WO2018093907A1 - Combination immunotherapies for treatment of cancer - Google Patents
Combination immunotherapies for treatment of cancer Download PDFInfo
- Publication number
- WO2018093907A1 WO2018093907A1 PCT/US2017/061810 US2017061810W WO2018093907A1 WO 2018093907 A1 WO2018093907 A1 WO 2018093907A1 US 2017061810 W US2017061810 W US 2017061810W WO 2018093907 A1 WO2018093907 A1 WO 2018093907A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cells
- instances
- tumor
- dengue virus
- cancer
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7088—Compounds having three or more nucleosides or nucleotides
- A61K31/713—Double-stranded nucleic acids or oligonucleotides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/66—Microorganisms or materials therefrom
- A61K35/76—Viruses; Subviral particles; Bacteriophages
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/19—Dendritic cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/20—Cellular immunotherapy characterised by the effect or the function of the cells
- A61K40/24—Antigen-presenting cells [APC]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/31—Chimeric antigen receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/36—Immune checkpoint inhibitors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/428—Undefined tumor antigens, e.g. tumor lysate or antigens targeted by cells isolated from tumor
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/04—Antineoplastic agents specific for metastasis
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0639—Dendritic cells, e.g. Langherhans cells in the epidermis
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N7/00—Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/525—Virus
- A61K2039/5254—Virus avirulent or attenuated
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55588—Adjuvants of undefined constitution
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/58—Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation
- A61K2039/585—Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation wherein the target is cancer
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/70—Multivalent vaccine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/31—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
- A61K2239/55—Lung
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
- A61K2239/57—Skin; melanoma
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2300/00—Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/14—Type of nucleic acid interfering nucleic acids [NA]
- C12N2310/141—MicroRNAs, miRNAs
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/50—Physical structure
- C12N2310/53—Physical structure partially self-complementary or closed
- C12N2310/531—Stem-loop; Hairpin
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2501/00—Active agents used in cell culture processes, e.g. differentation
- C12N2501/20—Cytokines; Chemokines
- C12N2501/24—Interferons [IFN]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/24011—Flaviviridae
- C12N2770/24111—Flavivirus, e.g. yellow fever virus, dengue, JEV
- C12N2770/24133—Use of viral protein as therapeutic agent other than vaccine, e.g. apoptosis inducing or anti-inflammatory
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- Immunotherapy unlike cytotoxic drugs, radiation, and surgery, stimulates the immune system to recognize and kill tumor cells. Numerous attempts have been made in stimulating the immune system to recognize and destroy tumor cells. These have been met with limited success due to the self-identity of peptides selected as target for immunotherapy, lack of immune activation, adverse events, and/or tumor immune evasion mechanisms.
- an Arbovirus that is a Dengue virus.
- the Dengue virus is present in an amount of about 10 2 to about 10 8 plaque-forming units (PFU)/mL.
- PFU plaque-forming units
- the Dengue virus is present in an amount of Dengue virus can be administered at about 10 5 PFU/mL.
- the Dengue virus is present in an amount of from about 10,000 to 90,000 PFU/mL.
- a Dengue virus can be about 30,000 PFU/mL. Further provided herein is a Dengue virus that is in a volume of about 0.01, 0.02, 0.03, 0.04, 0.05, or 0.1 mL. Further provided herein is a Dengue virus that is in a volume of 0.01 mL to 0.01 mL.
- a Dengue virus that is a serotype of at least one of DENV-1, DENV-2, DENV-3, DENV-4, or DENV-5. Further provided is a Dengue virus that is DENV-2 strain #1710. Further provided is a Dengue virus that is 45AZ5, 1710, S16803, HON 1991 C, HON 1991 D, HON 1991 B, HON 1991 A, SAL 1987, TRI 1981, PR 1969, IND 1957, TRI 1953, TSV01, DS09-280106, DS31-291005, 1349, GD01/03, 44, 43, China 04, FJ11/99, FJ-10, QHD13CAIQ, CO/BID-V3358, FJ/UH21/1971, GU/BID-V2950, American Asian, GWL18, IN/BID-V2961, Od2112, RR44, 1392, 1016DN, 1017DN, 1070DN, 98900663DHF, BA05i, 1022DN, NGC, Pa
- an Alphavirus that is Chikungunya virus. Further provided herein is a cancer that is from the subject. Further provided is an immune checkpoint modulatory agent that modulates the expression or activity of at least one of: CD244, A2aR, CD276, VTCN1, B7H6, B7RP1, BTLA, butyrophilin, CD 103, CD 122, CD 137, CD137L, CD 160, CD2, CD200R, CD226, CD26, CD27, CD28, CD30, CD39, CD40, CD48, CD70, CD73, CD80, CD86,
- an immune checkpoint modulatory agent that modulates the expression or activity of at least one of: A2aR, CD276, B7H4, BTLA, CTLA-4, IDOl, ID02, KIR, LAG3, PD-1, PDL-1, PDL-2, PS, TFM3, or VISTA.
- an immune checkpoint modulatory agent that increases the expression or activity of at least one of: CD122, CD137 (4-1BB), CD137L, CD27, CD28, CD40, CD70, CD80 (B7.1), CD86 (B7.2), GITR, GITRL, ICOS, ICOSL (B7H2), OX-40, or OX-40L.
- an immune checkpoint modulatory agent that is at least one of an antibody, a nucleic acid encoding an antibody, an antigen binding fragment, a RNA interfering agent, a peptide, a peptidomimetic, a small molecule, or an aptamer.
- RNA interfering agent that is a small interfering RNA (siRNA), short hairpin RNA (shRNA), or a microRNA (miRNA).
- siRNA small interfering RNA
- shRNA short hairpin RNA
- miRNA microRNA
- an immune checkpoint modulatory agent that is administered in a pharmaceutically acceptable formulation.
- a method for treatment or reduction of cancer in a subject in need thereof comprising: administering a strain of an Arbovirus or a strain of an Alphavirus to a subject in need thereof; administering an immune checkpoint modulatory agent; and
- tumor antigen primed dendritic cells that target cancer cells. Further provided herein are tumor antigen primed dendritic cells that are cultured on a hard surface. Further provided herein are tumor antigen primed dendritic cells that are autologous or allogeneic. Further provided are primed dendritic cells that produce about 6.5 ng/mL to about 30 ng/mL of IL-12p70. Further provided herein is obtaining dendritic cells from the subject. Further provided herein are dendritic cells that are contacted with a tumor cell lysate, wherein the tumor cell lysate is from the subject, thereby generating tumor antigen primed dendritic cells.
- an Arbovirus that is Dengue virus. Further provided herein are methods wherein the Dengue virus is present in an amount of about 10 2 to about 10 8 plaque-forming units (PFU)/mL. Further provided here are methods wherein the Dengue virus is present in an amount of Dengue virus can be administered at about 10 5 PFU/mL. Further provided here are methods wherein the Dengue virus is present in an amount of from about 10,000 to 90,000 PFU/mL. Further provided herein are methods wherein the amount of a Dengue virus can be about 30,000 PFU/mL. Further provided herein is a Dengue virus that is in a volume of about 0.01, 0.02, 0.03, 0.04, 0.05, or 0.1 mL.
- a Dengue virus that is in a volume of 0.01 mL to O.OlmL. Further provided is a Dengue virus that is a serotype of at least one of DENV-1, DENV-2, DENV-3, DENV-4, or DENV-5. Further provided is a Dengue virus that is DENV-2 strain #1710.
- Dengue virus is 45AZ5, 1710, S16803, HON 1991 C, HON 1991 D, HON 1991 B, HON 1991 A, SAL 1987, TRI 1981, PR 1969, IND 1957, TRI 1953, TSVOl, DS09-280106, DS31-291005, 1349, GD01/03, 44, 43, China 04, FJ11/99, FJ-10, QHD13CAIQ, CO/BID-V3358,
- an Alphavirus that is Chikungunya virus. Further provided are tumor antigen primed dendritic cells that produce at least about 6.5 ng/mL IL-12p70. Further provided is an immune checkpoint modulatory agent that modulates the expression or activity of at least one of: CD244, A2aR, CD276, VTCN1, B7H6, B7RP1, BTLA, butyrophilin, CD 103, CD 122, CD 137, CD137L, CD 160, CD2, CD200R, CD226, CD26, CD27, CD28, CD30, CD39, CD40, CD48, CD70, CD73, CD80, CD86,
- an immune checkpoint modulatory agent that modulates the expression or activity of at least one of: A2aR, CD276, B7H4, BTLA, CTLA-4, IDOl, ID02, KIR, LAG3, PD-1, PDL-1, PDL-2, PS, TFM3, or VISTA. Further provided is an immune checkpoint modulatory agent that increases the expression or activity of at least one of CD122, CD137 (4-1BB), CD137L, CD27, CD28, CD40, CD70, CD80 (B7.1), CD86 (B7.2), GITR, GITRL, ICOS, ICOSL (B7H2), OX-40, or OX-40L.
- an immune checkpoint modulatory agent that is at least one of an antibody, a nucleic acid encoding an antibody, an antigen binding fragment, a RNA interfering agent, a peptide, a peptidomimetic, a small molecule, or an aptamer.
- RNA interfering agent that is a small interfering RNA (siRNA), short hairpin RNA (shRNA), or a microRNA (miRNA).
- siRNA small interfering RNA
- shRNA short hairpin RNA
- miRNA microRNA
- kits for treatment or reduction of a cancer in a subject in need thereof comprising: administering primed dendritic cells to target cancer cells; administering a strain of an Arbovirus or a strain of an Alphavirus to the subject; and administering an immune checkpoint modulatory agent to the subject.
- the dendritic cells are cultured on a hard surface.
- the Arbovirus is Dengue virus.
- the Dengue virus is a serotype of at least one of DENV-1, DENV-2, DENV-3, DENV-4, or DENV-5.
- the Dengue virus is DENV-2 strain #1710.
- Alphavirus is Chikungunya virus.
- dendritic cells are autologous or allogeneic.
- cancer cells are from the subject.
- primed dendritic cells produce at least about 6.5 ng/mL IL-12p70.
- the immune checkpoint modulatory agent modulates the expression or activity of at least one of CD244, A2aR, CD276, VTCN1, B7H6, B7RP1, BTLA, butyrophilin, CD 103, CD 122, CD 137, CD137L, CD 160, CD2, CD200R, CD226, CD26, CD27, CD28, CD30, CD39, CD40, CD48, CD70, CD73, CD80, CD86, CEACAM1, CGEN-15049, CTLA-4, DR3, GAL9, GITR, GITRL, HVEM, ICOS, ICOSL, IDOl, ID02, ILT-2, ILT-4, KIR, KLRG1, LAG3, LAIR1, TNFSF14, MARCO, NKG2A, NKG2D, OX-40, OX-40L, PD-1, PDL- 1, PDL-2, PS, SIRPalpha, SLAM, TGFR, TIGIT, TFM1, TFM3,
- immune checkpoint modulatory agent is an immune checkpoint inhibitor that targets at least one of A2aR, CD276, B7H4, BTLA, CTLA-4, IDOl, ID02, KIR, LAG3, PD-1, PDL-1, PDL-2, PS, TIM3, or VISTA.
- an immune checkpoint modulatory agent activates at least one of CD 122, CD137 (4-1BB), CD137L, CD27, CD28, CD40, CD70, CD80 (B7.1), CD86 (B7.2), GITR, GITRL, ICOS, ICOSL (B7H2), OX-40, or OX-40L.
- the immune checkpoint modulatory agent is at least one of an antibody, a nucleic acid encoding an antibody, an antigen binding fragment, a RNA interfering agent, a peptide, a peptidomimetic, a small molecule, or an aptamer.
- RNA interfering agent is a small interfering RNA (siRNA), short hairpin RNA (shRNA), or a microRNA (miRNA).
- siRNA small interfering RNA
- shRNA short hairpin RNA
- miRNA microRNA
- methods for treatment or reduction of cancer in a subject in need thereof comprising: obtaining dendritic cells from a subject; contacting the dendritic cells with the lysate, thereby generating primed dendritic cells; administering the primed DCs to the subject; administering a strain of an Arbovirus or a strain of an Alphavirus to the subject in need thereof, and administering an immune checkpoint modulatory agent.
- the hard surface is a hard plastic surface.
- the hard plastic surface is a polystyrene surface.
- the Arbovirus is Dengue virus.
- Dengue virus is a serotype of at least one of DENV-1, DENV-2, DENV-3, DENV-4, or DENV-5. Further provided herein are methods, wherein the Dengue virus is DENV-2 strain #1710. Further provided herein are methods, wherein the Alphavirus is Chikungunya virus. Further provided herein are methods, wherein the cancer cells are from the subject. Further provided herein are methods, wherein the primed dendritic cells produce at least about 6.5 ng/mL IL-12p70.
- the immune checkpoint modulatory agent modulates the expression or activity of at least one of CD244, A2aR, CD276, VTCN1, B7H6, B7RP1, BTLA, butyrophilin, CD103, CD122, CD137, CD137L, CD160, CD2, CD200R, CD226, CD26, CD27, CD28, CD30, CD39, CD40, CD48, CD70, CD73, CD80, CD86, CEACAM1, CGEN-15049, CTLA-4, DR3, GAL9, GITR, GITRL, HVEM, ICOS, ICOSL, IDOl, ID02, ILT-2, ILT-4, KIR, KLRG1, LAG3, LAIR1, TNFSF14, MARCO, NKG2A, NKG2D, OX-40, OX-40L, PD-1, PDL-1, PDL-2, PS, SIRPalpha, SLAM, TGFR, TIGIT, TFM1, TFM3, TFM4,
- immune checkpoint modulatory agent is an immune checkpoint inhibitor that targets at least one of A2aR, CD276, B7H4, BTLA, CTLA-4, IDOl, ID02, KIR, LAG3, PD-1, PDL-1, PDL-2, PS, TFM3, or VISTA.
- an immune checkpoint modulatory agent activates at least one of CD122, CD137 (4-1BB), CD137L, CD27, CD28, CD40, CD70, CD80 (B7.1), CD86 (B7.2), GITR, GITRL, ICOS, ICOSL (B7H2), OX-40, or OX-40L.
- the immune checkpoint modulatory agent is at least one of an antibody, a nucleic acid encoding an antibody, an antigen binding fragment, a RNA
- RNA interfering agent a small interfering RNA (siRNA), short hairpin RNA (shRNA), or a microRNA (miRNA).
- siRNA small interfering RNA
- shRNA short hairpin RNA
- miRNA microRNA
- priming comprises: exposing the dendritic cells to a lysate to produce primed dendritic cells, wherein the lysate comprises a plurality of cancer cells, each cancer cell comprising an antigen present on the surface of said cancer cell; and administering the primed dendritic cells to the subject, wherein the administration provides for clearance of 33% or more of a cancer cell population in the subject. Further provided herein are methods, wherein the administration provides for clearance of 33% of the cancer cell population in the subject. Further provided herein are methods, wherein the Arbovirus is Dengue virus.
- Dengue virus is a serotype of at least one of DENV-1, DENV-2, DENV-3, DENV-4, or DENV-5. Further provided herein are methods, wherein the Dengue virus is DENV-2 strain #1710. Further provided herein are methods, wherein the Alphavirus is
- Chikungunya virus Further provided herein are methods, further comprising intravenously administering the Dengue virus serotype 2 and intravenously administering the population of primed dendritic cells. Further provided herein are methods, wherein the plurality of cancer cells are from the subject.
- the immune checkpoint modulatory agent is at least one of CD244, A2aR, CD276, VTCN1, B7H6, B7RP1, BTLA, butyrophilin, CD 103, CD 122, CD 137, CD137L, CD 160, CD2, CD200R, CD226, CD26, CD27, CD28, CD30, CD39, CD40, CD48, CD70, CD73, CD80, CD86, CEACAM1, CGEN-15049, CTLA-4, DR3, GAL9, GITR, GITRL, HVEM, ICOS, ICOSL, IDOl, ID02, ILT-2, ILT-4, KIR, KLRG1, LAG3, LAIR1, TNFSF14, MARCO, NKG2A, NKG2D, OX-40, OX-40L, PD-1, PDL- 1, PDL-2, PS, SIRPalpha, SLAM, TGFR, TIGIT, TFM1, TFM3, TFM4, or VIS
- immune checkpoint modulatory agent is an immune checkpoint inhibitor that targets at least one of A2aR, CD276, B7H4, BTLA, CTLA-4, IDOl, ID02, KIR, LAG3, PD-1, PDL-1, PDL-2, PS, TIM3, or VISTA.
- an immune checkpoint modulatory agent activates at least one of CD 122, CD137 (4-1BB), CD137L, CD27, CD28, CD40, CD70, CD80 (B7.1), CD86 (B7.2), GITR, GITRL, ICOS, ICOSL (B7H2), OX-40, or OX-40L.
- the immune checkpoint modulatory agent is at least one of an antibody, a nucleic acid encoding an antibody, an antigen binding fragment, a RNA interfering agent, a peptide, a peptidomimetic, a small molecule, or an aptamer.
- RNA interfering agent is a small interfering RNA (siRNA), short hairpin RNA (shRNA), or a microRNA (miRNA).
- siRNA small interfering RNA
- shRNA short hairpin RNA
- miRNA microRNA
- FIGURE 1 depicts an exemplary method of treatment with Dengue virus, an immune checkpoint modulatory agent, and primed dendritic cells.
- FIGURE 2 depicts an exemplary treatment timeline with Dengue virus and primed dendritic cells.
- FIGURE 3A depicts a histogram of ICAM-1 expression in A549 lung cancer cells with and without Dengue virus supernatant. Light orange represents addition of Dengue virus supernatant. Red represents Dengue virus supernatant mock (PBMC with no virus, but with contact-activation of monocyte cells). Blue represents control.
- FIGURE 3B depicts a second run of a histogram of ICAM-1 expression in A549 lung cancer cells with and without Dengue virus supernatant. Light orange represents addition of Dengue virus supernatant. Red represents Dengue virus supernatant mock (PBMC with no virus, but with contact-activation of monocyte cells). Blue represents control.
- FIGURE 4A depicts surface expression of MHC-1 on 624.28 alone (El) or 624.28 treated with Dengue Virus supernatant (E3) at MOI of 2.
- the histogram of HLA A/B/C expression after application of Dengue virus supernatant to 624.28 melanoma cells shows up- regulation of Class I MHC along both X and Y axes.
- the blue histogram up-regulation represents Dengue virus supernatant at 30 uL.
- the red histogram up-regulation represents control.
- FIGURE 4B depicts a high HLA-expression tumor cell line, FEMX, as a control group.
- FEMX high HLA-expression tumor cell line
- the FEMX control cells already showed high HLA expression; Dengue virus supernatants raised HLA expression levels 1.32-fold over controls.
- the blue flow area represents Dengue virus supernatant at 30 uL.
- the red flow area represents control.
- FIGURE 5A shows a FACs plot of HLA-A, B, C expression on FEMX.
- FIGURE 5B shows a duplicate FACs plot of HLA-A, B, C expression on FEMX.
- FIGURE 5C shows a FACs plot of HLA-A, B, C expression on FEMX to which Dengue virus has been added at MOI of 2.
- FIGURE 5D shows a duplicate FACs plot of HLA-A, B, C expression on FEMX to which Dengue virus has been added at MOI of 2.
- FIGURE 5E shows a FACs plot of HLA-A, B, C expression on FEMX to which no Dengue virus has been added, mock.
- FIGURE 5F shows a duplicate FACs plot of HLA-A, B, C expression on FEMX to which no Dengue virus has been added, mock.
- FIGURE 5G shows a FACs plot of HLA-A, B, C expression on 624.28.
- FIGURE 5H shows a duplicate FACs plot of HLA-A, B, C expression on 624.28.
- FIGURE 51 shows a FACs plot of HLA-A, B, C expression on 624.28 to which Dengue virus has been added at MOI of 2.
- FIGURE 5 J shows a duplicate FACs plot of HLA-A, B, C expression on 624.28 to which Dengue virus has been added at MOI of 2.
- FIGURE 5K shows a FACs plot of HLA-A, B, C expression of 624.28 to which no Dengue virus has been added, mock.
- FIGURE 5L shows a duplicate FACs plot of HLA-A, B, C expression of 624.28 to which no Dengue virus has been added, mock.
- kits for combination therapy for treating cancer comprising administering an immune checkpoint modulatory agent and a strain of an Arbovirus or a strain of an Alphavirus to a subject.
- a method can also comprise priming dendritic cells (DCs) to target cancer antigens.
- DCs dendritic cells
- a combination therapy for treating cancer comprising administering a strain of an Arbovirus or a strain of an Alphavirus.
- a combination therapy may be used to overcome tumor immune evasion mechanisms and deplete tumor cells in the subject.
- DCs primed dendritic cells
- methods for preparation of primed dendritic cells are provided herein.
- methods for exposing the primed dendritic cells to antigens associated with a disease state e.g., tumor antigens, resulting primed dendritic cells capable of inducing specific and robust responses from cytotoxic T lymphocyte (CTL) toward cancer cells.
- CTL cytotoxic T lymphocyte
- the disorder is cancer.
- the disorder is an autoimmune disorder, e.g., rheumatoid arthritis and multiple sclerosis.
- the disorder is a human immunodeficiency virus (HIV) infection or an acquired immunodeficiency syndrome.
- a strain of an Arbovirus or a strain of an Alphavirus is a Dengue virus or a Chikungunya virus.
- the subject is administered a Dengue Virus prior to administration of the primed DCs.
- the subject is administered a Chikungunya virus prior to administration of the primed DCs.
- an immune modulatory agent is administered prior, during, or following administration of a Dengue virus.
