WO2018072031A1 - Vaccine constructs and uses thereof against staphylococcus infections - Google Patents
Vaccine constructs and uses thereof against staphylococcus infections Download PDFInfo
- Publication number
- WO2018072031A1 WO2018072031A1 PCT/CA2017/051253 CA2017051253W WO2018072031A1 WO 2018072031 A1 WO2018072031 A1 WO 2018072031A1 CA 2017051253 W CA2017051253 W CA 2017051253W WO 2018072031 A1 WO2018072031 A1 WO 2018072031A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- polypeptide
- seq
- amino acid
- construct
- nos
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/02—Bacterial antigens
- A61K39/085—Staphylococcus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/305—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Micrococcaceae (F)
- C07K14/31—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Micrococcaceae (F) from Staphylococcus (G)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/08—Linear peptides containing only normal peptide links having 12 to 20 amino acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/74—Vectors or expression systems specially adapted for prokaryotic hosts other than E. coli, e.g. Lactobacillus, Micromonospora
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/52—Bacterial cells; Fungal cells; Protozoal cells
- A61K2039/522—Bacterial cells; Fungal cells; Protozoal cells avirulent or attenuated
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/55—Medicinal preparations containing antigens or antibodies characterised by the host/recipient, e.g. newborn with maternal antibodies
- A61K2039/552—Veterinary vaccine
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/20—Fusion polypeptide containing a tag with affinity for a non-protein ligand
- C07K2319/21—Fusion polypeptide containing a tag with affinity for a non-protein ligand containing a His-tag
Definitions
- the present Invention relates to vaccine constructs and uses thereof against Staphylococcus infections. More specifically, the present invention is concerned with vaccine constructs combining antigens and their uses against Staphylococcus infections such as bovine intramammary infections (IMI).
- IMI bovine intramammary infections
- Bovine mastitis is the most frequent and costly disease for dairy producers and Staphylococcus aureus is considered to be the transmittable bacterium that is the most often responsible for the development of the disease (Sears ef al., 2003). Staphylococcal IMIs, which may lead to mastitis, are difficult to treat and frequent relapses are common (Sandholm ef al., 1990).
- the present invention seeks to meet these and other needs.
- the present invention provides fusion polypeptides displaying increased immunogenicity and their use as vaccine against staphylococcal IMI.
- S. aureus IMI A characteristic of staphylococcal such as S. aureus IMI is the ability of S. aureus to persist within host cells.
- S. aureus small colony variants SCVs
- the present invention provides live-attenuated S. aureus strains for vaccine purposes based on the phenotypic aspects of SCVs to provide an immune response against such strains and increase the vaccine protective efficacy.
- the present invention provides the following items:
- Item 1 A fusion construct of formula (I): X-A-linker-B-Z (I) wherein: (1) A and B are identical or different and are independently: (a) a polypeptide comprising a SACOL0029 polypeptide as set forth in any one of the sequences depicted in FIG. 24 (SEQ ID NOs: 5 and 121 to 131), a SACOL0264 polypeptide (SEQ ID NO : 185), a SACOL0442 polypeptide as set forth in any one of the sequences depicted in FIG.
- a and B are identical or different and are independently: (a) a polypeptide comprising a SACOL0029 polypeptide as set forth in any one of the sequences depicted in FIG. 24 (SEQ ID NOs: 5 and 121 to 131), a SACOL0264 polypeptide (SEQ ID NO : 185), a SACOL0442 polypeptide as set forth in any one of the sequences depicted in FIG.
- Item 2 The construct of item 1 , wherein (1) (a) is a polypeptide comprising a SACOL0029 polypeptide as set forth in any one of the sequences depicted in FIG. 24 (SEQ ID NOs: 5 and 121 to 131), a SACOL0442 polypeptide as set forth in any one of the sequences depicted in FIG. 22D (SEQ ID NOs: 29 and 82 to 92), a SACOL0720 polypeptide as set forth in any one of the sequences depicted in FIGs. 231-K (SEQ ID NOs: 11 and 109 to 120), or a SACOL1867 polypeptide as set forth in any one of the sequences depicted in FIG. 25D (SEQ ID NOs: 152 to 164).
- a is a polypeptide comprising a SACOL0029 polypeptide as set forth in any one of the sequences depicted in FIG. 24 (SEQ ID NOs: 5 and 121 to 131), a SACOL0442 polypeptide
- Item 3 The construct of item 2, wherein at least one of A and B is (a) a polypeptide comprising a SACOL0029 polypeptide as set forth in any one of the sequences depicted in FIG. 24 (SEQ ID NOs: 5 and 121 to 131); (b) a polypeptide encoded by a gene from a same operon as a gene encoding the polypeptide of (a); (c) a polypeptide comprising an immunogenic fragment of at least 13 consecutive amino acids of (a) or (b); (d) a polypeptide comprising an amino acid sequence at least 60% identical overall to the sequence of the polypeptide of any one of (a) to (c); or (e) a polypeptide comprising an immunogenic variant comprising at least 13 consecutive amino acids of any one of (a) to (d); and the other one of A and B is (a') a polypeptide comprising a SACOL1867 polypeptide as set forth in any one of the sequences depicted in FIG.
- 25D (SEQ ID NOs: 152 to 164); (b') a polypeptide encoded by a gene from a same operon as a gene encoding the polypeptide of (a'); (c') a polypeptide comprising an immunogenic fragment of at least 13 consecutive amino acids of (a') or (b'); (d') a polypeptide comprising an amino acid sequence at least 60% identical overall to the sequence of the polypeptide of any one of (a') to (c'); or (e') a polypeptide comprising an immunogenic variant comprising at least 12 consecutive amino acids of any one of (a 1 ) to (d 1 ).
- Item 4 The construct of item 2, wherein at least one of A and B is (a) a polypeptide comprising a SACOL0442 polypeptide as set forth in any one of the sequences depicted in FIG. 22D (SEQ ID NOs: 29 and 82 to 92); (b) a polypeptide encoded by a gene from a same operon as a gene encoding the polypeptide of (a); (c) a polypeptide comprising an immunogenic fragment of at least 13 consecutive amino acids of (a) or (b); (d) a polypeptide comprising an amino acid sequence at least 60% identical overall to the sequence of the polypeptide of any one of (a) to (c); or (e) a polypeptide comprising an immunogenic variant comprising at least 13 consecutive amino acids of any one of (a) to (d); and the other one of A and B is (a') a polypeptide comprising a SACOL0720 polypeptide as set forth in any one of the sequences depicted in FIG. 22D (
- Item 5 The construct of item 2, wherein A and B are identical or different and are (a) a polypeptide comprising a SACOL0720 polypeptide as set forth in any one of the sequences depicted in FIGs. 23I-K (SEQ ID NOs: 11 and 109 to 120); (b) a polypeptide encoded by a gene from a same operon as a gene encoding the polypeptide of (a); (c) a polypeptide comprising an immunogenic fragment of at least 13 consecutive amino acids of (a) or (b); (d) a polypeptide comprising an amino acid sequence at least 60% identical overall to the sequence of the polypeptide of any one of (a) to (c); or (e) a polypeptide comprising an immunogenic variant comprising at least 13 consecutive amino acids of any one of (a) to (d).
- a and B are identical or different and are (a) a polypeptide comprising a SACOL0720 polypeptide as set forth in any one of the sequences depicted in FIG
- Item 6 The construct of any one of items 1-2 and 4, wherein said immunogenic fragment (d) comprises one or more of the following amino acid sequences: KDTINGKSNKSRNW (SEQ ID NO: 34); and KDGGKYTLESHKELQ (SEQ ID NO: 1).
- Item 7 The construct of item 6, wherein said immunogenic fragment (d) comprises one or more of the following amino acid sequences :
- DKQLQKVEEVPNNSEKALVKKLYDRYSKDTINGKSNKSRNWWSERPLNENQVRIHLEGTYTVAGRVYTPKRNIT LNKEWTLKELDHIIRFAHISYGLYMGEHLPKGNIVINTK (SEQ ID NO :32); and DKQLQKVEEVPNNSEKALVKKLYDRYSKDTINGKSNKSRNWVYSERPLNENQVRIHLEGTYTVAGRVYTPKRNIT LNKEWTLKELDHIIRFAHISYGLYMGEHLPKGNIVINTKDGGKYTLESHKELQKDRENVKINTADIKNVTFKLVKSV NDIEQV (SEQ ID NO : 33).
- Item 8 The construct of any one of items 1-2 and 4-5, wherein said immunogenic fragment (d) comprises one or more of the following amino acid sequences: QFGFDLKHKKDALA (SEQ ID NO: 21); TIKDQQKANQLAS (SEQ ID NO: 22); KDINKIYFMTDVDL (SEQ ID NO: 23); and DVDLGGPTFVLND (SEQ ID NO: 24).
- Item 9 The construct of item 8, wherein said immunogenic fragment (d) comprises one or more of the following amino acid sequences:
- Item 10 The construct of any one of items 1-3, wherein said immunogenic fragment (c 1 ) comprises one or more of the following amino acid sequences: PYNGWSFKDATGF (SEQ ID NO: 165); AHPNGDKGNGGIYK (SEQ ID NO: 167); SISDYPGDEDISVM (SEQ ID NO: 169); RGPKGFNFNENVQA (SEQ ID NO: 172); QFESTGTIKRIKDN (SEQ ID NO: 175); and GNSGSPVLNSNNEV (SEQ ID NO: 178).
- PYNGWSFKDATGF SEQ ID NO: 165
- AHPNGDKGNGGIYK SEQ ID NO: 167
- SISDYPGDEDISVM SEQ ID NO: 169
- RGPKGFNFNENVQA SEQ ID NO: 172
- QFESTGTIKRIKDN SEQ ID NO: 175)
- GNSGSPVLNSNNEV SEQ ID NO: 178.
- Item 12 The construct of any one of items 1 to 11 , wherein the linker comprises at least four identical or different amino acids selected from the group consisting of glycine, serine, alanine, aspartate, glutamate and lysine.
- Item 14 The construct of any one of items 1 to 13, wherein said X comprises a polyhistidine of 6 to 10 amino acids.
- Item 15 The construct of any one of items 1 to 13, wherein said X is absent.
- Item 16 The construct of any one of items 1 to 15, wherein said Z is absent.
- Item 17 An isolated nucleic acid molecule encoding the construct defined in any one of items 1 to 16.
- Item 18 A vector comprising the isolated nucleic acid defined in item 17.
- Item 19 A host cell comprising the vector defined in item 18.
- Item 20 The cell of item 19, which is a live attenuated form of Staphylococcus aureus.
- Item 21 The cell of item 20, wherein the live attenuated form of Staphylococcus aureus has a stabilized small colony variant (SCV) phenotype.
- SCV small colony variant
- Item 22 The cell of item 21, wherein the live attenuated form of Staphylococcus aureus having a stabilized SCV phenotype is a AhemBA720 S. aureus.
- Item 23 A composition comprising: (A) at least one of the constructs defined in any one of items 1 to 16; at least one of the nucleic acid molecules defined in item 17; at least one of the vectors defined in item 18; or at least one of the cells defined in any one of items 19 to 22; and (B) (i) the polypeptide defined in any one of items 1 to 11; (ii) a live attenuated Staphylococcus aureus; (iii) a pharmaceutically acceptable excipient; (iv) an adjuvant; or (v) a combination of at least two of (i) to (iv).
- Item 24 The composition of item 23, wherein the live attenuated form of Staphylococcus aureus expresses: (a) a polypeptide comprising a SACOL0029 polypeptide as set forth in any one of the sequences depicted in FIG. 24 (SEQ ID NOs: 5 and 121 to 131), a SACOL0264 polypeptide (SEQ ID NO : 185), a SACOL0442 polypeptide as set forth in any one of the sequences depicted in FIG.
- a polypeptide comprising a SACOL0029 polypeptide as set forth in any one of the sequences depicted in FIG. 24 (SEQ ID NOs: 5 and 121 to 131), a SACOL0264 polypeptide (SEQ ID NO : 185), a SACOL0442 polypeptide as set forth in any one of the sequences depicted in FIG.
- Item 25 The composition of item 23 or 24, wherein the live attenuated form of Staphylococcus aureus has a stabilized small colony variant (SCV) phenotype.
- SCV small colony variant
- Item 26 The composition of any one of items 23 to 25, wherein the adjuvant comprises alum, an oil (e.g., emulsified oil, mineral oil), saponin (e.g., Quil-ATM), cyclic-diguanosine-5'-monophosphate (c-di-GMP), polyphosphasine, indolicidin, pathogen-associated molecular patterns (PAMPS) or a combination of at least two thereof.
- an oil e.g., emulsified oil, mineral oil
- saponin e.g., Quil-ATM
- c-di-GMP cyclic-diguanosine-5'-monophosphate
- PAMPS pathogen-associated molecular patterns
- Item 27 A method for preventing and/or treating a Staphylococcal intramammary infection (IMI) in a mammal, said method comprising administrating to said mammal an effective amount of the construct defined in any one of items 1 to 16; of the nucleic acid molecule defined in item 17; of the vector defined in item 18; of the cell defined in any one of items 19 to 22; or of the composition defined in any one of items 23 to 26.
- IMI Staphylococcal intramammary infection
- Item 28 The method of item 27, wherein said Staphylococcal IMI is caused by one or more Staphylococcus aureus strains.
- Item 29 The method of item 27 or 28, wherein said mammal is a cow.
- Item 30 A use of an effective amount of (i) the construct defined in any one of items 1 to 16; (ii) the nucleic acid molecule defined in item 17; (iii) the vector defined in item 18; of the cell defined in any one of items 19 to 22; (iv) the composition defined in any one of items 23 to 26; or (v) a combination of at least two of (i) to (iv), for preventing and/or treating a Staphylococcal intramammary infection (IMI) in a mammal.
- IMI Staphylococcal intramammary infection
- Item 31 The use of item 30, wherein said Staphylococcal IMI is caused by one or more Staphylococcus aureus strains.
- Item 32 The use of item 30 or 31 , wherein said mammal is a cow.
- Item 33 The construct defined in any one of items 1 to 16; the nucleic acid molecule defined in item 17; the vector defined in item 18; the cell defined in any one of items 19 to 22; the composition defined in any one of items 23 to 26 or a combination of at least two thereof, for use in the prevention and/or treatment of a Staphylococcal intramammary infection (IMI) in a mammal.
- IMI Staphylococcal intramammary infection
- Item 34 The construct, nucleic acid molecule, vector, cell, composition or combination of item 33, wherein said Staphylococcal IMI is caused by one or more Staphylococcus aureus strains.
