ ID NO: 41
- a pharmaceutical composition comprising NOV1401 or an antigen-binding fragment thereof and a pharmaceutically acceptable carrier, is for use in preventing, treating, or managing or reducing the risk of stroke or
- thromboembolism such as systemic embolism
- a subject afflicted with AF such as non- vavular AF
- the antibody is administered subcutaneously, at a dose in the range of 100 mg to 300 mg., once a month.
- the subject has non-valvular AF with a demonstrated high risk of bleeding, for example, as determined by a CHA 2 DS 2 VASc risk score > 2, and wherein the subject is 55 years old or older.
- antibody NOV1401 e.g., antibody comprising a heavy chain comprising the amino acid sequence of SEQ ID NO: 31 and a light chain comprising the amino acid sequence of SEQ ID NO: 41
- a pharmaceutical composition comprising NOV1401 or an antigen-binding fragment thereof and a pharmaceutically acceptable carrier, is for use in preventing, treating, or managing or reducing the risk of stroke or
- thromboembolism such as systemic embolism
- AF such as non- valvular AF
- the antibody is administered subcutaneously, at a dose of approximately 100 mg, 120 mg, 150 mg, 180 mg, 210 mg, 240 mg, or 300 mg, once a month.
- the subject has non-valvular AF with a demonstrated high risk of bleeding, for example, as determined by a CHA 2 DS 2 VASc risk score > 2, and wherein the subject is 55 years old or older.
- such anti-FXI/FXIa antibody is administered once every week, once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month).
- such anti-FXI/FXIa antibody is administered once every two weeks, once every 3 weeks, or once every 4 weeks (or once every month). In a specific aspect, such anti-FXI/FXIa antibody is administered at a dose of approximately 100 mg, 1 10 mg, 120 mg, 130 mg, or 140 mg once every week or once every two weeks. In a specific aspect, such anti-FXI/FXIa antibody is administered at a dose of approximately 140 mg, 150 mg, 160 mg, 170 mg, or 180 mg, once every 3 weeks or once every 4 weeks (or once every month). In a particular aspect, such anti-FXI/FXIa antibody is administered at a dose of 150 mg or 1 80 mg once every 3 weeks or once every 4 weeks (or once every month).
- antibody NOV1401 e.g., antibody comprising a heavy chain comprising the amino acid sequence of SEQ ID NO: 31 and a light chain comprising the amino acid sequence of SEQ ID NO: 41
- a pharmaceutical composition comprising NOV1401 or an antigen-binding fragment thereof and a pharmaceutically acceptable carrier, is for use in preventing, treating, or managing or reducing the risk of stroke or
- thromboembolism such as systemic embolism
- a subject afflicted with AF such as non- valvular AF
- the antibody is administered subcutaneously, at a dose of 120 mg, 150 mg, or 180 mg, once a month.
- the subject has non-valvular AF with a demonstrated high risk of bleeding, for example, as determined by a CHA 2 DS 2 VASc risk score > 2, and wherein the subject is 55 years old or older.
- Antibody is usually administered on multiple occasions. Intervals between single dosages can be weekly, biweekly, monthly or yearly. Intervals can also be irregular as indicated by measuring blood levels of FXI- and/or FXIa-binding antibody in the patient. In addition alternative dosing intervals can be determined by a physician and administered monthly or as necessary to be efficacious. In some methods of systemic administration, dosage is adjusted to achieve a plasma antibody concentration of 1 -1000 ⁇ g/mL or 1 - 1200 ⁇ g/mL, and in some methods 25-500 ⁇ g/mL. Alternatively, antibody can be administered as a sustained release formulation, in which case less frequent administration is required. Dosage and frequency vary depending on the half-life of the antibody and its target in the patient.
- human and humanized antibodies show longer half-life, in humans, than that of chimeric antibodies and nonhuman antibodies.
- the dosage and frequency of administration can vary depending on whether the treatment is prophylactic or therapeutic. In prophylactic applications, a relatively low dosage is administered at relatively infrequent intervals over a long period of time. Some patients continue to receive treatment for the rest of their lives. In therapeutic applications, a relatively high dosage at relatively short intervals is sometimes required until progression of the disease is reduced or terminated, and preferably until the patient shows partial or complete amelioration of symptoms of disease. Thereafter, the patient can be administered a prophylactic regimen.
- SPR Surface plasmon resonance
- the SPR measurements were performed on a BIACORETM T200 surface plasmon resonance based optical biosensor (BIACORETM, GE Healthcare, Uppsala).
- Series S sensor chips (CM5), immobilization kits and regeneration buffer were purchased from GE Healthcare (Uppsala).
- Two different assay setups were performed depending on the ligand format, IgG or Fab.
- the surface was activated by /V-hydroxysuccinimide (NHS) and ⁇ /-(3- dimethylaminopropyl)-/V-ethylcarbodiimide hydrochloride (EDC).
- NHS /V-hydroxysuccinimide
- EDC ⁇ /-(3- dimethylaminopropyl)-/V-ethylcarbodiimide hydrochloride
- the NOV1401 -Fab was covalently attached to the activated dextran matrix on a CM5 chip by the standard amine- coupling method (GE Healthcare, Uppsala).
- a capture assay was performed and a goat anti-human IgG-Fc antibody (JIR) was immobilized on the chip at 14000 RUs. Remaining active surface groups were inactivated with Ethanolamine (EA).
- EA Ethanolamine
- a reference cell without immobilized ligand was prepared and the system equilibrated with 1x HBS-EP+ buffer (10 mM HEPES, 150 mM NaCI, 3 mM EDTA, 0.05% P20, pH 7.4, Teknova H8022).
- 60 ⁇ /well of each dilution mix was distributed in duplicates to a 384-well polypropylene MTP.
- Sample buffer served as negative control and a sample containing no antigen as positive control (Bmax).
- Bmax positive control
- the plate was sealed and incubated overnight at RT on a shaker.
- a standard 384-well MSD array MTP was coated with 30 ⁇ /well of 0.1 ⁇ g/ml huFXIa (for huFXIa and huFXI) diluted in PBS, sealed and incubated overnight at 4°C.
- the antigen-coated MSD plate was blocked with 50 ⁇ /well blocking buffer (PBS containing 5 % BSA) and incubated for 1 h at RT on a shaker. The wash step was repeated and 30 ⁇ /well of the Fab-/lgG-antigen preparation was transferred from the polypropylene MTP to the antigen coated MSD plate and incubated for 20 min at RT on a shaker.
- ECL-labeled goat anti-human-lgG/Fab detection antibody diluted in sample buffer was added to each well and incubated for 30 min at RT with shaking. After washing the plate again three times, 35 ⁇ of read buffer (MSD) was added to each well. Electrochemiluminescence (ECL) signals were generated and detected with the MSD Sector Imager 6000.
- ECL-signals were calculated from duplicate measurements within each assay. Data were baseline adjusted by subtracting the lowest value from all data points and plotted against the corresponding antigen concentration. K D values were determined by fitting the plot with the following 1 :1 (for Fab) or 1 :2 (for IgG) fit model (according to Piehler et al,. 1997).
- Biochemical assay Inhibition of FXIa in activity assay using fluorescent peptide as substrate
- the activity of human FXIa is determined by monitoring the cleavage of a fluorescently labelled peptide with the sequence D-Leu-Pro-Arg*Rh1 10-D-Pro (product number BS-2494; Biosyntan GmbH, Berlin, Germany).
- * indicates the scissile bond, D-Leu: D- leucine, Pro: proline, Arg: arginine, Rh1 10: rhodamine 1 10, D-Pro: D-proline).
- FXIa mediated cleavage of the scissile bond of the peptide substrate leads to an increase of fluorescence intensity of the rhodamine 1 10 when using excitation and emission wavelengths of 485 nm and 535 nm, respectively. Fluorescence intensity is continuously measured using the microtiter plate reader Safire2 (TECAN, Maennedorf, Switzerland) at room temperature (RT).
- the assay buffer contains 50 mM HEPES at pH 7.4, 125 mM NaCI, 5 mM CaCI 2 and 0.05% (w/v) CHAPS.
- human FXIa and the substrate BS-2494 have assay concentrations of 0.1 nM and 0.5 ⁇ , respectively. Under these conditions, the increase of fluorescence intensity over time is linear for at least 60 minutes.