- an immune modulatory agent is administered prior, during, or following administration of a Chikungunya virus
- Priming the dendritic cells generally involves contacting the dendritic cells with one or more tumor antigens that are present on target cancer cells.
- the dendritic cells are primed with the tumor antigen alone, the tumor antigen having been synthesized, isolated or purified.
- the dendritic cells are primed with a tumor cell lysate, wherein the tumor cell lysate contains the tumor antigen.
- the dendritic cell is primed with a whole cancer cell expressing the tumor antigen. The dendritic cell is then administered to the subject, where it will present the tumor antigen to the CTL, and thus, tailor the CTL for recognition and destruction of target cancer cells.
- dendritic cells may be cultured, stored and shipped in and on a hard container, such as a polystyrene tissue culture plate. This avoids a reduction in dendritic cell immunostimulatory activity that can be caused by exposure to polymers contained in soft plastic bags. For example, these polymers can reduce the amount of IL-12 produced by the dendritic cells, thereby reducing their capacity to induce a robust CTL response.
- Examples provided herein demonstrate that primed dendritic cells generated by the methods disclosed herein are capable of secreting at least about 6.5 pg/mL of IL-12p70, whereas dendritic cells produced by standard methods typically only produce 4-6 pg/mL of IL-12p70.
- the methods disclosed herein utilize a gentle cell lysis protocol that preserves the integrity of the tumor antigen.
- This gentle lysis may be achieved by exposing the tumor or cancer cells to a calcium or sodium hypochlorite solution for no more than about 30-60 minutes.
- any tumor cells used to prime dendritic cells are disassociated gently, for instance, by a Miltenyi GentleMACS system, or the like.
- Primed dendritic cells prepared by the methods disclosed herein may be administered to the subject along with an agent that will boost the subject's immune system.
- the primed dendritic cells may be administered to the subject after infecting the subject with a virus.
- the methods and examples disclosed herein use a Dengue virus, particularly Dengue virus serotype 2 strain #1710, which is relatively safe (e.g., no known occurrence of lethality or serious adverse events). This virus provides for the activation of a suppressed immune system (e.g., by producing a TH1 polarity shift), and improving targeting specificity, thereby providing higher efficacy and safety relative to current cellular therapies.
- primed dendritic cells with a viral infection provides for an effective treatment with minimal administration, possibly as few as one time, which avoids the challenge of subject adherence to therapy.
- the primed dendritic cells may be autologous, meaning derived from a subject's own cells, or allogenic, derived from another subject with a similar tissue type.
- combination therapy comprises administration of an immune checkpoint modulatory agent with an Arbovirus.
- the combination therapy comprises administration of an immune checkpoint modulatory agent with an Alphavirus.
- the Arbovirus is Dengue virus (DV).
- the Alphavirus is Chikungunya virus (CV).
- an immune checkpoint modulatory agent is administered prior to administration of DV.
- an immune checkpoint modulatory agent is coadministered with DV.
- an immune checkpoint modulatory agent is administered following administration of DV.
- an immune checkpoint modulatory agent is at least one of CD244, A2aR, CD276, VTCN1, B7H6, B7RP1, BTLA, butyrophilin, CD 103, CD 122, CD 137, CD137L, CD 160, CD2, CD200R, CD226, CD26, CD27, CD28, CD30, CD39, CD40, CD48, CD70, CD73, CD80, CD86, CEACAM1, CGEN-15049, CTLA-4, DR3, GAL9, GITR, GITRL, HVEM, ICOS, ICOSL, IDOl, ID02, ILT-2, ILT-4, KIR, KLRG1, LAG3, LAIR1, T FSF14, MARCO, KG2A, NKG2D, OX-40, OX-40L, PD-1, PDL- 1, PDL-2, PS, SIRPalpha, SLAM, TGFR, TIGIT, TFM1, ⁇ 3, ⁇ 4, or VISTA.
- the immune checkpoint modulatory agent can be at least one of B7H3, CD137 (41BB), CD27, CTLA4, GITR, KIR, LAG3, PD-1, PDL-1 (B7H1, CD274), or PS.
- Exemplary amino acid sequences for immune checkpoint modulatory agents are provided in Table 1.
- Amino acid sequences for immune checkpoint modulatory agents can be at least about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%), about 95%, or about 100% similar in homology to a sequence of Table 1.
- an immune checkpoint modulatory agent is administered prior to administration of CV. In some cases, an immune checkpoint modulatory agent is coadministered with CV. In some instances, an immune checkpoint modulatory agent is administered following administration of CV. In some cases, an immune checkpoint modulatory agent is at least one of CD244, A2aR, CD276, VTCN1, B7H6, B7RP1, BTLA, butyrophilin, CD 103, CD 122, CD 137, CD137L, CD 160, CD2, CD200R, CD226, CD26, CD27, CD28, CD30, CD39, CD40, CD48, CD70, CD73, CD80, CD86, CEACAM1, CGEN-15049, CTLA-4, DR3, GAL9, GITR, GITRL, HVEM, ICOS, ICOSL, IDOl, ID02, ILT-2, ILT-4, KIR, KLRG1, LAG3, LAIR1, TNFSF14, MARCO, NKG2A,
- the immune checkpoint modulatory agent can be at least one of B7H3, 41BB, CD27, CTLA4, GITR, KIR, LAG3, PD-1, PDL-1, or PS.
- Exemplary amino acid sequences for immune checkpoint modulatory agents are provided in Table 1. In some cases, from about 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or up to about 100% homology to any one of SEQ ID NO: 1 to SEQ ID NO: 9 can be utilized herein.
- HLIGEHHDGVSK A F SIGPMMQDL AGT YRC YGS VT HSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAG ES VTLSC S SRS S YDMYHLSREGEAHERRF SAGPKVN GTF Q ADFPLGP ATHGGT YRCF GSFRD SP YEW SNS S DPLLVSVTG PSNSWPSPTEPSSKTG PRHLHVLIG TSVVIILFILLLFFLLHRWCC KKNAVVMDQEPAGN RT V RED SDEQDPQE VTY AQLNHC VF TQRKITHP S QRPKTPPTDIIVYTELPNAEP
- an immune checkpoint modulatory agent for administration in a method described herein is an inhibitor that targets at least one of A2aR, B7H3, B7H4, BTLA, CTLA-4, IDOl, ID02, KIR, LAG3, PD-1, PDL-1, PDL-2, PS, TFM3, or VISTA.
- the inhibitor targets A2aR.
- the inhibitor targets B7H3.
- the inhibitor targets B7H4.
- the inhibitor targets BTLA.
- the inhibitor targets CTLA4.
- the inhibitor targets IDOL
- the inhibitor targets ID02.
- the inhibitor is directed to KIR.
- the inhibitor is directed to LAG3.
- the inhibitor is directed to PD-1. In some cases, the inhibitor is directed to PDL-1. In some cases, the inhibitor targets PDL-2. In some cases, the inhibitor is directed to PS. In some instances, the inhibitor targets TEVI3. In some cases, the inhibitor targets VISTA. In some instances, the immune checkpoint modulatory agent binds directly to a target described herein. In some instances, the immune checkpoint modulatory agent binds indirectly to a target described herein.
- the immune checkpoint inhibitor is an antibody against at least one of B7H3, CTLA4, KIR, LAG3, PD-1, PDL-1, or PS.
- the antibody is at least one of monoclonal antibodies, synthetic antibodies, polyclonal antibodies, multispecific antibodies (including bi-specific antibodies), human antibodies, humanized antibodies, chimeric antibodies, single-chain Fvs (scFv) (including bi-specific scFvs), single chain antibodies, Fab fragments, F(ab') fragments, disulfide-linked Fvs (sdFv), or epitope-binding fragments thereof.
- the antibodies are immunoglobulin molecules or immunologically active portions of immunoglobulin molecules.
- the antibodies are animal in origin including birds and mammals.
- the antibodies are human or humanized monoclonal antibodies.
- the antibody against B7H3 is Enoblituzumab (e.g., MGA271).
- the antibody against CTLA-4 is selected from Ipilimumab (e.g., BMS-734016, MDX- 010) and Tremelimumab (e.g., CP-675, CP-675,206).
- the KIR antibody is Lirilumab (e.g., BMS-986015, IPH2102).
- the antibody against LAG3 is
- the antibody against PD-1 is selected from Pembrolizumab (e.g., MK-3475, SCH 900475), Nivolumab (e.g., BMS-936558, MDX-1 106, ONO-4538), and Pidilizumab (e.g., CT-01 1, MDV9300).
- the antibody against PDL1 is selected from anti-PDLl monoclonal antibody MDX-1 105, Atezolizumab (e.g., MPDL3280A, RG7446, R05541267), and BMS-936559 (e.g., MDX-1 105).
- the antibody against PS is Bavituximab.
- the inhibitor is an IgG fusion protein.
- the fusion protein directed against PD-1 is AMP-224.
- the IgG protein directed against LAG3 is F P321.
- a combination of antibodies to several immune checkpoint inhibitors is administered in a method described herein.
- immune checkpoint inhibitor described herein comprises an RNA interfering agent.
- the RNA interfering agent inhibits the expression of at least one of A2aR, B7H3, B7H4, BTLA, CTLA-4, IDOl, ID02, KIR, LAG3, PD-1, PDL-1, PDL-2, PS, TEVI3, or VISTA.
- the RNA interfering agent is at least one of a small interfering RNA (siRNA), small hairpin RNA (shRNA), or a microRNA (miRNA).
- an oligonucleotide complementary to at least one A2aR, B7H3, B7H4, BTLA, CTLA-4, IDOl, ID02, KIR, LAG3, PD-1, PDL-1, PDL-2, PS, TEVI3, or VISTA is used.
- the immune checkpoint inhibitor is at least one of a small molecule, a peptide, a peptidomimetic, or a soluble version of the immune checkpoint.
- an immune checkpoint modulatory agent described herein reduces the expression of the immune checkpoint target.
- the expression of the immune checkpoint may be decreased by about 5-100, 10-90, 20-80, 30-70, 40-60, 50-95, 65-85, or 75-95%.
- the expression may be decreased by at least 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 76, 80, 85, 90, 95, 99, or 100%.
- the expression may be decreased by at least 5%.
- the expression may be decreased by at least 10%.
- the expression may be decreased by at least 30%.
- the expression may be decreased by at least 50%.
- the expression may be decreased by at least 70%.
- the expression may be decreased by at least 90%.
- an immune checkpoint modulatory agent described herein reduces the activity of the immune checkpoint target.
- the activity of the immune checkpoint may be decreased by about 5-100, 10-90, 20-80, 30-70, 40-60, 50-95, 65-85, or 75-95%.
- the activity may be decreased by at least 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 76, 80, 85, 90, 95, 99, or 100%.
- the activity may be decreased by at least 5%.
- the activity may be decreased by at least 10%.
- the activity may be decreased by at least 30%.
- the activity may be decreased by at least 50%.
- the activity may be decreased by at least 70%.
- the activity may be decreased by at least 90%.
- Exemplary activities include, without limitation, binding activity,
- an immune checkpoint modulatory agent described herein reduces the interaction between PD-1 and its ligands PDL-1 or PDL-2. In some instances, the immune checkpoint modulatory agent reduces the interaction between KIR and its ligand. In some cases, the immune checkpoint modulatory agent inhibits activation. In some cases, the immune checkpoint modulatory agent inhibits downstream signaling.
- an immune checkpoint modulatory agent described herein activates the immune checkpoint target.
- the immune checkpoint modulatory agent targets at least one of CD122, CD137, CD137L, CD27, CD28, CD40, CD70, CD80, CD86, GITR, GITRL, ICOS, ICOSL, OX-40, or OX-40L.
- the immune checkpoint modulatory agent targets CD122.
- the immune checkpoint modulatory agent targets CD137.
- the immune checkpoint modulatory agent targets CD137L.
- the immune checkpoint modulatory agent targets CD27.
- the immune checkpoint modulatory agent targets CD28.
- the immune checkpoint modulatory agent targets CD40.
- the immune checkpoint modulatory agent targets CD40. In some cases, the immune checkpoint modulatory agent targets CD70. In some instances, the immune checkpoint modulatory agent targets CD80. In some cases, the immune checkpoint modulatory agent targets CD86. In some instances, the immune checkpoint modulatory agent targets GITR. In some cases, the immune checkpoint modulatory agent targets GITRL. In some instances, the immune checkpoint modulatory agent targets ICOS. In some cases, the immune checkpoint modulatory agent targets ICOSL. In some instances, the immune checkpoint modulatory agent targets OX-40. In some cases, the immune checkpoint modulatory agent targets OX-40L.
- an immune checkpoint modulatory agent described herein is an antibody directed to at least one of CD137, CD27, and GITR.
- the antibody is at least one of monoclonal antibodies, synthetic antibodies, polyclonal antibodies, multispecific antibodies (including bi-specific antibodies), human antibodies, humanized antibodies, chimeric antibodies, single-chain Fvs (scFv) (including bi-specific scFvs), single chain antibodies, Fab fragments, F(ab') fragments, disulfide-linked Fvs (sdFv), or epitope-binding fragments thereof.
- the antibodies are immunoglobulin molecules or immunologically active portions of immunoglobulin molecules.
- the antibodies are animal in origin including birds and mammals. In some cases, the antibodies are human or humanized monoclonal antibodies. In some instances, the antibody directed towards CD 137 is Urelumab (e.g., BMS- 663513). In some cases, the antibody is directed towards CD27 is Varlilumab (e.g., CDX-1 127). In some instances, the antibody is directed towards GITR is TRX518.
- an immune checkpoint modulatory agent described herein activates an immune checkpoint.
- the immune checkpoint modulatory agent targets at least one of CD122, CD 137, CD137L, CD27, CD28, CD40, CD70, CD80, CD86, GITR, GITRL, ICOS, ICOSL, OX-40, or OX-40L.
- the immune checkpoint modulatory agent is at least one of a small molecule, a peptide, a peptidomimetic, or a soluble version of the immune checkpoint modulatory agent.
- an immune checkpoint modulatory agent described herein increases the expression of an immune checkpoint pathway component.
- the expression of the immune checkpoint pathway component may be increased by about 5-100, 10-90, 20-80, 30-70, 40-60, 50-95, 65-85, or 75-95%.
- the expression may be increased by at least 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 76, 80, 85, 90, 95, 99, or 100%.
- the expression may be increased by at least 5%.
- the expression may be increased by at least 10%.
- the expression may be increased by at least 30%.
- the expression may be increased by at least 50%.
- the expression may be increased by at least 70%.
- the expression may be increased by at least 90%.
- the immune checkpoint modulatory agent increases the activity of the immune checkpoint target.
- the activity of the immune checkpoint may be increased by about 5- 100, 10-90, 20-80, 30-70, 40-60, 50-95, 65-85, or 75-95%.
- the activity may be increased by at least 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 76, 80, 85, 90, 95, 99, or 100%.
- the activity may be increased by at least 5%.
- the activity may be increased by at least 10%.
- the activity may be increased by at least 30%.
- the activity may be increased by at least 50%.
- the activity may be increased by at least 70%.
- the activity may be increased by at least 90%.
- the DCs may comprise allogeneic dendritic cells or autologous dendritic cells.
- the methods described herein comprise administering allogeneic primed dendritic cells to a subject.
- the methods described herein comprise administering autologous primed dendritic cells to a subject.
- the methods disclosed herein comprising administering primed DCs to the subject may be referred to herein as "dendritic cell vaccination.”
- methods described herein comprise obtaining dendritic cells from CD34+ progenitor cells in the bone marrow. In some instances, methods described herein comprise obtaining dendritic cells from CD1+CD14+ immature monocytes in the peripheral blood. In some instances, obtaining the dendritic cells comprises leukapheresis. In some instances, leukapheresis comprises withdrawing a unit of blood from the subject or a donor, separating a series of blood-components: red cells, platelets, and most of the plasma factors, which are returned to the subject, with the white blood cells remaining. In some instances, methods described herein comprise assessing the white blood cells for sterility, shipping or storing them cold (4°C), and or processing the DCs from the apheresis product.
- Methods of DCs production disclosed herein may comprise separating monocytes in the unit of blood from other white cells, including, but not limited to, T cells, B cells, K cells, Eosinophils and Basophils. This may be accomplished with immuno-magnetic selection or by adherence properties. Immuno-magnetic selection involves contacting white blood cells from the unit of blood with a sterile plastic column with plastic beads coated with antibodies for immune cells, such as, by way of non-limiting example, CD surface proteins: (CD4, CD8, CD56, etc.). Unwanted (non-monocyte) cells will adhere to the beads, leaving the monocytes to pass through and be collected.
- CD surface proteins CD4, CD8, CD56, etc.
- magnetic beads may be coated with antibodies for CD1 and/or CD 14 to capture monocytes, a magnet is placed against the column, and unwanted cells are flushed out of the column with a buffered saline solution or cell-viable media. The monocytes are then washed off the beads and collected in a following step.
- properties of monocytes to stick to certain surfaces are used to separate them by running the apheresis product down a slanted column.
- methods for cell collection may comprise collecting only a few thousand monocytes from the unit of blood. Effective immunotherapy generally requires DC doses in the range of 50 million.
- methods disclosed herein may comprise expanding monocytes, as well as any precursors thereof, and any cells differentiated therefrom (e.g., DCs). Expanding cells may comprise contacting cells with factors such as growth factors, colony- stimulation factors, cytokines, or any other proliferation or growth inducing factors, and combinations thereof.
- IL-4 recombinant human growth factors rhuInterleukin-4
- GM-CSF rhuGranulocyte-Macrophage-Colony-Stimulation Factor
- IL-4 and GM-CSF may be used to accomplish the expansion of DC numbers.
- IL-4 and GM-CSF may be required to develop mature DCs from monocytes, which have poor antigen-uptake and CTL- stimulating ability, compared to mature DCs.
- IL-4 and GM-CSF may expand the number and the development of mature-DC markers.
- DC markers may include, but are not limited to CD1 1, CD80, and CD83, as well as increased expression of both Class I (for presentation of short peptides to CD8+ cells), and Class II (for presentation of longer peptides to CD4+Helper- Inducer T lymphocytes) MHC complexes.
- Expanding cells may produce mature D DCs C in the tens of millions within about 2 days. Expanding cells may produce mature DCs in the tens of millions within about 3 days. Expanding cells may produce mature DCs in the tens of millions within about 4 days. Expanding cells may produce mature DCs in the tens of millions within about 5 days. Expanding cells may produce mature DCs in the tens of millions within about one week.
- methods described herein comprise contacting or pulsing DCs with peptides/antigens, tumor cells, tumor supporting cells, tumor cell lysate and/or tumor supporting cell lysate.
- the term "pulsing,” as used herein, generally refers to contacting the cells more than once at one or more intervals, and may be used interchangeably with contacting, unless specified otherwise.
- the methods comprise contacting or pulsing DCs with a peptide that binds MHC Class I molecules ("MHC Class I peptide").
- methods described herein comprise contacting or pulsing DC with a peptide that binds MHC Class II molecules (“MHC Class II peptides").
- methods described herein comprise contacting or pulsing DC with MHC Class I peptides and MHC Class II peptides. In some instances, the contacting or pulsing makes the DCs competent to prime CTL and target CTL to tumors. In some instances, methods described here comprise contacting or pulsing DC with manufactured/synthetic Class I and/or Class II peptides. In some instances, the Class I and/or class II peptides are manufactured, then added to the DC medium, optionally in in microgram quantities or less. In some instances, methods described herein include Class II peptides for a sustained immune response. In some instances, methods described herein comprise DNA or RNA sequencing of the peptide (i.e.
- the peptide or portion thereof is represented by an amino acid sequence selected from EGSRNQDWL (SEQ ID NO: 28), (TAYRYHLL) (SEQ ID NO: 29), or combinations thereof.
- Class I peptides may by manufactured, then added to the DC medium in microgram quantities. However, this technique is costly, because the peptides must be matched to the subject's HLA type, and if the tumor cell does not present that antigen, it can evade detection and lysis. The lack of Class II peptides to activate CD4+ help leads to rapid decline of immune response power.
- Other methods may comprise RNA sequencing of common tumor antigens, then using electroporation to insert the RNA into the DCs to trigger antigen processing. This method does not require HLA matching, and includes Class II peptides for a sustained immune response. However, RNA sequencing may be technically complex, and may only present a limited number of antigens of thousands of potential gene products. For these reasons, autologous whole-tumor cells or their lysate have the advantages of low cost, ready availability by biopsy (1-2 gm sufficient), and contain the full array of potential antigens for a broad and deep immune response.
- Methods for dendritic cell priming described herein may comprise obtaining whole tumor cells and/or lysates thereof.
- Tumor cells may be killed by radiation or other means and preparing lysate by various methods.
- lysing the tumor cells does not comprise trypsin enzyme digestion and freeze-thaw cycles, which are simple and fast, but can damage the delicate peptides within.
- the methods disclosed herein may employ an automated cell processor (e.g. the Miltenyi GentleMACS system), which allows the sample to be manually minced, suspended in PBS solution, then a pre-selected tissue-specific software-controlled rotor system separates the tumor cells.
- the single-cell suspension may be membrane-lysed with minimal damage to tumor peptides.
- Methods for dendritic cell priming described herein may comprise contacting the dendritic cells with autologous tumor cells or lysates thereof.
- methods described herein comprise contacting the dendritic cells with autologous whole-tumor cells (e.g. tumor cells and tumor supporting cells) or lysates thereof which contain the full array of potential antigens for a broad and deep immune response.
- Methods for dendritic cell priming described herein may comprise contacting the dendritic cells with tumor cell lysate comprising apoptotic or necrotic bodies.
- the tumor cell lysate comprises tumor antigens from the microenvironment surrounding the tumor cells, such as extracellular matrix proteins.