- Item 35 The construct, nucleic acid molecule, vector, cell or composition of item 33 or 34, wherein said mammal Is a cow.
- Item 36 A kit for preventing and/or treating a Staphylococcal intramammary infection (IMI) in a mammal comprising: (A) (i) at least one of the constructs defined in any one of items 1 to 16; (ii) at least one of the nucleic acid molecules defined in item 17; (iii) at least one of the vectors defined in items 18; (iv) at least one of the cells defined in any one of items 19 to 22; or (v) a combination of at least two of (i) to (iv), and (B) (i) the polypeptide defined in any one of items 1 to 11 ; (ii) a live attenuated Staphylococcus aureus; (iii) a pharmaceutically acceptable excipient; (iv) an adjuvant; (v) instructions for using the kit for preventing and/or treating a Staphylococcal intramammary infection (IMI) in a mammal; or (vi) a
- FIGs. 1A-D shows serum total IgG (FIG. 1A), lgG1 (FIG. 1B), and lgG2 (FIG. 1C) titers for the vaccinated (9) and placebo (10) cows for each antigen of the vaccine, namely SACOL0029, SACOL0442, SACOL0720, SACOL1867, SACOL1912, and SACOL2385, four weeks after the second immunization (just before the experimental infection).
- the lgG2/lgG1 ratio is represented for the vaccinated cows.
- FIGs. 1A shows serum total IgG (FIG. 1A), lgG1 (FIG. 1B), and lgG2 (FIG. 1C) titers for the vaccinated (9) and placebo (10) cows for each antigen of the vaccine, namely SACOL0029, SACOL0442, SACOL0720, SACOL1867, SACOL1912, and SACOL2385, four weeks after the second im
- open circles (o) represent data for the vaccinated cows
- black squares ( ⁇ ) represent data for the placebo cows.
- Each symbol represents the titer for one cow.
- Horizontal lines represent the medians: dashed lines represent the medians for the vaccinated cows while continuous lines represent the medians for the placebo cows.
- titers for the vaccinated cows are higher than the titers for the placebo cows (P ⁇ 0.0001).
- symbols represent the ratio lgG2/lgG1 for each cow.
- Horizontal lines represent the medians. The different letters show statistical differences. ***, P ⁇ 0.001.
- FIG. 2. shows antigen dependent proliferation of blood CD4+ cells from the vaccinated cows (9) and placebo cows (10) four weeks after the second immunization for each antigen.
- Each symbol represents the percentage of CD4+ cells that have proliferated for each cow after a week of incubation with the positive control (ConA) or each antigen, namely SACOL0029, SACOL0442, SACOL0720, SACOL1867, SACOL1912, and SACOL2385.
- Open circles (o) represent data for the vaccinated cows
- black squares ( ⁇ ) represent data for the placebo cows.
- Horizontal lines represent the medians: dashed lines represent the medians for the vaccinated cows while continuous lines represent the medians for the placebo cows.
- FIG. 3. shows experimental S. aureus intramammary infections in dairy cows.
- CFU Colony Forming Unit
- Aseptic milk samples were taken at morning milking and Somatic Cell Counts (SCC) were determined by Valacta (Ste-Anne- de-Bellevue, QC).
- Open circles (o) and the dashed line represent data for the vaccinated cows, while the black squares ( ⁇ ) and the continuous line represent data for the placebo cows.
- Each open circle represents the mean of SCC for all the infected quarters of the vaccinated cows (27) while each square represents the mean of SCC for all the infected quarters of the placebo cows (30 quarters).
- somatic cell counts in milk were found to be significantly lower for the vaccinated cows than for the placebo cows (***; PO.001).
- FIG. 4A shows the correlation between CFU and the SCC for each cow
- FIG. 4B shows the correlation between serum lgG1 titer against SACOL0442 and SCC for each cow.
- Each symbol represents data for one cow.
- FIG. 4A it represents the mean of SCC and CFU for the 3 infected quarters from the beginning to the end of the infection.
- FIG. 4B it represents the mean of SCC for the 3 infected quarters from the beginning to the end of the infection and the serum lgG1 titer against SACOL0442 four weeks after the second immunization and just before the experimental infection.
- Open circles represent data for the vaccinated cows and black squares represent data for the placebo cows.
- FIG. 4C the correlation between SCC or CFU relative to milk lgG2 titer against SACOL0029 is shown for each cow ten days after experimental infection (6 weeks after the second immunization). Each symbol represents data for one cow ten days after the experimental infection.
- Aseptic milk samples were taken at morning milking and the viable counts of S. aureus were determined by 10-fold dilutions and plating on tryptic soy agar (TSA) plates while SCC were determined by Valacta (Ste-Anne-de-Bellevue, QC).
- SCC and CFU data for each cow is the mean of the data for the 3 infected quarters ten days after the experimental infection.
- Milk samples for the determination of milk lgG2 titers are the mix of an equivalent volume of milk from the 4 quarters of each cow 10 days after the experimental infection (6 weeks after the second immunization).
- Black squares ( ⁇ ) represent data for the placebo cows
- open circles (o) represent data for the vaccinated cows.
- FIG. 5 shows serum total IgG titers for the vaccinated cows for each antigen of a vaccine comprising the fused antigens SACOL0029 and SACOL1867 (shown as SACOL0029-1867) and the antigens SACOL0442 and SACOL0720.
- the targeted antigens were SACOL0029-1867, SACOL0029, SACOL1867, SACOL0442 and SACOL0720.
- Each open circle represents the titer four weeks after the second immunization for each of the 11 cows whereas each black diamond represents the preimmune titer.
- Horizontal lines represent the medians: solid line for the preimmune serums, dotted line for the samples taken four weeks after immunization. Titers for the vaccinated cows are higher than the titers of the preimmune serums (**, P ⁇ 0.01 ; ***, P ⁇ 0.001 for the other antigens tested).
- FIG. 6 shows serum total IgG titers against the SACOL1867 antigen of mice immunised with the fusion protein (SACOL0029-1867; fusion), a combination of the separate proteins (SACOL0029 + SACOL1867; combination), the SACOL0029 protein only (0029) or SACOL1867 protein only (1867), in equivalent molar quantities.
- Open circles (o ) represent data for preimmune titers
- black squares ( ⁇ ) represent data for the immune titers.
- preimmune sera were mixed equally between the 5 mice of each immunization group to obtain a preimmune pool titer, represented by one open circle per group.
- each square symbol represents the titer for one mouse.
- Horizontal lines represent the medians: black lines represent the medians for the immune serums while dashed lines (and the open circle) represent the medians for the preimmune serums pool.
- Titers for the vaccinated mice in the fusion, combination and 1867 groups are higher than the titers for the preimmune mice (P ⁇ 0.001), and the titers of the mice that received SACOL0029 monovalent antigen only were not found to be significantly different from the titers of the preimmune pool against SACOL1867.
- Statistical significance between immune titers of fusion group versus the combination and the two monovalent vaccines groups is shown (***: P ⁇ 0.001).
- FIG. 7 Serum total IgG (as measured by O.D. 450 nm in the ELISA assay) directed against a B-cell epitope sequence KDGGKYTLESHKELQ (SEQ ID NO: 1) contained in a fragment of the amino acid sequence of SACOL0442 (GEHLPKGNIVINTKDGGKYTLESHKELQKDRENVKINTAD, SEQ ID NO: 2), and obtained from mice immunized with either a fusion of peptides encoded from SACOL0442 and SACOL0720 KDGGKYTLESHKELQ£ ⁇ WK£ 4 KDINKIYFMTDVDLGGPTFVLND (SEQ ID NO: 3) (Group 1) or the peptide KDGGKYTLESHKELQ (SEQ ID NO: 1) encoded from SACOL0442 (Group 2).
- the ELISA assay was carried out with serum samples diluted 100 000 times and a fragment from SACOL0442 (GEHLPKGNIVINTKDGGKYTLESHKELQKDRENVKINTAD, (SEQ ID NO: 2)) was used as the target antigen containing the peptide epitope KDGGKYTLESHKELQ (SEQ ID NO: 1). Individual data are expressed as circles on the graph and the medians by bars. The difference between groups was found statistically significant (P ⁇ 0.0286, Kuskal-Wallis test, GraphPad PrismTM 7.00).
- FIGs. 8A-B Deletion of hemB in ATCC29213 and ⁇ 720 strains of Staphylococcus aureus.
- FIG. 8A The hemB gene in the wild-type (WT) strain ATCC29213 and its isogenic mutant ⁇ 720 was deleted by homologous recombination and replacement with an ermA cassette to create the mutant strains AhemB and A720AhemB, respectively. Thick lines and numbers denote the PCR-amplified regions depicted in B for parental (1) and hemB deleted (2) strains.
- FIG. 8B PCR products of the WT strain and its isogenic AhemB mutant (similar results were obtained with ⁇ 720 and M20khemB strains).
- FIGs. 9A-C show influence of S. aureus AhemB, ⁇ 720, and AhemBA720 mutations on MAC-T cell infectivity.
- FIG. 9A Relative recovery of the initial inoculum found within cells at t 3h for ⁇ 720, and (FIG. 9B) for AhemBA720 mutants.
- FIG. 9C Means and SD of intracellular CFUs for WT and mutants at 12h (left) and 24h (right). A two-way ANOVA and Tukey's multiple comparisons test was used (*: P ⁇ 0.05; ***: P ⁇ 0.001). All values indicate the mean of three independent experiments, each performed in triplicate.
- FIG. 10. shows persistence of S. aureus ATCC 29213 (WT) and isogenic mutants within MAC-T cells over time.
- MAC-T cells were infected with each of the four strains for 3h, then were incubated with lysostaphin an additional 30 min, 12h or 24h and lysed for measurement of intracellular bacteria (CFU).
- CFU intracellular bacteria
- Intracellular bacterial CFUs are expressed as the percentage of the initial inoculum after being transformed in base 10 logarithmic values (Log 10 CFU/ml). Values indicate the mean of three independent triplicate experiments with standard deviations.
- FIGs. 11A-B shows viability of MAC-T cells infected by S. aureus ATCC 29213 (WT) and isogenic mutants.
- MAC-T cells were infected with each of the four strains for 3h, then were incubated with lysostaphin for 12 h (FIG. 11 A) or 24 h (FIG. 11 B).
- MTT viability assays were then performed with a method described in Kubica et al., 2008. The results are reported as percent viability relative to uninfected cells and are expressed as the mean with SD of three independent experiments done in triplicate.
- FIG. 12 Shows murine IMIs with the parental (WT) and AhemBA720 ( ⁇ ) strains. Mice were infected as previously described and glands harvested at the indicated hour (h) or day (D) after infection. Each column represents the median value of bacterial CFU counts for a group of glands, and ranges are indicated by bars. A minimum of six glands per group were used excepted for the WT strain at D7 (2 glands: only one mouse survived). Mortality of mice at specific time points is indicated by arrows. The asterisk indicates the clearance of AhemBA72Q from glands (below the detection limit of 10 CFU/gland).
- FIG. 14 Visual Inflammation of the large R4 and L4 mammary glands 24 h after mouse IMI with S. aureus ATCC 29213 (WT) and the double mutant A720AhemB ( ⁇ ). Mice were infected as described in materials and methods, and control group (PBS) mice received a sterile PBS injection. Pictures show glands that were harvested after 24 h. In each panel, the R4 (left) and L4 (right) glands are shown.
- FIG. 15A Neutrophil infiltration goes back to normal levels after clearance of the double mutant A720AhemB.
- Mice were infected as described in materials and methods, and a control group (PBS) of mice received a sterile PBS injection. Glands were harvested at the indicated times, homogenized and kinetically assayed for MPO activity as described in materials and methods. Columns represent means of MPO Units of a group of 6 glands (4 for the PBS control) adjusted by gram of gland, and error bars illustrate standard deviation. Statistical significance between the Day 4 and 12 groups post infection is shown by ( ⁇ ) symbol. One-Way ANOVA and Tukey's multiple comparison tests were used ( ⁇ : P ⁇ 0.01; NS: No significant difference between groups).
- FIGs. 15B-C Immunization of mice with the live-attenuated double mutant (M20 hemB) stimulates a strong humoral response against S. aureus bovine mastitis isolates of commonly found spa types. Mice were immunized as previously described: serums were collected before priming immunization (Preimmune) and ten days after the boost immunization (Immune).
- FIG. 15B IgG titers rise with increasing doses of the live-attenuated strain M2QG hemB each dot represents the total IgG titer of one mouse against a A720GA/iem8 whole cell extract.
- FIG. 15C Immunization with the live-attenuated mutant M20GLhemB confers IgG titers against components that are shared by mastitis strains of commonly found spa types. Each dot represents the total IgG titer of one mouse against the whole cell extract of the indicated strain. Medians are represented by thick lines for Immune titers and dashed lines for Preimmune titers. All immune titers were compared to their corresponding preimmune titer (P ⁇ 0.0001) and between clinical strains (Two-way ANOVA and Sidak's multiple comparisons test: NS: no significant difference).
- FIG. 16 shows total serum IgG titers against SACOL0029-1867 fusion protein of mice immunised with the protein mix (composed of 5 g of the antigens SACOL0029, SACOL0442, SACOL0720, and the SACOL0029-1867 fusion), 10 5 CFU of the attenuated live strain ⁇ 720 ⁇ ) ⁇ alone or a combination of the protein mix and the HQAhemB strain.
- Open circles (o) represent data for preimmune titers
- black squares ( ⁇ ) represent data for the immune titers. Each symbol represents the titer for one mouse.
- Horizontal lines represent the medians: black lines represent the medians for the immune serums while dashed lines represent the medians for the preimmune serums.
- FIG. 17. shows total serum IgG titers against SACOL0029 of mice immunised with the protein mix (composed of 5 Mg of the antigens SACOL0029, SACOL0442, SACOL0720, and the SACOL0029-1867 fusion), 10 5 CFU of the attenuated live strain A720AhemB alone or a combination of the protein mix and the N720AhemB strain.
- Open circles (o) represent data for preimmune titers
- black squares ( ⁇ ) represent data for the immune titers.
- Each symbol represents the total IgG titer for one mouse.
- Horizontal lines represent the medians: black lines represent the medians for the immune serums while dashed lines represent the medians for the preimmune serums.
- Statistical significance between immune and preimmune titers of the three mice groups is shown (**: P ⁇ 0.01).
- FIG. 18 shows total serum IgG titers against the staphylococcal surface protein ClfA for mice immunised with the SACOL0029, SACOL0442, SACOL0720, and SACOL0029-1867 protein mix, 10 5 CFU of the attenuated live strain ⁇ 720 ⁇ 7 ⁇ alone or a combination of the protein mix and Lll b emB.