- serial dilutions of antibodies are prepared in PBS buffer (137 mM NaCI, 2.7 mM KCI, 10 mM Na 2 HP0 4 , 1 .8 mM KH 2 P0 4 ) containing 0.05% (w/v) CHAPS.
- PBS buffer 137 mM NaCI, 2.7 mM KCI, 10 mM Na 2 HP0 4 , 1 .8 mM KH 2 P0 4
- Two ⁇ _ of antibody solution are pre-incubated with 10 ⁇ _ FXIa solution (in assay buffer) for 60 minutes at RT. After the pre-incubation step, 10 ⁇ _ of substrate BS-2494 (diluted in assay buffer) is added, and the enzymatic reaction is allowed to proceed for 60 minutes, after which the fluorescence intensity is measured.
- the exponent, p is the Hill coefficient.
- Figure 4A shows a representative compound response curve of antibody NOV1401 inhibiting the enzymatic activity of full length human FXIa. The results show that NOV1401 inhibits the enzymatic activity of human full length FXIa in a concentration dependent manner ( Figure 4A). Fitting with the logistic fit model leads to an IC 50 value of approximately 160 pM.
- Anticoagulant Activity of anti-FXIa Abs The antithrombotic activity of the antibodies NOV1401 and NOV1090 were tested by using the activated partial thromboplastin time (aPTT) assay and the thrombin generation assay (TGA).
- aPTT activated partial thromboplastin time
- TGA thrombin generation assay
- Lyophilized normal human plasma 'Coagulation Control N' (reference no 5020050) was purchased from Technoclone GmbH (Vienna, Austria). It was pooled from citrated plasma of selected healthy donors. The clotting time obtained with this normal plasma reflects normal concentrations of the coagulation factors involved in clotting. The lyophilized plasma was stored at 4°C. Prior to its use, the plasma was re-suspended in 1 ml_ of distilled water by carefully rotating the vial and then keeping it for 10 minutes at RT.
- the intrinsic pathway triggering reagent 'aPTT-s' (reference no TE0350) was purchased from SYCOmed (Lemgo, Germany) and contains phospholipid and silicate (colloidal) in a buffered solution (sodium chloride, polyethylene glycol 20000; sucrose, sodium azide). The solution was stored at 4 °C.
- UltraPure Tris/HCI buffer at pH 7.5 (reference no 15567-027; Life Technologies Corporation, NY, USA) and Phosphate Buffered Saline (PBS, reference no P4417-100TAB; Sigma-Aldrich Chemie GmbH, Steinheim, Germany) were compound dilution.
- the measurements of the clotting time were performed in an Amelung ball coagulometer model KC4A (purchased through SYCOmed, Lemgo, Germany), which is a semi-automated mechanical clot detection system.
- the system utilizes a special cuvette (reference no AI4000; SYCOmed) in which a stainless steel ball (reference no AI5000;
- the sample is added to the cuvette. After an appropriate incubation period, the cuvette is placed into the measuring well of the ball coagulometer. The measuring well rotates slowly causing the cuvette to rotate along its longitudinal axis. Because the cuvette is positioned at a slight angle, gravity and inertia always position the ball at the lowest point of the cuvette. Exactly opposite the ball-position is a magnetic sensor. With the addition of the trigger reagent, a timer is started. As coagulation takes place fibrin strands form in the reaction mixture. The fibrin strands pull the ball away from its inertia position that triggers an impulse in the magnetic sensor. This impulse electronically stops the timer.
- Table 4a Table 4a
- the samples were measured in duplicates at a temperature of 37 °C in the Amelung ball coagulometer.
- Figure 4B shows a representative compound response curve of antibody NOV1401 , leading to the concentration dependent prolongation of aPTT clotting times.
- the results suggest that NOV1401 leads to the prolongation of aPTT clotting times of human plasma in a concentration dependent manner.
- the aPTT clotting time is doubled compared to baseline at a NOV1401 concentration of approximately 14 nM.
- the IC 50 value was calculated to be approximately 13 nM.
- TGA Thrombin Generation Assay
- TGA lyophilized normal human plasma (Coagulation control N) was purchased from Technoclone GmbH, (reference number 5020040, Lot# 1 P37B00) and reconstituted in distilled water in a the volume suggested by the manufacturer.
- the substrate solution was prepared using the fluorogenic substrate Z-Gly-Gly-Arg- AMC from Technoclone GmbH (reference number 5006230, Lot# 8F41 B00). Aliquots of the lyophilized substrate were kept at 4° C. The substrate was dissolved freshly in the volume of distilled water indicated on the vial 20 minutes prior its use in the assay. The reconstituted substrate solution contains the fluorogenic peptide at a concentration of 1 mM and CaCI 2 at a concentration of 15 mM.
- TGA RD' reference no 500622
- TGA RC low' reference no 5006213
- the trigger reagent 'platelet poor plasma (PPP)-reagent low' was purchased from Thrombinoscope (TS31 .00, Lot#
- PPL1409/01 PPL1409/01
- 'PPP-reagent low' contains a mixture of phospholipids and tissue factor at very low concentration.
- the reagent was 8-fold diluted in 80 mM Tris/HCI at pH7.4, 0.05% (w/v) CHAPS immediately before use.
- the samples were aliquoted and measured in 96 well black/clear bottom plates purchased from Costar (product no 3603).
- For automation transfer samples were placed in V- bottom 96 well plate (Costar, 3894) and transferred using a CyBio automation system (Analytik Jena US, Woburn, MA, USA).
- the reconstituted human blood plasma, trigger reagent 'PPP-reagent low' and substrate were pre-warmed for 10 minutes in a water bath at 37 °C.
- Serial 1 :3 antibody dilutions in PBS were prepared in a 96 well plate starting with a NOV1401 concentration of 5 ⁇ (5x the highest final concentration of 1 ⁇ ) for a total of 8 dilutions.
- 222 ⁇ of trigger reagent was mixed with 1 108 ⁇ of substrate solution to generate the 10+50 trigger reagent substrate mix.
- 80 ⁇ per well was added into a V-bottom 96 well plate for later transfer using an automation system. The plate was kept at 37 °C.
- the reagents were added according to the scheme given in Table 4b.
- Trigger/substrate mixtures were transferred using automation. After adding the mixtures, excitation and emission at 360 nm at 460 nm, respectively, were recorded immediately using a Synergy Neo instrument (BioTek Instrument Inc., Winooski, VT, USA). The samples were measured in duplicates at a temperature of 37 °C in the plate reader for 90 minutes at intervals of 55 seconds.
- Figure 4C shows a representative compound response curve of antibody NOV1401 , displaying the concentration-dependent inhibition of thrombin generation in the TGA.
- An IC 50 value of 24 nM and a residual thrombin concentration of 159 nM (dotted line) were calculated for this compound response curve.
- FXI mice FXI mice
- hFXI human FXI
- these mice acquire a wild-type thrombophilic phenotype when exposed to a thrombogenic stimulus.
- thrombosis was induced in the carotid artery by applying ferric chloride (FeCI 3 ) to the surface of the artery.
- NOV1401 was injected as a bolus through the jugular vein of anesthetized mice 15 minutes prior to the induction of thrombosis. Doses of antibody ranged from 0.24 mg/kg - 0.47 mg/kg.
- the FXI _/" mice were reconstituted with human FXI by injecting 0.47 mg/kg human FXI via the jugular vein 10 minutes prior to the FeCI 3 challenge.
- Two 1 mm x 1 .5 mm pieces of filter paper saturated with 3.5% FeCI 3 were then applied to opposite sides of the carotid artery, in contact with its adventitial surface, and removed 3 minutes afterward, followed by thorough washing with saline. Blood flow through the carotid artery was measured with a Transonic flow probe.
- Baseline blood flow was obtained for 5 minutes prior to FeCI 3 application and then for 30 minutes after application of FeCI 3 (i.e., during the thrombogenic period).
- blood was sampled from the vena cava into syringes containing 3.8% sodium citrate, plasma was prepared and subjected to an aPTT assay.
- Figure 1 A shows the effect of NOV1401 on FeCI 3 -induced thrombosis in FXl ' mice reconstituted with human FXI (humanized FXI mouse model).