- Methods for dendritic cell priming described herein may comprise contacting the DCs with an augmenting agent that will augment the priming, proliferation or viability of the DCs.
- the augmenting agent may be selected from lymphokines, monokines, cytokines, growth factors, cells, cell fragments, (non-protein) small molecules, antibodies, antibody fragments, nucleic acids, and combinations thereof.
- Methods for preparing cells and antigens for DC priming may comprise rendering the target cells (e.g., cancer cells) incapable of cell division.
- the methods may comprise treating cells with mytomycin C or radiation to render cells incapable of cell division.
- These may include cells that are added as augmenting agents or cells used to pulse DCs (e.g., tumor cells).
- methods described herein comprise pulsing the DCs from about 1 hour to about 24 hours. In some instances, methods described herein comprise pulsing the DCs from about 12 hours to about 48 hours. In some instances, methods described herein comprise pulsing the DCs from about 8 hours to about 24 hours. In some instances, methods described herein comprise pulsing the DCs for about 18 hours. Pulsing may comprise contacting the DCs at least once with the peptides/antigens, tumor cells, tumor supporting cells, tumor cell lysate and/or tumor supporting cell lysate.
- Pulsing may comprise contacting the DCs at least twice with the peptides/antigens, tumor cells, tumor supporting cells, tumor cell lysate and/or tumor supporting cell lysate. Pulsing may comprise contacting the DCs at least three times with the peptides/antigens, tumor cells, tumor supporting cells, tumor cell lysate and/or tumor supporting cell lysate. Pulsing may comprise contacting the DCs less than two times, less than three times, less than four times, less than five times, or less than 10 times with the peptides/antigens, tumor cells, tumor supporting cells, tumor cell lysate and/or tumor supporting cell lysate.
- Pulsing may comprise adding the peptides/antigens, tumor cells, tumor supporting cells, tumor cell lysate and/or tumor supporting cell lysate to the DC more than once, such that the peptides/antigens, tumor cells, tumor supporting cells, tumor cell lysate and/or tumor supporting cell lysate accumulates in the DC culture media. Pulsing may comprise washing the cells or removing the DC culture media between one or more pulses.
- Methods described herein may comprise contacting DC with a maturing agent to enhance, complete or finalize the maturation of the DC.
- the maturing agent also acts as a "danger signal.” Without this danger signal, the tumor antigen may induce Treg production or activity, which will ultimately lower CTL activity.
- the maturing agent/danger signal is an inflammatory signal.
- the inflammatory signal may also be referred to as an inflammatory mediator.
- Inflammatory mediators may include cytokines, as well as other factors (e.g., chemokines, adhesion molecules, etc.), that may not be classified by those in the art as cytokines, but affect inflammation either directly or indirectly,
- the inflammatory mediator is selected from a chemokine, a cytokine, a pathogen, a non-peptidic small molecule, a compound, an antibody, a peptide, fragments thereof, portions thereof, and combinations thereof.
- the inflammatory signal is a modulator of a pattern recognition receptor (PRR) or pathway thereof.
- PRR pattern recognition receptor
- inflammatory signals are selected from an interferon, a toll-like receptor signaling modulator, and combinations thereof.
- the interferon may be interferon-gamma.
- the inflammatory signal is a toll-like receptor signaling pathway modulator.
- the inflammatory signal is a toll-like receptor (TLR) signaling pathway regulator.
- TLR toll-like receptor
- the toll-like receptor signaling pathway regulator may be lipopoly saccharide (LPS), a polysaccharide from bacterial cell walls.
- the toll-like receptor signaling pathway regulator may be selected from a toll-like receptor signaling pathway regulator that regulates TLR1, TLR2, TLR3, TLR4, TLR5, TLR6, TLR7, TLR8, TLR9 and TLR 10.
- the toll-like receptor signaling pathway regulator may be a ligand, a binding protein, an antibody, an agonist or an antagonist, of a TLR.
- the toll-like receptor signaling pathway regulator may be selected from a peptide, a protein, a cell fragment, a cell-wall component, a lipoprotein, a peptidoglycan, a polysaccharide, a monosaccharide, and a small molecule compound.
- the toll-like receptor signaling pathway regulator may be a portion of an animal cell, a plant cell, a bacterial cell, a yeast cell, a fungal cell, and
- the toll-like receptor signaling pathway regulator may be a TLR2 signaling pathway regulator.
- the TLR2 signaling pathway regulator may be lipoteichoic acid, MALP-2, MALP-4, OspA, Porin, LcrV, lipomannan, GPI anchor, lysophosphatidyl serine, lipophosphoglycan, glycophosphatidylinositol, zymosan, hsp60, and hemagllutinin.
- the toll-like receptor signaling pathway regulator may be a TLR4 signaling pathway regulator.
- the TLR4 signaling pathway regulator may be buprenorphine, carbamazepine, ethanol, fentanyl, levorphanol, LPS, methadone, morphine, oxcarbazepine, oxycodone, pethidine, and glucuronoxylomannan.
- the toll-like receptor signaling pathway regulator may be a TLR7 signaling pathway regulator.
- the TLR7 signaling pathway regulator may be a single stranded RNA or an imidazoquinoline compound.
- the toll-like receptor signaling pathway regulator may be a TLR8 signaling pathway regulator.
- the TLR8 signaling pathway regulator may be a single stranded RNA, a G-rich oligonucleotide or an
- imidazoquinoline compound The imidazolquinoline compound may be R848.
- the DC may up-regulate their
- CD80/CD83+activation markers increase production of IL-12p70 to induce a Type 1 CTL response, and become resistant to further antigen uptake and processing.
- Methods for producing primed dendritic cells described herein may comprise contacting primed dendritic cells with interferon gamma.
- the methods comprise culturing the primed dendritic cells in a culture media with a concentration of interferon gamma selected from about 100 U/mL to about 10,000 U/mL, about 500 U/mL to about 5000 U/mL, and about 500 U/mL to about 2,000 U/mL.
- the methods comprise culturing the primed dendritic cells in a culture media with a concentration of interferon gamma of about 500 U/mL.
- the methods comprise culturing the primed dendritic cells in a culture media with a concentration of interferon gamma of about 1000 U/mL. In some instances, the methods comprise culturing the primed dendritic cells in a culture media with a concentration of interferon gamma of about 2000 U/mL.
- Methods for producing primed dendritic cells described herein may comprise contacting primed dendritic cells with TLR8 agonist R848.
- the methods comprise culturing the primed dendritic cells in a culture media with a concentration of R848 selected from about 0.1 ⁇ g/mL to about 50 ⁇ g/mL, about 1 ⁇ g/mL to about 20 ⁇ g/mL, and about 1 ⁇ g/mL to about 10 ⁇ g/mL.
- the methods comprise culturing the primed dendritic cells in a culture media with a concentration of R848 of about 1 ⁇ g/mL.
- the methods comprise culturing the primed dendritic cells in a culture media with a concentration of R848 of about 5 ⁇ g/mL. In some cases, the methods comprise culturing the primed dendritic cells in a culture media with a concentration of R848 of about 10 ⁇ g/mL.
- Methods for producing primed dendritic cells described herein may comprise contacting primed dendritic cells with lipopolysaccharide.
- the methods comprise culturing the primed dendritic cells in a culture media with a concentration of lipopolysaccharide selected from about 1 ng/mL to about 100 ng/mL, about 1 ng/mL to about 50 ng/mL, and about 1 ng/mL to about 25 ng/mL.
- the methods comprise culturing the primed dendritic cells in a culture media with a concentration of lipopolysaccharide of about 5 ng/mL.
- the methods comprise culturing the primed dendritic cells in a culture media with a concentration of lipopolysaccharide of about 10 ng/mL. In some instances, the methods comprise culturing the primed dendritic cells in a culture media with a concentration of lipopolysaccharide of about 15 ng/mL.
- Methods described herein may comprise sterility, specificity, and viability assessment of the DCs. The testing may occur before shipping or storing the DCs. The testing may occur after shipping or storing the DCs. The methods may comprise measuring expression level of IL- 12p70 in DCs, either at the RNA or protein level.
- IL-12p70 is an independent predictor of clinical response, tested across numerous trials in the last two decades, some with about 40% response rates.
- the expression level of IL-12p70 in primed DCs produced by the methods disclosed herein may be at least about two times greater than primed DCs
- the expression level of IL-12p70 in primed DCs produced by the methods disclosed herein may be at least about two times greater than primed DCs produced/stored/shipped by traditional methods ("traditional primed DC").
- the expression level of IL-12p70 in primed DCs may be at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, or at least about 100% greater than traditional primed DCs.
- the expression level of IL-12p70 in primed DCs may be at least about three times greater than traditional primed DCs.
- the expression level of IL-12p70 in primed DCs may be at least about four times greater than traditional primed DCs.
- the expression level of IL-12p70 in primed DCs produced by the methods disclosed herein may be about two to about twenty times greater than traditional primed DCs.
- dendritic cells that produce more than 6 ng/mL of IL-12p70. In some instances, provided herein are dendritic cells that produce at least about 6.5 ng/mL of IL- 12p70. In some instances, provided herein are dendritic cells that produce more than 10 ng/mL of IL-12p70.
- DCs produced by methods described herein produce at least about lOng/mL IL-12p70, at least about 12 ng/mL IL-12p70, at least about 14 ng/mL IL-12p70, at least about 16 ng/mL IL-12p70, at least about 18 ng/mL IL-12p70, at least about 20 ng/mL IL-12p70, at least about 22 ng/mL IL-12p70, or at least about 24 ng/mL IL-12p70. In some instances, DCs produced by methods described herein produce about lOng/mL to about 30 ng/mL.
- DCs produced by methods described herein produce from about lOng/mL to about 25 ng/mL IL-12p70. In some instances, DCs produced by methods described herein produce from about 15 ng/mL to at least about 23 ng/mL IL-12p70. In some instances, DCs produced by methods described herein produce from about 6.5 ng/mL to at least about 23 ng/mL IL-12p70.
- Methods for producing DCs described herein may comprise testing the ability of the DCs to induce a CTL response.
- Measuring the level of the CTL response may comprise measuring cytokines or inflammatory mediators in blood, serum or plasma from the subject.
- Measuring the level of the CTL response may comprise measuring a change in the level of a cytokine or inflammatory mediator in blood, serum or plasma from the subject.
- Measuring the level of the CTL response may comprise measuring the production of a cytokine or inflammatory mediator in vitro.
- Cytokines and inflammatory mediators may include interleukins, migration inhibitory proteins, monocyte chemotactic proteins, monocyte chemoattractant proteins, interferons, tumor necrosis factors, colony stimulating factors (CSFs), macrophage inflammatory proteins, monokines, chemokines, chemokine ligands (CCLs), and C-X-C motif chemokines (CXCL), and receptors thereof.
- CSFs colony stimulating factors
- CXCL C-X-C motif chemokines
- Cytokines and inflammatory mediators include, but are certainly not limited to, interleukin 1 beta (IL-lb), interleukin 2 (IL-2), interleukin 4 (IL-4), interleukin 5 (IL- 5), interleukin 7 (IL-7), interleukin 8 (IL-5), interleukin 10 (TL-10), interleukin 13 (IL-13), interleukin 6 (IL-6), interleukin 12 (IL-12), interleukin 15 (IL-15), interleukin 17 (IL-17), Rantes, Eotaxin, macrophage inflammatory protein 1 alpha (MTP-la), macrophage inflammatory protein 1 beta (MTP-lb), granulocyte macrophage colony-stimulating factor (GM-CSF), monocyte chemoattractant protein- 1 (MCP-1), interferon alpha (IFNa), interferon gamma (IFNg), interleukin 1 receptor alpha (IL-IRa), interleukin 2 receptor (IL-2R), tumor necros
- Methods for DC preparation described herein may comprise culturing DCs on a hard surface.
- hard surface generally refers to a standard plastic tissue culture plate or flask (e.g. a polystyrene plate).
- the methods disclosed herein comprise culturing DCs on a hard surface to which the DCs can adhere.
- the hard surface is coated with a protein, peptide, extracellular matrix molecule, polymer, or combinations thereof.
- the hard surface is not coated (e.g., the DCs adhere directly to the hard plastic surface).
- the hard surface is contrasted to a soft tissue culture bag, also known as cell differentiation bags.
- Soft tissue culture bags may be bags comprising polymers or chemicals (e.g.
- Soft tissue culture bags may be bags comprising polymers or chemicals that evoke a neutral Type 0 response from the DCs, rendering the DCs functionally inert.
- Soft tissue culture bags may be bags comprising a polymer selected from polyethylene, fluorinated ethylene propylene (FEP), hexafluoropropylene, tetrafluoroethylene, polytetrafluoroethylene, and co-polymers thereof, and combinations thereof.
- Methods for DC preparation described herein may comprise transferring the DCs to a storage unit.
- the storage unit may also be a shipping unit.
- the storage unit may be selected from a flexible or soft container or surface (e.g., a bag) or a hard container or surface (e.g., a flask or plate).
- the storage unit may comprise a hard plastic surface.
- the storage unit may consist essentially of a hard plastic surface.
- the storage unit may consist of a hard plastic surface.
- the storage unit may comprise a non-plastic surface (e.g., glass).
- the storage unit may consist essentially of a non-plastic surface.
- the storage unit may consist of a non-plastic surface.
- the storage unit may be free of any polymers that would be taken up by, and/or induce a response in, cells stored within the storage unit.
- the storage unit may be free or essentially free of polymers that induce a neutral or Type 0 response in immature DCs.
- a neutral response may be characterized by low expression of IL-12p70.
- the storage unit may be essentially free of any polymers that would be taken up by, and/or induce a response in, cells stored within the storage unit. Essentially free may mean that the storage unit is at least 90%, at least 95%, at least 98%, or at least 99% free of any polymers that would be taken up by, and/or induce a response in, cells stored within the storage unit.
- Essentially free may mean that the storage unit is at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, or at least 99.9% free of any polymers that would be taken up by, and/or induce a response in, cells stored within the storage unit.
- the storage units for storing DCs produced by methods described herein, wherein the storage units comprise an inner surface, wherein the inner surface is the surface of the storage unit that is in contact with cells stored therein.
- the inner surface may consist of a hard plastic surface.
- the inner surface may be glass.
- the inner surface may be absent of any polymers that would be taken up by, and/or induce a response in, cells stored within the storage unit.
- the inner surface may be constructed of polymers that are not taken up by immature DC or any cells stored within the storage unit.
- the inner surface may be free of any polymers that would be taken up by, and/or induce a response in, cells stored within the storage unit.
- the inner surface may be essentially free of any polymers that would be taken up by, and/or induce a response in, cells stored within the storage unit.
- the inner surface may be at least 90%, at least 95%, at least 98%, or at least 99% free of any polymers that would be taken up by, and/or induce a response in, cells stored within the storage unit following addition of cells and storage media.
- the inner surface may be at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, or at least 99.9% free of any polymers that would be taken up by, and/or induce a response in, cells stored within the storage unit following addition of cells and storage media.
- the inner surface may be free or essentially free of polymers that induce a neutral or Type 0 response in immature DCs.
- a neutral response may be characterized by low expression of IL-12p70.
- storage units for storing DCs produced by methods described herein, wherein the storage units are suitable for freezing at -70oC in liquid N2, storage up to 1 year, and shipping to the clinic for use.
- the methods may comprise storing and/or shipping mature DCs, immature DCs, monocytes or blood in a storage unit.
- the methods may comprise shipping cells cool overnight.
- the methods may comprise thawing or warming cells to 37° C (e.g., in a warm-water bath).
- DCs are primed with tumor cells from a subject.
- the tumor cells are isolated cells from a tumor microenvironment of the subject, referred to herein as tumor supporting cells.
- dendritic cells are exposed to/ pulsed with tumor cells, tumor supporting cells and/or peptides thereof, such that the dendritic cells will target tumor cells and/or tumor supporting cells that support tumor growth and metastasis (e.g. endothelial cells, vascular cells, immune cells, etc.).
- peptides/antigens from tumor cells and tumor supporting cells induce dendritic cells or cytotoxic lymphocytes with receptors for peptides/antigens on both tumor cells and tumor supporting cells, resulting in targeting of the dendritic cells or cytotoxic lymphocytes to the tumor
- tumor cells and/or tumor supporting cells are obtained from a biopsy of tumor tissue.
- the biopsy comprises cells selected from tumor cells, adipocytes, fibroblasts, endothelial cells, infiltrating immune cells, and combinations thereof.
- the methods comprise expanding tumor cells in order to have a sufficient number of tumor cells, tumor cell lysates or tumor cell antigens to effectively and optimally prime/pulse the DC. Expanding may comprise proliferating of the tumor cells in vitro.
- lysing comprises contacting the tumor cells and/or tumor supporting cells with an H4C1 enzyme solution to eliminate red blood cells.
- the lysing comprises contacting the tumor cells and/or tumor supporting cells with hypochlorous acid solution to induce immunogenic cell death.
- the cells are lysed gently enough to not destroy peptides.
- the cells are lysed to produce apoptotic or necrotic bodies.
- the methods comprise lysing the tumor cells and/or tumor supporting cells with an enzymatic solution.
- the methods comprise lysing the tumor cells and/or tumor supporting cells with a peroxide-free solution or a low peroxide-containing solution.
- HOCL hypochlorite solution
- the hypochlorite solution comprises sodium chlorite.
- the hypochlorite solution comprises calcium chlorite.
- concentration of the hypochlorite in a media in which the tumor cells are suspended is about 10 ⁇ , about 20 ⁇ , about 30 ⁇ , about 40 ⁇ , about 50 ⁇ , about 60 ⁇ , about 70 ⁇ , about 80 ⁇ , about 90 ⁇ , or about 100 ⁇ .
- methods for methods activating DCs comprise lysing the tumor cells and/or tumor supporting cells with a detergent solution prior to contact with the DCs.
- the detergent is selected from, but is not limited to, Triton X-100, Triton X-l 14, P- 40, Brij-35, Brij-58, Tween 20, Tween 80, octyl glucoside, octyl thioglucoside, SDS, CHAPS, and CHAPSO.
- the detergent solution is purified of peroxides, and other impurities.
- the detergent is about 0.1% to about 10% v/v of the detergent solution.
- the detergent is about 0.1% to about 5% v/v of the detergent solution. In some instances, the detergent is about 0.5% to about 5% v/v of the detergent solution. In some instances, the detergent is about 1% to about 10% v/v of the detergent solution. In some instances, the detergent is about 1% to about 5% v/v of the detergent solution. In some instances, the methods comprise lysing cells without shaking, vortexing, freezing, thawing, shear pressure, sonicating and/or heating the cells.
- methods for cell lysis described herein further comprise stopping or neutralizing the lysing.
- cells may be washed with a buffered saline solution (phospho-buffered saline solution or Hank's balanced salt solution) to neutralize the lysing.
- a buffered saline solution phospho-buffered saline solution or Hank's balanced salt solution
- combination therapies comprising therapeutic agents disclosed herein with other types of therapies in order to achieve an optimal result.
- combination approaches to cancer immunotherapy may be more successful than single-axis attacks which tumors can mutate to avoid.
- the therapy is a cancer therapy.
- Cancer therapies include, but are not limited to, chemotherapy, radiation, small molecule inhibitors, and monoclonal antibodies.
- compositions and methods wherein dendritic cell vaccination is combined with co-administration of an adjuvant effect of a virus to overcome tumor immune evasion mechanisms and deplete tumor cells and an effective amount of an immune checkpoint modulatory agent.
- the immune checkpoint modulatory agent is administered with an Arbovirus .
- the immune checkpoint modulatory agent is administered with DV.
- the immune checkpoint modulatory agent is administered with an Alphavirus.
- the immune checkpoint modulator agent is administered with CV.
- a schematic representation of the combination therapies disclosed herein is depicted in FIG. 1.
- Methods described here may be used to treat a subject for cancer by obtaining dendritic cells and tumor cells from the subject, exposing the dendritic cells to the tumor cells or tumor cell lysate, also referred to as “pulsing" the dendritic cells, to primed (or “activated") the dendritic cells, delivering the resulting primed and tumor-targeting dendritic cells to the subject after the subject has had his/her immune system stimulated with the virus (see, e.g., FIG. 1).
- a therapeutic effective amount of an immune checkpoint modulatory agent is co-administered with the virus.
- a tumor antigen that is not from the subject can be used for pulsing the dendritic cells.
- compositions and methods wherein dendritic cell vaccination is combined with co-administration of an adjuvant effect of a virus to overcome tumor immune evasion mechanisms and deplete tumor cells and an effective amount of an immune checkpoint modulatory agent.
- compositions wherein Dengue virus therapy is utilized as an adjuvant along with immune checkpoint inhibition are provided herein.
- an immune checkpoint modulatory agent is at least one of CD244, A2aR, CD276, VTCN1, B7H6, B7RP1, BTLA, butyrophilin, CD 103, CD 122, CD 137, CD137L, CD 160, CD2, CD200R, CD226, CD26, CD27, CD28, CD30, CD39, CD40, CD48, CD70, CD73, CD80, CD86, CEACAM1, CGEN-15049, CTLA-4, DR3, GAL9, GITR, GITRL, HVEM, ICOS, ICOSL, IDOl, ID02, ILT-2, ILT-4, KIR, KLRG1, LAG3, LAIR1, T FSF14, MARCO, KG2A, NKG2D, OX-40, OX-40L, PD-1, PDL- 1, PDL-2, PS, SIRPalpha, SLAM, TGFR, TIGIT, TFM1, TFM3, TFM4, or VISTA.
- Tumor immune evasion mechanisms are responsible for the lack of efficacy seen with most immunotherapy platforms.