- Open circles (o) represent data for preimmune titers
- black squares ( ⁇ ) represent data for the immune titers.
- Each symbol represents the titer for one mouse.
- Horizontal lines represent the medians: black lines represent the medians for the immune serums while dashed lines represent the medians for the preimmune serums.
- Statistical significance between preimmune titers and immune titers is shown (*: P ⁇ 0.05).
- FIG. 19 shows serum ratio of lgG2a/lgG1 titers against the SACOL0029-1867 fusion polypeptide for mice immunised with the protein mix, or the combination of the protein mix and the attenuated N2QNiemB live strain.
- FIG. 20 shows serum ratios against the SACOL0029 antigen.
- Open squares (n) represent data for preimmune titers
- black squares ( ⁇ ) represent data for the immune titers.
- Each symbol represents the titer ratio for one mouse.
- Horizontal lines represent the medians.
- Statistical significance between the protein mix group versus combination group ratios is shown (*: P ⁇ 0.05; **: P ⁇ 0.01).
- FIGs. 21A-J I. SACOL0029 polynucleotides (full length sequence SEQ ID NO: 4) and polypeptides (full length, fragment(s) and variant(s) sequences SEQ ID NOs: 5 to 9). Selected epitopes are shown shaded and/or bolded; II. SACOL0720 polynucleotides (full length sequence SEQ ID NO: 10) and polypeptides (full length, fragments and variant(s) sequences SEQ ID NOs: 11 to 27). Selected epitopes are shown shaded; III.
- SACOL0442 polynucleotides (full length sequence SEQ ID NO: 28) and polypeptides (full length, fragments and variants) sequences SEQ ID NOs: 29 to 36 and 1). Selected epitopes are shown shaded; IV. SACOL1867 polynucleotides (full length sequence SEQ ID NO: 37) and polypeptides (full length, fragment(s) and variant(s) sequences SEQ ID NOs: 38 to 41). Selected epitopes are shown shaded. Predicted transmembrane (http://www.enzim.hu/hmmtop/html/submit.html) domain shown bolded; V.
- SACOL1912 polynucleotide full length sequence SEQ ID NO: 42
- polypeptides full length and variant(s) sequences SEQ ID NOs: 43 to 44
- Selected epitopes are shown shaded (see e.g., SEQ ID NOs: 45-48);
- SACOL2385 polynucleotide full length SEQ ID NO: 49
- polypeptides full length and variant(s) sequences SEQ ID NOs: 50 to 51.
- Selected epitopes are shown shaded (see e.g., SEQ ID NOs: 52-53); VII.
- the double underlined sequence if any, is that of the polyhistidine
- the italicized sequence is the sequence of the SACOL0442 fragment
- the single underlined sequence is the sequence of the linker
- the bolded sequence is the sequence of the SACOL0720 fragment
- VIII. Sequences of linkers SEQ ID NOs: 59 to 70).
- FIGs. 22A-D I. Multiple polynucleotide sequences (SEQ ID NOs: 71-72, 28, 73 to 81) alignment for full length SACOL0442 and orthologues; II. Multiple polypeptide sequences (SEQ ID NOs: 29 and 82 to 92) alignment for full length SACOL0442, orthologues and consensus sequences derived therefrom are presented. In these sequences, “*” denotes that the residues in that column are identical in all sequences of the alignment, ":” denotes that conserved substitutions have been observed, and “.” denotes that semi-conserved substitutions have been observed. Consensus sequences derived from these alignments are also presented wherein X is any amino acid. In the polypeptide sequences, selected epitopes are shown shaded (see e.g., SEQ ID NOs: 1, 34, 93-97).
- FIGs. 23A-K I. Multiple polynucleotide sequences (SEQ ID NOs: 98 to 104, 10, and 105 to 108) alignment for full length SACOL0720 and orthologues; II. Multiple polypeptide sequences (SEQ ID NOs: 11 and 109 to 120) alignment for full length SACOL0720, orthologues. and consensus sequences derived therefrom are presented. In these sequences, “*” denotes that the residues in that column are identical in all sequences of the alignment, ":” denotes that conserved substitutions have been observed, and “.” denotes that semi-conserved substitutions have been observed. Consensus sequences derived from these alignments are also presented wherein X is any amino acid. In the polypeptide sequences, selected epitopes are shown shaded (see e.g., SEQ ID NOs: 22, 19 and 21).
- FIG. 24 Multiple polypeptide sequences (SEQ ID NOs: 5 and 121 to 131) alignment for full length SACOL0029, orthologues. and consensus sequences derived therefrom are presented. In these sequences, “*” denotes that the residues in that column are identical in all sequences of the alignment, ":” denotes that conserved substitutions have been observed, and “.” denotes that semi-conserved substitutions have been observed. Consensus sequences derived from these alignments are also presented wherein X is any amino acid. In the polypeptide sequences, selected epitopes are shown shaded (see e.g., SEQ ID NOs: 132-139). Bolded epitope identified by BCPredTM. Shaded epitopes identified by AAp predictions.
- FIGs. 25A-D I-Multiple polynucleotide sequences (SEQ ID NOs: 140 to 151) alignment for full length SACOL1867 and orthologues; II- Multiple polypeptide sequences (SEQ ID NOs: 152 to 164) alignment for full length SACOL1867, orthologues. and consensus sequences derived therefrom are presented.
- "*" denotes that the residues in that column are identical in all sequences of the alignment
- ":” denotes that conserved substitutions have been observed
- “.” denotes that semi-conserved substitutions have been observed.
- Consensus sequences derived from these alignments are also presented wherein X is any amino acid.
- polypeptide sequences selected epitopes are shown shaded (see e.g., SEQ ID NOs: 165-180) and the end of the signal peptide domain and/or transmembrane domain is marked with a line (separates signal peptide and/or transmembrane domain from secreted form).
- FIG. 26 1 - polynucleotide sequence (SEQ ID NO: 181) for full length SACOL1715 (hemB); and ll-amino acid sequence (SEQ ID NO: 182) for full length SACOL1715 (hemB).
- FIG. 27 1 - polynucleotide sequence (SEQ ID NO: 183) for full length ClfA (NWMN_0756, newman); and ll-amino acid sequence (SEQ ID NO: 184) for full length ClfA.
- the present invention showed that a fusion of two antigens created an unexpected synergy in the immune response.
- the present invention also stabilized the SCV phenotype of a Staphylococcus via hemB (complete deletion thus impairing the possibility of reversion to an invasive phenotype (Tuchscherr, 2011)) enabling its use as a vaccine delivery system.
- HemB is coding for the HemB protein/monomer, which combines to create the porphobilinogen synthase or aminolevulinate dehydratase enzyme [EC 4.2.1.24].
- further attenuation was brought about by inactivation of an antigen of the present invention, namely gene SACOL0720, which has been previously shown to be important for S.
- Headings, and other identifiers e.g., (a), (b), (i), (ii), etc., are presented merely for ease of reading the specification and claims.
- the use of headings or other identifiers in the specification or claims does not necessarily require the steps or elements be performed in alphabetical or numerical order or the order in which they are presented.
- the words “comprising” (and any form of comprising, such as “comprise” and “comprises”), “having” (and any form of having, such as “have” and “has”), "including” (and any form of including, such as “includes” and “include”) or “containing” (and any form of containing, such as “contains” and “contain”) are inclusive or open-ended and do not exclude additional, un-recited elements or method steps.
- the term "vaccine” refers to any compound/agent ("vaccine component"), or combinations thereof, capable of inducing/eliciting an immune response in a host and which permits to treat and/or prevent an infection and/or a disease. Therefore, non-limiting examples of such agent include proteins, polypeptides, protein/polypeptide fragments, immunogens, antigens, peptide epitopes, epitopes, mixtures of proteins, peptides or epitopes as well as nucleic acids, genes or portions of genes (encoding a polypeptide or protein of interest or a fragment thereof) added separately or in a contiguous sequence such as in nucleic acid vaccines, and the like.
- a and B are identical or different and are each independently an antigenic polypeptide (i.e. native, fragment or variant thereof) of the present invention.
- a and/or B is (a) a polypeptide comprising a SACOL0029 polypeptide as set forth in any one of the sequences depicted in FIG. 24 (SEQ ID NOs: 5 and 121 to 131), a SACOL0264 polypeptide (SEQ ID NO : 185), a SACOL0442 polypeptide as set forth in any one of the sequences depicted in FIG. 22D (SEQ ID NOs: 29 and 82 to 92), a SACOL0718 polypeptide (SEQ ID NO : 186), a SACOL0720 polypeptide as set forth in any one of the sequences depicted in FIGs.
- the above polypeptide (a) is the secreted or extracellular fragment of the polypeptide defined above.
- Transmembrane domains can be predicted using, for example, the software TMpredTM (ExPASy) http://www.ch.embnet.org/software/TMPRED_form.html, http://www.psort.org/psortb/index.html http://www.enzim.hu/hmmtop/html/submit.html and/or SignIP 4 ⁇ (http://www.cbs.dtu.dk/services/SignalP).
- TMpredTM and SignallP 4.1 predicted extracellular domain for: SACOL0720: AA 310-508; SACOL0442 AA 36 to 203.
- Enzim predicted a transmembrane domain SACOL1867 (1-40) so that extracellular domain was: AA 41-239 while http://www.psort.org/psortb/index.html predicted that SACOL1867 was an extracellular protein. Since the above-mentioned transmembrane and/or signal peptide domains are putative, the present invention encompasses cases where the antigens presented herein (e.g., SACOL1867) have or not a signal peptide and/or transmembrane domain and encompasses the corresponding extracellular fragments.
- the above-mentioned polypeptide is a polypeptide normally secreted or expressed at the surface of the bacteria (e.g., Staphylococcus aureus).
- GenbankTM accession numbers for S. aureus genes listed herein and their encoded antigenic polypeptides encompassed by the present invention are depicted in Table I below:
- each X in the consensus sequences is defined as being any amino acid, or absent when this position is absent in one or more of the orthologues presented in the alignment.
- each X in the consensus sequences is defined as being any amino acid that constitutes a conserved or semi-conserved substitution of any of the amino acid in the corresponding position in the orthologues presented in the alignment, or absent when this position is absent in one or more of the orthologues presented in the alignment.
- each X refers to any amino acid belonging to the same class as any of the amino acid residues in the corresponding position in the orthologues presented in the alignment, or absent when this position is absent in one or more of the orthologues presented in the alignment. In another embodiment, each X refers to any amino acid in the corresponding position of the orthologues presented in the alignment, or absent when this position is absent in one or more of the orthologues presented in the alignment.
- a and/or B is a polypeptide satisfying any one of these consensuses or a fragment thereof.
- Conservative amino acid mutation may include addition, deletion, or substitution of an amino acid; a conservative amino acid substitution is defined herein as the substitution of an amino acid residue for another amino acid residue with similar chemical properties (e.g., size, charge, or polarity). Such a conservative amino acid substitution may be a basic, neutral, hydrophobic, or acidic amino acid for another of the same group (see e.g., Table II below).
- basic amino acid it is meant hydrophilic amino acids having a side chain pK value of greater than 7, which are typically positively charged at physiological pH.
- Basic amino acids include histidine (His or H), arginine (Arg or R), and lysine (Lys or K).
- neutral amino acid also “polar amino acid”
- hydrophilic amino acids having a side chain that is uncharged at physiological pH, but which has at least one bond in which the pair of electrons shared in common by two atoms is held more closely by one of the atoms.
- Polar amino acids include serine (Ser or S), threonine (Thr or T), cysteine (Cys or C), tyrosine (Tyr or Y), asparagine (Asn or N), and glutamine (Gin or Q).
- hydrophobic amino acid (also “non-polar amino acid”) is meant to include amino acids exhibiting a hydrophobicity of greater than zero according to the normalized consensus hydrophobicity scale of Eisenberg (1984). Hydrophobic amino acids include proline (Pro or P), isoleucine (He or I), phenylalanine (Phe or F), valine (Val or V), leucine (Leu or L), tryptophan (Trp or W), methionine (Met or M), alanine (Ala or A), and glycine (Gly or G).
- “Acidic amino acid” refers to hydrophilic amino acids having a side chain pK value of less than 7, which are typically negatively charged at physiological pH. Acidic amino acids include glutamate (Glu or E), and aspartate (Asp or D).
- a semi-conserved amino acid replaces one residue with another one that has similar steric conformation, but does not share chemical properties.
- Examples of semi-conservative substitutions would include substituting cysteine for alanine or leucine; substituting serine for asparagine; substituting valine for threonine; or substituting proline for alanine.
- the similarity and identity between amino acid or nucleotide sequences can be determined by comparing each position in the aligned sequences.
- Optimal alignment of sequences for comparisons of similarity and/or identity may be conducted using a variety of algorithms, for example using a multiple sequence alignment program/software well known in the art such as ClustalWTM, SAGATM, UGENETM or T-coffeeTM. Examples of multiple sequence alignments are described in the examples below and depicted in FIGs. 21 A to 25.
- a and/or B is (b) a polypeptide encoded by a gene from a same operon as a gene encoding the polypeptide of (a) as defined above.
- SACOL0718 is a gene from the same operon as SACOL0720.
- a and/or B Is (c) a polypeptide comprising an Immunogenic fragment of at least 13 consecutive amino acids of (a) or (b) as defined above.
- An Immunogenic fragment of a protein/polypeptlde Is defined as a part of a protein/polypeptide which is capable of inducing/eliciting an immune response in a host.
- the immunogenic fragment is capable of eliciting the same immune response in kind, albeit not necessarily in amount, as the protein/polypeptide.
- An immunogenic fragment of a protein/polypeptide preferably comprises one or more epitopes of said protein/polypeptide.
- An epitope of a protein/polypeptide is defined as a fragment of said protein/polypeptide of at least about 4 or 5 amino acids in length, capable of eliciting a specific antibody and/or an immune cell (e.g., a T cell or B cell) bearing a receptor capable of specifically binding said epitope.
- an immune cell e.g., a T cell or B cell
- a linear epitope comprises a stretch of consecutive amino acids.
- a conformational epitope is typically formed by several stretches of consecutive amino acids that are folded in position and together form an epitope in a properly folded protein.
- An immunogenic fragment as used herein refers to either one, or both, of said types of epitopes.
- the immunogenic fragment of a protein/polypeptide comprises at least 16 amino acid residues.