- Figure 1 B shows the effect of NOV1401 on aPTT in the same mouse model.
- Figure 1 C shows aPTT prolongation in FXI _/" mice in comparison to wild-type mice.
- NOV1401 fully inhibited FeCI 3 -induced thrombus formation in hFXI-reconstituted FXI _/" mice ( Figure 1 A) starting at 0.24 mg/kg. A steep dose response was observed, likely reflecting a stoichiometric all-or-none antithrombotic response. The aPTT was prolonged to 1 .6 fold above vehicle controls in the high dose group ( Figure 1 B), corresponding to the same level of prolongation by genetic depletion of FXI ( Figure 1 C), i.e., maximal effect.
- an anti- FXI/FXIa antibody such as NOV1401
- the antibody was administered via subcutaneous (s.c.) or intravenous (i.v.) injections to cynomolgus monkeys in a rising dose study.
- NOV1401 has sustained anticoagulant activity in cynomolgus monkeys.
- the pharmacodynamics (PD) of NOV1401 characterized by its anticoagulant effect as determined by aPTT and FXI f levels, were then compared to the PK profile. The comparison indicates that there is a good PK/PD correlation.
- Total NOV1401 plasma concentrations were measured by standard methods for human IgG detection by ELISA using a sandwich immunoassay with a mouse anti-human-IgG monoclonal antibody as capture antibody and a goat anti-human-IgG with an HRP label as detection antibody.
- ELISA plates (384-Well LUMITRACTM 600 HB) were coated with NOV1401 (5 ⁇ g/mL in PBS) for binding of free FXI. After blocking (milk blocker: KPL #50-82-01 , 1 :20 dilution) and washing the plates with wash buffer (PBS; 0.05% Tween 20), plasma samples diluted 1 :40 in assay buffer (50 mM HEPES at pH 7.4, 125 mM NaCI, 5 mM CaCI 2 , 5 mM EDTA and 0.05% (w/v) CHAPS) were incubated at RT for 30 min. and washed 3X with wash buffer.
- assay buffer 50 mM HEPES at pH 7.4, 125 mM NaCI, 5 mM CaCI 2 , 5 mM EDTA and 0.05% (w/v) CHAPS
- the detection antibody 14E1 1 was added at 1 ⁇ g/mL in dilution buffer (1 .7 mM sodium phosphate monobasic, 8.1 mM sodium phosphate dibasic heptahydrate, 0.15 M sodium chloride, 0.7% Triton X-100, and 0.1 % sodium azide, pH 7) containing 0.7% casein.
- dilution buffer 1 .7 mM sodium phosphate monobasic, 8.1 mM sodium phosphate dibasic heptahydrate, 0.15 M sodium chloride, 0.7% Triton X-100, and 0.1 % sodium azide, pH 7.
- a secondary detection antibody peroxidase-labeled anti-mouse IgG (Sigma #A5278), was added at 0.5 ⁇ g/mL in dilution buffer containing 0.4% casein.
- Plasma samples from all time points were subjected to aPTT analysis and aPTT results were compared to total plasma NOV1401 concentration and free FXI levels.
- Figures 2A and 2B show changes of aPTT clotting times in relationship to total plasma NOV1401 levels for i.v.- and s.c. -dosed animals.
- Figures 3A and 3B show changes of aPTT clotting times in relationship to free FXI levels for i.v.- and s.c.-dosed animals.
- NOV1401 A sustained anticoagulant effect of NOV1401 was also observed in a 13-week s.c./4- week i.v. repeat dose toxicity study in cynomolgus monkeys.
- FXI:C was assessed by measuring clotting time of cynomolgus monkey plasma samples in the presence of human FXI deficient plasma (one-stage aPTT). aPTT and FXI:C were measured on study days 2, 23, and 79 for the s.c. groups and on days 2 and 23 for the i.v. group. Across all animals and all treatment groups, an aPTT prolongation of 2.1 - to 3-fold was observed (Figure 5A). The effect was sustained throughout the dosing phase of the study and no dose-dependency was observed similar to the observation in the previous rising dose study. FXI:C was reduced across animals and treatment groups by 88-95% and remained at these levels throughout the dosing phase of the study ( Figure 5B). The effect on FXI:C was also dose-independent over these doses.
- the exposure to total NOV1401 was comparable between the individual animals in each group. Exposure (C max or AUCo-Hd) was approximately dose-proportional for each dosing route (Table 9). C max was approximately 3-fold higher in the i.v. group than in the s.c. group. However, plasma total NOV1401 concentrations were similar in both groups following the initial distribution phase.
- the absolute bioavailability following s.c. injection ranged from 61 -66% (3 dose levels). Anti- NOV1401 antibodies were not detected after either i.v. or s.c. administration in any animals.
- Table 9 Mean pharmacokinetic parameters following single (rising) dose administration in female cynomolgus monkeys
- Cynomolgus monkeys were administered weekly doses of 10 or 100 mg/kg NOV1401 s.c. for 13 weeks (14 doses) or doses of 50 mg/kg NOV1401 i.v. for 4 weeks (5 doses).
- Table 10 Mean toxicokinetic parameters for the penultimate dose (Study Day 85 for the s.c. arms, Study Day 22 for the i.v. arm) of 13-week/4-week GLP-compliant toxicity study in cynomolgus monkeys (male + female combined)
- the dose can be lowered based, for example, based on model simulations, to ensure that the mean duration of aPTT prolongation does not exceed 2-fold for > 42 days.
- Non-limiting exemplary dose adjustments may involve lowering a dose using decrements of 10 mg, 20 mg, 30 mg, 40 mg, or 50 mg.
- the last 2 dose escalation steps are ⁇ 2-fold increments to mitigate the risk of prolonged target saturation and extended aPTT prolongation.
- the maximum duration of 2-fold aPTT prolongation for a certain number of days (e.g., 30 days, 35 days, 40 days, 42 days, etc.) with a therapy targeting FXI can be assessed based on genetic data showing mild bleeding phenotype in patients with severe FXI deficiency, data from patients with FXI deficiency with acquired inhibitor, and also data from human studies, for instance, FXI-ASO (see, e.g., Liu et al., (201 1) "ISIS-FXIRx, a novel and specific antisense inhibitor of factor XI, caused significant reduction in FXI antigen and activity and increased aPTT without causing bleeding in healthy volunteers.” Presented at the 53rd American Society of Hematology annual meeting and exposition, San Diego, California.
- Subjects are monitored throughout the study for safety parameters and/or end points, such as, physical exam, neurological exam, vital signs, electrocardiogram (ECG), safety laboratories, and adverse events (AEs) including serious AEs (SAEs) up until and including Day 106 post-dose.
- safety parameters and/or end points such as, physical exam, neurological exam, vital signs, electrocardiogram (ECG), safety laboratories, and adverse events (AEs) including serious AEs (SAEs) up until and including Day 106 post-dose.
- anti-FXI/FXIa antibody e.g., NOV1401
- Plasma concentrations of total anti-FXI/FXIa antibody e.g., NOV1401 are measured to assess the PK of single doses in these subjects.
- IG immunogenicity
- FXI/FXIa antibodies e.g., NOV1401
- FXI:C Free and total FXI and FXI coagulation activity
- prothrombin fragments 1 .2 F1 .2
- prothrombin-antithrombin complex TAT
- anti-FXI/FXIa antibodies e.g., NOV1401
- prothrombin time PT
- thrombin time TT
- exploratory coagulation laboratory parameters such as thrombin activatable fibrinolysis inhibitor, fibrinogen, tissue plasminogen activator (tPA) and TGA in the subjects.
- Biomarkers studied may include, but are not be limited to: D-Dimer, FXI activity, PT/INR, TT, F1 .2, fibrinogen, TGA, TAFI activity, TAT, PAI-1 antigen, TFPi activity, tPA activity, and vWF activity.
- NOV1401 was evaluated in a first-in-human (FIH) study to characterize its
- PK pharmacokinetics
- PD pharmacodynamics
- NOV1401 was safe and well tolerated, and the incidences of adverse events (AEs) were comparable across dose groups and to placebo. No bleeding events, hypersensitivity reactions or injection site reactions were reported. Exposure increased with increasing dose of s.c. NOV1401 ; the median maximum observed concentration (C max ) occurred on Day 7 to 21 and the mean terminal elimination half-life (t 1/2 ) ranged from 20 to 28 days. A dose and time-dependent prolongation of aPTT occurred with NOV1401 after single s.c. administration; the 150 mg dose resulted in a mean aPTT prolongation > 2-fold at Day 29 and the 240 mg dose extended the duration of aPTT prolongation.