- Compositions and methods described herein provide for a multi-pronged approach, combining physiological (hyperthermic reduction of tumor perfusion), immunological (activation of effector cells of the adaptive and innate immune system), and apoptosis-inducing pathways (sTRAIL) to destroy tumor cells.
- a virus like Dengue virus (DV)
- DV Dengue virus
- compositions wherein Dengue virus therapy is utilized as an adjuvant along with immune checkpoint inhibition are provided herein.
- DCs dendritic cells
- incubating the DCs with at least one tumor cell antigen comprises incubating the DCs with a tumor cell.
- incubating the DCs with at least one tumor antigen comprises incubating the DCs with a tumor cell lysate. In some instances, incubating the DCs with at least one tumor antigen comprises incubating the DC with a peptide expressed by a tumor cell.
- the condition or disease is cancer.
- the virus is an Arbovirus. In some cases, the virus is a Dengue virus. In some cases, the virus is an Alphavirus . In some instances, the virus is Chikungunya virus.
- the immune checkpoint modulatory agent is at least one of CD244, A2aR, CD276, VTCN1, B7H6, B7RP1, BTLA, butyrophilin, CD 103, CD 122, CD 137, CD137L, CD 160, CD2, CD200R, CD226, CD26, CD27, CD28, CD30, CD39, CD40, CD48, CD70, CD73, CD80, CD86,
- DCs dendritic cells
- incubating the DCs with at least one tumor cell antigen comprises incubating the DCs with a tumor cell.
- incubating the DCs with at least one tumor antigen comprises incubating the DCs with a tumor cell lysate.
- the immune checkpoint modulatory agent is at least one of CD244, A2aR, CD276, VTCN1, B7H6, B7RP1, BTLA, butyrophilin, CD103, CD122, CD137, CD137L, CD160, CD2, CD200R, CD226, CD26, CD27, CD28, CD30, CD39, CD40, CD48, CD70, CD73, CD80, CD86, CEACAM1, CGEN-15049, CTLA-4, DR3, GAL9, GITR, GITRL, HVEM, ICOS, ICOSL, IDOl, ID02, ILT-2, ILT-4, KIR, KLRG1, LAG3, LAIR1, TNFSF14, MARCO, NKG2A, NKG2D, OX-40, OX-40L, PD-1, PDL-1, PDL-2, PS, SlRP
- Co-administering the primed DCs, the virus, and the immune checkpoint modulatory agent may increase cancer cell death or cancer cell lysis beyond that induced by DCs and the virus. Cancer cell death may be increased by at least about 10% to 25%, at least about 10% to about 50%), at least about 20% to about 100%>, at least about at least about 20% to about 200%. Cancer cell death may be increased by at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%. Co-administering the primed DCs, the virus, and the immune checkpoint modulatory agent may reduce the size of tumor lesions beyond that reduced by DCs and the virus.
- Tumor lesion size may decrease by at least about 10% to about 50%, at least about 10% to about 30%, at least about 15%) to about 80%>. Tumor lesion size may decrease by at least 5%, at least 10%>, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%), or at least 95%.
- Co-administering the primed DCs, the virus, and the immune checkpoint modulatory agent may reduce the number of myeloid-derived suppressor cells (MDSC) in the tumor microenvironment beyond that decreased by DCs and the virus.
- MDSC myeloid-derived suppressor cells
- Co-administering the primed DCs, the virus, and the immune checkpoint modulatory agent may reduce the number of myeloid-derived suppressor cells (MDSC) in the tumor microenvironment by at least about 10%> to about 65%), at least about 10%> to about 85%>, at least about 10%> to about 100%>, or at least about 10% to about 200%.
- MDSC myeloid-derived suppressor cells
- Co-administering the primed DCs, the virus, and the immune checkpoint modulatory agent may increase cancer cell death or cancer cell lysis similar to that induced by DCs and the virus. Cancer cell death may be increased by at least about 10%> to 25%, at least about 10%> to about 50%), at least about 20% to about 100%, at least about at least about 20% to about 200%. Cancer cell death may be increased by at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%. Co-administering the primed DCs, the virus, and the immune checkpoint modulatory agent may reduce the size of tumor lesions similar to that reduced by DCs and the virus.
- Tumor lesion size may decrease by at least about 10% to about 50%, at least about 10% to about 30%, at least about 15%) to about 80%. Tumor lesion size may decrease by at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%), or at least 95%.
- Co-administering the primed DCs, the virus, and the immune checkpoint modulatory agent may reduce the number of myeloid-derived suppressor cells (MDSC) in the tumor microenvironment similar to that decreased by DCs and the virus.
- MDSC myeloid-derived suppressor cells
- Co-administering the primed DCs, the virus, and the immune checkpoint modulatory agent may reduce the number of myeloid-derived suppressor cells (MDSC) in the tumor microenvironment by at least about 10% to about 65%), at least about 10% to about 85%, at least about 10% to about 100%, or at least about 10%) to about 200%.
- Co-administering the primed DCs, the virus, and the immune checkpoint modulatory agent may reduce the number of myeloid-derived suppressor cells (MDSC) in the tumor microenvironment by at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%.
- Co-administering the virus and the immune checkpoint modulatory agent may increase cancer cell death or cancer cell lysis beyond that induced by DCs alone. Cancer cell death may be increased by at least about 10% to 25%, at least about 10% to about 50%, at least about 20% to about 100%, at least about at least about 20% to about 200%. Cancer cell death may be increased by at least 5%, at least 10%>, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%), at least 70%, at least 80%, at least 90%, or at least 95%. Co-administering the virus and the immune checkpoint modulatory agent may reduce the size of tumor lesions beyond that reduced by DCs alone.
- Tumor lesion size may decrease by at least about 10% to about 50%, at least about 10% to about 30%, at least about 15% to about 80%. Tumor lesion size may decrease by at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%), at least 70%, at least 80%, at least 90%, or at least 95%.
- Co-administering the virus and the immune checkpoint modulatory agent may reduce the number of myeloid-derived suppressor cells (MDSC) in the tumor microenvironment beyond that decreased by DCs alone.
- MDSC myeloid-derived suppressor cells
- Co-administering the virus and the immune checkpoint modulatory agent may reduce the number of myeloid-derived suppressor cells (MDSC) in the tumor microenvironment by at least about 10%) to about 65%, at least about 10% to about 85%, at least about 10% to about 100%, or at least about 10% to about 200%.
- Co-administering the virus and the immune checkpoint modulatory agent may reduce the number of myeloid-derived suppressor cells (MDSC) in the tumor microenvironment by at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%.
- Co-administering the virus and the immune checkpoint modulatory agent may increase cancer cell death or cancer cell lysis similarly to that induced by DCs alone. Cancer cell death may be increased by at least about 10% to 25%, at least about 10% to about 50%, at least about 20%) to about 100%), at least about at least about 20% to about 200%. Cancer cell death may be increased at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%), at least 70%, at least 80%, at least 90%, or at least 95%. Co-administering the virus and the immune checkpoint modulatory agent may reduce the size of tumor lesions similar to that reduced by DCs alone.
- Tumor lesion size may decrease by at least about 10% to about 50%, at least about 10% to about 30%, at least about 15% to about 80%. Tumor lesion size may decrease by at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%), at least 70%, at least 80%, at least 90%, or at least 95%.
- Co-administering the virus and the immune checkpoint modulatory agent may reduce the number of myeloid-derived suppressor cells (MDSC) in the tumor microenvironment similar to that decreased by DCs alone.
- MDSC myeloid-derived suppressor cells
- Co-administering the virus and the immune checkpoint modulatory agent may reduce the number of myeloid-derived suppressor cells (MDSC) in the tumor microenvironment by at least about 10%) to about 65%, at least about 10% to about 85%, at least about 10% to about 100%, or at least about 10% to about 200%.
- Co-administering the virus and the immune checkpoint modulatory agent may reduce the number of myeloid-derived suppressor cells (MDSC) in the tumor microenvironment by at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%.
- Reduction in cancer may be a decrease in tumor size.
- Tumor size may decrease by about 5-100, 10-90, 20-80, 30-70, 40-60, 50-95, 65-85, or 75-95%.
- the decrease in tumor size may by at least 2, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 76, 80, 85, 90, 95, 99, or 100%.
- the decrease in tumor size may by at least 2%.
- the decrease in tumor size may by at least 5%.
- the decrease in tumor size may by at least 10%.
- the decrease in tumor size may by at least 30%).
- the decrease in tumor size may be by at least 50%.
- Reduction in cancer may be an increase in long term survival compared to patients not treated with an immune checkpoint inhibitor alone or accompanying DV.
- Long term survival may be increased by about 5-100, 10-90, 20-80, 30-70, 40-60, 50-95, 65-85, or 75-95%.
- Long term survival may be increased by at least 2, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 76, 80, 85, 90, 95, 99, or 100%.
- Long term survival may be increased by at least 2%.
- Long term survival may be increased by at least 5%.
- Long term survival may be increased by at least 10%).
- Long term survival may be increased by at least 30%.
- Long term survival may be increased by at least 50%.
- the reduction in cancer may be a decrease in cancer metastases.
- Cancer metastases may decrease by about 5-100, 10-90, 20-80, 30-70, 40-60, 50-95, 65-85, or 75-95%).
- the decrease in cancer metastases may by at least 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 76, 80, 85, 90, 95, 99, or 100%).
- the decrease in cancer metastases may by at least 2%.
- the decrease in cancer metastases may by at least 5%.
- the decrease in cancer metastases may by at least 10%.
- the decrease in cancer metastases may by at least 30%.
- the decrease in cancer metastases may be by at least 50%.
- compositions for the treatment of cancer wherein the composition comprises a Dengue virus in an effective amount for depletion or reduction of cancer in a subject in need thereof.
- methods for treatment of cancer comprising administering to a subject in need thereof, an effective amount of a Dengue virus for depletion or reduction of a cancer.
- methods for the stabilization of cancer comprising administering to a subject in need thereof, an effective amount of a Dengue virus for stabilizing or controlling growth of a cancer.
- Dengue viruses are Arboviruses, and are transmitted exclusively by mosquitoes of the Aedes aegypti and albopictus species.
- the virus has a complex life cycle involving an unidentified forest-dwelling mammalian reservoir (possibly primates), and human hosts.
- the female mosquito takes a blood meal from an infected person, the virus replicates to a high infectious titer (10 5 /ml) in gut epithelial cells, then is transmitted to another person when the mosquito withdraws its stylet using back pressure after another blood meal.
- Dengue virus and activated DCs disclosed herein to target tumor cells, wherein the DV is administered to a subject.
- the term "Dengue virus” includes any serotype of Dengue virus serotypes 1, 2, 3, 4, or 5.
- the term Dengue virus may also encompass genetically modified DV, in vitro mutated DV, and combinations of DV or proteins/peptides thereof.
- the DV may be alive, dead, recombinant or a protein/peptide thereof.
- the death rate from DV is very low (1 in 61,000 per Manson's Tropical Diseases).
- the virus infects, but does not kill APC of the monocyte-macrophage and Dendritic Cell lineage.
- These infected APC then begin a cytokine cascade of the proinflammatory (TNF-alpha and IL-1 beta), and TH1 (IL-2, IL-7, IL-12, IL-15, and IL-21) types.
- TNF-alpha and IL-1 beta cytokine cascade of the proinflammatory (TNF-alpha and IL-1 beta), and TH1 (IL-2, IL-7, IL-12, IL-15, and IL-21) types.
- TNF-alpha and IL-1 beta cytokine cascade of the proinflammatory (TNF-alpha and IL-1 beta), and TH1 (IL-2, IL-7, IL-12, IL-15, and IL-21) types.
- Dengue viruses are Arboviruses, and are transmitted exclusively by mosquitoes of the Aedes aegypti and albopictus species.
- the virus has a complex life cycle involving an unidentified forest-dwelling mammalian reservoir (possibly primates), and human hosts.
- the female mosquito takes a blood meal from an infected person, the virus replicates to a high infectious titer (10 5 /ml), in gut epithelial cells, then is transmitted to another person when the mosquito withdraws its stylet using back pressure after another blood meal.
- Dengue epidemics infect 50 million persons annually, with several thousand deaths, usually children with inadequate treatment of secondary infection-related shock.
- the Dengue virus genome encodes structural proteins, capsid protein C, membrane protein M, envelope protein E, and nonstructural proteins, NSl, NS2a, NS2b, NS3, NS4a, NS4b and NS5.
- the Dengue virus is a live strain of the Dengue virus.
- the Dengue virus is a non-attenuated strain of the Dengue virus.
- the Dengue virus is an attenuated strain of the Dengue virus.
- the Dengue virus is a weakened strain of the Dengue virus.
- the Dengue virus is selected the following serotypes of dengue virus: DENV-1, DENV-2, DENV-3, DENV-4, and DENV-5, and combinations thereof.
- Dengue Viruses are positive-strand RNA viruses of the Togavirus Family, sub-family Flaviviridae, (Group B).
- the virus has an icosahedral geometry and is approximately 40-45 nanometers in diameter.
- the 11,000 base genome codes for a nucleocapsid (NC), protein, a prM membrane fusion protein, an envelope glycoprotein (E), and 5 non- structural proteins NS1-NS5.
- the NC protein forms the viral core, with the envelope spikes attached via the prM complex.
- the E glycoprotein is the main target of neutralizing antibodies, and the NS-3 and NS-4 proteins make up the main targets for CD4+and CD8+CTL.
- the Dengue viruses make up five distinct serotypes, DENV-1 through DENV-5.
- the serotypes 2 and 4 are cross-neutralizing for IgG, and types 1 and 3 are also cross-neutralizing. Immunity is not complete, however, and dengue is unique among viral infections in that a subsequent infection by a non-cross-neutralizing serotype carries an increased risk of mortality due to shock syndrome from immune hyper-activation.
- a non-lethal form of a Dengue virus can be utilized.
- Exemplary non -lethal Dengue viruses can be of serotype 1, 2, 3, 4, or 5.
- a non-lethal Dengue virus can be selected from Table 2.
- a non-lethal Dengue Virus can be substantially similar to any strain of Table 2.
- a Dengue Virus can be from about 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99%, or up to about 100%) identical in sequence homology or structural homology to any strain of Table 2.
- Table 2 Non-lethal Dengue Virus Strains
- compositions and method using such compositions wherein the composition comprises Dengue virus serotype 1, 2, 3, 4, or 5.
- the DV is serotype 2.
- the DV serotype 2 is DENV-2 strain #1710. DENV-2 strain
- DENV-2 strain #1584 A more virulent strain, by way of non-limiting example, is DENV-2 strain #1584.
- the DENV-2 strain #1710 is from a sample taken from Puerto Rico in 1985 and characterized as type A from a restriction site specific RT-PCR analysis using 4 primers (see Table 3) specific to the envelope gene region. Restriction site specific RT- PCR with these primers produces amplification products of 582 base pairs, 754 base pairs, and possibly 676 base pairs.
- the DENV-2 strain #1710 is recorded in a CDC database as entry number 555.
- the DENV-2 strain #1710 was isolated during a Puerto Rican epidemic. This outbreak had 9,540 suspected cases of DV, with one suspected, but no confirmed deaths due to the virus, which indicates the toxicity of DEN-2 strain #1710 is very low and therefore suitable for the methods disclosed herein.
- a unique feature of DV is that primary infections result in activation of a THl-type response of CD4+ and CD8+ helper-inducer and cytotoxic- effector CTL.
- APC antigen presenting cell
- DV up-regulates CD80 and CD83 expression on the APC, resulting in a pro-inflammatory TH1 cytokine profile.
- Primary DV infections induce a TH1 type response with activated CD4+ and CD8+ effector T cells as well as lymphokine-activated killer cells. This may increase the likelihood of a complete response to a cancer immunotherapy, such as therapies utilizing the primed dendritic cells disclosed herein.
- Dengue viruses can provide a counter attack to a tumor immune evasion mechanism.
- the tumor immune evasion mechanism may be low levels of MHC on the tumor cell to prevent CTL recognition, and the counter attack may be high Interferon- ⁇ raising MHC levels by up-regulating MHC gene expression.
- the tumor immune evasion mechanism also by way of non-limiting example, may be one or more point mutations in a tumor peptide to prevent TCR binding, and the counter attack may be stimulating lymphokine-activated killer cells or cytokine-induced killer cells to target "escaped" tumor cells expressing aberrant peptides or MHC.
- the tumor immune evasion mechanism may be low levels of MHC on the tumor cell to prevent CTL recognition, and the counter attack may be high Interferon- ⁇ raising MHC levels by up-regulating MHC gene expression.
- the tumor immune evasion mechanism also by way of non-limiting example, may be one or more point mutations in a tumor peptide to prevent TCR binding, and the counter attack may be stimulating lymphokine-activ
- the tumor immune evasion mechanism is tumor vessels lacking factors for CTL attachment and trafficking, and the counter attack is high TNF-a restores gaps by altering PECAM-1, restores ICAM-l/VCAM-1 expression and P and E-selectins.
- the tumor immune evasion mechanism is FasL killing of Fas+ CTL by triggering apoptosis, and the counter attack is high IL-6 and/or IL-15] protects Fas+ CTL by up-regulating FLIP ligand.
- the tumor immune evasion mechanism is ULA-G protects from NK Cells, and the counter attack may be high IL-2, IL-7, IL-12, and/or IL-15 raise activation of NK.
- the tumor immune evasion mechanism may be stromal barriers inhibit CTL and the counter attack may be high IFN- ⁇ activates macrophages to Ml .
- the tumor immune evasion mechanism may be Myeloid-Derived Suppressor Cells, (MDSC) and the counter attack may be iNKT Cells decrease MDSC.
- MDSC Myeloid-Derived Suppressor Cells
- the tumor immune evasion mechanism may be CTL inactivated by TGF- ⁇ and the counter attack may be TH1 cytokines reactivate tolerant CTL.
- the tumor immune evasion mechanism may be Tumor PI-9 blocks CTL killing and the counter attack may be high CD8 & ICAM-1 expression restores low- avidity CTL recognition and lysis by stabilizing weak interactions between TCR and
- the tumor immune evasion mechanism may be T-regulatory cells block CTL and the counter attack may be high CD4 Helper cells overcome CD4 T Reg cells.
- the methods comprise activating or enhancing the subject's immune response by administering Dengue virus to the subject.
- Activating or enhancing may comprise inducing or increasing expression of cytokines and inflammatory mediators.
- Expression of genes in cells of the subject that may be increased by DV infection include, but are not limited to, IL-1 beta, IL-2, IL-7, IL-12, IL-15, IFN-alpha, IFN- gamma, ICAM-1, TNF-alpha, TNF-beta, GM-CSF, CD 8 antigen, ICOSLG, CCL3, CCL5, TRAIL, IP10, GNLY, MHC, HLA, GZMA, HLA-DRA, HLA-DP alphal, HLA-DP beta 1, and ZAP70.
- ICAM-1 up- regulation is mediated by TNFa, and can be utilized for cell-to-cell contact, i.e., CTL-to-tumor cell.
- CTL-to-tumor cell i.e., CTL-to-tumor cell.
- ICAM-1 can be utilized for close CTL-to-tumor contact and lysis.
- ICAM-1 can increase the "stickiness" of tumor cells, to allow CTL to adhere to them and kill them. For example when a tumor cell is exposed to Dengue virus supernatant or Dengue virus, the tumor cell can up-regulate its ICAM-1 expression. Lack or low expression of ICAM-1 in immunosuppressed tumors is one of the challenges in CTL-based checkpoint inhibitors such as Ipilimumab and Nivolumab.
- the use of Dengue virus can increase an ICAM-1 expression on a tumor by about 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or up to about 100%. In some cases, the use of Dengue virus can increase an ICAM-1 expression on a tumor by about 5% to 20%, 25% to 35%, 30% to 55%, 40% to 65%, 50% to 75%, 60% to 85%, or 70% to 95%.
- the methods comprise activating or enhancing a subject's immune response by administering Dengue virus to a subject.
- a Dengue virus or Dengue virus supernatant can increase MHC or HLA expression on a tumor.
- MHC expressions are critical for CTL-based checkpoint inhibitors such as Ipilimumab and Nivolumab to establish CTL-to-tumor contact.
- CTL-based checkpoint inhibitors such as Ipilimumab and Nivolumab to establish CTL-to-tumor contact.
- Dengue virus infection can increase Class I expression on resistant tumor cells, enabling CTL immunotherapy.
- Checkpoint inhibitors can work by delaying the "off or "die” signals like CTLA-4 or PD-1 on CTLs.
- CTLs can utilize Class I MHC expression in order to identify and destroy tumor cells. Raising MHC expression on tumor targets allows the CTL to kill more effectively.
- the use of Dengue virus can increase an MHC or HLA expression on a tumor by about 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%), 90%) or up to about 100%. In some cases, the use of Dengue virus can increase an MHC or HLA expression on a tumor by about 5% to 20%, 25% to 35%, 30% to 55%, 40% to 65%, 50% to 75%, 60% to 85%, or 70% to 95%.
- DV has affinity for immature B-lymphocytes and antigen-presenting cells (APC) of monocyte/macrophage and dendritic cell (DC) lineage.
- a unique feature of DV is that primary infections result in activation of a T H l-type response of CD4+ and CD8+ helper-inducer and cytotoxic-effector CTL. By infecting, but not killing the APC, DV up-regulates their CD80 and CD83 expression, resulting in a pro-inflammatory T H 1 cytokine profile.
- Primary DV infections induce a T H 1 type response with activated CD4 + and CD8 + effector T cells as well as LAK cells. This type of response is seen in patients having complete responses to cancer immunotherapies (see Table 4).