- the immunogenic fragment comprises at least 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, 30, 31 , 32, 33, 34, 35, 36, 37, 38, 39, 40, 41 , 42, 43, 44, 45, 46, 47, 48, 49, 50, 51 , 52, 53, 54, 55, 56, 57, 58, 59, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, or 160 consecutive amino acids of the native protein/polypeptide.
- the fragment has at least 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46 ,47, 48, 49, 50, or 50 or more consecutive amino acids of the native protein/polypeptide.
- the immunogenic fragment comprises at least 13 consecutive amino acid residues of the polypeptide.
- fragments encompassed by the present invention comprise immunogenic fragments of at least 13 consecutive amino acids of SACOL029 as shown in FIG.
- fragments encompassed by the present invention include immunogenic fragments comprising at least one epitope of antigenic proteins/polypeptides of the present invention (polypeptide (a) defined above).
- fragments encompassed by the present invention include immunogenic fragments comprising at least one epitope as depicted (shaded) in any one of the antigenic proteins/polypeptides depicted in any one of FIGs. 21 to 25.
- epitopes in a sequence may be predicted with softwares such as BCPredTM, AAPTM, FBCPredTM and ABCPredTM.
- the above-mentioned immunogenic fragment comprises a sequence that is conserved (i.e. identical) in at least two different strains of Staphylococcus aureus. In further embodiments, the above-mentioned immunogenic fragment comprises a sequence that is conserved (i.e. identical) in at least 3, 4, 5, 6, 7, 8, 9 or 10 different strains of Staphylococcus aureus. In another embodiment, the above-mentioned strains of Staphylococcus aureus are COL, RF122, NCTC 8325, JH1 , JH9, Newman, Mu3, Mu50, USA300- FPR3757, N315, MW2 or MSSA476. In an embodiment, the above-mentioned strains of Staphylococcus aureus are associated with bovine mastitis (e.g., RF122).
- the above-mentioned polypeptide, or a polypeptide substantially identical to said polypeptide is expressed in at least two different strains of Staphylococcus aureus.
- Substantially identical as used herein refers to polypeptides having at least 60% of identity, in embodiments at least 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% of identity in their amino acid sequences.
- the polypeptides have at least 60%, 65%, 70%,71%, 72%, 73%, 74%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% of identity in their amino acid sequences with other polypeptides to which they are compared.
- a and/or B is (d) a polypeptide comprising an amino acid sequence at least 60% identical overall to the sequence of the polypeptide of any one of (a) to (c) defined above.
- the amino acid is at least 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to (a) (e.g., over their full length).
- the amino acid is at least 60%, 65%, 70%,71%, 72%, 73%, 74%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% to (a).
- antigens orthologues presented in alignments of FIGs. 21-25 are not identical but present a certain identity with the antigens or fragments to which they are compared. Consensuses presented in these FIGs embody such percent identities.
- a and/or B is (e) a polypeptide comprising an immunogenic variant comprising at least 13 consecutive amino acids of any one of (a) to (d).
- An immunogenic variant of a protein/polypeptide is defined as a part of a protein/polypeptide which is capable of inducing/eliciting an immune response in a host.
- agents proteins/polypeptides, fragments thereof having non- naturally occurring modifications (e.g., immunogenic variants) and which are capable of inducing an immune response specific for the unmodified agent (e.g., capable of inducing the production of antibodies capable of recognizing the unmodified agent) are also within the scope of the term "vaccine component".
- the vaccine components of the present invention can be modified to enhance their activity, stability, and/or bioavailability, and/or to reduce their toxicity.
- Conservative amino acid substitutions may be made, like for example replacement of an amino acid comprising an acidic side chain by another amino acid comprising an acidic side chain, replacement of a bulky amino acid by another bulky amino acid, replacement of an amino acid comprising a basic side chain by another amino acid comprising a basic side chain, and the like.
- a person skilled in the art is well able to generate variants of a protein/polypeptide. This is for instance done through screening of a peptide library or by peptide changing programs.
- An immunogenic variant according to the invention has essentially the same immunogenic properties of said protein in kind, not necessarily in amount.
- An immunogenic variant of a protein/polypeptide of the invention may for instance comprise a fusion protein and/or chimeric protein.
- the biological function of a protein identified herein predicted to be an exotoxin, enterotoxin or superantigen could potentially interfere with the mammalian immune system and antibody production, and/or show some toxicity in the host.
- SACOL0442 polypeptide was used in combination with for example SACOL0720 during immunization, it may be useful to modify the protein or polypeptide used for vaccination so that the biological activity of the exotoxin is decreased.
- it is possible to inactivate the exotoxin with chemicals e.g., formaldehyde).
- nucleic acids e.g., genes or portions of genes added separately or in a contiguous sequence
- carbohydrates such as those found in microbial polysaccharide capsules or biofilms.
- variants include antigens described herein or fragments thereof comprising at either of their N or C terminus or inserted within their antigen sequence, an oligopeptide useful for purification (e.g., affinity purification) or useful as a spacer or linker.
- oligopeptides useful for affinity purification include polyhistidine tags (e.g., 6-10 histidine residues including or not RGS tags (e.g. HHHHHH, RGSHHHHHH, or RGSHHHHHGS).
- the his-tag may also be followed by an amino acid sequence suitable to facilitate a removal of the polyhistidine-tag using endopeptidases.
- the "X" and/or "Z" segments as recited in formula (I) also may comprise such oligopeptide useful for purification and/or sequence suitable to facilitate removal of such oligopeptide useful for purification.
- the immunogenic fragment comprises at least one epitope of the polypeptide (a).
- the immunogenic fragment comprises at least one epitope of the polypeptide (a) as depicted (shaded) in the sequences presented in FIGs. 21-25, In other specific embodiments, the variants are as disclosed in FIGs. 21-25.
- Insertion of linkers between fusion protein domains can increase bioactivity by augmenting distance between domains alleviating potential repulsive forces between different segments (e.g., antigenic fragments) of the construct resulting in improved and/or restored protein folding.
- Different sequences of polypeptide linkers can be used and are known to have distinct properties, such as flexible, rigid or cleavable linkers.
- the present invention encompasses the use of any such linkers including any one of those listed in Chen et. al, Adv Drug Deliv Rev. (2013), 65(10):1357-69 for example. Examples herein provide illustrations of specific linkers that were used (i.e.
- GGGGSGGGGSGGGGS SEQ ID NO: 60
- ERKYK SEQ ID NO: 61
- EAAAKEAAAK SEQ ID NO: 62
- flexible linker structures rich in small hydrophilic amino acids that maintain distance between the two connected domains and improve their folding.
- the Fc comprises a CH2 domain, a CH3 domain and a hinge region.
- the Fc is a constant domain of an immunoglobulin selected from the group consisting of lgG-1 , lgG-2, lgG-3, lgG-3 and lgG-4.
- the Fc is a constant domain of an immunoglobulin lgG-1.
- Linkers may be included between contiguous antigens of the fusion (e.g., 1 linker in fusion comprising two antigens, 2 linkers in fusions comprising three antigens, three linkers in fusions comprising four antigens, etc.).
- linker may be larger and may comprise a fragment crystallizable region (Fc).
- the linker is an amino acid sequence of at least one amino acid or is absent.
- the linker comprises at least three (at least 4, 5, 6,7, 8, 9 or 10) amino acids selected from the group consisting of glycine, serine, alanine, aspartate, glutamate and lysine.
- the linker is (EAAAK)n (SEQ ID NO: 63); (GGGGS)n (SEQ ID NO: 67); or (XPXPXP)n (SEQ ID NO: 69) wherein x is any amino acid; wherein n is any one of 1 to 5, more specifically 1, 2, 3, 4 or 5; EAAAKEAAAK (SEQ ID NO: 62); EAAAKEAAAKEAAAK (SEQ ID NO: 64); GGGGS (SEQ ID NO: 67); GGGGSGGGGS (SEQ ID NO: 68); GGGGSGGGGSGGGGS (SEQ ID NO: 60); XPXPXP (SEQ ID NO: 69), wherein x is any amino acid; XPXPXPXPXPXP (SEQ ID NO: 70), wherein x is any amino acid; ERKYK (SEQ ID NO: 61); ERKYKERKYK (SEQ ID NO: 65); ERKYKERKYK
- X and Z are each independently absent or an amino acid sequence of at least one amino acid. Without being so limited, they may be one or more of amino acids resulting from cloning strategy, amino acids used to facilitate purification of the construct (e.g. polyhistidine), amino acids suitable to facilitate a removal of the purification-tag using endopeptidases.
- amino acids used to facilitate purification of the construct e.g. polyhistidine
- amino acids suitable to facilitate a removal of the purification-tag using endopeptidases e.g. polyhistidine
- any one of X and/or Z may also include the sequence of a further antigen (antigen C, antigen D, etc.) and, optionally that of at least one further linker.
- X and/or Z comprise one or more further antigen(s) and optionally linker(s)
- X and/or Z could be more specifically illustrated as e.g., formula (II) or (III) as follows X'-C-linkeri-A-linker2-B-Z' (II) when the fusion comprises at least 3 antigens; or X'-C-linkeri-A- Iinker2-B-Iinker3-D-Z' (III) when the fusion comprises at least 4 antigens.
- X', Z', linker ⁇ linker, and, the case being, linker are identical or different and are independently defined as are X, Z and linker in formula (I) defined herein.
- the fusion construct comprises 2, 3, 4 or more antigen polypeptides (and, the case being further linkers).
- the fusion construct may be SACOL0029_SACOL0442; SACOL0029_SACOL0720; SACOL0029_SACOL1867; SACOL0029_SACOL0720_SACOL1867; SACOL0029_SACOL1867_SACOL0442; SACOL0029_SACOL0720_SACOL0442; SACOL0442_SACOL0029_SACOL0720; SACOL0442_SACOL0029_SACOL1867; SACOL0442_SACOL1867_SACOL0720; SACOL0720_SACOL0442_SACOL1867; or SACOL0029_SACOL1867_SACOL0720_SACOL0442, or any of the foregoing constructs wherein the antigen polypeptides are in any other order.
- constructs of the present invention may be used as sole immunogenic component of a composition (e.g., vaccine) of the present invention or in combination with one or more further fusion construct(s), immunogenic polypeptide(s), fragment(s) or variant(s) thereof and/or live attenuated bacteria (e.g., S. aureus) (expressing or not fusion constructs and/or polypeptide(s), fragment(s) orvariant(s) thereof).
- a composition e.g., vaccine
- further fusion construct(s), immunogenic polypeptide(s), fragment(s) or variant(s) thereof and/or live attenuated bacteria (e.g., S. aureus) expressing or not fusion constructs and/or polypeptide(s), fragment(s) orvariant(s) thereof).
- the one or more fusion constructs may be any immunogenic fusion construct including a further fusion construct as defined above (see e.g., Example 14).
- the one or more immunogenic polypeptide(s), fragment(s) or variant(s) thereof for use in compositions of the present invention may be any polypeptide(s), fragment(s) or variant(s) that contribute to the immunogenicity of the compositions of the present invention as defined herein.
- such polypeptide(s), fragment(s) or variants) includes (a) a polypeptide comprising a SACOL0029 polypeptide as set forth in any one of the sequences depicted in FIG. 24 (SEQ ID NOs: 5 and 121 to 131), a SACOL0264 polypeptide (SEQ ID NO : 185), a SACOL0442 polypeptide as set forth in any one of the sequences depicted in FIG.
- the live attenuated bacteria for use in compositions of the present invention may be independent from the fusions constructs and/or polypeptide(s), fragment(s) or variant(s) thereof of the present invention, or be the vessel for (i.e. may express) such fusion constructs and/or polypeptide(s), fragment(s) or variants) thereof of the present invention.
- useful live attenuated bacteria in the context of combinations of the present invention include Staphylococcus [e.g., aureus) bacteria having at least one gene contributing to virulence (e.g., ⁇ 720) or contributing to fitness in the host (e.g., a metabolic gene) mutated or deleted.
- Staphylococcus e.g., aureus
- virulence e.g., ⁇ 720
- a metabolic gene mutated or deleted.
- such gene may be any one of the genes identified in Novick 2003, Novick 2008, or Maresso and Schneewind 2008.
- the live attenuated bacteria may be further attenuated by having a stabilized SCV phenotype.
- SCV phenotype refers to bacteria having a dysfunctional oxidative metabolism causing a slow growth, an alteration in the expression of virulence factors, and an ability to be internalized in host cells.
- stabilized SCV phenotype is used to denote an SCV strain retaining the SCV phenotype i.e. unable to produce invasive revertants (i.e., a reversion to the normal growth phenotype). Such stabilized SCV S.
- aureus may be produced by mutating or deleting any one of the genes (e.g., AhemB) listed in Table III below. Without being limited, the present invention encompasses the use of the stabilized SCV S. aureus exemplified in Examples 15 to 25.
- Mutation as used herein includes a substitution, a deletion and/or an insertion of one or more nucleotides that prevents expression of the polypeptide encoded by a gene of the present invention or that prevents expression of a functional polypeptide. In a preferred embodiment, the mutation prevents expression of the polypeptide.
- the two mutations in the same attenuated live or inactivated strain of S. aureus are a deletion or an insertion.
- Attenuated live vaccines i.e. vaccines comprising the bacterium according to the invention in a live attenuated form
- vaccines have the advantage over inactivated vaccines that they best mimic the natural way of infection.
- their replicating abilities allow vaccination with low amounts of bacteria; their number will automatically increase until it reaches the trigger level of the immune system. From that moment on, the immune system will be triggered and will finally eliminate the bacteria.
- IMI bacterial infection
- Table III GenbankTM accession numbers for S. aureus genes associated with SCV phenotype (Kahl, 2014)
- the nucleic acid of the present invention preferably comprises a nucleotide sequence that encodes one or more proteins/polypeptides noted above (or fragments thereof) operably linked to regulatory elements needed for gene expression, such as a promoter, an initiation codon, a stop codon, enhancers, and a polyadenylation signal. Regulatory elements are preferably selected that are operable in the species to which they are to be administered. In specific embodiments, the nucleic acid is as depicted in FIGs. 21 to 25.
- nucleic acid of the invention e.g., nucleic acid vaccine, DNA or RNA vaccine.
- the nucleic acid of the present vaccine can be "naked” DNA or can be operably incorporated in a vector.
- Nucleic acids may be delivered to cells in vivo using methods well known in the art such as direct injection of DNA, receptor-mediated DNA uptake, viral-mediated transfection or non-viral transfection and lipid-based transfection, all of which may involve the use of vectors. Direct injection has been used to introduce naked DNA into cells in vivo (see e.g., Acsadi ef al. (1991) Nature 332:815-818; Wolff ef al. (1990) Science 247:1465-1468).