- C max median maximum observed concentration
- t 1/2 mean terminal elimination half-life
- AF atrial fibrillation
- Subjects are monitored throughout the study for safety parameters and/or end points, such as, physical exam, neurological exam, vital signs, electrocardiogram (ECG), safety laboratories, and adverse events (AEs) including serious AEs (SAEs).
- the primary objective of this study is to evaluate the proportion of patients achieving FXI inhibition > 80% at trough after monthly dosing of NOV1401 .
- NOV1401 The effect of NOV1401 on aPTT is assessed, and plasma concentrations of total NOV1401 are measured to assess the PK.
- Free and total FXI and FXI coagulation activity are measured to assess the effects of NOV1401 on target engagement and target-related PD parameters.
- prothrombin fragments 1 .2 F1 .2
- prothrombin-antithrombin complex TAT
- PT prothrombin time
- TT thrombin time
- exploratory coagulation laboratory parameters such as thrombin activatable fibrinolysis inhibitor, fibrinogen, tissue plasminogen activator (tPA) and TGA in the subjects.
- Biomarkers studied may include, but are not be limited to: D-Dimer, FXI activity, PT/INR, TT, F1 .2, fibrinogen, TGA, TAFI activity, TAT, PAI-1 antigen, TFPi activity, tPA activity, and vWF activity. Study 2 in humans with AF
- PK pharmacokinetics
- PD pharmacodynamics
- the trial will evaluate the effects of three dosing regimens of NOV1401 on Factor XI inhibition, indices of coagulation, thrombogenesis biomarkers, bleeding, and major cardiovascular (CV) and cerebrovascular events.
- PK/PD relationship, hypersensitivity reactions, injection site reactions and immunogenicity will also be assessed.
- a comparative study with a NOAC can be conducted in parallel.
- the primary objective of this study is to evaluate the proportion of patients achieving FXI inhibition > 80% at trough (Day 91 ) after monthly dosing at 3 dose levels of NOV1401 .
- Study design This is a randomized, open-label, blinded endpoint evaluation, active- controlled, dose-range finding study. After a screening period of 1 to 2 weeks, patients will be randomized to 1 of 4 treatment groups below (low, medium or high dose NOV1401 or a NOAC) in a 1 :1 :1 :1 ratio and followed during a 90-day treatment period:
- NOV1401 120 mg subcutaneous administration once a month;
- NOV1401 180 mg subcutaneous administration once a month.
- Randomization will be stratified by country and whether patients are anticoagulant naive (Yes/No) at screening. Patients will be transitioned to a NOAC and/or other standard of care therapy at a doctor's discretion on Day 91 and followed up to Day 170.
- Interim analyses Four interim analyses are planned. The interim analyses will be implemented when approximately 80, 160 and 300 patients have completed at least 1 month of treatment, and when all patients have completed the treatment period and data collected at the Day 91 visit are available. Available PD parameters (e.g., relevant coagulation parameters), safety and tolerability data will be assessed. Incorporation By Reference
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Hematology (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Biochemistry (AREA)
- General Chemical & Material Sciences (AREA)
- Diabetes (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Immunology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Dermatology (AREA)
- Epidemiology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
Priority Applications (17)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP17832998.3A EP3558370A2 (en) | 2016-12-23 | 2017-12-22 | Methods of treatment with anti-factor xi/xia antibodies |
| KR1020247029148A KR102918597B1 (ko) | 2016-12-23 | 2017-12-22 | 항-인자 XI/XIa 항체를 사용한 치료 방법 |
| JP2019533396A JP7110199B2 (ja) | 2016-12-23 | 2017-12-22 | 抗第XI/XIa因子抗体による処置法 |
| IL267519A IL267519B2 (en) | 2016-12-23 | 2017-12-22 | Factor XI/XIA for use in the prevention, treatment, management, or reduction of the risk of stroke or thromboembolism in a patient with end-stage renal disease |
| AU2017383537A AU2017383537B2 (en) | 2016-12-23 | 2017-12-22 | Methods of treatment with anti-Factor XI/XIa antibodies |
| KR1020197021024A KR102702288B1 (ko) | 2016-12-23 | 2017-12-22 | 항-인자 XI/XIa 항체를 사용한 치료 방법 |
| KR1020267002235A KR20260023597A (ko) | 2016-12-23 | 2017-12-22 | 항-인자 XI/XIa 항체를 사용한 치료 방법 |
| CN201780087088.7A CN110325211A (zh) | 2016-12-23 | 2017-12-22 | 采用抗因子XI/XIa抗体治疗的方法 |
| US16/472,641 US20200231701A1 (en) | 2016-12-23 | 2017-12-22 | Methods of treatment with anti-factor xi/xia antibodies |
| CA3048157A CA3048157A1 (en) | 2016-12-23 | 2017-12-22 | Methods of treatment with anti-factor xi/xia antibodies |
| IL316673A IL316673A (en) | 2016-12-23 | 2017-12-22 | Factor XI/XIA FOR USE IN PREVENTING, TREATING, MANAGING OR REDUCING THE RISK OF STROKE OR THROMBOEMBOLISM IN A SUBJECT AFFLICTED WITH END STAGE RENAL DISEASE |
| CN202410462229.0A CN118320078A (zh) | 2016-12-23 | 2017-12-22 | 采用抗因子XI/XIa抗体治疗的方法 |
| US17/670,270 US20230002507A1 (en) | 2016-12-23 | 2022-02-11 | Methods of treatment with anti-factor xi/xia antibodies |
| JP2022115212A JP7500662B2 (ja) | 2016-12-23 | 2022-07-20 | 抗第XI/XIa因子抗体による処置法 |
| JP2024091065A JP2024116221A (ja) | 2016-12-23 | 2024-06-05 | 抗第XI/XIa因子抗体による処置法 |
| US18/781,421 US20250197522A1 (en) | 2016-12-23 | 2024-07-23 | Methods of treatment with anti-factor xi/xia antibodies |
| AU2024287181A AU2024287181A1 (en) | 2016-12-23 | 2024-12-23 | Methods of treatment with anti-Factor XI/XIa antibodies |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201662438654P | 2016-12-23 | 2016-12-23 | |
| US62/438,654 | 2016-12-23 | ||
| US201762589851P | 2017-11-22 | 2017-11-22 | |
| US62/589,851 | 2017-11-22 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/472,641 A-371-Of-International US20200231701A1 (en) | 2016-12-23 | 2017-12-22 | Methods of treatment with anti-factor xi/xia antibodies |
| US17/670,270 Continuation US20230002507A1 (en) | 2016-12-23 | 2022-02-11 | Methods of treatment with anti-factor xi/xia antibodies |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2018116267A2 true WO2018116267A2 (en) | 2018-06-28 |
| WO2018116267A3 WO2018116267A3 (en) | 2018-08-02 |
Family
ID=61022382
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/IB2017/058345 Ceased WO2018116267A2 (en) | 2016-12-23 | 2017-12-22 | Methods of treatment with anti-factor xi/xia antibodies |