- Point mutations in Tumor LAK/CIK cells target "escaped" tumor cells expressing Peptides prevent TCR binding aberrant peptides or MHC
- Tumor vessels lack factors for Hi [TNF-a] restores gaps by altering PEC AM- 1, restores CTL attachment and trafficking ICAM-l/VCAM-1 expression and P and E-selectins
- FasL can kill Fas + CTL by Hi [IL-6, 15] protects Fas + CTL by up-regulating FLIP ligand triggering apoptosis
- HLA-G protects from NK Cells Hi [IL-2,7,12, 15] raise activation of NK
- Myeloid-Derived Suppressor iNKT Cells can decrease MDSC Immune evasion Dengue counter-attack
- MDSC MD Cells
- Tumor PI-9 blocks CTL killing Hi [CD8] & ICAM-1 expression can restore low-avidity CTL recognition and lysis by stabilizing weak interactions between TCR and MHC + self-peptide
- T-regulatory cells block CTL Hi CD4 Helper cells overcome CD4 Reg cells
- the methods disclosed herein comprise administering DV to the subject, wherein the administering results in the release of T F- ⁇ by the immune system.
- T Fa is an inflammatory cytokine with pleiotropic effects, including direct killing of tumor cells via TRAIL (TNF-Apoptosis-Inducing-Ligand). Increased levels of proteins corresponding to these genes may be observed in tissues and circulating fluids of the subject as well. Levels may be increased at least 2-fold. Levels may be increased between 2-fold and 1000-fold.
- Levels may be increased between 2-fold, 10-fold, 40-fold, 80-fold, 100-fold, 200-fold, 300-fold, 400-fold, 500-fold, 600-fold, 700-fold, 800-fold, 900-fold, and 1000-fold. Levels may be increased between 2-fold and 10-fold.
- administering DV induces high levels of soluble TRAIL (sTRAIL) from a variety of cells including y5CTL, activated Ml macrophages and plasmacytoid DC (pDC).
- sTRAIL soluble TRAIL
- pDC plasmacytoid DC
- IFNP a multifunctional cytokine with a 10-fold higher affinity for the same receptor as IFNa.
- IFNP has similar antiviral properties in suppressing transcription of viral RNA, but is much more potent than IFNa in inducing apoptosis in tumor cells.
- Nitric oxide and IFNP could act in a synergistic fashion during dengue infection. These molecules may work in tandem to overcome resistance to apoptosis mediated by the high levels of sTRAIL induced by Ml macrophages, pDC, and ⁇ CTL.
- Activating or enhancing the immune system of the subject may comprise inducing or increasing cell types present in the subject. These cell types include, but are not limited to, CD8+CD44+62L- cells, CD4+CD44+ CD62Llo cells, HLA-DR+ CD8+ cells, Tia-1 CD8+ cells, VLA-4 CD8+ cells, ICAM-1 CD8+ cells, and LFA-1 CD8+ cells.
- Chikungunya virus may be abbreviated herein as "CHK” or "CV," Chikungunya virus belongs to the alphavirus genus, and Togaviridae family. It is an RNA virus. Chikungunya virus may be related to Ross River virus, O'nyong'nyong virus, and Semliki Forest virus, which may provide alternative viruses used in methods provided herein. Chikungunya virus has a very low mortality rate, approximately 1 : 1000, the elderly being most likely to have severe complications.
- Symptoms may include onset of fever two to four days after exposure, headache, fatigue, digestive complaints, conjunctivitis, joint pains, abdominal pain, nausea, vomiting, diarrhea, and combinations thereof. Further provided herein are methods, wherein the CV induces a fever that is between 39 °C (102 °F) and 40 °C (104 °F). Symptoms may include a rash. In some cases, the rash may be a maculopapular rash.
- RT-PCR of CV specific nucleic acid sequences, or measurement of IgM levels in the blood serum (e.g., via ELISA) of the subject in order to ascertain an infection sufficient to have adjuvant effects with DC administration.
- the Chikungunya virus is an attenuated Chikungunya virus.
- the methods may comprise attenuating the Chikungunya virus.
- Attenuation of the original virus strain may be desirable or necessary, as a wild-type CUK strain may cause unacceptable toxicity: fever, hepatic and splenic lesions, internal hemorrhage, and most critical: crippling joint pain, which persists for months or years in up to 30% of CV infection cases.
- Attenuation is a process where an original virus strain is passaged in various cell lines, then progeny are analyzed for signs of attenuation: lower growth characteristics, less severe disease symptoms in mice, etc.
- Chikungunya virus is attenuated to a strength capable of inducing a systemic immune response without severe symptoms.
- Severe symptoms may include fever, hepatic and splenic lesions, internal hemorrhage, and crippling joint pain.
- Attenuation may be carried out by serial passage of said virus in permissive cell lines. Attenuation may also be carried out by selective passage in live animals. Attenuation may result in a virus strain with desired properties for a systemic infection without overt Chikungunya symptoms.
- Systemic infection may be produced by injecting virus into a cancer patient.
- Systemic infection may be induced by injecting sufficient said virus into the patient to produce an immune activation. Immune activation of sufficient power may be required to activate CTL induced by aforementioned Dendritic Cells to overcome tumor immune evasions and kill tumor cells.
- the CV strain is an Asian strain, a West African strain or an East/Central/South African (ECSA) strain.
- the CV strain may be of the Indian Ocean Lineage (IOL).
- the CV strain may be found in or originate in Brazil.
- the Asian strain may be a strain found in patient sera from an Indonesia, Malaysia, Philippines, India, or Thailand epidemic.
- the West African strain may be a strain found in patient sera from a Nigeria, Senegal, or Cote d'llude.
- the ECSA strain may be a strain found in patient sera from a South Africa, Africa, Congo, Angola, Reunion, Sri-Lanka, Central Africa, or Kenya epidemic.
- the CV strain may be CHK/SBY8/10
- the CV strain may be TSI-GSD-218 (181/clone 25 V-181, Accession number L37661).
- the CV strain may be AF15561 (Accession number EF452493).
- the CV strain may be about 10% to about 90% less virulent than a strain selected from
- CV strain may be about 10% to about 90% more virulent than a strain selected from CHK/SBY8/10, TSI-GSD- 218, and AF15561, as measured by plaque assay.
- GenBank sequence accession numbers for genomes of known CV strains include HM045792, HM045795, HM045805, AF490259, HM045821, HM045806, HM045809, HM045822, JQ067624, HM045812, HM045784 and HM045823.
- GenBank sequence accession numbers for genomes of known Asian strains include HM045803, EF027140, HM045813, HM045788, EF027141, HM045810, HM045814, HM045808, HM045789, HM045802, HM045796, HM045787, HM045797, HM045791, HM045800, HM045790, HE806461, FN295483, FN295484, EU703762, EU703759, EU703760, EU703761, FJ807897, KF318729, KJ451623, KJ451622, CNR20236, CNR20235, and KJ451624.
- GenBank sequence accession for genomes of known IOL strains include: JF274082, EU372006, GU908223, FR717336, GQ428213, KJ796852, KJ796851, KJ796845, KC862329, FN295485, FN295487, GU189061, HQ456255, HQ456254, HQ456253, HQ456252, HQ456251.
- West African genotype :
- CV strains described herein may be assayed for cytopathic effects and further screened to confirm non-lethality prior to selection for a combination therapy described herein. In some instances, CV strains described herein are attenuated to a strength capable of inducing a systemic immune response without severe symptoms.
- kits for cancer therapy comprising administration of therapeutic agents disclosed herein.
- Methods described herein also provide for clearing cancer cells.
- administering DV to the subject induces an immune response.
- the immune response is potent as compared to a common virus, such as a common cold virus.
- the immune response results in tumor regression.
- the methods disclosed herein may comprise developing DCs capable of inducing an immune response that results in eliminating all tumor cells in a subject's body.
- DNA microarray analyses have revealed that hundreds of genetically distinct tumor clones may exist in a single subject with advanced tumor. There is a pattern of negative correlation between 02 supply and genetic mutation rates. The majority of agents such as cytotoxic drugs, antibodies, and small molecules, are nearly always blood-borne, exerting a Darwinian selective pressure to tumor clones that evade therapeutic mechanisms. Clones with the lowest perfusion rates have both low drug exposure and high capacity to evade immune system detection, making them resistant to conventional therapies.
- methods for cancer cell targeting comprising inducing fever hyperthermia by administering DV to the subject with cancer, starving low-flow, resistant clones with mutated phenotypes, leaving more genetically stable clones for elimination by activated lymphocytes and other arms of the immune system.
- the methods comprise combining fever with activation of CTL and lymphokine-activated killer cells (LAK) by administering pulsed DCs, lead to higher response rates than with conventional cancer therapies (e.g. antibody drug conjugates, kinase inhibitors, small molecules, etc.) or CTLs alone.
- LAK lymphokine-activated killer cells
- the immune suppression seen in subjects with advanced cancer is a complex and dynamic process. It involves tolerance to the tumor antigens themselves, which are usually recognized as "self by CTL.
- methods described herein comprise breaking this tolerance and achieving high levels of TH1 cytokines, which DV infection induces.
- Cancers targeted herein may be a recurrent and/or a refractory cancer.
- the cancer is an acute cancer or a chronic cancer.
- the cancer is an accelerated refractory cancer.
- the cancer is in remission.
- the cancer is a stage I, stage II, stage III, or stage IV cancer.
- the cancer is a juvenile cancer or adult cancer. Examples of cancers include, but are not limited to, sarcomas, carcinomas, lymphomas or leukemias.
- the cancer is a solid tumor or a liposarcoma.
- the cancer is a sarcoma.
- the sarcomas may be a cancer of the bone, cartilage, fat, muscle, blood vessels, or other connective or supportive tissue.
- sarcomas include, but are not limited to, bone cancer, fibrosarcoma, chondrosarcoma, Ewing's sarcoma, malignant hemangioendothelioma, malignant schwannoma, bilateral vestibular schwannoma, osteosarcoma, soft tissue sarcomas (e.g. alveolar soft part sarcoma, angiosarcoma, cystosarcoma phylloides, dermatofibrosarcoma, desmoid tumor, epithelioid sarcoma,
- the sarcoma may comprise a Ewing's sarcoma.
- the cancer is a carcinoma.
- Carcinomas are cancers that begin in the epithelial cells, which are cells that cover the surface of the body, produce hormones, and make up glands.
- carcinomas include breast cancer, pancreatic cancer, lung cancer, colon cancer, colorectal cancer, rectal cancer, kidney cancer, bladder cancer, stomach cancer, liver cancer, ovarian cancer, brain cancer, vaginal cancer, vulvar cancer, uterine cancer, oral cancer, penile cancer, testicular cancer, esophageal cancer, skin cancer, cancer of the fallopian tubes, head and neck cancer, gastrointestinal stromal cancer, adenocarcinoma, cutaneous or intraocular melanoma, cancer of the anal region, cancer of the small intestine, cancer of the endocrine system, cancer of the thyroid gland, cancer of the parathyroid gland, cancer of the adrenal gland, cancer of the urethra, cancer of the renal pelvis, cancer of the ureter, cancer of
- the cancer is a skin cancer, such as a basal cell carcinoma, squamous, melanoma, nonmelanoma, or actinic (solar) keratosis.
- the cancer is bladder cancer.
- the cancer is a neuroendocrine cancer. In some instances, the cancer is a pancreatic cancer. In some instances, the cancer is thyroid cancer. In some instances, the cancer is an epithelial cancer, breast cancer, endometrial cancer, ovarian cancer, stromal ovarian cancer, or cervical cancer. In some instances, the cancer is prostate cancer. In some instances, the cancer is a skin cancer. In some instances, the cancer is a neo-angiogenic skin cancer. In some instances, the cancer is a melanoma. In some instances, the cancer is a kidney cancer, a lung cancer. Exemplary lung cancers include, without limitation, a small cell lung cancer or a non-small cell lung cancer.
- the cancer is a colorectal cancer, e.g., a gastric cancer or a colon cancer.
- the cancer is a brain cancer.
- the cancer is a brain tumor.
- the cancer is a glioblastoma or an astrocytoma.
- the cancer is breast cancer.
- the breast cancer is a triple negative breast cancer (negative for estrogen receptor, progesterone receptor and Her2).
- the breast cancer is estrogen receptor positive (ER+).
- the cancer is a lung cancer.
- the lung cancer is a non-small cell lung carcinoma (NSCLC), small cell lung carcinoma, or mesotheliomia.
- NSCLC examples include squamous cell carcinoma, adenocarcinoma, and large cell carcinoma.
- the mesothelioma is a cancerous tumor of the lining of the lung and chest cavity (pleura) or lining of the abdomen (peritoneum). In some instances, the mesothelioma is due to asbestos exposure.
- the cancer is a central nervous system (CNS) tumor.
- the CNS tumor is classified as a glioma or nonglioma.
- the glioma is malignant glioma, high grade glioma, diffuse intrinsic pontine glioma.
- Examples of gliomas include astrocytomas, oligodendrogliomas (or mixtures of oligodendroglioma and astocytoma elements), and ependymomas.
- Astrocytomas include, but are not limited to, low-grade astrocytomas, anaplastic astrocytomas, glioblastoma multiforme, pilocytic astrocytoma, pleomorphic xanthoastrocytoma, and subependymal giant cell astrocytoma.
- Oligodendrogliomas include low-grade oligodendrogliomas (or oligoastrocytomas) and anaplastic
- Nongliomas include meningiomas, pituitary adenomas, primary CNS lymphomas, and medulloblastomas.
- the cancer is a meningioma.
- the cancer is a blood cancer. In some instances, the cancer is leukemia. In some instances, the cancer is a myeloid leukemia. In some instances, the cancer is a lymphoma. In some instances, the cancer is a non-Hodgkin's lymphoma.
- the cancer is selected from myelogenous leukemia, lymphoblastic leukemia, myeloid leukemia, an acute myeloid leukemia, myelomonocytic leukemia, neutrophilic leukemia, myelodysplastic syndrome, B-cell lymphoma, burkitt lymphoma, large cell lymphoma, mixed cell lymphoma, follicular lymphoma, mantle cell lymphoma, hodgkin lymphoma, recurrent small lymphocytic lymphoma, hairy cell leukemia, multiple myeloma, basophilic leukemia, eosinophilic leukemia, megakaryoblastic leukemia, monoblastic leukemia, monocytic leukemia, erythroleukemia, erythroid leukemia and hepatocellular carcinoma.
- the cancer is a
- the hematological malignancy is a B cell malignancy.
- the cancer is a chronic lymphocytic leukemia.
- the cancer is an acute lymphoblastic leukemia.
- the cancer is a CD19-positive Burkitt's lymphoma.
- the leukemia is an acute lymphocytic leukemia, acute myelocytic leukemia, chronic lymphocytic leukemia, or chronic myelocytic leukemia.
- leukemias include, but are not limited to, hairy cell leukemia, chronic myelomonocytic leukemia, and juvenile myelomonocytic leukemia.
- the lymphoma develops from a B lymphocyte or T lymphocyte.
- Two major types of lymphoma are Hodgkin's lymphoma, previously known as Hodgkin's disease, and non-Hodgkin's lymphoma.
- the Non-Hodgkin lymphoma is indolent.
- the Non-Hodgkin lymphoma is aggressive.
- Non-Hodgkin's lymphomas include, but are not limited to, diffuse large B cell lymphoma, follicular lymphoma, mucosa-associated lymphatic tissue lymphoma (MALT), small cell lymphocytic lymphoma, mantle cell lymphoma, Burkitt's lymphoma, mediastinal large B cell lymphoma, Waldenstrom macroglobulinemia, nodal marginal zone B cell lymphoma (NMZL), splenic marginal zone lymphoma (SMZL), extranodal marginal zone B cell lymphoma, intravascular large B cell lymphoma, primary effusion lymphoma, and lymphomatoid granulomatosis.
- MALT mucosa-associated lymphatic tissue lymphoma
- MALT mucosa-associated lymphatic tissue lymphoma
- small cell lymphocytic lymphoma mantle cell lymphoma
- Burkitt's lymphoma mediastinal large B cell
- the methods may comprise administering DC.
- the methods may comprise administering DCs after pulsing the DCs, without storing or shipping the DCs.
- the methods may comprise administering the DCs after storing or shipping the DCs.
- the methods may comprise administering DCs at a time point selected from about 1 hour to about 24 hours after pulsing the DC.
- the methods may comprise administering the DCs at a time point selected from about 1 day to about 30 days after pulsing the DCs.
- the methods may comprise administering the DCs at a time point selected from about 1 week to about 12 weeks after pulsing the DCs.
- DCs are provided in a solution.
- the DCs are administered by a route selected from subcutaneous injection, intramuscular injection, intradermal injection, percutaneous administration,
- i.v. intravenous
- intranasal administration intranasal administration
- intralymphatic injection intralymphatic injection
- oral administration intranasal administration
- iv administration is preferable, eliciting a more desirable response than other forms of administration (e.g. subcutaneous injection).
- the subject is infused with the DC by an intralymphatic microcatheter.
- Methods described herein may comprise suspending or mixing cells in a solution for intravenous (i.v.) administration (e.g., a 0.9% NaCL solution).
- a solution for intravenous (i.v.) administration e.g., a 0.9% NaCL solution.
- the i.v. DCs may traffic to the lungs, where some will be trapped, but the majority may pass to secondary lymphatic organs such as liver and spleen white pulp T-cell zones to prime the CTL.
- the Dengue virus is initially administered at least 24 hours before administering the dendritic cells. In some instances, the Dengue virus is initially administered between about 12 hours and about 96 hours before administering the dendritic cells. In some instances, the Dengue virus is initially administered between about 24 hours and about 72 hours before administering the primed dendritic cells. In some instances, the Dengue virus is initially administered between 1 day and 4 days before administering the primed dendritic cells. In some instances, the Dengue virus is administered only once. In some instances, the Dengue virus is administered more than once. In some instances, the Dengue virus is administered only before receiving dendritic cells. In some instances, the Dengue virus is administered after receiving the primed dendritic cells. In some instances, the Dengue virus is administered before and after receiving the primed dendritic cells.
- the methods may comprise administering primed DCs on Day 0, followed by two injection of virus, such that the entire treatment is conducted in a week or less.
- the subject will only receive the entire treatment once.
- the entire treatment is repeated not more than once.
- the entire treatment is repeated not more than twice.
- the entire treatment is repeated not more than three times.
- the entire treatment is repeated not more than ten times.
- the methods comprise administering the Dengue virus at a dose of about 0.5 ml of 10 6 pfu/ml. In some instances, the dose is between about 10 3 pfu/ml and about 10 8 pfu/ml. In some instances, the dose is between about 10 3 pfu/ml and about 10 6 pfu/ml.
- the dose is between about 10 3 pfu/ml to about 10 4 pfu/ml, between about 10 4 pfu/ml to about 10 6 pfu/ml, between about 10 6 pfu/ml to about 10 8 pfu/ml, or between about 10 8 pfu/ml to about 10 10 pfu/ml.
- the dose is from about 10 1 pfu/ml, 10 2 pfu/ml, 10 3 pfu/ml, 10 4 pfu/ml, 10 5 pfu/ml , 10 6 pfu/ml, 10 7 pfu/ml, 10 8 pfu/ml , or up to about 10 9 pfu/ml.
- a dose described herein is in a volume of about 0.01, 0.02, 0.03, 0.04, 0.05, 0.1, 0.2 ml or 0.3 ml.
- a dose is in a volume of about 0.01ml to about 0.03 ml, 0.03 ml to about 0.05 ml, 0.05 ml to about 0.07 ml, 0.07 ml to about 0.09 ml, 0.1 ml to about 0.2 ml, 0.2 ml to about 0.4 ml, 0.4 ml to about 0.6 ml.
- the methods disclosed herein comprise administering Dengue virus at a dose of about 0.5 ml of 10 6 pfu/ml per day. In some instances, the dose is between about 10 3 pfu/ml/day and about 10 8 pfu/ml/day. In some instances, the dose is between about 10 3 pfu/ml/day and about 10 6 pfu/ml/day. In some instances, the methods disclosed herein comprise administering Dengue virus at more than one dose of about 0.5 ml of 10 6 pfu/ml per day. In some instances, methods comprise administering a dose between about 10 3 pfu/ml and about 10 8 pfu/ml more than once per day.
- methods comprise administering a dose between about 10 3 pfu/ml and about 10 6 pfu/ml more than once per day. In some instances, methods comprise administering a dose between about 10 3 pfu/ml and about 10 8 pfu/ml one to five times per day. In some instances, methods comprise administering a dose between about 10 3 pfu/ml and about 10 6 pfu/ml one to five times per day. In some instances, methods comprise administering a dose between about 10 3 pfu/ml and about 10 8 pfu/ml one to three times per day. In some instances, methods comprise administering a dose between about 10 3 pfu/ml and about 10 6 pfu/ml one to three times per day.
- the methods disclosed herein comprise administering Dengue virus at a dose of about 0.5 ml of 10 6 pfu/ml per day. In some instances, the dose is between about 10 3 pfu/ml/day and about 10 8 pfu/ml/day. In some instances, the dose is between about 10 3 pfu/ml/day and about 10 6 pfu/ml/day. In some instances, the methods disclosed herein comprise administering Dengue virus at more than one dose of about 0.5 ml of 10 6 pfu/ml per day. In some instances, methods comprise administering a dose between about 10 3 pfu/ml and about 10 8 pfu/ml more than once per day.