- a delivery apparatus e.g., a "gene gun" for injecting DNA into cells in vivo may be used.
- Naked DNA may also be introduced into cells by complexing the DNA to a cation, such as polylysine, which is coupled to a ligand for a cell-surface receptor (see for example Wu, G. and Wu, C. H. (1988) J. Biol. Chem. 263: 14621 ; Wilson ef al. (1992) J. Biol. Chem. 267: 963-967; and U.S. Pat. No. 5,166,320). Binding of the DNA-ligand complex to the receptor may facilitate uptake of the DNA by receptor-mediated endocytosis.
- a cation such as polylysine
- a DNA-ligand complex linked to adenovirus capsids which disrupt endosomes, thereby releasing material into the cytoplasm may be used to avoid degradation of the complex by intracellular lysosomes (see for example Curiel ef al. (1991) Proc. Natl. Acad. Sci. USA 88: 8850; Cristiano ef al. (1993) Proc. Natl. Acad. Sci. USA 90:2122-2126).
- Useful delivery vectors include biodegradable microcapsules, immuno-stimulating complexes (ISCOMs) or liposomes, and genetically engineered attenuated live vectors such as cells, viruses or bacteria.
- ISCOMs immuno-stimulating complexes
- liposomes liposomes
- genetically engineered attenuated live vectors such as cells, viruses or bacteria.
- Liposome vectors are unilamellar or multilamellar vesicles, having a membrane portion formed of lipophilic material and an interior aqueous portion.
- the aqueous portion is used in the present invention to contain the polynucleotide material to be delivered to the target cell.
- the liposome forming materials have a cationic group, such as a quaternary ammonium group, and one or more lipophilic groups, such as saturated or unsaturated alkyl groups having about 6 to about 30 carbon atoms.
- a cationic group such as a quaternary ammonium group
- lipophilic groups such as saturated or unsaturated alkyl groups having about 6 to about 30 carbon atoms.
- suitable materials is described in European Patent Publication No. 0187702, and further discussed in U.S. Pat. No.
- Preferred viral vectors include Bacteriophages, Herpes virus, Adenovirus, Polio virus, Vaccinia virus, defective retroviruses, adeno-associated virus (AAV) and Avipox. Methods of transforming viral vector with an exogenous DNA construct are also well described in the art. See Sambrook and Russell, above.
- the nucleic acid may be incorporated in a host such as a host cell in vitro or ex vivo (e.g., an immune cell such as a dendritic cell) or, as indicated above, in an attenuated microbial host (e.g., attenuated S. aureus, SCV, etc., see e.g., Examples 25-26 for instance) by transfection or transformation, and the transfected or transformed cell or microorganism, which expresses the polypeptide (e.g. fusion of multiple antigens or fragments therefor and/or single antigens or fragments thereof) of interest, may be administered to the subject. Following administration, the cell will express the protein or polypeptide of interest (or a variant or fragment thereof) in the subject, which will in turn lead to the induction of an immune response directed against the protein, polypeptide or fragment thereof.
- a host cell in vitro or ex vivo e.g., an immune cell such as a dendritic cell
- Attenuated live bacteria to immunize and/or to deliver specific constructs or antigen mixture of the present invention represents an interesting approach to improve immune responses (Griffiths and Khader, 2014).
- Live attenuated organisms that mimic natural infection stimulate the immune system in a powerful manner, eliciting broad and robust immune responses that produce both serum and mucosal antibodies, and effector and memory T cells which act synergistically to protect against disease (Detmer and Glenting, 2006; Kollaritsch et al, 2000; Pasetti et al., 2011).
- suitable attenuated live bacterial vectors include S.
- aureus expressing the construct of the present invention as sole immunogenic component or in combination with other attenuated live bacteria each expressing another polypeptide, fragment or variant of the present invention (e.g., SACOL0442, SACOL0720 or fragments or variants thereof).
- compositions can be formulated into compositions.
- pharmaceutically acceptable refers to vaccine components (e.g., excipients, carriers, adjuvants) and compositions that are physiologically tolerable and do not typically produce an allergic or similar untoward reaction, such as gastric upset, dizziness and the like, when administered to a subject.
- pharmaceutically acceptable means approved by regulatory agency of the federal or state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, and in humans.
- excipient refers to a diluent, carrier, or vehicle with which the vaccine components of the present invention may be administered.
- Sterile water or aqueous saline solutions and aqueous dextrose and glycerol solutions may be employed as carriers, particularly for injectable solutions.
- the agent of the present invention is administered in combination with an adjuvant or immunostimulant.
- Suitable adjuvant or immunostimulant that may improve the efficacy of components to raise an immune response include but is not limited to oils (e.g., mineral oils, emulsified oil such as MONTANIDETM or EMULSIGENTM-D), metallic salts (e.g., alum, aluminum hydroxide or aluminum phosphate), cationic peptides (Bowdish et al., 2005; Hancock, et al., 2000) such as indolicidin, a cationic peptide produced by the cow's immune cells (Falla et al., 1996), natural and artificial microbial components (e.g., bacterial liposaccharides, Freund's adjuvants, muramyl dipeptide (MDP), cyclic-diguanosine-5'-monophosphate (c-di-GMP), pathogen- associated mole
- oils
- Vaccine components of the invention may be administered in a pharmaceutical composition.
- Pharmaceutical compositions may be administered in unit dosage form. Any appropriate route of administration may be employed, for example, parenteral, subcutaneous, intramuscular, intramammary, intracranial, intraorbital, ophthalmic, intraventricular, intracapsular, intraarticular, intraspinal, intracistemal, intraperitoneal, intranasal, aerosol, or oral administration. Examples of specific routes of administration include parenteral, e.g., intravenous, intradermal, subcutaneous, intramammary; oral (e.g., inhalation); transdermal (topical); transmucosal, and rectal administration.
- compositions and formulations may be employed to provide suitable formulations or compositions to administer such vaccine components with or without adjuvants to subjects.
- Methods well known in the art for making pharmaceutical compositions and formulations are found in, for example, Remington: The Science and Practice of Pharmacy, (20 th ed.) ed. A. R. Gennaro A R., 2000, Lippincott: Philadelphia.
- Formulations for parenteral administration may, for example, contain excipients, sterile water, or saline, polyalkylene glycols such as polyethylene glycol, miglyol, oils of vegetable origin, or hydrogenated napthalenes.
- Biocompatible, biodegradable lactide polymer, lactide/glycolide copolymer, or polyoxyethylene-polyoxypropylene copolymers may be used to control the release of the compounds.
- Other potentially useful parenteral delivery systems for compounds of the invention include ethylenevinyl acetate copolymer particles, osmotic pumps, implantable infusion systems, and liposomes.
- Formulations for inhalation or intramammary injection may contain excipients, for example, lactose, or may be aqueous solutions containing, for example, polyoxyethylene-9-lauryl ether, miglyol, glycocholate and deoxycholate, or may be oily solutions (e.g., paraffin oil) for administration in the form of nasal drops, or as a gel.
- excipients for example, lactose
- oily solutions e.g., paraffin oil
- Therapeutic formulations may be in the form of liquid solutions or suspension; for oral administration, formulations may be in the form of tablets or capsules; and for intranasal formulations, in the form of powders, nasal drops, or aerosols.
- Solutions or suspensions used for parenteral, intradermal, intramammary or subcutaneous application can include the following components: a sterile diluent such as water for injection, saline solution, fixed oils (e.g., paraffin oil), polyethylene glycols, glycerin, propylene glycol, miglyol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; reducing agents such dithiothreitol, buffers such as acetates, citrates or phosphates and agents for the adjustment of tonicity such as sodium chloride or dextrose.
- compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
- suitable carriers include physiological saline, bacteriostatic water, CremophorTM ELTM (BASF, Parsippany, N.J.) or phosphate buffered saline (PBS).
- Oral compositions generally Include an Inert diluent or an edible carrier. They can be enclosed In gelatin capsules or compressed Into tablets or feed.
- the active components can be Incorporated with excipients and used In the form of tablets, troches, capsules or In feed.
- Pharmaceutically compatible binding agents, and/or adjuvant materials can be Included as part of the composition.
- the tablets, pills, capsules, troches and the like can contain any of the following Ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; an excipient such as starch or lactose, a disintegrating agent such as alginic acid, PrimogelTM, or com starch; a lubricant such as magnesium stearate or sterotes; a glidant such as colloidal silicon dioxide; a sweetening agent such as sucrose or saccharin; or a flavoring agent such as peppermint, methyl salicylate, or orange flavoring.
- a binder such as microcrystalline cellulose, gum tragacanth or gelatin
- an excipient such as starch or lactose,
- the vaccine components are delivered In the form of an aerosol spray from pressured container or dispenser which contains a suitable propellant, e.g., a gas such as carbon dioxide, or a nebulizer.
- a suitable propellant e.g., a gas such as carbon dioxide, or a nebulizer.
- Systemic administration can also be by transmucosal or transdermal means.
- penetrants appropriate to the barrier to be permeated are used in the formulation.
- penetrants are generally known in the art, and include, for example, for transmucosal administration, detergents, bile salts, and fusidic acid derivatives.
- Transmucosal administration can be accomplished through the use of nasal sprays or suppositories.
- the active compounds are formulated into ointments, salves, gels, or creams as generally known in the art.
- Liposomal suspensions (including liposomes targeted to specific cell types) can also be used as pharmaceutically acceptable carriers.
- compositions may also contain preserving agents, solubilizing agents, stabilizing agents, wetting agents, emulsifiers, sweeteners, colorants, odorants, salts for the variation of osmotic pressure, buffers, coating agents or antioxidants. They may also contain other therapeutically valuable agents.
- Intravenous, intramuscular, subcutaneous, intramammary or oral administration is a preferred form of use.
- the dosages in which the components of the present invention are administered in effective amounts depend on the nature of the specific active ingredient, the host and the requirements of the subject and the mode of application.
- Polypeptides, nucleic acids and delivery systems of the present invention may be used as antimicrobial agents against Staphylococcal infections including those causing intramammary infection (IMI).
- the Staphylococcal infections are caused by Staphylococcus aureus.
- Passive immunization is the injection of antibodies or antiserum, previously generated against the pathogen (or antigens described herein), in order to protect or cure a recipient animal of an infection or future infection. Protection fades over the course of a few weeks during which time the active immunization with polypeptides, nucleic acids or delivery systems (e.g., as described above) will have time to generate a lasting protective response. Serum for passive immunization can be generated by immunization of donor animals using the polypeptides, nucleic acids or delivery systems, as described herein.
- This serum which contains antibodies against the antigens, can be used immediately or stored under appropriate conditions. It can be used to combat acute infections (e.g., IMI) or as a prophylactic (Tuchscherr ef a/., 2008). Use of antibodies or serums in a passive immunization can be combined with other agents such as an antibiotic to increase the cure rate of an infection currently in progress or to increase protection against an imminent infection.
- Active immunization is administration of the polypeptides, nucleic acids or delivery systems as described herein to a subject.
- the components identified in accordance with the teachings of the present invention have a prophylactic and/or therapeutic value such as they can be used to raise an immune response to prevent and/or combat diseases or conditions, and more particularly diseases or conditions related to microbial infections.
- the terms "prevent/preventing/prevention” or “treat/treating/treatment” as used herein, refer to eliciting the desired biological response, i.e., a prophylactic and therapeutic effect, respectively in a subject.
- the therapeutic effect comprises one or more of a decrease/reduction in the severity, intensity and/or duration of the microbial infection (e.g., staphylococcal infection) or any symptom thereof following administration of the polypeptide, nucleic acid or delivery system (agent/composition of the present invention) of the present invention when compared to its severity, intensity and/or duration in the subject prior to treatment or as compared to that/those in a non-treated control subject having the infection or any symptom thereof.
- a prophylactic effect may comprise a delay in the onset of the microbial infection (e.g., staphylococcal infection) or any symptom thereof in an asymptomatic subject at risk of experiencing the microbial infection (e.g., staphylococcal infection) or any symptom thereof at a future time; or a decrease/reduction in the severity, intensity and/or duration of a microbial infection (e.g., staphylococcal infection) or any symptom thereof occurring following administration of the agent/composition of the present invention, when compared to the timing of their onset or their severity, intensity and/or duration in a non-treated control subject (i.e.
- microbial infection e.g., bacterial infection
- staphylococcal infection e.g., staphylococcal infection
- the agent/composition of the present invention in a therapeutic treatment, is administered after the onset of the microbial infection (e.g., staphylococcal infection) or any symptom thereof.
- the agent/composition of the present invention in a prophylactic treatment, is administered before the onset of the microbial infection (e.g., staphylococcal infection) or any symptom thereof or after the onset thereof but before the progression thereof.
- “decrease” or “reduction” of microbial infection refers to a reduction in a symptom of at least 10% as compared to a control subject (a subject not treated with the agent/composition present invention), in an embodiment of at least 20% lower, in a further embodiment of at least 30% lower, in a further embodiment of at least 40% lower, in a further embodiment of at least 50% lower, in a further embodiment of at least 60% lower, in a further embodiment of at least 70% lower, in a further embodiment of at least 80% lower, in a further embodiment of at least 90% lower, in a further embodiment of 100% (complete inhibition).
- microbial infection e.g., staphylococcal infection
- any symptom thereof refers to a reduction in a symptom of at least 10% as compared to a control subject (a subject not treated with the agent/composition present invention), in an embodiment of at least 20% lower, in a further embodiment of at least 30% lower, in a further embodiment of at least 40% lower, in a further embodiment of at least 50% lower, in
- symptom in reference to a staphylococcal infection refers to any staphylococcal infection symptom such as pain, inflammation, fever, vomiting, diarrhea, fatigue muscle aches, anorexia, dehydration, low blood pressure, cellulitis, impetigo, boil and scalded skin syndrome.
- a staphylococcal IMI symptom refers for example to visual abnormalities in milk (e.g., such as a watery appearance, flakes, clots, malodourous, presence of blood), redness of the udder, swelling in the udder, tenderness in the udder, elevated rectal temperature (>39.0°C), anorexia, decreased rumen motility and fatigue.
- An increase in milk somatic cell counts (SCC) is another staphylococcal IMI. Milk somatic cells include white blood cells such as leukocytes or neutrophils as well as epithelial cells. It is generally agreed that a SCC of >200,000/mL may represent a staphylococcal IMI symptom or is indicative of a staphylococcal IMI.
- Toxicity or efficacy of vaccine components to elicit an immune response can be determined by standard procedures in cell cultures or experimental animals. The dose ratio between toxic and immune stimulatory effects can be measured. Components that exhibit large ratios are preferred. While components that exhibit toxic side effects may be used, care should be taken to design a delivery system in order to minimize potential damage to cells and, thereby, reduce side effects.