Country Status (9)
| Country | Link |
|---|---|
| US (3) | US20200231701A1 (https=) |
| EP (1) | EP3558370A2 (https=) |
| JP (3) | JP7110199B2 (https=) |
| KR (3) | KR102702288B1 (https=) |
| CN (2) | CN110325211A (https=) |
| AU (2) | AU2017383537B2 (https=) |
| CA (1) | CA3048157A1 (https=) |
| IL (2) | IL267519B2 (https=) |
| WO (1) | WO2018116267A2 (https=) |
Cited By (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10465011B2 (en) | 2015-06-26 | 2019-11-05 | Novartis Ag | Factor XI antibodies and methods of use |
| WO2020061465A1 (en) | 2018-09-20 | 2020-03-26 | Phasebio Pharmaceuticals, Inc. | Methods of reversing ticagrelor activity |
| US10647780B2 (en) | 2016-05-25 | 2020-05-12 | Novartis Ag | Reversal binding agents for anti-factor XI/XIa antibodies and uses thereof |
| WO2021022676A1 (zh) * | 2019-08-08 | 2021-02-11 | 上海博槿生物科技有限公司 | 一种抗凝血因子XI活化形式因子XIa的抗体及其制备方法和应用 |
| WO2021127525A1 (en) * | 2019-12-20 | 2021-06-24 | Anthos Therapeutics, Inc. | Pharmaceutical formulations and dosage regimens for factor xi/xia antibodies |
| CN113474374A (zh) * | 2019-04-16 | 2021-10-01 | 四川科伦博泰生物医药股份有限公司 | 抗FXI/FXIa抗体及其用途 |
| US11168147B2 (en) | 2016-12-23 | 2021-11-09 | Novartis Ag | Factor XI antibodies and methods of use |
| US11773186B2 (en) | 2014-10-01 | 2023-10-03 | Medimmune Limited | Antibodies to ticagrelor and methods of use |
| WO2023250463A3 (en) * | 2022-06-24 | 2024-02-29 | Anthos Therapeutics, Inc. | Combination therapies with an anti-factor xi/factor xia antibody |
| US12617870B2 (en) | 2019-09-20 | 2026-05-05 | SFJ Pharmaceutical X, LTD. | Methods of reversing ticagrelor activity |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| IL267519B2 (en) * | 2016-12-23 | 2025-04-01 | Novartis Ag | Factor XI/XIA for use in the prevention, treatment, management, or reduction of the risk of stroke or thromboembolism in a patient with end-stage renal disease |
| EP4177274A4 (en) * | 2020-07-02 | 2024-04-03 | Beijing Tuo Jie Biopharmaceutical Co. Ltd. | Anti-fxi/fxia antibody, antigen-binding fragment thereof, and pharmaceutical use thereof |
| WO2025201156A1 (zh) * | 2024-03-28 | 2025-10-02 | 施能康生物医药(苏州)有限公司 | 靶向凝血因子xi的核酸及其用途 |
Citations (29)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4458066A (en) | 1980-02-29 | 1984-07-03 | University Patents, Inc. | Process for preparing polynucleotides |
| EP0154316A2 (en) | 1984-03-06 | 1985-09-11 | Takeda Chemical Industries, Ltd. | Chemically modified lymphokine and production thereof |
| EP0307434A1 (en) | 1987-03-18 | 1989-03-22 | Medical Res Council | CHANGED ANTIBODIES. |
| EP0367166A1 (en) | 1988-10-31 | 1990-05-09 | Takeda Chemical Industries, Ltd. | Modified interleukin-2 and production thereof |
| EP0401384A1 (en) | 1988-12-22 | 1990-12-12 | Kirin-Amgen, Inc. | Chemically modified granulocyte colony stimulating factor |
| EP0413622A1 (en) | 1989-08-03 | 1991-02-20 | Rhone-Poulenc Sante | Albumin derivatives with therapeutic functions |
| WO1991006570A1 (en) | 1989-10-25 | 1991-05-16 | The University Of Melbourne | HYBRID Fc RECEPTOR MOLECULES |
| US5112946A (en) | 1989-07-06 | 1992-05-12 | Repligen Corporation | Modified pf4 compositions and methods of use |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| WO1993015199A1 (fr) | 1992-01-31 | 1993-08-05 | Rhone-Poulenc Rorer S.A. | Nouveaux polypeptides biologiquement actifs, leur preparation et composition pharmaceutique les contenant |
| WO1993015200A1 (fr) | 1992-01-31 | 1993-08-05 | Rhone-Poulenc Rorer S.A. | Polypeptides antithrombotiques, antagonistes de la liaison du vwf aux plaquettes et/ou au sous-endothelium |
| US5336603A (en) | 1987-10-02 | 1994-08-09 | Genentech, Inc. | CD4 adheson variants |
| US5349053A (en) | 1990-06-01 | 1994-09-20 | Protein Design Labs, Inc. | Chimeric ligand/immunoglobulin molecules and their uses |
| US5359046A (en) | 1990-12-14 | 1994-10-25 | Cell Genesys, Inc. | Chimeric chains for receptor-associated signal transduction pathways |
| US5447851A (en) | 1992-04-02 | 1995-09-05 | Board Of Regents, The University Of Texas System | DNA encoding a chimeric polypeptide comprising the extracellular domain of TNF receptor fused to IgG, vectors, and host cells |
| WO1996004388A1 (en) | 1994-07-29 | 1996-02-15 | Smithkline Beecham Plc | Novel compounds |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5605793A (en) | 1994-02-17 | 1997-02-25 | Affymax Technologies N.V. | Methods for in vitro recombination |
| US5622929A (en) | 1992-01-23 | 1997-04-22 | Bristol-Myers Squibb Company | Thioether conjugates |
| US5641870A (en) | 1995-04-20 | 1997-06-24 | Genentech, Inc. | Low pH hydrophobic interaction chromatography for antibody purification |
| WO1997034631A1 (en) | 1996-03-18 | 1997-09-25 | Board Of Regents, The University Of Texas System | Immunoglobin-like domains with increased half lives |
| WO1998023289A1 (en) | 1996-11-27 | 1998-06-04 | The General Hospital Corporation | MODULATION OF IgG BINDING TO FcRn |
| US5766886A (en) | 1991-12-13 | 1998-06-16 | Xoma Corporation | Modified antibody variable domains |
| US5834252A (en) | 1995-04-18 | 1998-11-10 | Glaxo Group Limited | End-complementary polymerase reaction |
| US5837458A (en) | 1994-02-17 | 1998-11-17 | Maxygen, Inc. | Methods and compositions for cellular and metabolic engineering |
| US6277375B1 (en) | 1997-03-03 | 2001-08-21 | Board Of Regents, The University Of Texas System | Immunoglobulin-like domains with increased half-lives |
| WO2001077137A1 (en) | 2000-04-12 | 2001-10-18 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| US6703199B1 (en) | 1997-06-12 | 2004-03-09 | Research Corporation Technologies, Inc. | Artificial antibody polypeptides |
| WO2016207858A1 (en) | 2015-06-26 | 2016-12-29 | Novartis Ag | Factor xi antibodies and methods of use |
Family Cites Families (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20070190059A1 (en) * | 1996-01-17 | 2007-08-16 | Smithkline Beecham Corporation | Antithrombotic agents |
| US20030235587A1 (en) * | 1998-08-07 | 2003-12-25 | Feuerstein Giora Z. | Anticoagulant agents useful in treatment of thrombosis |
| MA24512A1 (fr) * | 1996-01-17 | 1998-12-31 | Univ Vermont And State Agrienl | Procede pour la preparation d'agents anticoagulants utiles dans le traitement de la thrombose |
| WO2000007626A1 (en) * | 1998-08-07 | 2000-02-17 | Smithkline Beecham Corporation | Use of anti-coagulation factor antibodies as long-lasting protective agents |