- methods comprise administering a dose between about 10 3 pfu/ml and about 10 6 pfu/ml more than once per day. In some instances, methods comprise administering a dose between about 10 3 pfu/ml and about 10 8 pfu/ml one to five times per day. In some instances, methods comprise administering a dose between about 10 3 pfu/ml and about 10 6 pfu/ml one to five times per day. In some instances, methods comprise administering a dose between about 10 3 pfu/ml and about 10 8 pfu/ml one to three times per day. In some instances, methods comprise administering a dose between about 10 3 pfu/ml and about 10 6 pfu/ml one to three times per day.
- composition comprising
- the composition comprises a sugar. In some instances, the composition comprises a surfactant. In some instances, the composition comprises a protein. In some instances, the composition comprises a salt. In some instances, the composition comprises a non-ionic surfactant, a non-reducing sugar, a salt, a carrier protein, or a combination thereof. In some instances, the composition comprises a non-ionic surfactant. In some instances, the non-ionic surfactant is a non-ionic detergent. In some instances, the non- ionic surfactant is an agent comprising a hydrophobic chain. In some instances, the non-ionic surfactant is an agent comprising polyoxyethylene.
- the non-ionic surfactant is an agent comprising polyoxypropylene. In some instances, the non-ionic surfactant is an agent comprising a polyoxyethylene-polyoxypropylene block copolymer. In some instances, the non- ionic surfactant is an agent that acts as a stabilizer of a cell membrane. In some instances, the non-ionic surfactant is an agent that protects from cell membrane shearing. In some instances, the non-ionic surfactant is an agent that acts as an anti-foaming agent. In some instances, the non-ionic surfactant comprises pluronic F-68. In some instances, the non-ionic surfactant consists essentially of pluronic F-68.
- non-ionic surfactants contemplated for use in the compositions disclosed herein include alkyl polyglycoside, cetomacrogol 1000, cetostearyl alcohol, cetyl alcohol, cocamide DEA, cocamide MEA, decyl glucoside, decyl polyglucose, glycerol monostearate, IGEPAL CA-630, isoceteth-20, lauryl glucoside, maltosides, monolaurin, mycosubtilin, narrow-range ethoxylate, nonidet P-40, nonoxynol-9, nonoxynols, P-40, octaethylene glycol monododecyl ether, N-octyl beta-d- thioglucopyranoside, octyl glucoside, oleyl alcohol, PEG- 10 sunflower glycerides,
- the non-ionic surfactant is present in the composition at a concentration of about 0.01% w/v to about 10% w/v. In some instances, the non-ionic surfactant is present in the composition at a concentration of about 0.1% w/v to about 5% w/v.
- the non-ionic surfactant is present in the composition at a concentration of about 1% w/v to about 5% w/v. In some instances, the non-ionic surfactant is present in the composition at a concentration of about 2% w/v.
- the composition comprises a non- reducing sugar.
- the non-reducing sugar is a sugar capable of trapping water molecules.
- the non-reducing sugar acts as a cryoprotectant, protecting the viability of the Dengue virus during freezing and thawing.
- the non-reducing sugar comprises a disaccharide.
- the non-reducing sugar comprises an alpha, alpha- 1, 1-glucoside bond between two alpha glucose units.
- the non- reducing sugar consists essentially of a disaccharide.
- the non-reducing sugar comprises a trehalose.
- Trehalose is also known as a-D-glucopyranosyl-(l ⁇ l)-a-D- glucopyranoside, mycose, and tremalose.
- the non-reducing sugar consists essentially of a trehalose.
- the trehalose is alpha-trehalose.
- the trehalose is D-(+)-Trehalose dehydrate.
- the trehalose has the chemical formula of C12H22O11 ⁇ 2H 2 0.
- the non-reducing sugar is present in the composition at a concentration of about 5% w/v to about 25% w/v.
- the non-reducing sugar is present in the composition at a concentration of about 1% w/v to about 10% w/v. In some instances, the non-reducing sugar is present in the composition at a concentration of about 10%) w/v to about 20% w/v. In some instances, the non-reducing sugar is present in the composition at a concentration of about 15% w/v.
- the composition comprises a carrier protein.
- Carrier proteins may function as a carrier or stabilizer for steroids, fatty acids, or hormones.
- the carrier protein is a protein capable of stabilizing a virus envelope in storage conditions (e.g., below room temperature).
- the carrier protein is a soluble monomelic protein.
- the carrier protein is albumin.
- the carrier protein is a human protein ensuring compositions disclosed herein are compliant with good manufacturing protocol (GMP) standard.
- the carrier protein is human albumin.
- the carrier protein is present in the composition at a concentration of about 0.1% w/v to about 10% w/v. In some instances, the carrier protein is present in the composition at a concentration of about 1% w/v to about 5% w/v. In some instances, the carrier protein is present in the composition at a concentration of about 2% w/v. [0123] Provided herein are methods comprising administering a composition comprising
- the salt comprises calcium, magnesium, potassium, sodium, boron.
- the salt is a phosphate salt, a chloride salt, a sulfate salt or a dichromate salt.
- the salt is calcium chloride.
- the salt is magnesium chloride.
- compositions comprise calcium chloride and magnesium chloride.
- the salt is present in the composition at a concentration of about 0.1 mM to about 10 mM. In some instances, the salt is present in the composition at a concentration of about 0.1 mM to about 5 mM. In some instances, the salt is present in the composition at a concentration of about 0.1 mM to about 2 mM.
- compositions comprise calcium chloride and magnesium chloride wherein calcium chloride is present in the composition at about 0.1 mM to about 10 mM, and magnesium chloride is present in the composition at about 0.1 mM to about 10 mM. In some instances, compositions comprise calcium chloride and magnesium chloride wherein calcium chloride is present in the
- composition at about 1 mM and magnesium chloride is present in the composition at about 1 mM.
- the effective amount is an amount sufficient to increase a level of at least one cytokine in the subject. In some instances, the effective amount is an amount sufficient to increase a level of at least one cytokine in the blood of the subject. In some instances, the effective amount is an amount sufficient to increase a level of at least one cytokine in a serum sample of the subject. In some instances, the effective amount is an amount sufficient to significantly increase the level of the at least one cytokine. In some instances, the effective amount is an amount sufficient to increase the level of the at least one cytokine by about 2% to about 20,000%.
- the effective amount is an amount sufficient to increase the level of the at least one cytokine by about 50% to about 20,000%). In some instances, the effective amount is an amount sufficient to increase the level of the at least one cytokine by about 100%> to about 20,000%). In some instances, the effective amount is an amount sufficient to increase the level of the at least one cytokine by about 100%> to about 15,000%). In some instances, the effective amount is an amount sufficient to increase the level of the at least one cytokine by about 100%> to about 14,000%). In some instances, the effective amount is an amount sufficient to increase the level of the at least one cytokine by about 50%) to about 15,000%).
- the effective amount is an amount sufficient to increase the level of the at least one cytokine by about 50% to about 14,000%).
- methods comprising administering an effective amount of Dengue virus disclosed herein to a subject in need thereof.
- the effective amount is an amount sufficient to increase a level of at least one cytokine in the subject.
- the at least one cytokine is an interleukin (IL).
- the at least one cytokine is an interferon (IFN).
- the at least one cytokine is an interleukin.
- the at least one cytokine is selected from tumor necrosis factor (TNF) alpha, IFN alpha, IFN beta, IFN gamma, interferon gamma induced protein 10 (IP- 10), IL-12, IL-2R, IL-7, IL-15, granulocyte macrophage colony stimulating factor (GM-CSF), and a combination thereof.
- TNF tumor necrosis factor
- IP- 10 interferon gamma induced protein 10
- IL-12 IL-2R
- IL-7 IL-15
- GM-CSF granulocyte macrophage colony stimulating factor
- the level of TNF alpha is increased from about 50% to about 500%.
- the level of TNF alpha is increased from about 50% to about 300%.
- the level of TNF alpha is increased from about 50% to about 240%.
- the level of IFN alpha is increased from about 50% to about 800%.
- the level of IFN alpha is increased from about 50% to about 500%. In some instances the level of IFN alpha is increased from about 50% to about 420%. In some instances the level of IFN beta is increased from about 50% to about 20,000%). In some instances the level of IFN beta is increased from about 50%) to about 14,000%). In some instances the level of IFN gamma is increased from about 50%) to about 200%). In some instances the level of IFN gamma is increased from about 50% to about 100%). In some instances the level of IP-10 is increased from about 50% to about 8000%). In some instances the level of IP-10 is increased from about 50% to about 5000%). In some instances the level of IP-10 is increased from about 50% to about 4000%).
- the level of IL-12 is increased from about 20% to about 200%. In some instances the level of IL-12 is increased from about 20% to about 100%. In some instances the level of IL-12 is increased from about 20% to about 80%. In some instances the level of IL-15 is increased from about 20% to about 200%). In some instances the level of IL-15 is increased from about 20% to about 200%. In some instances the level of IL-15 is increased from about 20% to about 100%. In some instances the level of IL-7 is increased from about 50% to about 1000%). In some instances the level of IL-7 is increased from about 50% to about 1000%). In some instances the level of IL-7 is increased from about 50% to about 500%. In some instances the level of GM-CSF is increased from about 50% to about 1000%).
- the level of GM-CSF is increased from about 50%) to about 400%. In some instances the level of GM-CSF is increased from about 50%, 60%, 70%, 80%, 90%, 100%, 110%, 120%, 130%, 140%, 150%, 160%, 170%, 180%, 190%, 200%, 210%, 220%, 230%, 240%, 250%, 260%, 270%, 280%, 290%, 300%, 310%, 320%, 330%), 340%), to about 350%).
- the level of IL-12R is increased from about 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 110%, 120%, 130%, 140%, 150%, 160%, 170%, 180%, 190%, to about 200%. In some instances the level of IL-12R is increased from about 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 110%, 120%, 130%, 140%, 150%, 160%, 170%, 180%), 190%), up to about 200%Provided herein are methods comprising administering an effective amount of Dengue virus disclosed herein to a subject in need thereof. In some instances, the effective amount is an amount sufficient to increase a level of at least one cytokine in the subject.
- successful infection or inoculation of the subject with the Dengue virus is confirmed by the development of hyperthermia or fever.
- successful infection or inoculation of the subject with the Dengue virus is confirmed by the presence or increase of circulating cytokines in the blood/plasma of the subject.
- Cytokines may include, but are not limited to, interleukin-2 and interferon-gamma.
- methods described herein comprise administering primed dendritic cells to a subject in need thereof only once.
- the primed dendritic cells are administered more than once.
- the primed dendritic cells are administered a first time and a second time, wherein the first time and the second time are separated by about 1 day, about 2 days, about 3 days, about 4 days, about 5 days, or about 6 days, about 8 days, about 10 days, aboutl2 days, or about 18 days.
- the first time and the second time are separated by about 1 week, about 2 weeks, about 3 weeks, or about a month.
- the first time and the second time are separated by more than a month.
- the first time and the second time are separated by less than 12 months.
- the first time and the second time are separated by more than 12 months.
- methods described herein provide for administering primed dendritic cells to a subject when the subject is hyperthermic.
- primed dendritic cells are administered after the subject has spiked a fever.
- primed dendritic cells are administered after the subject's temperature has risen to between about 37.5°C and about 42°C.
- the primed dendritic cells are administered after the subject's temperature has risen to between about 38° C and about 42°C.
- the primed dendritic cells are administered after the subject's temperature has risen to at least about 38.5°C.
- the primed dendritic cells are administered after the subject's temperature has risen to 38.5° C.
- the primed dendritic cells are administered to the subject after the subject's temperature reaches 38 degrees Celsius or higher.
- the subject's temperature is measured by a tympanic or oral method.
- Methods for producing primed DC described herein may comprise activating T cells in vitro with the DCs produced by the methods disclosed herein.
- the subject is incapable of mounting an effective immune response.
- the subject may be immunocompromised.
- the subject may have received a therapy that renders them immunocompromised.
- the subject may have a disease that renders them immunocompromised.
- the methods may comprise contacting T cells from an HLA-matched subject with the DCs. Contacting the T cells with the DCs in vitro may induce a CTL response. Contacting the T cells with the DCs in vitro may also induce proliferation of the T cells.
- compositions comprising more than one strain of Dengue virus.
- the pharmaceutical compositions comprise at least a portion of a Dengue virus.
- the portion of the Dengue virus may be a portion sufficient to generate an immune response in a subject receiving the pharmaceutical composition.
- the compositions may further comprise one or more pharmaceutically acceptable salts, excipients or vehicles.
- compositions for use in the present pharmaceutical compositions include carriers, excipients, diluents, antioxidants, preservatives, coloring, flavoring and diluting agents, emulsifying agents, suspending agents, solvents, fillers, bulking agents, buffers, delivery vehicles, tonicity agents, cosolvents, wetting agents, complexing agents, buffering agents, antimicrobials, and surfactants.
- the carriers disclosed herein comprise neutral buffered saline.
- the pharmaceutical compositions may include antioxidants such as ascorbic acid; low molecular weight polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, arginine or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; salt-forming counterions such as sodium; and/or nonionic surfactants such as Tween, pluronics, or polyethylene glycol (PEG).
- antioxidants such as ascorbic acid
- low molecular weight polypeptides such as serum albumin, gelatin, or immunoglobulins
- hydrophilic polymers such as polyvinylpyrrolidone
- amino acids
- suitable tonicity enhancing agents include alkali metal halides (preferably sodium or potassium chloride), mannitol, sorbitol, and the like.
- Suitable preservatives include benzalkonium chloride, thimerosal, phenethyl alcohol, methylparaben, propylparaben, chlorhexidine, sorbic acid and the like. Hydrogen peroxide also may be used as preservative.
- Suitable cosolvents include glycerin, propylene glycol, and PEG.
- Suitable complexing agents include caffeine, polyvinylpyrrolidone, beta- cyclodextrin or hydroxy-propyl-beta-cyclodextrin.
- Suitable surfactants or wetting agents include sorbitan esters, polysorbates such as polysorbate 80, tromethamine, lecithin, cholesterol, tyloxapal, and the like.
- the buffers may be conventional buffers such as acetate, borate, citrate, phosphate, bicarbonate, or Tris-HCl.
- Acetate buffer may be about pH 4-5.5, and Tris buffer may be about pH 7-8.5.
- compositions that comprise a Dengue virus, wherein the composition is in liquid form, lyophilized form or freeze-dried form and may include one or more
- lyoprotectants include excipients, surfactants, high molecular weight structural additives and/or bulking agents.
- a lyoprotectant is included, which is a non-reducing sugar such as sucrose, lactose or trehalose.
- the amount of lyoprotectant generally included is such that, upon reconstitution, the resulting formulation will be isotonic, although hypertonic or slightly hypotonic formulations also may be suitable.
- the amount of lyoprotectant should be sufficient to prevent an unacceptable amount of degradation and/or aggregation of the virus upon lyophilization.
- Exemplary lyoprotectant concentrations for sugars (e.g., sucrose, lactose, trehalose) in the pre-lyophilized formulation are from about 10 mM to about 400 mM.
- compositions that comprise a Dengue virus disclosed herein, wherein the compositions are suitable for injection or infusion.
- Exemplary compositions are suitable for injection or infusion into an animal by any route available to the skilled worker, such as intraarticular, subcutaneous, intravenous, intramuscular, intraperitoneal, intracerebral
- a parenteral formulation typically will be a sterile, pyrogen-free, isotonic aqueous solution, optionally containing pharmaceutically acceptable preservatives.
- Devices for injection of a Dengue Virus described herein may be configured for subcutaneous injection. In some instances, the device is not configured for intradermal injection.
- the device may have a needle gauge size of 30 to 19 G on an ISO scale.
- the device may have a needle gauge size of 27 to 19 G on an ISO scale.
- the device may have a needle gauge size of 24 to 19 G on an ISO scale.
- the device may have a needle gauge size of 23 to 19 G on an ISO scale.
- the device may have a needle gauge size of 22 to 19 G on an ISO scale.
- the device may have a needle gauge size of 21 to 19 G on an ISO scale.
- the device may have a needle length of 3/8 inches to 3/4 inches.
- the device may have a needle length of 1/2 inches to 5/8 inches.
- the needle may be injected at an angle of 45 degrees to 90 degrees for subcutaneous injection.
- the injection site may be in the deltoid muscle of arm, or vastus lateralis muscle of thigh.
- the DV is stored in a 0.5 ml container. In some instances, the DV is stored in a 1.0 ml container. In some instances, the DV is stored in a 1.5 ml container. In some instances, the DV is stored in a 2.0 ml container. In some instances, the DV is stored in a 2.5 ml container. In some instances, the DV is stored in a 3.0 ml container. In some instances, the DV is stored in a 3.5 ml container. In some instances, the DV is stored in a 4.0 ml container. In some instances, the DV is stored in a 4.5 ml container.
- the DV is stored in a 5.0 ml container. In some instances, the DV is stored in a 5.5 ml container. In some instances, the DV is stored in a 6.0 ml container. In some instances, the DV is stored in a 6.5 ml container. In some instances, the DV is stored in a 7.0 ml container. In some instances, the DV is stored in a 7.5 ml container. In some instances, the DV is stored in an 8.0 ml container. In some instances, the DV is stored in an 8.5 ml container. In some instances, the DV is stored in a 9.0 ml container. In some instances, the DV is stored in a 9.5 ml container. In some instances, the DV is stored in a 10 ml container.
- Exemplary containers include, without limitation, a bottle, vial, can, or syringe.
- compositions that comprise a Dengue virus disclosed herein, and a non-aqueous solvent.
- non-aqueous solvents are propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate.
- Aqueous carriers include water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media.
- Parenteral vehicles include sodium chloride solution, Ringers' dextrose, dextrose and sodium chloride, lactated Ringer's, or fixed oils.
- Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers, such as those based on Ringer's dextrose, and the like. Preservatives and other additives may also be present, such as, for example, anti-mi crobials, anti-oxidants, chelating agents, inert gases and the like.
- compositions that comprise a Dengue virus disclosed herein, wherein the pharmaceutical composition is formulated for inhalation, such as for example, as a dry powder.
- suitable and/or preferred pharmaceutical formulations may be determined in view of the present disclosure and general knowledge of formulation technology, depending upon the intended route of administration, delivery format, and desired dosage.
- an effective dose may be calculated according to patient body weight, body surface area, or organ size. Further refinement of the calculations for determining the appropriate dosage for treatment involving each of the formulations described herein are routinely made in the art and is within the ambit of tasks routinely performed in the art. Appropriate dosages may be ascertained through use of appropriate dose-response data. Kits
- kits comprising Dengue Virus compositions.
- a kit can also be kits for the treatment or prevention of a cancer, pathogen infection, or immune disorder.
- a kit can include a therapeutic or prophylactic composition containing an effective amount of a composition of Dengue virus in unit dosage form and/or an effective amount of a checkpoint inhibitor.
- a kit comprises a sterile container which can contain a therapeutic composition of Dengue virus; such containers can be boxes, ampules, bottles, vials, tubes, bags, pouches, blister-packs, or other suitable container forms known in the art.
- Such containers can be made of plastic, glass, laminated paper, metal foil, or other materials suitable for holding medicaments.
- a kit can include cells, such as dendritic cells, from about 1 x 10 4 cells to about 1 x 10 12 cells.
- a kit can include at least about lxlO 5 cells, at least about lxlO 6 cells, at least about lxlO 7 cells, at least about 4xl0 7 cells, at least about 5xl0 7 cells, at least about 6xl0 7 cells, at least about 6xl0 7 cells, at least about 8xl0 7 cells, at least about 9xl0 7 cells, at least about lxlO 8 cells, at least about 2xl0 8 cells, at least about 3xl0 8 cells, at least about 4xl0 8 cells, at least about 5xl0 8 cells, at least about 6xl0 8 cells, at least about 6xl0 8 cells, at least about 8xl0 8 cells, at least about 9xl0 8 cells, at least about lxlO 9 cells, at least about 2xl0 9 cells, at least about 3xl
- kits can include 3xl0 6 cells; the cells can be expanded to about 5xl0 10 cells and administered to a subject.
- kits can further comprise instructions for use thereof.
- the term "effective amount” or “therapeutic effective amount” refers to the amount of a compound described herein that is sufficient to effect the intended application including but not limited to disease treatment, as defined below.
- the therapeutically effective amount may vary depending upon the intended application (in vitro or in vivo), or the subject being treated, e.g., the weight and age of the subject, the severity of the disease condition, the manner of administration and the like, which can readily be determined by one of ordinary skill in the art.
- the specific dose will vary depending on the particular compounds chosen, the dosing regimen to be followed, whether it is administered in combination with Dengue virus, timing of administration, or the physical delivery system in which it is carried.
- treatment or “treating” is used interchangeably herein. These terms refer to an approach for obtaining beneficial or desired results including but not limited to therapeutic benefit and/or a prophylactic benefit.
- therapeutic benefit is meant reduction, eradication or amelioration of the underlying disorder being treated.
- a therapeutic benefit is achieved with the reduction eradication or amelioration of one or more of the physiological symptoms associated with the underlying disorder such that an improvement is observed in the patient, notwithstanding that the patient may still be afflicted with the underlying disorder.
- the compositions may be administered to a patient at risk of developing a particular disease, or to a patient reporting one or more of the physiological symptoms of a disease, even though a diagnosis of this disease may not have been made.
- co-administration encompass administration of two or more agents to an animal so that both agents are present in the animal at the same time.
- Co-administration includes simultaneous administration in separate compositions, administration at different times in separate compositions, or administration in a composition in which both agents are present.
- inhibitor refers to a compound having the ability to inhibit a biological function of a target protein, whether by inhibiting the activity or expression of the target protein. Accordingly, the term “inhibitor” is defined in the context of the biological role of the target protein.
- agent refers to a biological, pharmaceutical, or chemical compound or other moiety.