- Data obtained from cell culture assays and laboratory animal studies can be used in formulating a range of dosage for use in large animals and humans.
- the dosage of such components lies preferably within a range of administered concentrations that include efficacy with little or no toxicity.
- the dosage may vary within this range depending upon the dosage form employed and the route of administration utilized.
- any suitable amount of the pharmaceutical composition may be administered to a subject.
- the dosages will depend on many factors. Typically, the amount of active ingredient contained within a single dose will be an amount that effectively prevents, or treats IMI without inducing significant toxicity. The skilled artisan will appreciate that certain factors may influence the dosage required to effectively raise an immune response in a subject.
- the therapeutically effective amount of the antigens (e.g., fusion construct) of the present invention may require a series of doses. In general, an amount of about 0.01 mg - 500 mg of antigens including the fusion construct per dose, come into consideration. In a specific embodiment, an amount of about 0.1 mg - 1 mg of antigens including the fusion construct per dose, come into consideration.
- one, two or three doses of the vaccine may favor optimal development of immunity.
- the time between two doses may be as short as three or four weeks but it may be preferred to separate the priming dose (first dose) and the booster dose (second dose) by five, six, seven, eight, nine or ten weeks before stimulating the immune system with the booster shot.
- a subsequent booster shot (a recall shot) may also be optimal to provide a sustainable immunity. This recall could for example occur every half year (6 months), yearly, every two years, every three or every five years.
- sample refers to any solid or liquid sample isolated from a live being. In a particular embodiment, it refers to any solid (e.g., tissue sample) or liquid sample isolated from a mammal, such as milk, a biopsy material (e.g., solid tissue sample), blood (e.g., plasma, serum or whole blood), saliva, synovial fluid, urine, amniotic fluid and cerebrospinal fluid.
- tissue sample e.g., tissue sample
- blood e.g., plasma, serum or whole blood
- saliva e.g., synovial fluid
- urine e.g., amniotic fluid and cerebrospinal fluid.
- sample may be, for example, fresh, fixed (e.g., formalin-, alcohol- or acetone-fixed), paraffin-embedded or frozen prior to analysis of the infectious agent's expression level.
- the term "subject" or "patient” refers to an animal, preferably a mammal such as but not limited to a human, cow (e.g., heifer, multiparous, primiparous, calf), goat, sheep, ewe, ass, horse, pig, chicken, cat, dog, etc. who is the object of treatment, observation or experiment. In a specific embodiment, it is a cow (e.g., at risk of experiencing staphylococcal (e.g., IMI) infection).
- cow e.g., at risk of experiencing staphylococcal (e.g., IMI) infection.
- the terms "subject at risk of experiencing a staphylococcal infection refers to a mammal (e.g., a cow (e.g., heifer, multiparous, primiparous, calf), goat, sheep) that is used for milk or meat production.
- a mammal e.g., a cow (e.g., heifer, multiparous, primiparous, calf), goat, sheep) that is used for milk or meat production.
- the above-mentioned mammal is a cow.
- Examples of methods to measure the amount/level of selected proteins/polypeptides include, but are not limited to: Western blot, immunoblot, enzyme-linked immunosorbent assay (ELISA), radioimmunoassay (RIA), immunoprecipitation, surface plasmon resonance, chemiluminescence, fluorescent polarization, phosphorescence, immunohistochemical analysis, matrix-assisted laser desorption/ionization time-of-flight (MALDI-TOF) mass spectrometry, microcytometry, microarray, microscopy, flow cytometry, and assays based on a property of the protein including but not limited to DNA binding, ligand binding, interaction with other protein partners or enzymatic activity.
- ELISA enzyme-linked immunosorbent assay
- RIA radioimmunoassay
- MALDI-TOF matrix-assisted laser desorption/ionization time-of-flight
- the amount of the polypeptide/protein within the methods of the present invention is detected using antibodies that are directed specifically against the polypeptide/protein.
- antibody encompasses monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments, so long as they exhibit the desired biological activity or specificity.
- Antibody fragments comprise a portion of a full-length antibody, generally the antigen binding or variable region thereof. Interactions between antibodies and a target polypeptide are detected by radiometric, colorimetric, or fluorometric means. Detection of antigen-antibody complexes may be accomplished by addition of a secondary antibody that is coupled to a detectable tag, such as for example, an enzyme, fluorophore, or chromophore.
- Polyclonal antibodies can be prepared by immunizing a suitable subject (e.g., rabbit, goat, mouse, or other mammal) with the polypeptide/protein of interest or a fragment thereof as an immunogen.
- a polypeptide/protein "fragment” "portion” or “segment” is a stretch of amino acid residues of at least about 5, 7, 10, 14, 15, 20, 21 or more amino acids of the polypeptide noted above.
- the antibody titer in the immunized subject can be monitored over time by standard techniques, such as with an enzyme linked immunosorbent assay (ELISA) using immobilized exosomal marker polypeptide or a fragment thereof.
- ELISA enzyme linked immunosorbent assay
- antibody-producing cells can be obtained from the animal, usually a mouse, and can be used to prepare monoclonal antibodies by standard techniques, such as the hybridoma technique originally described by Kohler and Milstein (1975) Nature 256: 495-497, the human B cell hybridoma technique (Kozbor et al. (1983) Immunol. Today 4: 72), the EBV- hybridoma technique (Cole et al. (1985) in Monoclonal Antibodies and Cancer Therapy, ed. Reisfeld and Sell (Alan R. Liss, Inc., New York, NY), pp. 77-96) or trioma techniques.
- the technology for producing hybridomas is well known (see generally Coligan et al., eds. (1994) Current Protocols in Immunology, John Wiley & Sons, Inc., New York, NY).
- a monoclonal antibody can be identified and isolated by screening a recombinant combinatorial immunoglobulin library (e.g., an antibody phage display library) with a polypeptide or a fragment thereof to thereby isolate immunoglobulin library members that bind the polypeptide.
- Kits for generating and screening phage display libraries are commercially available (e.g., the Pharmacia Recombinant Phage Antibody SystemTM, Catalog No. 27-9400-01 ; and the Stratagene SurfZAPTM Phage Display Kit, Catalog No. 240612).
- antibodies directed against one or more of the polypeptides/proteins described herein may be obtained from commercial sources.
- immobilized antibodies specific for the polypeptides/proteins is also contemplated by the present invention and is well known by one of ordinary skill in the art.
- the antibodies could be immobilized onto a variety of solid supports, such as magnetic or chromatographic matrix particles, the surface of an assay place (such as microtiter wells), pieces of a solid substrate material (such as plastic, nylon, paper), and the like.
- An assay strip could be prepared by coating the antibody or a plurality of antibodies in an array on solid support. This strip could then be dipped into the test sample and then processed quickly through washes and detection steps to generate a measurable signal, such as a colored spot.
- polypeptides/proteins may be carried out separately or simultaneously with one test sample. Several polypeptides/proteins may be combined into one test for efficient processing of a multiple of samples.
- polypeptides/proteins could be carried out in a variety of physical formats as well.
- the use of microtiter plates or automation could be used to facilitate the processing of large numbers of test samples.
- single sample formats could be developed to facilitate immediate treatment and diagnosis in a timely fashion.
- Particularly useful physical formats comprise surfaces having a plurality of discrete, addressable locations for the detection of a plurality of different analytes.
- Such formats include protein microarrays, or "protein chips" (see, e.g., Ng and Hag, J. Cell Mol. Med. 6: 329-340, 2002) and capillary devices.
- the above-mentioned level of expression is determined by measuring the level of expression of a mRNA transcribed from said one or more genes.
- mRNA levels are known in the art, and include for example polymerase chain reaction (PCR), reverse transcriptase-PCR (RT-PCR), SAGE, quantitative PCR (q-PCR), Southern blot, Northern blot, sequence analysis, microarray analysis, detection of a reporter gene, or other DNA/RNA hybridization platforms.
- PCR polymerase chain reaction
- RT-PCR reverse transcriptase-PCR
- SAGE quantitative PCR
- q-PCR quantitative PCR
- Southern blot Southern blot
- Northern blot sequence analysis
- microarray analysis detection of a reporter gene, or other DNA/RNA hybridization platforms.
- RNA expression preferred methods include, but are not limited to: extraction of cellular mRNA and Northern blotting using labeled probes that hybridize to transcripts encoding all or part of one or more of the nucleic acids encoding the protein/polypeptide of this invention; amplification of mRNA expressed from one or more of the nucleic acids encoding the proteins/polypeptides of this invention using specific primers, polymerase chain reaction (PCR), quantitative PCR (q-PCR), and reverse transcriptase- polymerase chain reaction (RT-PCR), followed by quantitative detection of the product by any of a variety of means; extraction of total RNA from the biological sample, which is then labeled and used to probe cDNAs or oligonucleotides encoding all or part of the nucleic acids encoding the proteins/polypeptides of this invention, arrayed on any of a variety of surfaces.
- PCR polymerase chain reaction
- q-PCR quantitative PCR
- RT-PCR reverse transcriptase
- kits comprising the components of the present invention.
- the kit can comprise one or more components.
- the components can be packaged in a suitable container and device for administration.
- the kit can further comprise instructions for using the kit.
- the present invention also provides a kit or package comprising reagents useful for administering one or more construct, polypeptide, nucleic acid, vector, host, compositions of the present invention, or a combination of at least two thereof, to a subject in need thereof for treating and/or preventing Staphylococcal IMI.
- kit may further comprise, for example, instructions for the prevention and/or treatment of Staphylococcal IMI, containers, reagents useful for performing the methods.
- the kit may further include where necessary agents for reducing background interference in a test, agents for increasing signal, software and algorithms for combining and interpolating marker values to produce a prediction of clinical outcome of interest, apparatus for conducting a test, calibration curves and charts, standardization curves and charts, and the like.
- EXAMPLE 1 Materials and Methods for Vaccine including SACOL0029, SACOL0442, SACOL0720, SACOL1867, SACOL1912 and SACOL2385 (Vaccine #1)
- antigens that are highly expressed during S. aureus bovine intramammary infection were selected for inclusion in a first bovine vaccine (Vaccine #1). These antigens are: SACOL0029 (GenBankTM accession No.: YPJ84940.1) (SEQ ID NO: 5), SACOL0442 (YPJ85332.1) (SEQ ID NO: 29), SACOL0720 (YPJ85601.1) (SEQ ID NO: 11), SACOL1867 (GenBankTM accession No.: YPJ86695.1) (SEQ ID NO: 38), SACOL1912 (GenBankTM accession No.: YPJ86737.1) (SEQ ID NO: 43), and SACOL2385 (GenBankTM accession No.: YPJ87189.1) (SEQ ID NO: 50).
- His-tagged recombinant proteins of SACOL0029, SACOL1867, SACOL1912, and SACOL2385 were engineered and produced by GenScript, Inc. (Piscataway, NJ). His-tagged recombinant proteins of SACOL0442 and SACOL0720 were engineered and produced using QIA expression technology (pQE30 plasmid) from Qiagen Inc. (Mississauga, ON, Canada), according to the manufacturers' recommendations. See, FIG. 21 I to VI for the his-tagged sequences of the antigens. Examples 2- 5 and FIGs. 1 relate to this vaccine #1.
- the vaccine was composed of 300 pg of each of six antigens (SACOL0029, SACOL0720, SACOL1867, SACOL1912, and SACOL2385) combined with EmulsigenTM-D (MVP Technologies, Omaha, NE), CpG ODN 2007 (TCGTCGTTGTCGTTTTGTCGTT (SEQ ID NO: 194), a pathogen-associated molecular pattern (PAMP), VIDO, Saskatoon, SW) and the cationic peptide indolicidin (ILPWKWPWWPWRR (SEQ ID NO: 195), used to induce the cow's immune response, (Chemprep Inc., Miami, FL). Two immunizations were performed 10 weeks apart, subcutaneously in the neck.
- the plates were washed three times with PBS containing 0.1% TweenTM 20.
- One hundred microliters of horseradish peroxidase (HRP)-conjugated secondary antibody were added to the plate.
- the secondary antibodies used were a goat anti-bovine IgG (Jackson ImmunoResearch Laboratories Inc., West Grove, PA), a sheep anti-bovine lgG1 (AbD Serotec, Raleigh, NC) or a sheep anti-bovine lgG2 (AbD Serotec), diluted 1/50,000 1/20,000 and 1/20,000 respectively in PBS containing 0.5% gelatin and 0.1% TweenTM 20.
- TMB 3,3',5,5'- tetramethylbenzidine
- Detection of total IgG, lgG1 and lgG2 in milk was carried out using the same procedure with few modifications. Milk samples were diluted into PBS containing 0.5% gelatin. The sheep anti-bovine lgG2 was diluted 1/10,000 into PBS containing 0.5% gelatin and 0.1% TweenTM 20.
- PBMCs were isolated from jugular vein blood and labelled with carboxyfluoroscein diacetate, succinimidyl ester (CFDA-SE; Molecular Probes Inc., Eugene, OR) as previously described (Loiselle et al., J. Dairy. Sci. (2009), 92:1900-1912).
- CFDA-SE carboxyfluoroscein diacetate, succinimidyl ester
- the PBMCs (5x10 6 cells per well) were stimulated with the mitogen concanavalin A (ConA; positive control; Sigma Aldrich) at a final concentration of 1 ⁇ g/mL, or each antigen (5 ⁇ g per well) and incubated for 7 days at 37°C. As a negative control, the PBMCs were incubated without any mitogen. Stimulations were performed in duplicate (Ster et al., 2010).
- CD8 coupled with Alexa FluorTM 647 (diluted 1/20, AbD Serotec) and the mouse anti- bovine CD4 coupled with rPE (diluted 1/20, AbD Serotec) were then added. After 20 min of incubation on ice, the cells were washed three times with PBS containing 0.5% BSA. The cells were then suspended in PBS with 0.5% formaldehyde. The percentages of the proliferative populations were determined by flow cytometry on a BD FACS Canto II flow cytometer using the BD FACS Diva software.
- Somatic cell count (SCC) determinations and bacterial analysis of aseptic quarter milk samples were carried out prior to experimental IMI to ensure that all cows were free of IMI.
- Experimental infusion of mammary quarters with bacteria was performed in three (randomly chosen) of the four quarters of each cow after the evening milking according to a procedure previously described (Petitclerc et al., J. Dairy. Sci. (2007), 90: 2778- 2787) with few modifications. Briefly, before inoculation, teats were scrubbed with gauze soaked in 70% ethanol. Teats were allowed to air-dry before intramammary infusion of 3 mL of bacterial suspension (containing 63 CFU) into three of the four quarters.