| US6624295B1 (en) * | 1998-08-28 | 2003-09-23 | Genentech, Inc. | Human anti-factor IX/IXa antibodies |
| KR20070116192A (ko) * | 2000-05-15 | 2007-12-06 | 스미스클라인 비참 코포레이션 | 항혈전제 |
| JP2011504371A (ja) * | 2007-11-21 | 2011-02-10 | オレゴン ヘルス アンド サイエンス ユニバーシティー | 抗第xi因子モノクローナル抗体およびその使用方法 |
| TR201820051T4 (tr) * | 2008-06-19 | 2019-01-21 | Prothix Bv | Anti-faktör XI Antikorlarının Trombüs Oluşumunun Engellenmesi Veya Tedavisi İçin Kullanılması |
| PT2373691T (pt) * | 2008-12-18 | 2019-05-08 | Univ Vanderbilt | Anticorpos anti-fxi e métodos de utilização |
| IL212911A0 (en) * | 2011-05-16 | 2011-07-31 | Omrix Biopharmaceuticals Ltd | Immunoglobulin reduced in thrombogenic contaminants and preparation thereof |
| EP2847228B1 (en) * | 2012-05-10 | 2018-07-25 | Bayer Pharma Aktiengesellschaft | Antibodies capable of binding to the coagulation factor xi and/or its activated form factor xia and uses thereof |
| IL267519B2 (en) * | 2016-12-23 | 2025-04-01 | Novartis Ag | Factor XI/XIA for use in the prevention, treatment, management, or reduction of the risk of stroke or thromboembolism in a patient with end-stage renal disease |
-
2017
- 2017-12-22 IL IL267519A patent/IL267519B2/en unknown
- 2017-12-22 IL IL316673A patent/IL316673A/en unknown
- 2017-12-22 EP EP17832998.3A patent/EP3558370A2/en active Pending
- 2017-12-22 KR KR1020197021024A patent/KR102702288B1/ko active Active
- 2017-12-22 KR KR1020267002235A patent/KR20260023597A/ko active Pending
- 2017-12-22 US US16/472,641 patent/US20200231701A1/en not_active Abandoned
- 2017-12-22 JP JP2019533396A patent/JP7110199B2/ja active Active
- 2017-12-22 AU AU2017383537A patent/AU2017383537B2/en active Active
- 2017-12-22 CN CN201780087088.7A patent/CN110325211A/zh active Pending
- 2017-12-22 WO PCT/IB2017/058345 patent/WO2018116267A2/en not_active Ceased
- 2017-12-22 CA CA3048157A patent/CA3048157A1/en active Pending
- 2017-12-22 CN CN202410462229.0A patent/CN118320078A/zh active Pending
- 2017-12-22 KR KR1020247029148A patent/KR102918597B1/ko active Active
-
2022
- 2022-02-11 US US17/670,270 patent/US20230002507A1/en not_active Abandoned
- 2022-07-20 JP JP2022115212A patent/JP7500662B2/ja active Active
-
2024
- 2024-06-05 JP JP2024091065A patent/JP2024116221A/ja active Pending
- 2024-07-23 US US18/781,421 patent/US20250197522A1/en active Pending
- 2024-12-23 AU AU2024287181A patent/AU2024287181A1/en active Pending
Patent Citations (35)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4458066A (en) | 1980-02-29 | 1984-07-03 | University Patents, Inc. | Process for preparing polynucleotides |
| EP0154316A2 (en) | 1984-03-06 | 1985-09-11 | Takeda Chemical Industries, Ltd. | Chemically modified lymphokine and production thereof |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| EP0307434A1 (en) | 1987-03-18 | 1989-03-22 | Medical Res Council | CHANGED ANTIBODIES. |
| US5336603A (en) | 1987-10-02 | 1994-08-09 | Genentech, Inc. | CD4 adheson variants |
| EP0367166A1 (en) | 1988-10-31 | 1990-05-09 | Takeda Chemical Industries, Ltd. | Modified interleukin-2 and production thereof |
| EP0401384A1 (en) | 1988-12-22 | 1990-12-12 | Kirin-Amgen, Inc. | Chemically modified granulocyte colony stimulating factor |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US6180370B1 (en) | 1988-12-28 | 2001-01-30 | Protein Design Labs, Inc. | Humanized immunoglobulins and methods of making the same |
| US5585089A (en) | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5693762A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5112946A (en) | 1989-07-06 | 1992-05-12 | Repligen Corporation | Modified pf4 compositions and methods of use |
| EP0413622A1 (en) | 1989-08-03 | 1991-02-20 | Rhone-Poulenc Sante | Albumin derivatives with therapeutic functions |
| WO1991006570A1 (en) | 1989-10-25 | 1991-05-16 | The University Of Melbourne | HYBRID Fc RECEPTOR MOLECULES |
| US5349053A (en) | 1990-06-01 | 1994-09-20 | Protein Design Labs, Inc. | Chimeric ligand/immunoglobulin molecules and their uses |
| US5359046A (en) | 1990-12-14 | 1994-10-25 | Cell Genesys, Inc. | Chimeric chains for receptor-associated signal transduction pathways |
| US5766886A (en) | 1991-12-13 | 1998-06-16 | Xoma Corporation | Modified antibody variable domains |
| US5622929A (en) | 1992-01-23 | 1997-04-22 | Bristol-Myers Squibb Company | Thioether conjugates |
| WO1993015200A1 (fr) | 1992-01-31 | 1993-08-05 | Rhone-Poulenc Rorer S.A. | Polypeptides antithrombotiques, antagonistes de la liaison du vwf aux plaquettes et/ou au sous-endothelium |
| WO1993015199A1 (fr) | 1992-01-31 | 1993-08-05 | Rhone-Poulenc Rorer S.A. | Nouveaux polypeptides biologiquement actifs, leur preparation et composition pharmaceutique les contenant |
| US5447851A (en) | 1992-04-02 | 1995-09-05 | Board Of Regents, The University Of Texas System | DNA encoding a chimeric polypeptide comprising the extracellular domain of TNF receptor fused to IgG, vectors, and host cells |
| US5447851B1 (en) | 1992-04-02 | 1999-07-06 | Univ Texas System Board Of | Dna encoding a chimeric polypeptide comprising the extracellular domain of tnf receptor fused to igg vectors and host cells |
| US5830721A (en) | 1994-02-17 | 1998-11-03 | Affymax Technologies N.V. | DNA mutagenesis by random fragmentation and reassembly |
| US5811238A (en) | 1994-02-17 | 1998-09-22 | Affymax Technologies N.V. | Methods for generating polynucleotides having desired characteristics by iterative selection and recombination |
| US5837458A (en) | 1994-02-17 | 1998-11-17 | Maxygen, Inc. | Methods and compositions for cellular and metabolic engineering |
| US5605793A (en) | 1994-02-17 | 1997-02-25 | Affymax Technologies N.V. | Methods for in vitro recombination |
| WO1996004388A1 (en) | 1994-07-29 | 1996-02-15 | Smithkline Beecham Plc | Novel compounds |
| US5834252A (en) | 1995-04-18 | 1998-11-10 | Glaxo Group Limited | End-complementary polymerase reaction |
| US5641870A (en) | 1995-04-20 | 1997-06-24 | Genentech, Inc. | Low pH hydrophobic interaction chromatography for antibody purification |
| WO1997034631A1 (en) | 1996-03-18 | 1997-09-25 | Board Of Regents, The University Of Texas System | Immunoglobin-like domains with increased half lives |
| WO1998023289A1 (en) | 1996-11-27 | 1998-06-04 | The General Hospital Corporation | MODULATION OF IgG BINDING TO FcRn |
| US6277375B1 (en) | 1997-03-03 | 2001-08-21 | Board Of Regents, The University Of Texas System | Immunoglobulin-like domains with increased half-lives |