- Non-limiting examples include simple or complex organic or inorganic molecule, a peptide, a protein, an oligonucleotide, an antibody, an antibody derivative, antibody fragment, a vitamin derivative, a carbohydrate, a toxin, or a
- chemotherapeutic compound Various compounds can be synthesized, for example, small molecules and oligomers (e.g., oligopeptides and oligonucleotides), and synthetic organic compounds based on various core structures.
- various natural sources can provide compounds for screening, such as plant or animal extracts, and the like. A skilled artisan can readily recognize that there is no limit as to the structural nature of the agents of the present invention.
- antibody is an immunoglobulin molecule capable of specific binding to a target, such as a carbohydrate, polynucleotide, lipid, and polypeptide through at least one antigen recognition site, located in the variable region of the immunoglobulin molecule.
- the term encompasses not only intact polyclonal or monoclonal antibodies but also fragments thereof (such as Fab, Fab', F(ab')2, Fv), single chain (ScFv), mutants thereof, fusion proteins comprising an antibody portion (such as domain antibodies), synthetic antibodies, multi-specific antibodies, human antibodies, humanized antibodies, chimeric antibodies, single chain antibodies, and any other modified configuration of the immunoglobulin molecule that comprises an antigen recognition site.
- An antibody includes an antibody of any type of class, such as IgG, IgA, or IgM (or sub-class thereof), and the antibody need not be of any particular class.
- An antibody can be from any animal origin.
- subject as used herein includes to mammals. Mammals include rats, mice, non-human primates, and primates, including humans.
- DCs were pulsed with the synthetic peptides at 10 ⁇ g/ml for 18 hours. After 18 hours of incubation, DCs were harvested, washed twice in HBSS, and resuspended in HESS for additional studies (see Example 2 and 3).
- Example 2 Dengue virus and dendritic cells for the treatment of melanoma in a first mouse model
- a mouse model assay was performed to observe results from combination targeting of cancer cells using a Dengue virus (DV) strain and tumor antigen primed dendritic cells (DCs).
- DV C57BL/6 mice were inoculated with 0.05 ml of Dengue virus (DEN-2 strain #1710) at lxlO 6 or lxl0 7 pfu/ml by injection in the base of tail.
- DEN-2 strain #1710 Dengue virus
- Recombinant murine IL-2 (Genzyme) and IFN-gamma (Sigma Pharmaceuticals) were administered by intravenous infusion at 2,000 (rlL- 2) and 500 1U (rIFN- gamma) on days 5, 10, 15, and 20 following administration of Dengue virus (DEN-2 strain #1710, CDC database entry number 555, provided by Dr. Duane Gubler). Seven days after the Dengue virus administration, C57BL/6 mice were immunized with mouse DCs incubated with the 2 peptides separately and injected intravenously. Peptides were synthesized. The H-2b-restricted peptide from Ovalbumin (OVA-8), SIINFEKL (SEQ ID NO: 30), was used as a control.
- Ovalbumin Ovalbumin
- SIINFEKL SEQ ID NO: 30
- mice were used to pulse murine DCs (see Example 1 for details). Two additional immunizations with DCs were given at 14-day intervals. Three days after the last DC infusion, mice were challenged with 5xl0 4 viable B 16 melanoma cells intravenously in the lateral tail vein and then followed for survival, which was recorded as the percentage of surviving animals over time (in days) after tumor injection. Data was recorded from five or more mice/group (see Table 5)
- mice administered in Group 2 were 7.5% lower than control mice in Group 1, administered the tumor peptide primed DCs without the Dengue virus.
- Example 3 Dengue virus and dendritic cells for the treatment of melanoma in a second mouse model
- a mouse model assay was performed to observe results from combination targeting of cancer cells using a Dengue virus (DV) strain and tumor antigen primed dendritic cells (DCs). Mice were administered cytokines to parallel the response to DV observed in humans.
- DV Dengue virus
- DCs tumor antigen primed dendritic cells
- H- 2 b-restricted B 16 murine melanoma cells line ATCC #CRL-6322.
- Peptides B 16 melanoma associated H- 2 b-restricted peptides derived from antigens gplOO/pmel 17 and from TRP-l/gp75
- Dendritic cells were generated from mouse bone marrow according to methods as described in Lutz et al. (J. Immunol. Methods 223 :77-92, 1999).
- mice received 5xl0 4 viable B 16 melanoma cells intravenously in the lateral tail vein to establish pulmonary metastases.
- the mice were inoculated with 0.05 ml of Dengue virus (DEN-2 strain #1710, CDC database entry number 555) at lxlO 6 or 1 xl0 7 pfu/ml by injection in the base of tail.
- Recombinant murine IL-2 (Genzyme) and IFN-gamma (Genzyme) and IFN-gamma (Sigma Pharmaceuticals) were administered by intravenous infusion at 2,000 1U (rIL-2) and 500 1U (rIFN-gamma) at 5-day intervals following administration of Dengue virus (DEN-2 strain #1710).
- mice On days 21, 35 and 49, the mouse DCs were incubated with the 2 peptides separately and inj ected intravenously in 2 sequential administrations on the same day to match the route and schedule of administration in subjects (see Example 2 for additional details).
- Control groups of mice received no Dengue virus or dendritic cells pulsed with H- 2 b-restricted peptide from ovalbumin (OVA-8), SIINFEKL. Treatment and control groups are shown in Table 6.
- the number of lung metastases observed in mice in Group B was 51% less than control Group D (administered DENV-2 #1710 and DCs exposed to a control peptide).
- the average reduction in Group A and B compared to Group D was 52.8%.
- Vero African Green Monkey Kidney Cells
- Vero lines are used by the World Health Organizations to produce a variety of viral vaccines.
- Dengue virus was passaged in a validated Vero Line derived from the Master Cell Bank and established as a Working Cell Bank according to guidelines established by the FDA Center for Biologies (CBER).
- CBER FDA Center for Biologies
- Two Dengue Virus Type 2 strains (DNV-2 #1584 and DENV-2 #1710) from initial seed stocks were added to the Vero Cells of the WCB at a MOI of 10 "5 .
- a plaque assay on final virus cultures was performed.
- the titer of DNV-2 #1584 was about 5E+06 PFU/ml, and the titer of DENV-2 #1710 was 3.5E+06 pfu/mL as estimated from plaque assays.
- Dengue virus 2 (DNV-2; #1584) from ATCC showed a clear cytopathic effect in Vero cells 5 days post infection , whereas Vero cells appears to have a morphology change 11 days post infection of the blind passage #2 (#1710 virus). (Data not shown.) The results showed that the DENV-2 #1710 virus is far less cytopathic than the DNV-2 #1584 strain.
- TILs normal human tumor infiltrating lymphocytes
- T-cell receptors were matched to FEMX melanoma cell line via HLA A2.1+.
- human TILs were exposed to DV supernatants containing interferons and interleukins.
- Exposed TILs + DV supernatants were placed in culture with FEMX tumor cells. Both arms were left to kill cancer cells for 4 hours at a ratio of 5-to-lT- cell to tumor cell (100,000 cells to 20,000 cells). Surviving tumor cells were then counted as %> of starting cells by flow cytometry. Results, shown in Table 9, demonstrate that DV induces 35% additional cancer cell killing beyond the pulsed DC anti -cancer response.
- Example 6 Human dendritic cell isolation and pulse with melanoma lysate antigens - [0161]
- the following example demonstrates generation of a highly pure CD1 la+ mature DC population expressing high levels of human IL-12p70 from pure, isolated CD14+ monocytes, as well as priming of the DC with melanoma cell lysate, the entire process being completed in less than one week. Cells were cultured on hard plastic plates and not exposed to soft plastic bags.
- CD14+ monocytes were isolated and analyzed for expression of CD14, CD15, CD45 and 7AAD. Post-prodigy run, 90.25 % of input cells were CD14+. CD14+ cells were treated with GM-CSF and IL-4 24hours post plating to generate immature dendritic cells.
- RPMI-7951 melanoma cells from ATCC arrived on the day of the prodigy run and were re-suspended, counted and plated. Melanoma cells were than treated with a calcium
- hypochlorite solution cells were treated with sodium chlorite solution.
- the melanoma cell lysate was added to the immature DC, and maturing agents IFN gamma
- a viability assay was conducted and average viability was recorded at 79.2% after cells were frozen, thawed and cultured (compared to a comparator which showed 70%).
- DC IL-12p70 production relative to that of several comparators was determined. These comparators methods include exposing cells to soft plastic bags, lysing cells with solutions other than a chlorite solution, and do not use the combination of LPS, IFN gamma and R848 to mature cells.
- Example 7 Inducing cytokines in human white blood cells with Dengue virus
- WBC Human white blood cells
- lymphocytes were infected with either mock virus or Dengue virus at three different conditions
- multiplicities of infection MOI
- MOI of 0.1 MOI of 0.5
- MOI of 2 at time 0.
- both Vero and FRhL cells are infected using dilutions of the supernatant from blind passage #2, DENV-2 #1710 and DNV-2 # 1584, respectively.
- an immunofluorescence staining is developed to detect virus in the cells infected with supernatant from blind passage #2.
- Ultracentrifugation is used to concentrate virus when necessary. Following confirmation of virus titer, final product is filtered to remove any cellular debris, assessed for absence of any adventitious organisms, and upon final lot released, bottled in 5 ml bottles, and stored at 4°C until ready for shipment and administration.
- Example 8 Dengue Virus Supernatant Increases ICAM-1 Expression on Tumor cells
- Table 16 Flow cytometric count of CD54 expression in Set 1 and Set 2 of FIG. 3A and FIG. 3B
- Example 9 Dengue Virus Supernatant Increases Human Leukocyte Antigen (HLA) expression on melanoma tumor cells
- Dengue virus supernatant was incubated with melanoma tumor cell lines FEMX (a mixture of HLA-A2.1 + cells) and 624.28 (cell line missing HLA A2.1 at the gene level) tumor cell lines. Cell lines were incubated with 30 uL of Dengue virus supernatant from human PBMCs infected at 10 6 plaque forming units per mL as in Table 19.
- HLA-A, HLA-B, and HLA-C expression was measured by flow cytometry using the W6/A32 pan-HLA antibody, which reacts to all HLA gene products, FIGS. 5A-5L.
- PBMC peripheral blood monocytes
- Leukopaks derived from apheresis were utilized to isolate PBMC.
- the PBMC containing monocytes, DCs, K, T and B cells, were placed in complete cell media at 37° C and 5%FBS.
- Dengue virus was expanded to 10 6 pfu/ml in Vero (African Green Monkey) kidney cells.
- the virus titer was calculated to 3.5 x 10 6 PFU/mL in Vero cells using standard growth conditions.
- PBMC was infected at escalating doses of multiplicities of infection (MOI).
- MOI The following MOI were used: Mock (PBMC with no virus), 0.1 (a ratio of 1 virus particle to 10 PBMC cells), 0.5 (a ratio of 5 virus particles to 10 PBMC cells), and 2.0 (a ratio of 20 virus particles to 10 PBMC cells).
- the supernatants were collected and frozen at -80° C. Resulting supernatants were used to measure the cytokines using a multiplex ELISA panel and compared against supernatant collected before infection. Comparison of mock infections to the changes across MOI 0.1, 0.5, and 2.0 confirmed a virus-concentration and time-dependence of activation.
- Original measures were done in triplicates, in pg/mL, expressed as a % of baseline pre- and post- infection by dengue virus as shown in Table 20. Some values may exceed instrument measurements; such data points were set to the measurement maximums as a means of calculating % increases.
- Results show that Dengue virus infection of PBMCs results in up-regulation of Class I MHC to allow the CTL to recognize their targets ( ⁇ , IFNa), increase in CTL proliferation and cytotoxic capability (IL-2), preventing apoptosis of activated CTL (IL-7, IL-15).
- PBMC is not completely representative of in vivo conditions. The lack of soluble or somatic receptors can influence cytokine levels. For example, contact activation, even without Dengue virus, induced levels of IL-8 above detection limits. IL-6 was also very high, and IL-2 was reduced/absent as the lack of concentrated dendritic cells (DCs) in the PBMC allowed the virus-mediated IL-2 block to remain. In vivo, the clustering of infected, activated DCs in lymphatics can overcome the virus IL-2 block, supporting the CTL proliferation.
- DCs concentrated dendritic cells
- IFN-a - pro-inflammatory cytokine that promotes Class I MHC expression starts both the innate and adaptive immune response.
- IFN- ⁇ - produced typically by activated NK and CTL, IFN- ⁇ up-regulates Class I MHC and activates macrophages to Type 1 polarity.
- IL-6 one of the early cytokines expected of dengue infection; while its increase acts as both an inflammatory and antiinflammatory cytokine. It has inflammatory properties when applied to immune cells, but all somatic cells carry the low-affinity receptor, gpl30. Binding to gpl30 activates antiinflammatory genes to protect from immune-mediated damage. Data shows an increase of >120000%>, but this experiment was not under homeostatic control. In dengue cases with IL-6 receptor activity, levels are much lower, between 3.1-80.1 pg/mL, and are not definitively correlated with disease severity. These levels are well below the 10,000-fold IL-6 rise seen in cytokine release syndrome such as with CAR-T therapy.
- DCs pulsed with self-peptide in the absence of IL-12 induce T Reg CD4 + CD25 + cells, lower the immune response.
- IL-8 - a pro-inflammatory cytokine that restores critical adhesion points along tumor epithelial cells which lead to further tumor microenvironment infiltration by CTL; Data shows a constant heighted stimulation, far beyond data measures.
- IL-8 is important to help open gap junctions in tumor blood vessels. The levels of IL-8 in dengue patients are moderate and increases are not associated with higher toxicity.
- IL-15 an adaptive cytokine of the IL-2 family
- IL-15 increases cytolytic function of CTL and NK cells and slows CTL apoptosis.
- Data shows an increase of 93%> above baseline.
- IL-7 an adaptive cytokine of the IL-2 family
- IL-7 stimulates CTL and NK cells to effector status, making them better at killing their targets. It also induces a switch from glycolysis to fatty acid metabolism, allowing transition of CTL to central memory and memory/effector T cells data shows an increase of 363%> above baseline.
- IL-2 the prototypical TH1 cytokine; IL-2 induces CTL proliferation; data shows an increase of 152%) in the IL-2 receptor, but IL-2 was not detected.
- Table 20 Cytokine Detection by ELISA. Mean of triplicate values, some values may exceed instrument measurements; such data points were set to the measurement maximums.
- Donors either autologous or HLA-matched allogenic have a leukapheresis procedure performed at a facility with trained personnel and proper equipment. After the apheresis is complete, the red cells, platelets, and plasma proteins are returned to the donor. The apheresis product is assessed at the site (Gram Stain test and Limulus Amoeba Lysis [LAL]) for presence of bacterial contamination. After passing, the collection container (with small testing sample container attached), is barcoded with donor-specific information and placed in an approved shipping container conforming to both FDA and DOT regulations for storage and shipping of non-infectious biological materials. The shipping container is packaged with a cooling element ⁇ e.g., solid C0 2 , Liquid N 2 ), and temperature monitors. The shipping container is a hard plastic flask. A courier transports the container within 24 hours to the GMP manufacturing facility.
- a cooling element ⁇ e.g., solid C0 2 , Liquid N 2
- Monocytes are separated from other collected white blood cells ⁇ e.g. T cells. B cells, NK cells, eosinophils and basophils). This is accomplished with immuno-magnetic selection or, alternatively, by adherence properties. Immuno-magnetic selection involves pouring the white blood cells into a sterile plastic column with plastic beads coated with antibodies for immune cell CD surface proteins: (CD4/CD8/CD56, etc.).
- An example of immunomagnetic selection is the EasySep Monocyte Enrichment kit available from Stem Cell Technologies (Vancouver, B.C, Canada, www.stemcell.com).
- the EasySep kit To use the EasySep kit, the apheresis product is suspended in sterile PBS and poured into the EasySep plastic column containing Tetrameric antibody complexes with murine antibodies for: human CD2, CD3, CD16, CD19, CD20, CD56, CD66b, CD123, and Glycophorin A. After incubation for 10 minutes, EasySep magnetic particles are added. The cells adhering to the beads removed an electromagnet sorting.
- the magnet is inverted, and the desired cell fraction (monocytes), is poured into a sterile polystyrene flask for additional processing.
- the desired cell fraction monocytes
- a positive adherence selection assay magnetic beads coated with CD1+/CD14+ antibodies is mixed with monocytes, a magnet is placed against the column, and non-binding cells are flushed out of the column with PBS solution. The monocytes are then washed off the beads.
- positive adherence selection the properties of monocytes to stick to certain surfaces are used to separate them by running the apheresis product down a slanted column.
- bone marrow cells are depleted for lymphocytes and MHC Class positive cells by Fluorescent Activated Cell Sorting (FACS) with monoclonal antibodies for CD3, CD4, and CD8.
- FACS Fluorescent Activated Cell Sorting
- Remaining cells are cultured overnight at 37°C in a 5% C0 2 atmosphere in a basal cell culture medium supplemented with human AB serum.
- Human AB serum is chosen because it grows cells at a faster rate than other serum types, and serum free media produces DCs with much lower T-cell stimulation capability.
- the cells are replated and cultured in the presence of Granulocyte-Macrophage Colony Stimulation Factor (GM-CSF), and
- GM-CSF Granulocyte-Macrophage Colony Stimulation Factor
- recombinant IL-4 at 900 U/ml. After 3 to 4 days, media to be exchanged for fresh cytokine media.
- DDCs dermal dendritic cells
- Keratomes from healthy human volunteers are incubated in a solution of the bacterial proteases Dispase type 2 at a final concentration of 1.2 U/ml in RPMI 1640 for 1 hour at 37°C. After the incubation period, epidermis and dermis are easily separated. Epidermal and dermal sheets are then cut into small (1-10 mm) pieces after several washing with PBS, and placed in RPMI 1640 supplemented with 10% Fetal Bovine Serum (FBS), and placed in 10-cm tissue culture plates. After 2-3 days, pieces of tissue are removed, and the medium collected.
- FBS Fetal Bovine Serum
- Cells migrating out of the tissue sections into the medium are spun down, resuspended in 1-2 ml fresh medium and stained with trypan blue. Further enrichment is achieved by separation on a metrizamide gradient. Cells are layered onto 3-ml columns of hypertonic 14.5% metrizamide and sedimented at 650 g for 10 minutes at room temperature. Low density interphase cells are collected and washed in two successively less hypertonic washes (RPMI 1640 with 10% FBS and 40 mM NaCl) to return cells to isotonicity.
- monocytes When the monocytes are collected, they may number only a few thousand.
- the recombinant human growth factors rhuInterleukin-4 (IL-4), and r1 ⁇ 2Granulocyte-Macrophage- Colony-Stimulation Factor (GM-CSF), are used in a multi-step protocol to accomplish the expansion of DC numbers to the range of 50 million.
- cells are assessed for and expansion in number and the development of mature-DC markers: (CD1 1 + , CD80 + , CD83 + ), as well as increased expression of both Class I (for presentation of short peptides to CD8 + , and Class II MHC complexes (for presentation of longer peptides to CD4 + Helper-Inducer T lymphocytes). After approximately 3-4 days, the number of mature DCs will be measured.
- the monocyte-enriched fraction is placed in Nuclon-coated Cell Factory (Thermoscientific), with serum-free DC media (CellGro, Inc.), supplemented with GMP-2% human AB serum, 500 IU/ml (about 50ng/ml) rhuIL-4 (CellGenix), with 500 IU/ml (about 50ng/ml) rhuGM-CSF (CellGenix), added after the first 24 hours.
- Final product is approximately about 1L of total media volume.
- a population of immature DCs are assessed for the following markers: CD1 + CD1 1 + CD14 + .
- a variety of tumor antigen sources are used for high-quality DCs: peptides, lysate from autologous tumors, whole tumor cells, and RNA coding for specific tumor antigens.
- An excisional biopsy or blood sample containing leukemic or lymphoma cells are obtained by surgery or blood draw followed by a magnetic selection to obtain leukemia/lymphoma cells.
- Whole autologous tumor cell lysate is prepared by several methods. To prepare the lysate, the tumor sample may be rewarmed to approximately 35°C using a water bath or other procedure.
- the development of automated cell processors like the Miltenyi GentleMACS system allows the sample to be manually minced, suspended in PBS solution, then a pre-selected tissue-specific software-controlled rotor system separates the tumor cells. Cells are added to an enzyme mixture before being transferred to the Miltenyi GentleMACS dissociator.
- the single- cell suspension can be membrane-lysed with minimal damage to tumor peptides, using a hypochlorite solution, which will kill any residual tumor cells, neutralize dT H 2 cytokines, and increase immunogenicity for superior CTL affinity, avidity and activation.
- hypochlorite solution After adding hypochlorite, culture plates are incubated at 37 degrees Celsius, 5% C0 2 , for 1 hour, with gentle manual agitation at 30 min to disperse hypochlorite. Cells are washed two time to neutralize the lysis reaction (e.g. with HBSS). Hypochlorite -treated cells may be subjected to subsequent freeze-thaw cycles. Alternatively, the sample does not separate the tumor cells. Instead the sample is left to contain tumor cells and supporting cells (e.g. cells from the tumor
- Cells are lysed with calcium hypochlorite to eliminate red blood cells and produce apoptotic and necrotic bodies without destroying peptides needed for CTL induction.
- Lysate from the GentleMACS is added on the third day of immature DCs production. Immature DCs are co-cultured with tumor lysate for about 16 hours. The final step is maturation with an inflammatory signal.