- EXAMPLE 2 Serum total lgG1 titers following vaccination - vaccine #1
- EXAMPLE 3 Antigen dependent proliferation of blood CD4+ and CD8+ cells following vaccination- vaccine #1
- Example 1 Antigen dependent proliferation of blood CD4+ and CD8+ cells from the vaccinated cows (9) and placebo cows (10) was evaluated as described in Example 1 (Evaluation of the cellular immune response) four weeks after the second immunization (just before the experimental infection) for each antigen.
- the results for CD4+ cells are shown in FIG. 2, in which each symbol represents the percentage of CD4+ cells that have proliferated for each cow after a week of incubation with the positive control (ConA) or each antigen.
- Open circles (o) represent data for the vaccinated cows, black squares ( ⁇ ) represent data for the placebo cows.
- Horizontal lines represent the medians: dashed lines represent the medians for the vaccinated cows while continuous lines represent the medians for the placebo cows.
- CD8+ cells were similar for the vaccinated and placebo cows for all antigens with the exception of the antigen SACOL0720 for with higher proliferation of the CD8+ cells was observed for the vaccinated cows (data not shown). Induction of CD8+ cells also seemed to be important for the resolution of the infection (Riollet et al., 2001; Burton and Erskine, 2003).
- the vaccine was able to stimulate both cellular (CD8+) and humoral (CD4+) immune response.
- the vaccine #1 with its different antigens leads to a balanced immune response.
- EXAMPLE 4 Protection effect of the vaccine as evaluated by following the evolution of somatic cell counts (SCC) ⁇ vaccine #1
- Example 1 Experimental S. aureus IMI infection in dairy cows were carried out and evaluated as described in Example 1 (Experimental S. aureus IMI in dairy cows, Evaluation of the S. aureus viable counts after experimental infections, Evaluation of the somatic cell counts and Statistical analysis).
- Example 1 Experimental S. aureus IMI in dairy cows, Evaluation of the S. aureus viable counts after experimental infections, Evaluation of the somatic cell counts and Statistical analysis.
- 63 CFU of S. aureus were infused into 3 of the 4 quarters of the vaccinated (9) and placebo cows (10) at the evening milking (day 1 , arrow in FIG. 3).
- Aseptic milk samples were taken at morning milking and SCC was determined by Valacta (Ste-Anne-de-Bellevue, QC). The results are shown FIG.
- EXAMPLE 5 Correlation between SCC or the viable counts of S. aureus (CFU) relative to serum or milk IgG titers against specific antigens ⁇ vaccine #1
- a similar analysis was performed with the samples collected at day 10. The same correlations were observed as previously obtained but at this particular time point SCC and S.
- EXAMPLE 6 Materials and methods for vaccine including SACOL0442, SACOL0720, and a fusion between SACOL1867 and SACOL0029 ⁇ vaccine #2
- antigens are polypeptides encoded by: SACOL0029 (GenBankTM accession No.: YP_184940.1) (SEQ ID NO: 5), SACOL1867 (GenBankTM accession No.: YPJ86695.1) (SEQ ID NO: 38), SACOL0442 (SEQ ID NO: 29), and SACOL0720 (SEQ ID NO: 11).
- SACOL0029 and SACOL1867 antigens were included in the form of a fusion. His-tagged recombinant proteins of SACOL0720 and SACOL0029-1867 were engineered and produced by GenScript, Inc.
- a his- tagged recombinant protein of SACOL0442 was engineered and produced using QIA expression technology (pQE30 plasmid) from Qiagen Inc. (Mississauga, ON, Canada), according to the manufacturers' recommendations, (see FIGs. 21D-E and I, and items II, III and VII for SACOL0720, SACOL0442, and SACOL0029-1867 his-tagged sequences).
- the surface protein ClfA (SEQ ID NO: 184), was also additionally produced by using the QIA expression vector by cloning the clfA gene from S. aureus ATCC 25904. The latter recombinant protein was not part of the vaccine composition but was used in ELISA assays to determine IgG titers of sera against other S. aureus proteins such as ClfA.
- the vaccine was composed of 300 pg of each of 3 antigens (SACOL0442 and SACOL0720 as defined in Example 1 and the fusion SACOL0029-1867) and with EmulsigenTM-D (MVP Technologies, Omaha, NE), CpG ODN 2007 (i.e. ⁇ 06 ⁇ 06 ⁇ 6 ⁇ 06 ⁇ (SEQ ID NO: 194) (IDT, Coralville, IA)), and indolicidin (ILPWKWPWWPWRR (SEQ ID NO: 195, GenScript, Piscataway, NJ, Chemprep Inc., Miami, FL) (vaccine #2).
- TMB 3,3',5,5'-tetramethylbenzidine
- EXAMPLE 7 The fusion of antigens induces high antibody titers - vaccine #2
- FIG. 5 shows serum total IgG titers for the vaccinated cows for each antigen of the vaccine (including the fused antigens SACOL0029 and SACOL1867 (labeled SACOL0029-1867 on FIG. 5).
- Each open circle represents the titer four weeks after the second immunization for each cow (just before the experimental infection) whereas each black diamond represents the preimmune titer.
- Horizontal lines represent the medians: solid line for the preimmune serums, dotted line for the samples taken four weeks after immunization. Titers for the vaccinated cows are higher than the titers of the preimmune serums (**, P ⁇ 0.01; ***, P ⁇ 0.001 for the other antigens tested).
- FIG. 5 thus shows that the vaccine composed of three separate antigens, including a fusion peptide, induces a strong immune response in the cows. Furthermore, FIG. 5 surprisingly shows that the fused antigens SACOL0029 and SACOL1867 (fusion SACOL0029-SACOL1867) raised antibody titers that were above those raised by each of the antigen alone (Compare FIG. 1A vs. FIG. 5) and that such fused antigens provide an additional benefit to the vaccine.
- EXAMPLE 8 Materials and methods for vaccine comprising SACOL0029, SACOL1867, and a fusion between SACOL1867 and SACOL0029 ⁇ vaccine #3
- Three antigens derived from two genes that are highly expressed during S. aureus bovine intramammary infection were selected for inclusion in a vaccine. These antigens are: SACOL0029 (GenBankTM accession No.: YP_184940.1) (SEQ ID NO: 5), SACOL1867 (GenBankTM accession No.: YP_186695.1) (SEQ ID NO: 38) and a fusion between SACOL1867 and SACOL0029 (GenBankTM accession No.: YPJ84940.1) (SEQ ID NO: 5). His-tagged recombinant proteins of SACOL0029, SACOL1867 and SACOL0029-1867 were engineered and produced by GenScript, Inc. (Piscataway, NJ). (see FIGs. 21A, F and I, items I, IV and VII for SACOL0029, SACOL1867, and SACOL0029-1867 his-tagged sequences).
- mice The immunogenic properties of recombinant S. aureus proteins encoded by the SACOL0029, SACOL1867 genes and a fusion of SACOL0029 and SACOL1867 were evaluated in mice.
- Four groups of mice received the exact equimolar quantity of proteins, either in a monovalent form (SACOL0029 or SACOL1867) or in a multivalent form (the fusion SACOL0029-1867 or SACOL0029 together with SACOL1867 in combination), were compared.
- SACOL0029, SACOL1867 and the SACOL0029-1867 fusion polypeptides were individually mixed and suspended in PBS to obtain the final equimolar quantity of each antigenic dose in a volume of 100 ⁇ .
- Twenty CD-1 female mice were randomly divided into 4 groups: group A (5 mice) received 5 ⁇ g of the SACOL0029-1867 fusion protein (Fusion); group B (5 mice) received 1.15 ⁇ g of SACOL0029 and 3.69 ⁇ g of SACOL1867 (Combination); group C (5 mice) received 1.15 ⁇ g of SACOL0029 (0029) and group D received 3.69 ⁇ g of SACOL1867 (1867).
- the CD-1 mice were immunized by two subcutaneous injections in the neck two weeks apart. No adverse side effects were observed during the totality of the experimental immunization period. Blood samples were taken just before the first priming injection (preimmune serums) and ten days after the boost immunization (immune serums). The blood aliquots were allowed to clot at room temperature for an hour, centrifuged at 10,000 g for 10 min at 4°C. The sera were harvested and kept at -20°C until subsequent analysis.
- TMB 3,3',5,5'- tetramethylbenzidine
- EXAMPLE 9 The fusion of antigens induces significantly higher antibody titers compared to monovalent antigens or a combination of antigens ⁇ vaccine #3
- FIG. 6 shows that an antigen (SACOL1867) included in a fusion polypeptide (i.e., the SACOL0029-1867 fusion protein) can induce a strong and specific antibody immune response against that specific antigen (SACOL1867), and, more importantly, that this response can be significantly higher than that obtained with a monovalent form of this antigen (SACOL1867 administered alone) or a multivalent combination of individual polypeptides that are part of the fusion (combination of SACOL1867 plus SACOL0029).
- SACOL1867 administered alone
- EXAMPLE 10 Materials and methods for vaccines including SACOL0720 fragments) and/or SACOL442 fragment(s) - vaccines #4-6
- mice Peptides and amino acid fragments were used as antigens for immunization of mice.
- each peptide and amino acid fragment or a combination of such were mixed and suspended in PBS containing 20 % of the EMULSIGEN®-D oil-in-water emulsion adjuvant to obtain a final dose of 100 ⁇ of polypeptide per dose, unless otherwise specified.
- CD-1 female mice were randomly divided into different groups of 3 to 4 animals. Mice were immunized by two subcutaneous injections in the neck two weeks apart. No adverse side effects were observed during the totality of the experimental period.
- the plates were then saturated with PBS containing 5% skim milk powder for 1 h at 37°C.
- PBS containing 5% skim milk powder for 1 h at 37°C.
- One hundred microliters of four-fold or two-fold serial dilutions of the sera in PBS containing 1% milk and 0.025% TweenTM 20 were loaded into the plates and incubated for 1 h at 37°C.
- the plates were then washed three times with PBS containing 0.05% TweenTM 20.
- One hundred microliters of horseradish peroxidase (HRP)-conjugated secondary antibody were then added to the plate.
- HRP horseradish peroxidase
- the secondary antibody used was a goat anti-mouse IgG (Jackson ImmunoResearch Laboratories Inc., West Grove, PA), diluted 1/5000 in PBS containing 1% milk and 0.025% TweenTM 20. After 1 h of incubation at 37°C followed by 3 washes with PBS TweenTM 20 and a final wash with PBS, peroxidase activity was detected with 3,3',5,5'- tetramethylbenzidine (TMB) reagent (KPL Inc., Gaithersburg, MD) according to the manufacturer's recommendations.
- TMB 3,3',5,5'- tetramethylbenzidine
- EXAMPLE 11 Immune response against a fusion of peptides that includes epitopes encoded from sequences SACOL0442 and SACOL0720 - vaccine #4
- the sequence of the fusion of peptides was KDGGKYTLESHKELQEA KEdAA DINKIYFMTDVDLGGPTFVLND (SEQ ID NO: 3) (vaccine #4), where the linker is italicized and the different epitopes are identified in bold characters.
- the epitopes were KDGGKYTLESHKELQ (SEQ ID NO: 1) encoded from SACOL0442, KDINKIYFMTDVDL (SEQ ID NO: 23) encoded from SACOL0720, and DVDLGGPTFVLND (SEQ ID NO: 24) also encoded from SACOL0720.
- the IgG antibodies from the sera harvested from the animals were able to bind amino acid fragments comprising B-cell epitopes from either SACOL0442 (i.e. KDGGKYTLESHKELQ (SEQ ID NO: 1)) and/or SACOL0720 (i.e.
- SACOL0442 (SEQ ID NO: 55) (i.e. polyhistidine version shown in FIG. 21 E, item II);
- SACOL0720 (SEQ ID NO: 25) (i.e. polyhistidine version shown in FIG. 21 D, item III);
- EXAMPLE 12 A fusion of multiple epitopes used as an antigen in immunizations significantly enhances the immune response against a single epitope - vaccine #4
- the sequence of the fusion of peptides was KDGGKYTLESHKELQBAAAKEAA I DINKIYFMTDVDLGGPTFVLND (SEQ ID NO: 3), where the linker is italicized and the different epitopes are identified in bold characters.
- the epitopes were KDGGKYTLESHKELQ (SEQ ID NO: 1) encoded from SACOL0442, KDINKIYFMTDVDL (SEQ ID NO: 23) encoded from SACOL0720, and DVDLGGPTFVLND (SEQ ID NO: 24) also encoded from SACOL0720.
- Sera were collected from animals and tested for the presence of IgG antibodies directed toward an amino acid fragment encoded from SACOL0442 (GEHLPKGNIVINTKDGGKYTLESHKELQKDRENVKINTAD) (SEQ ID NO: 2), which contains the peptide epitope KDGGKYTLESHKELQ (SEQ ID NO: 1).
- EXAMPLE 13 Immune response against a polypeptide fragment of 50 amino acids encoded a variant of SACOL0720 -vaccine #5
- the overall sequence of KDINKIYFMTDVDLGGPTFVLNDKDYERKYKKHIVSQFGFDLKHKKDALA (SEQ ID NO: 27) vary from the native sequence of SACOL0720 by four amino acids in the region linking the epitopes DVDLGGPTFVLND (SEQ ID NO: 24) and QFGFDLKHKKDALA (SEQ ID NO: 21).
- Vaccine #5 can thus be considered being a variant fragment of SACOL0720 or a fusion of epitopes from SACOL0720, which are spaced by linker ERKYK (SEQ ID NO: 61).
- Sera were tested for the presence of IgG antibodies directed toward a fragment of the native protein encoded by SACOL0720 (SEQ ID NO: 25) (i.e. polyhistidine version shown in FIG. 21 D, item II). Both mice vaccinated with the peptide fragment corresponding to the variant sequence of amino acids (or fusion SACOL0720-720) produced antibodies that recognized epitopes in the original sequence of amino acids in an ELISA assay with titers of 1/6400 or higher.
- EXAMPLE 14 Immune response against a combination of fusions (peptide fusion 0442-0720 and polypeptide fusion 0029-1867) - vaccine #6
- a fusion of peptide epitopes encoded from SACOL0442 and SACOL0720 was combined to a polypeptide fusion containing sequences of SACOL0029 and SACOL1867 (see sequence in FIG. 211, Item VII fusions) and was used to vaccinate mice (vaccine #6).