| US6703199B1 (en) | 1997-06-12 | 2004-03-09 | Research Corporation Technologies, Inc. | Artificial antibody polypeptides |
| WO2001077137A1 (en) | 2000-04-12 | 2001-10-18 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| WO2016207858A1 (en) | 2015-06-26 | 2016-12-29 | Novartis Ag | Factor xi antibodies and methods of use |
Non-Patent Citations (107)
| Title |
|---|
| "Monoclonal Antibodies For Cancer Detection And Therapy", 1985, ACADEMIC PRESS, article "Analysis, Results, And Future Prospective Of The Therapeutic Use Of Radiolabeled Antibody In Cancer Therapy", pages: 303 - 16 |
| "PCR Protocols: A Guide to Methods and Applications", 1990, ACADEMIC PRESS |
| "PCR Technology: Principles and Applications for DNA Amplification", 1992, FREEMAN PRESS |
| "Remington: The Science and Practice of Pharmacy", 2000, MACK PUBLISHING CO. |
| "Sustained and Controlled Release Drug Delivery Systems", 1978, MARCEL DEKKER, INC. |
| AI-LAZIKANI ET AL., JMB, vol. 273, 1997, pages 927 - 948 |
| ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410 |
| ALTSCHUL ET AL., NUC. ACIDS RES., vol. 25, 1977, pages 3389 - 3402 |
| ARNON ET AL.: "Monoclonal Antibodies And Cancer Therapy", 1985, ALAN R. LISS, INC., article "Monoclonal Antibodies For Immunotargeting Of Drugs In Cancer Therapy", pages: 243 - 256 |
| ASHKENAZI ET AL., PROC. NATL. ACAD. SCI. USA, vol. 88, 1991, pages 10535 - 10539 |
| BANE; GAILANI, DRUG DISC., vol. 19, no. 9, 2014 |
| BATZER ET AL., NUCLEIC ACID RES., vol. 19, 1991, pages 5081 |
| BEAUCAGE ET AL., TETRA. LETT., vol. 22, 1981, pages 1859 |
| BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426 |
| BRENT ET AL.: "Current Protocols in Molecular Biology", 2003, JOHN WILEY & SONS, INC. |
| BROWN, METH. ENZYMOL., vol. 68, 1979, pages 109 |
| BULLER ET AL., N ENGL J MED., vol. 372, no. 3, 2014, pages 232 - 240 |
| BUNCH ET AL., J INNOVATIONS OF CARD RHYTHM MANAG 2012, vol. 3, 2012, pages 855 - 863 |
| CAMM ET AL., EUR HEART J 2012, vol. 33, 2012, pages 2719 - 2747 |
| CAMM ET AL., EUR HEART J, vol. 33, 2012, pages 2719 - 2747 |
| CHENG ET AL., BLOOD, vol. 116, 2010, pages 3981 - 3989 |
| CONNOLLY ET AL., N ENGL J MED, vol. 361, 2009, pages 1139 - 1151 |
| CONNOLLY ET AL., N ENGL J MED, vol. 364, 2011, pages 806 - 817 |
| CONNOLLY, S.J. ET AL., N. ENGL. J. MED., vol. 361, 2009, pages 1139 |
| COX, J. P. L. ET AL., EUR. J IMMUNOL., vol. 24, 1994, pages 827 - 836 |
| CREIGHTON, PROTEINS, 1984 |
| CROSBY ET AL., ARTERIOSCLER THROMB VASC BIOL 2013, vol. 33, 2013, pages 1670 - 1678 |
| DATABASE Protein [O] retrieved from NCBI Database accession no. AAA51985 |
| DENARDO ET AL., CLIN CANCER RES., vol. 4, no. 10, 1998, pages 2483 - 2490 |
| E. MEYERS; W. MILLER, COMPUT. APPL. BIOSCI., vol. 4, 1988, pages 11 - 17 |
| ECKERT ET AL., PCR METHODS AND APPLICATIONS, vol. 1, 1991, pages 17 |
| ELLIOT; O'HARE, CELL, vol. 88, 1997, pages 223 |
| FRIBERG ET AL., CIRCULATION, vol. 125, 2012, pages 2298 - 2307 |
| GAILANI; RENNE, ARTERIOSCLER THROMB VASC BIOL. 2007, vol. 27, no. 12, 2007, pages 2507 - 2513 |
| GALLEGO ET AL., CARC ARRHYTHM ELECTROPHYSIOL., vol. 5, 2012, pages 312 - 318 |
| GALLEGO ET AL., CARCARRHYTHM ELECTROPHYSIOL., vol. 5, 2012, pages 312 - 318 |
| GENTZ, PROC. NATL. ACAD. SCI. USA, vol. 86, 1989, pages 821 - 824 |
| HANSSON ET AL., J. MOL. BIOL., vol. 287, 1999, pages 265 - 276 |
| HARAYAMA, TRENDS BIOTECHNOL., vol. 16, no. 2, 1998, pages 76 - 82 |
| HARRINGTON ET AL., NAT GENET, vol. 15, 1997, pages 345 |
| HELLSTROM ET AL.: "Controlled Drug Delivery", 1987, MARCEL DEKKER, INC., article "Antibodies For Drug Delivery", pages: 623 - 653 |
| HENIKOFF, PROC. NATL. ACAD. SCI. USA, vol. 89, 1989, pages 10915 |
| HOFFMAN M.M.; MONROE D.M., CURR HEMATOL REP., vol. 4, 2005, pages 391 - 396 |
| HOLLINGER; HUDSON, NATURE BIOTECHNOLOGY, vol. 23, no. 9, 2005, pages 1126 - 1136 |
| HUSTON ET AL., PROC. NATL. ACAD. SCI., vol. 85, 1988, pages 5879 - 5883 |
| JANUARY ET AL.: "AHA/ACC/HRS Atrial Fibrillation Guideline", J AM COLL CARDIOL, vol. 64, 2014, pages 2246 - 2280 |
| JOHNE J, BIOL CHEM., vol. 387, 2006, pages 173 - 178 |
| JONES, P. ET AL., NATURE, vol. 321, 1986, pages 522 - 525 |
| KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, PUBLIC HEALTH SERVICE, NATIONAL INSTITUTES OF HEALTH |
| KABAT, E. A. ET AL.: "Sequences of Proteins of Immunological Interest", 1991, U.S. DEPARTMENT OF HEALTH AND HUMAN SERVICES, NIH |
| KANNEL; BENJAMIN, MED CLIN NORTH AM. 2008, vol. 92, 2008, pages 17 - 40 |
| KARLIN; ALTSCHUL, PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 5873 - 5787 |
| LASSEN, M.R. ET AL., N. ENGL. J. MED., vol. 361, 2009, pages 594 |
| LEFRANC ET AL., DEV. COMP. IMMUNOL., vol. 27, 2003, pages 55 - 77 |
| LEUNG ET AL., TRANSL STROKE RES 2012, vol. 3, 2012, pages 381 - 389 |
| LIVNAT ET AL., THROMB. HAEMOST., vol. 102, 2009, pages 487 - 492 |
| LORENZO; BLASCO, BIOTECHNIQUES, vol. 24, no. 2, 1998, pages 308 - 313 |
| MANDLE RJ JR, BLOOD, vol. 54, no. 4, 1979, pages 850 |
| MARZONA ET AL., CMAJ 2012, vol. 184, 2012, pages 329 - 336 |
| MATTILA ET AL., NUCLEIC ACIDS RES., vol. 19, 1991, pages 967 |
| MEIJERS, N ENGL J MED. 2000, vol. 342, 2000, pages 696 - 701 |
| MORRISON, PROC. NATL. ACAD. SCI. USA, vol. 81, 1984, pages 6851 - 6855 |
| MORRISON; OI, ADV. IMMUNOL., vol. 44, 1988, pages 65 - 92 |
| NARANG, METH. ENZYMOL., vol. 68, 1979, pages 90 |
| NEEDLEMAN; WUNSCH, J. MOL, BIOL., vol. 48, 1970, pages 444 - 453 |
| NEEDLEMAN; WUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 443 |
| NIEUWLAAT ET AL., EUR HEART J, vol. 26, 2005, pages 2422 - 2434 |
| OHTSUKA, J. BIOL. CHEM., vol. 260, 1985, pages 2605 - 2608 |
| PADLAN, MOLEC. IMMUN., vol. 28, 1991, pages 489 - 498 |
| PADLAN, MOLEC. IMMUN., vol. 31, 1994, pages 169 - 217 |
| PAN, FASEB J., vol. 9, 1995, pages 43 - 49 |
| PATEL ET AL., N ENGL J MED 2011, vol. 365, 2011, pages 883 - 891 |
| PATTEN ET AL., CURR. OPINION BIOTECHNOL., vol. 8, 1997, pages 724 - 33 |
| PEARSON; LIPMAN, PROC. NAT'L. ACAD. SCI. USA, vol. 85, 1988, pages 2444 |
| PETERSON ET AL., BIOCONJUG. CHEM., vol. 10, no. 4, 1999, pages 553 - 557 |
| PICCINI ET AL., EUR HEART J, vol. 35, 2014, pages 1873 - 1880 |
| PIEHLER ET AL.: "Assessment of affinity constants by rapid solid phase detection of equilibrium binding in a flow system", J.IMMUNOL. METH., 1997, pages 189 - 206, XP004117417, DOI: doi:10.1016/S0022-1759(96)00222-0 |