- Clinical -Grade LPS 60 EU/ml (R & D Invivogen) (R & D Invivogen), and
- Interferon-gamma 2000 IU/ml, about 100 ng/ml
- R&D Systems Interferon-gamma (2000 IU/ml, about 100 ng/ml) (R&D Systems) are added to the flask and incubated for about 12 hours to mature the pulsed DC. After exposure to LPS, the DCs are assessed for up-regulation of CD80/CD83 + activation markers, and increase production of IL- 12p70. In process testing at this stage includes sterility (as previously described), viability (% viable cells by Trypan Blue dye exclusion), and specificity (%DC measured by CD1 lc flow cytometry).
- the DCs are transferred to hard plastic containers suitable for freezing at -70 C in liquid N 2 , storage up to 1 year, and shipping to the clinic for use.
- the containers are shipped cool overnight, then re-warmed to 37 C in a warm-water bath before intravenous administration with a 0.9% NaCl solution concurrent over 30 minutes.
- the DCs are administered intravenously.
- Dengue Virus is similar to that of other viral vaccine injections.
- a subject has an area of skin in the shoulder (deltoid) region cleaned with alcohol, then 0.5 ml of the virus is injected under the skin to mimic a mosquito bite. Once the subject has a fever the reaches 38.5 °C, after 2-5 days from DV injection, the subject is infused by intravenous line concurrent with 0.9% NaCl solution with pulsed (primed) dendritic cells. Infusions are repeated until the subject is negative for disease. DC infusions will use cells as manufactured in
- Example 15 Co-administration of an immune checkpoint inhibitor with Dengue virus for the treatment of cancer in a mouse model
- mice receive 5xl0 4 of cultured tumor cells intravenously into the lateral tail vein.
- mice are inoculated with 0.05 mL of Dengue virus at lxlO 6 or lxlO 7 pfu/mL by injection in the base of the tail.
- Recombinant murine IL-2 (Genzyme) and IFN-gamma (Sigma Pharmaceuticals) are administered by intravenous infusion at 2,000 1U (rIL-2) and 500 1U (rIFN-gamma) at 5-day intervals following administration of Dengue virus and an effective amount of at least one of Pembrolizumab, Ipilimumab (e.g., BMS-734016, MDX-010), Enoblituzumab (e.g., MGA271), Lirilumab (e.g., BMS-986015, IPH2102), BMS986016, Atezolizumab (e.g., MPDL3280A, RG7446, R05541267), or Bavituximab.
- Pembrolizumab e.g., Ipilimumab (e.g., BMS-734016, MDX-010), Enoblituzumab (e.g., MGA271), Lir
- Exemplary amino acid sequences for immune checkpoint modulatory agents are provided in Table 21.
- the mouse DC are incubated with peptides and injected intravenously.
- Two groups of control mice are used. One group of mice receives no Dengue virus and no dendritic cells.
- a group of control mice receives Dengue virus and dendritic cells but no immune checkpoint inhibitor. Histopathology and biochemical analyses of organs including brain, heart, liver, kidneys, spleen, and gonads are performed.
- Example 16 Co-administration of an immune modulatory agent that activates an immune checkpoint with Dengue virus for the treatment of cancer in a mouse model
- mice receive 5xl0 4 of cultured tumor cells intravenously into the lateral tail vein.
- mice are inoculated with 0.05 mL of Dengue virus at lxlO 6 or lxlO 7 pfu/mL by injection in the base of the tail.
- Recombinant murine IL-2 (Genzyme) and IFN-gamma (Sigma Pharmaceuticals) are administered by intravenous infusion at 2,000 1U (rIL-2) and 500 1U (rIFN-gamma) at 5-day intervals following administration of Dengue virus and an effective amount of at least one of Urelumab (e.g., BMS-663513), Varlilumab (e.g., CDX-1 127), or TRX518.
- Exemplary amino acid sequences for immune checkpoint modulatory agents are seen in Table 15. On days 21, 35 and 49, the mouse DCs are incubated with peptides and inj ected intravenously. Two groups of control mice are used.
- the immune checkpoint activating agent is Urelumab (e.g., BMS-663513), Varlilumab (e.g., CDX-1 127), TRX518, or combinations thereof.
- Example 17 Dengue virus and DCs paired with other dendritic cells
- a patient with cancer is treated with autologous dendritic cells that are pulsed with a tumor cell lysate containing antigens expressed on the patient' s cancer cells.
- the cancer is metastatic melanoma.
- the autologous dendritic cells are cultured and stored in soft plastic bags according to standard industry protocols. A subsequent CAT-SCAN or measure of cancer markers in the bloodstream of the patient reveals that the dendritic cells have had little to no effect on tumor size or cancer growth.
- the autologous dendritic cells are administered again, along with Dengue virus and dendritic cells that have been cultured and stored on a hard surface and pulsed with the same tumor lysate.
- Example 18 Dengue virus and DCs paired with oncolytic viruses
- a patient with cancer is treated with an oncolytic virus (a virus that targets and lyses cancer cells), along with Dengue virus and primed dendritic cells.
- the dendritic cells are cultured and stored on a hard surface and pulsed with a tumor lysate containing antigens expressed on the cancer cells of the patient.
- Example 19 Dengue virus and DCs paired with CTLA4 PD-1 PD-L1 therapy
- a patient with metastatic melanoma is treated with a checkpoint inhibitor.
- the checkpoint inhibitor is Ipilimumab, a monoclonal antibody inhibitor of cytotoxic T-lymphocyte- associated antigen 4 (CTLA-4).
- CTLA-4 cytotoxic T-lymphocyte- associated antigen 4
- the checkpoint inhibitor is Nivolumab, a monoclonal antibody inhibitor of programmed death 1 (PD-1).
- the patient also receives Dengue virus and primed dendritic cells.
- the dendritic cells are cultured and stored on a hard surface and pulsed with a tumor lysate containing antigens expressed on the cancer cells of the patient.
- Dengue virus and dendritic cells paired with the checkpoint inhibitor stimulates the immune system of the patient. Treatment is continued with the checkpoint inhibitor to achieve a complete response or near complete response.
- Example 20 Dengue virus and DCs paired with CAR-T cells
- a patient with cancer is treated with chimeric antigen receptor T cells (CAR-T cells) programmed to target antigens on the cancer cells of the patient, along with Dengue virus and primed dendritic cells.
- CAR-T cells chimeric antigen receptor T cells
- the dendritic cells are cultured and stored on a hard surface and pulsed with a tumor lysate containing antigens expressed on the cancer cells of the patient.
- Dengue virus and dendritic cells paired with the checkpoint inhibitor stimulates the immune system of the patient.
- Example 21 Dengue virus and DCs paired with IL-2 therapy
- a patient with cancer is treated with high-dose interleukin-2 (IL-2, Proleukin), along with Dengue virus and primed dendritic cells.
- IL-2 interleukin-2
- the dendritic cells are cultured and stored on a hard surface and pulsed with a tumor lysate containing antigens expressed on the cancer cells of the patient.
- Dengue virus and dendritic cells paired with IL-2 stimulates the immune system of the patient.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Epidemiology (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Biomedical Technology (AREA)
- Zoology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Pharmacology & Pharmacy (AREA)
- Immunology (AREA)
- Biotechnology (AREA)
- Microbiology (AREA)
- General Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- Virology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Hematology (AREA)
- Oncology (AREA)
- Molecular Biology (AREA)
- Mycology (AREA)
- Cell Biology (AREA)
- Biophysics (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Developmental Biology & Embryology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Priority Applications (7)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA3082779A CA3082779A1 (en) | 2016-11-16 | 2017-11-15 | Combination immunotherapies for treatment of cancer |
| EP17871276.6A EP3541417A4 (en) | 2016-11-16 | 2017-11-15 | Combination immunotherapies for treatment of cancer |
| CN201780076988.1A CN110139671A (zh) | 2016-11-16 | 2017-11-15 | 用于治疗癌症的组合免疫疗法 |
| JP2019525727A JP2020500847A (ja) | 2016-11-16 | 2017-11-15 | 癌の処置のための併用免疫療法 |
| US16/413,444 US10675304B2 (en) | 2016-11-16 | 2019-05-15 | Combination immunotherapies for treatment of cancer |
| US15/931,787 US11357795B2 (en) | 2016-11-16 | 2020-05-14 | Combination immunotherapies for treatment of cancer |
| US17/837,294 US12377115B2 (en) | 2016-11-16 | 2022-06-10 | Combination immunotherapies for treatment of cancer |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201662423119P | 2016-11-16 | 2016-11-16 | |
| US62/423,119 | 2016-11-16 |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/413,444 Continuation US10675304B2 (en) | 2016-11-16 | 2019-05-15 | Combination immunotherapies for treatment of cancer |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2018093907A1 true WO2018093907A1 (en) | 2018-05-24 |
Family
ID=62146828
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2017/061810 Ceased WO2018093907A1 (en) | 2016-11-16 | 2017-11-15 | Combination immunotherapies for treatment of cancer |
Country Status (6)
| Country | Link |
|---|---|
| US (3) | US10675304B2 (cg-RX-API-DMAC7.html) |
| EP (1) | EP3541417A4 (cg-RX-API-DMAC7.html) |
| JP (1) | JP2020500847A (cg-RX-API-DMAC7.html) |
| CN (1) | CN110139671A (cg-RX-API-DMAC7.html) |
| CA (1) | CA3082779A1 (cg-RX-API-DMAC7.html) |
| WO (1) | WO2018093907A1 (cg-RX-API-DMAC7.html) |
Cited By (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10159727B2 (en) | 2015-07-02 | 2018-12-25 | PrimeVax Immuno-Oncology, Inc. | Compositions and methods for combination therapy with dengue virus and dendritic cells |
| US10675304B2 (en) | 2016-11-16 | 2020-06-09 | PrimeVax Immuno-Oncology, Inc. | Combination immunotherapies for treatment of cancer |
| US10765727B2 (en) | 2015-09-26 | 2020-09-08 | PrimeVax Immuno-Oncology, Inc. | Compositions and methods for producing dendritic cells |
| EP3721899A1 (en) * | 2019-04-08 | 2020-10-14 | China Medical University | Combination therapies comprising dendritic cells-based vaccine and immune checkpoint inhibitor |
| US11793843B2 (en) | 2019-01-10 | 2023-10-24 | Janssen Biotech, Inc. | Prostate neoantigens and their uses |
| US12018289B2 (en) | 2019-11-18 | 2024-06-25 | Janssen Biotech, Inc. | Vaccines based on mutant CALR and JAK2 and their uses |
| US12059443B2 (en) | 2017-01-04 | 2024-08-13 | Prime Vax Immuno-Oncology, Inc. | Method for treating cancer using dengue virus serotype 1 (DENV-1) |
| US12240899B2 (en) | 2020-06-22 | 2025-03-04 | Ngm Biopharmaceuticals, Inc. | LAIR-1-binding agents and methods of use thereof |
| US12295997B2 (en) | 2020-07-06 | 2025-05-13 | Janssen Biotech, Inc. | Prostate neoantigens and their uses |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN110904229B (zh) * | 2019-11-25 | 2020-09-29 | 济南市中心医院 | Ilt4在肿瘤诊治中的应用 |
| CN116546999A (zh) * | 2020-09-27 | 2023-08-04 | 深圳华大生命科学研究院 | 药物组合物及其制备方法和应用 |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20070087015A1 (en) * | 1999-03-26 | 2007-04-19 | Eckels Kenneth I | Multivalent dengue virus vaccine |
| US20130089567A1 (en) * | 2006-08-15 | 2013-04-11 | The Usa, As Represented By The Secretary, Dept. Of Health & Human Services | Development of dengue virus vaccine components |
| US20160058852A1 (en) * | 2014-02-14 | 2016-03-03 | Immune Design Corp. | Immunotherapy of cancer through combination of local and systemic immune stimulation |
| WO2016179475A1 (en) * | 2015-05-07 | 2016-11-10 | Baylor College Of Medicine | Dendritic cell immunotherapy |
Family Cites Families (21)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US1015972A (en) | 1905-09-25 | 1912-01-30 | Westinghouse Electric & Mfg Co | Electric switch. |
| US1035755A (en) | 1908-07-21 | 1912-08-13 | Glenn S Smith | Draftsman's apparatus. |
| US6429199B1 (en) | 1994-07-15 | 2002-08-06 | University Of Iowa Research Foundation | Immunostimulatory nucleic acid molecules for activating dendritic cells |
| AU2872199A (en) | 1998-02-20 | 1999-09-06 | Rockefeller University, The | Apoptotic cell-mediated antigen presentation to dendritic cells |
| US6048686A (en) | 1998-05-05 | 2000-04-11 | Randy Kyle Brown | Hyperthermia and immunotherapy for cancer |
| US6524587B1 (en) * | 1998-05-05 | 2003-02-25 | Bruce W. Lyday | Hyperthermia and immunotherapy for leukemias lymphomas, and solid tumors |
| WO2000057909A2 (en) | 1999-03-26 | 2000-10-05 | Walter Reed Army Institute Of Research | Attenuated dengue-2 virus vaccine |
| EP1168924A4 (en) | 1999-03-31 | 2002-09-04 | Univ Pittsburgh | DERIVATIVED IMMUNOGENES IN VITRO INDUCTION OF ANTIQUE-SPECIFIC T-CELLS USING DENDRITIC CELL-TUMOR CELL OR DENDRITIC CELL-VIRAL CELL |
| EP1484064A1 (en) | 2003-06-04 | 2004-12-08 | Gesellschaft für Biotechnologische Forschung | Therapeutical composition containing dentritic cells and use thereof |
| WO2006001120A1 (ja) | 2004-06-24 | 2006-01-05 | Dnavec Research Inc. | マイナス鎖rnaウイルスを含む抗癌剤 |
| US8513008B2 (en) | 2004-10-07 | 2013-08-20 | Argos Therapeutics, Inc. | Mature dendritic cell compositions and methods for culturing same |
| EP2714076A1 (en) | 2011-05-26 | 2014-04-09 | GlaxoSmithKline Biologicals S.A. | Inactivated dengue virus vaccine |
| JP2015513401A (ja) | 2012-03-02 | 2015-05-14 | ラボラトリオス・デル・ドクトル・エステベ・ソシエダッド・アノニマ | 樹状細胞ワクチンの調製方法 |
| US9879003B2 (en) | 2012-04-11 | 2018-01-30 | Dana-Farber Cancer Institute, Inc. | Host targeted inhibitors of dengue virus and other viruses |
| JP2015520196A (ja) | 2012-06-10 | 2015-07-16 | タケダ ワクチン, インコーポレイテッドTakeda Vaccines, Inc. | デングウイルスに対するワクチン投与のための組成物および方法 |
| EP3473708B1 (en) | 2012-07-24 | 2021-01-27 | The General Hospital Corporation | Oncolytic virus therapy for resistant tumors |
| US9730989B2 (en) * | 2015-07-02 | 2017-08-15 | PrimeVax Immuno-Oncology, Inc. | Compositions and methods for combination therapy with dengue virus and dendritic cells |
| CA2999881A1 (en) * | 2015-09-26 | 2017-03-30 | PrimeVax Immuno-Oncology, Inc. | Compositions and methods for producing dendritic cells |
| JP2020500847A (ja) | 2016-11-16 | 2020-01-16 | プライムヴァックス イミュノ−オンコロジー,インク. | 癌の処置のための併用免疫療法 |
| EP3565567A4 (en) | 2017-01-04 | 2020-07-29 | Primevax Immuno-Oncology, Inc. | COMPOSITIONS AND METHODS OF THERAPY WITH DENGUE VIRUS |
| SG11201912163WA (en) | 2017-06-15 | 2020-01-30 | Primevax Immuno Oncology Inc | Compositions and methods for cancer therapy with dengue virus and dendritic cells |
-
2017
- 2017-11-15 JP JP2019525727A patent/JP2020500847A/ja active Pending
- 2017-11-15 EP EP17871276.6A patent/EP3541417A4/en not_active Withdrawn
- 2017-11-15 CN CN201780076988.1A patent/CN110139671A/zh active Pending
- 2017-11-15 WO PCT/US2017/061810 patent/WO2018093907A1/en not_active Ceased
- 2017-11-15 CA CA3082779A patent/CA3082779A1/en active Pending
-
2019
- 2019-05-15 US US16/413,444 patent/US10675304B2/en active Active
-
2020
- 2020-05-14 US US15/931,787 patent/US11357795B2/en active Active
-
2022
- 2022-06-10 US US17/837,294 patent/US12377115B2/en active Active
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20070087015A1 (en) * | 1999-03-26 | 2007-04-19 | Eckels Kenneth I | Multivalent dengue virus vaccine |
| US20130089567A1 (en) * | 2006-08-15 | 2013-04-11 | The Usa, As Represented By The Secretary, Dept. Of Health & Human Services | Development of dengue virus vaccine components |
| US20160058852A1 (en) * | 2014-02-14 | 2016-03-03 | Immune Design Corp. | Immunotherapy of cancer through combination of local and systemic immune stimulation |
| WO2016179475A1 (en) * | 2015-05-07 | 2016-11-10 | Baylor College Of Medicine | Dendritic cell immunotherapy |
Non-Patent Citations (4)
| Title |
|---|
| JING, W ET AL.: "Combined immune checkpoint protein blockade and low dose whole body irradiation as immunotherapy for myeloma", JOURNAL FOR IMMUNOTHERAPY OF CANCER, vol. 3, no. 2, 20 January 2015 (2015-01-20), pages 1 - 15, XP021210655 * |
| KAKA, A ET AL.: "Using Dendritic Cell Maturation and IL -12 Producing Capacity as Markers of Function: A Cautionary Tale", JOURNAL OF IMMUNOTHERAPY, vol. 31, no. 4, May 2008 (2008-05-01), pages 359 - 369, XP009514322, ISSN: 1524-9557, DOI: 10.1097/CJI.0b013e318165f5d2 * |
| LYDAY, B ET AL.: "Overcoming tumor immune evasion with an unique Arbovirus", JOURNAL OF TRANSLATIONAL MEDICINE , 2015, vol. 13, no. 3, 16 January 2015 (2015-01-16), pages 1 - 12, XP021210052 * |
| See also references of EP3541417A4 * |
Cited By (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10946080B2 (en) | 2015-07-02 | 2021-03-16 | PrimeVax Immuno-Oncology, Inc. | Compositions and methods for combination therapy with dengue virus and dendritic cells |
| US10357553B2 (en) | 2015-07-02 | 2019-07-23 | PrimeVax Immuno-Oncology, Inc. | Compositions and methods for combination therapy with dengue virus and dendritic cells |
| US10159727B2 (en) | 2015-07-02 | 2018-12-25 | PrimeVax Immuno-Oncology, Inc. | Compositions and methods for combination therapy with dengue virus and dendritic cells |
| US10765727B2 (en) | 2015-09-26 | 2020-09-08 | PrimeVax Immuno-Oncology, Inc. | Compositions and methods for producing dendritic cells |
| US11357795B2 (en) | 2016-11-16 | 2022-06-14 | PrimeVax Immuno-Oncology, Inc. | Combination immunotherapies for treatment of cancer |
| US10675304B2 (en) | 2016-11-16 | 2020-06-09 | PrimeVax Immuno-Oncology, Inc. | Combination immunotherapies for treatment of cancer |
| US12377115B2 (en) | 2016-11-16 | 2025-08-05 | PrimeVax Immuno-Oncology | Combination immunotherapies for treatment of cancer |
| US12059443B2 (en) | 2017-01-04 | 2024-08-13 | Prime Vax Immuno-Oncology, Inc. | Method for treating cancer using dengue virus serotype 1 (DENV-1) |
| US11793843B2 (en) | 2019-01-10 | 2023-10-24 | Janssen Biotech, Inc. | Prostate neoantigens and their uses |
| US12582683B2 (en) | 2019-01-10 | 2026-03-24 | Janssen Biotech, Inc. | Prostate neoantigens and their uses |
| EP3721899A1 (en) * | 2019-04-08 | 2020-10-14 | China Medical University | Combination therapies comprising dendritic cells-based vaccine and immune checkpoint inhibitor |
| US12018289B2 (en) | 2019-11-18 | 2024-06-25 | Janssen Biotech, Inc. | Vaccines based on mutant CALR and JAK2 and their uses |
| US12240899B2 (en) | 2020-06-22 | 2025-03-04 | Ngm Biopharmaceuticals, Inc. | LAIR-1-binding agents and methods of use thereof |
| US12295997B2 (en) | 2020-07-06 | 2025-05-13 | Janssen Biotech, Inc. | Prostate neoantigens and their uses |
Also Published As
| Publication number | Publication date |
|---|---|
| US10675304B2 (en) | 2020-06-09 |
| CN110139671A (zh) | 2019-08-16 |
| JP2020500847A (ja) | 2020-01-16 |
| US11357795B2 (en) | 2022-06-14 |
| US20230051860A1 (en) | 2023-02-16 |
| US12377115B2 (en) | 2025-08-05 |
| EP3541417A4 (en) | 2020-05-27 |
| US20190298764A1 (en) | 2019-10-03 |
| US20200276235A1 (en) | 2020-09-03 |
| EP3541417A1 (en) | 2019-09-25 |
| CA3082779A1 (en) | 2018-05-24 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12377115B2 (en) | Combination immunotherapies for treatment of cancer | |
| US12059443B2 (en) | Method for treating cancer using dengue virus serotype 1 (DENV-1) | |
| US20200360497A1 (en) | Compositions and methods for producing dendritic cells | |
| US20200121745A1 (en) | Compositions and methods for cancer therapy with dengue virus and dendritic cells | |
| US10946080B2 (en) | Compositions and methods for combination therapy with dengue virus and dendritic cells |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 17871276 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2019525727 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2017871276 Country of ref document: EP Effective date: 20190617 |
|
| ENP | Entry into the national phase |
Ref document number: 3082779 Country of ref document: CA |