| QUEEN ET AL., IMMUNOL. REV., vol. 89, 1986, pages 49 - 68 |
| QUEEN, C. ET AL., PROC. NATL. ACAD., U.S.A., vol. 86, 1989, pages 10029 - 10033 |
| RIDDELL ET AL., THROMB. HAEMOST., vol. 106, 2011, pages 521 - 527 |
| RIECHMANN, L. ET AL., NATURE, vol. 332, 1998, pages 323 - 327 |
| ROSENFELD ET AL., CELL, vol. 68, 1992, pages 143 |
| ROSSOLINI ET AL., MOL. CELL. PROBES, vol. 8, 1994, pages 91 - 98 |
| SALOMON ET AL., BLOOD 2008, vol. 111, 2011, pages 4113 - 4117 |
| SALOMON ET AL., THROMB HAEMOST., vol. 105, 2011, pages 269 - 273 |
| SCHUMACHER ET AL., EUR J PHARMACOL 2007, vol. 570, 2007, pages 167 - 174 |
| SMITH, ANNU. REV. MICROBIOL., vol. 49, 1995, pages 807 |
| SMITH; WATERMAN, ADV. APPL. MATH., vol. 2, 1970, pages 482c |
| THORPE ET AL., IMMUNOL. REV., vol. 62, 1982, pages 119 - 158 |
| THORPE ET AL.: "Antibody Carriers Of Cytotoxic Agents In Cancer Therapy: A Review", MONOCLONAL ANTIBODIES 84: BIOLOGICAL AND CLINICAL APPLICATIONS, 1985, pages 475 - 506 |
| TOMLINSON, I. M. ET AL., J. MOL. BIOL., vol. 227, 1992, pages 776 - 798 |
| TUCKER ET AL., BLOOD 2009, vol. 113, 2009, pages 936 - 944 |
| VERHOEYEN ET AL., SCIENCE, vol. 239, 1988, pages 1534 - 1536 |
| VIL ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 11337 - 11341 |
| WANG ET AL., J THROMB HAEMOST, vol. 4, 2006, pages 1982 - 1988 |
| WANG, J THROMB HAEMOST, vol. 3, 2005, pages 695 - 702 |
| WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 546 |
| WEITZ J.I., THROMB. HAEMOST., vol. 103, 2010, pages 62 |
| WILSON, CELL, vol. 37, 1984, pages 767 |
| WINNACKER: "FROM GENES TO CLONES", 1987, VCH PUBLISHERS |
| WONG ET AL., J THROMB THROMBOLYSIS 2011, vol. 32, 2011, pages 129 - 137 |
| YOUNIS ET AL., BLOOD 2012, vol. 119, 2012, pages 2401 - 2408 |
| ZAPATA ET AL., PROTEIN ENG., vol. 8, no. 10, 1995, pages 1057 - 1062 |
| ZHANG ET AL., BLOOD 2010, vol. 116, 2010, pages 4684 - 4692 |
| ZHENG ET AL., J. IMMUNOL., vol. 154, 1995, pages 5590 - 5600 |
| ZIMMERMAN ET AL., NEPHROL DIAL TRANSPLANT, vol. 27, 2012, pages 3816 - 3822 |
| ZIMMERMAN ET AL., NUCL. MED. BIOL., vol. 26, no. 8, 1999, pages 943 - 950 |
Cited By (20)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12391768B2 (en) | 2014-10-01 | 2025-08-19 | Medimmune Limited | Antibodies to ticagrelor and methods of use |
| US11773186B2 (en) | 2014-10-01 | 2023-10-03 | Medimmune Limited | Antibodies to ticagrelor and methods of use |
| US10465011B2 (en) | 2015-06-26 | 2019-11-05 | Novartis Ag | Factor XI antibodies and methods of use |
| US10647780B2 (en) | 2016-05-25 | 2020-05-12 | Novartis Ag | Reversal binding agents for anti-factor XI/XIa antibodies and uses thereof |
| US11168147B2 (en) | 2016-12-23 | 2021-11-09 | Novartis Ag | Factor XI antibodies and methods of use |
| US12012464B2 (en) | 2016-12-23 | 2024-06-18 | Novartis Ag | Factor XI antibodies and methods of use |
| CN113194821A (zh) * | 2018-09-20 | 2021-07-30 | 费斯生物制药公司 | 逆转替卡格雷活性的方法 |
| EP4653465A3 (en) * | 2018-09-20 | 2026-01-07 | SFJ Pharma X, Inc. | Methods of reversing ticagrelor activity |
| WO2020061465A1 (en) | 2018-09-20 | 2020-03-26 | Phasebio Pharmaceuticals, Inc. | Methods of reversing ticagrelor activity |
| CN113194821B (zh) * | 2018-09-20 | 2025-07-04 | 顺孚嘉第十制药股份有限公司 | 逆转替卡格雷活性的方法 |
| US12258419B2 (en) | 2019-04-16 | 2025-03-25 | Sichuan Kelun-Biotech Biopharmaceutical Co., Ltd. | Anti-FXI/FXIa antibody and use thereof |
| EP3957652A4 (en) * | 2019-04-16 | 2023-06-21 | Sichuan Kelun-Biotech Biopharmaceutical Co., Ltd. | Anti-fxi/fxia antibody and use thereof |
| CN113474374B (zh) * | 2019-04-16 | 2025-05-02 | 四川科伦博泰生物医药股份有限公司 | 抗FXI/FXIa抗体及其用途 |
| CN113474374A (zh) * | 2019-04-16 | 2021-10-01 | 四川科伦博泰生物医药股份有限公司 | 抗FXI/FXIa抗体及其用途 |
| US12240914B2 (en) | 2019-08-08 | 2025-03-04 | Mab-Legend Biotech Co., Ltd. | Antibody against factor XIa in activated form of coagulant factor XI, preparation method therefor and use thereof |
| WO2021022676A1 (zh) * | 2019-08-08 | 2021-02-11 | 上海博槿生物科技有限公司 | 一种抗凝血因子XI活化形式因子XIa的抗体及其制备方法和应用 |
| EP3892641A4 (en) * | 2019-08-08 | 2022-08-24 | MAB-Legend Biotech Co., Ltd. | ANTIBODIES DIRECTED AGAINST FACTOR XIA IN ACTIVATED FORM OF COAGULATION FACTOR XI, METHOD FOR PREPARATION AND USE |
| US12617870B2 (en) | 2019-09-20 | 2026-05-05 | SFJ Pharmaceutical X, LTD. | Methods of reversing ticagrelor activity |
| WO2021127525A1 (en) * | 2019-12-20 | 2021-06-24 | Anthos Therapeutics, Inc. | Pharmaceutical formulations and dosage regimens for factor xi/xia antibodies |
| WO2023250463A3 (en) * | 2022-06-24 | 2024-02-29 | Anthos Therapeutics, Inc. | Combination therapies with an anti-factor xi/factor xia antibody |
Also Published As
| Publication number | Publication date |
|---|---|
| IL267519B2 (en) | 2025-04-01 |
| US20200231701A1 (en) | 2020-07-23 |
| JP2020504110A (ja) | 2020-02-06 |
| EP3558370A2 (en) | 2019-10-30 |
| AU2017383537B2 (en) | 2024-10-03 |
| IL316673A (en) | 2024-12-01 |
| IL267519B1 (en) | 2024-12-01 |
| JP2024116221A (ja) | 2024-08-27 |
| US20250197522A1 (en) | 2025-06-19 |
| JP7500662B2 (ja) | 2024-06-17 |
| CN118320078A (zh) | 2024-07-12 |
| KR102702288B1 (ko) | 2024-09-05 |
| US20230002507A1 (en) | 2023-01-05 |
| WO2018116267A3 (en) | 2018-08-02 |
| AU2024287181A1 (en) | 2025-03-06 |
| JP2022141831A (ja) | 2022-09-29 |
| JP7110199B2 (ja) | 2022-08-01 |
| KR20260023597A (ko) | 2026-02-20 |
| CN110325211A (zh) | 2019-10-11 |
| IL267519A (en) | 2019-08-29 |
| KR20190099256A (ko) | 2019-08-26 |
| KR102918597B1 (ko) | 2026-01-28 |
| KR20240134248A (ko) | 2024-09-06 |
| CA3048157A1 (en) | 2018-06-28 |
| AU2017383537A1 (en) | 2019-06-27 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20240067750A1 (en) | Factor xi antibodies and methods of use | |
| US20250197522A1 (en) | Methods of treatment with anti-factor xi/xia antibodies | |
| US12012464B2 (en) | Factor XI antibodies and methods of use | |
| CA3048156C (en) | Factor xi antibodies and methods of use |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 17832998 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 2019533396 Country of ref document: JP Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 3048157 Country of ref document: CA |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2017383537 Country of ref document: AU Date of ref document: 20171222 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20197021024 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2017832998 Country of ref document: EP Effective date: 20190723 |