- the peptide fusion 0442-0720 and the polypeptide fusion 1867-0029 were mixed and suspended in PBS containing 20 % of the EMULSIGEN®-D oil-in-water emulsion adjuvant to obtain a final dose of 100 ⁇ g and 5 ⁇ g per dose of the peptide fusion (0442-0720) and the polypeptide fusion (0029-1867), respectively.
- the IgG antibodies from the sera harvested from the animals were able to bind amino acid fragments comprising epitopes from either SACOL0442 or SACOL0720 or to polypeptide SACOL0029 or SACOL1867 in ELISA assays with antibody titers of 1/6400 or higher.
- the fusion of peptides and polypeptides used for immunization and the polypeptides or amino acid fragments used as antibody targets in ELISA assays are shown in the Table IV below.
- the epitopes are in bold and the linker sequence is italicized
- GEHLPKGNIVINTKDGGKYTLESHKELQKDRENVKINTAD fragment encoded by SACOL0442 (SEQ ID NO: 2) (see sequence in FIG. 211, Item VII- fusions);
- KDINKIYFMTDVDLGGPTFVLNDKDYERKYKKHIVSQFGFDLKHKKDALA fragment encoded by SACOL0720 (SEQ ID NO: 27) (see sequence in FIG. 211, Item VII- fusions);
- SACOL0029 (SEQ ID NO: 8) (see his-tagged sequence in FIG. 21A, Item I);
- a combination of fusions e.g., peptide fusion 0442-0720 mixed with the polypeptide fusion 0029-1867
- the obtained immune response includes the production of antibodies that recognize amino acid sequences encoded from either SACOL0442 or SACOL0720 or SACOL0029 or SACOL1867.
- ampicillin ⁇ / ⁇
- chloramphenicol 20 ⁇ ⁇
- erythromycin 10 ⁇ g/ml
- Strain SHY97-3906 (spa t529) was isolated from a case of clinical bovine mastitis that occurred during the lactation period, and CLJ08-3 (spa t359) was originally isolated from a cow with persistent mastitis at dry-off (Allard ef al., 2013).
- Strains Sa3151 (spa t13401) and Sa3181 (spa t267) were obtained from the Canadian Bovine Mastitis and Milk Quality Research Network (CBMMQRN) Mastitis Pathogen Culture Collection (Universite de Montreal, Faculte de medecine veterinaire, St- Hyacinthe, QC, Canada), and were isolated from cases of subclinical intramammary infections.
- CBMMQRN Canadian Bovine Mastitis and Milk Quality Research Network
- AhemB hemBv.EW] isogenic mutant of ATCC29213, SCV phenotype As described herein A720AhemB ftemB::EM r ; isogenic mutant of ⁇ 720, SCV phenotype As described herein E. coli
- CLJ08-3 (spa isolated from a cow with 1359) persistent mastitis at dry- off
- PBT-E pBT2 derivative inserted ErmA cassette As described herein pBT-EhemB pBT2 derivative, for hemB deletion; Ap r Cm r Em r As described herein
- BMEC bovine mammary epithelial cell
- MAC-T Human mammary epithelial cell
- the MAC-T cells were routinely cultured and maintained in Dulbecco's modified Eagle's medium (DMEM) containing 10% heat-inactivated fetal bovine serum (FBS), supplemented with ⁇ / ⁇ insulin (Roche Diagnostics Inc., Laval, Canada) and 1 Mg/ml hydrocortisone (Sigma), and incubated at 37°C in a humidified incubator with 5% CO2.
- DMEM Dulbecco's modified Eagle's medium
- FBS heat-inactivated fetal bovine serum
- ⁇ / ⁇ insulin Gibval, Canada
- 1 Mg/ml hydrocortisone Sigma
- DNA manipulations Recommendations from the manufacturers of kits were followed for genomic DNA isolation (Sigma), plasmid DNA isolation (Qiagen, ON, Canada), extraction of DNA fragments from agarose gels (Qiagen) and purification of PCR products and of digested DNA fragments (Qiagen).
- Primers (IDT® Integrated DNA Technologies; Coraville, Iowa, USA) were designed to add restriction sites upstream and downstream of the amplified products.
- Plasmid constructs were generated using E. coli DH5a (Invitrogen, Burlington, ON, Canada), restriction enzymes (NEB), and the T4 DNA ligase (NEB). Plasmid constructs were validated by restriction digestion patterns and DNA sequencing before electroporation in S. aureus RN4220 (Kreiswirth ef al., 1983) and in final host strains. Plasmids used in Examples 15-25 are listed in Table V above.
- S. aureus ATCC 29213 mutant for gene SACOL0720 was generated using the TargeTronTM Gene Knockout System (with the TargeTronTM Vector pNL9164 (Sigma-Aldrich Canada Ltd.) (Chen et al., 2007) for disruption of bacterial genes by insertion of group II introns (fragment size of approx. 2Kb as previously described (Allard et al., 2013) between nucleotide 803 and 804 in S. aureus ATCC29213. The manufacturer protocols and recommendations were followed.
- aureus ATCC 29213 and were cloned on both sides of the ermA cassette into the plasmid pBT-E.
- the plasmid was then transferred for propagation into S. aureus RN4220 (res-).
- plasmid DNA was isolated and used to transform ATCC 29213 and ⁇ 720 by electroporation.
- bacteria were first grown overnight at 30°C with 10 ⁇ g/ml of erythromycin and a 1 g/ml hemin supplementation (Sigma-Aldrich, ON, Canada).
- Bacteria were then diluted 1 :1000 and grown overnight at 42°C with 2.5 ⁇ g/ml of erythromycin and 1 ⁇ g/ml hemin. This step was repeated twice. Finally, bacteria were diluted 1 :1000 and grown overnight at 42°C without antibiotics. Mutants with the inactivated hemB gene were selected as resistant to erythromycin and sensitive to chloramphenicol, together with an SCV phenotype that can be complemented (i.e., reversion to the normal growth phenotype) by a 5 Mg/ml hemin supplementation on agar plates.
- BMECs bovine mammary epithelial cells
- MAC-T BMECs were used for the characterization of intracellular infectivity and persistence of ATCC 29213 (WT) and its isogenic mutants.
- WT ATCC 29213
- MAC-T BMECs were seeded on treated 24-well plates (Corning) to obtain 30 % confluence.
- Monolayers were grown to confluence under 10% CO2 at 37°C.
- monolayers were washed with DMEM and incubated with invasion medium (IM) (growth medium without antibiotics containing 1% heat-inactivated FBS).
- IM invasion medium without antibiotics containing 1% heat-inactivated FBS.
- the treatment was allowed for 30 min to determine CFUs at 3h of infection, or for an additional 12 or 24 h. Then, following extensive washing with Dulbecco's Phosphate-Buffered Saline (DPBS), monolayers were detached with trypsinization and lysed with 0.05% Triton X-100 and PBS was added to obtain a final 1X concentration. The lysate was serially diluted and plated on TSA for CFUs determination.
- DPBS Dulbecco's Phosphate-Buffered Saline
- BMECs viability and metabolic activity assay To determine the cytotoxic damage inflicted by S. aureus ATCC 29213 (WT) and its isogenic mutants on MAC-T cells, the MTT cell metabolic activity assay that measures the reduction of 3-[4,5-dimethylthiazol-2-yl]-2,5 diphenyl tetrazolium bromide (MTT) into an insoluble formazan product in viable cells, was performed. The assay followed the method of Kubica ef a/. (Kubica ef a/, 2008) with some modifications. Briefly, S.
- aureus infection of cells was achieved as described in the persistence assay, but instead of lysis after 12 h or 24 h, cells were incubated with 100 ⁇ of MTT reagent (5 mg/ml) (Sigma) in DPBS for 2 h at 37 °C. Following this, an acidic solvent solution of 16 % SDS and 40 % PMF, pH 47, was added to lyse the cells and solubilize the crystals of formazan overnight. The samples were read using an Epoch microplate reader (Biotek Instruments Inc.) at a wavelength of 570 nm.
- mice Virulence in the mouse mastitis model.
- the mouse mastitis model of infection is based on that previously described (Brouillette, 2005; Brouillette, 2004). All the experiments performed with mice were approved by the ethics committee on animal experimentation of the Faculte des sciences of the Universite de Sherbrooke and were conducted in accordance with the guidelines of the Canadian Council on Animal Care. Briefly, one hour following removal of 12-14 day-old offspring, lactating CD-1 mice (Charles River Laboratories) were anesthetized with ketamine and xylazine at 87 and 13 mg/kg of body weight, respectively, and mammary glands were inoculated under a binocular.
- Mammary ducts were exposed by a small cut at the near ends of teats and a 100 ⁇ -bacterial suspension containing 10 2 CFUs in endotoxin-free phosphate-buffered saline (PBS, Sigma) was injected through the teat canal using a 32-gauge blunt needle. Two glands (fourth on the right [R4] and fourth on the left [L4] from head to tail) were inoculated for each animal. Mammary glands were aseptically harvested at the indicated times, weighed and visually evaluated for inflammation. Bacterial burden was evaluated after mechanical tissue homogenization in PBS, serial dilutions, and plating on agar for CFU determination. In a second experiment, homogenized glands were conserved for protein extraction for myeloperoxidase (MPO) activity enzymatic assays.
- MPO myeloperoxidase
- Mammary gland protein extraction Total protein extraction from mammary glands was performed by an optimized method previously described (Pulli ef a/., 2013), with some modifications. Mammary tissues were homogenized in a buffer containing a final concentration of potassium phosphate of 50 mM, pH 6.0, and hexadecyltrimethylammonium bromide (CTAB) 50 mM (Sigma). The samples were then sonicated, freeze-thawed in liquid nitrogen, and centrifuged at 2000 g for 15 min at 4°C. Finally, the fat layer was removed by aspiration, and supernatants were saved for a final centrifugation of 15 min at 15 000 g, to discard every cellular debris. Supernatants were distributed in aliquots and kept at -80 0 C until use for the enzymatic assays or protein concentration determination as measured by the bicinchoninic acid method (BCA) Protein Assay Kit (Thermo- Scientific).
- BCA bicinchon
- MPO activity assay Neutrophil recruitment in mammary tissues was measured by quantification of MPO enzyme activity by the o-dianisidine-H2C>2 method, modified for microplates (Bradley, RD. and Rothstein, GPPC, 1982).
- o-dianisidine hydrochloride 0.167 mg/mL
- H2O2 0.1% H2O2
- the MPO activity was measured kinetically with intervals of 15 s over a period of 5 min in an Epoch microplate reader at 460 nm.
- a Unit of MPO was considered as the amount of enzyme that degrades 1 ⁇ of H202/min at 25°C, assuming an absorption coefficient of 11.3 mM -1 cm -1 at 460 nm for o-dianisidine (Zhang ef a/., 2004). Results were expressed as units of MPO per g of gland.
- mice [00230] Mouse immunizations with the live attenuated mutant A720AhemB.
- the immunogenic properties of the attenuated strain L720LhemB administered as a live vaccine were evaluated in mice.
- SC subcutaneous
- the doses of 10 6 , 10 7 and 10 8 CFUs and the SC route were selected for subsequent experiments.
- S. aureus A720 hemB colonies previously grown on BHIA plates were washed twice in ice cold PBS and suspended in PBS containing 15% glycerol, then aliquoted and kept at -80 °C until subsequent use.
- Mice were immunized by two subcutaneous injections of bacteria in PBS (100 ⁇ ), in the neck, two weeks apart. Blood samples were taken just before the priming injection (preimmune serums) and ten days after the boost immunization (immune serums). Blood aliquots were allowed to clot at room temperature for an hour and then centrifuged at 10,000 g for 10 min at 4 °C. The serums were collected and kept at -20 °C until subsequent analysis.
- S. aureus cell extracts Preparation of S. aureus cell extracts. Preparation of S. aureus whole cell extracts was done as previously described with some modifications (Asli ef a/., 2016). Briefly, overnight bacterial cultures were diluted 1/1000 in fresh BHI broth, and then incubated at 35 °C (225 rpm) until an A600nm of - 0.8 was reached. Bacterial cells were centrifuged and pellets were washed in ice-cold PBS twice and suspended with the addition of 5 ml of PBS per ml of pellet.
- Bacterial suspensions were first treated with lysostaphin (Sigma) (100 ⁇ g/ml of pellet) for 1 h at 37°C, and then 3 ⁇ g of protease inhibitor cocktail (Sigma), 8 ⁇ g of RNAse A (Sigma) and 8 ⁇ g of DNAse (Qiagen) per ml of pellet were added to the suspension. After 30 min at room temperature, cells were mechanically disrupted by 3 to 4 passages in a SLM AmincoTM French Pressure cell disrupter, and then centrifuged at 12,000 ⁇ g and 4 °C for 10 min to remove unbroken cells. Supernatant was collected and total protein concentration was determined as previously described with the BCA Protein Assay Kit.
- mice total IgG by ELISA. Detection of serum total IgG against the A720AhemB vaccination strain and each of the bovine IMI isolates was performed to demonstrate and measure the systemic humoral response generated by the immunization of mice.
- Nunc MaxiSorpTM 96-well plates (Thermo Fisher Scientific Inc., Rochester, NY) were coated with 100 ⁇ of each of the whole S. aureus cell extracts (10 Mg/ml diluted in carbonate/bicarbonate buffer, Sigma), and incubated overnight at room temperature.
- the plates were then saturated with PBS containing 5% skim milk powder for 1 h at 37°C, followed by a second blocking step with an addition of 5% porcine serum to prevent unspecific S. aureus protein A interactions.
- PBS 5% skim milk powder
- porcine serum 5% porcine serum
- HRP horseradish peroxidase
- TMB 3,3',5,5'-tetramethylbenzidine
- EXAMPLE 16 Construction of strain S. aureus ATCC 29213 ⁇ 720, AhemB and A720AhemB
- SCVs do not generally generate invasive infections (i.e. additional attenuation) and can be internalized in host cells and therefore will stimulate the cell-mediated immune response in addition to the humoral immune response.
- a stable S. aureus SCV was first created through the deletion of the hemB gene (AhemB) (see Example 15, Generation of live attenuated S. aureus strain ⁇ 720 and AhemB). Further attenuation of this SCV was then achieved by inactivation of gene SACOL0720 ( ⁇ 720) (see Example 15, Generation of AhemBA72Q).
- the double mutant ( ⁇ 720 ⁇ / ⁇ 7 ⁇ ) significantly showed lower internalization and cell destruction compared to that seen with AhemB and ⁇ 720, respectively.
- EXAMPLE 17 Strain S. aureus AhemBA720 is attenuated in MAC-T cells
- the single ⁇ 720 mutant however showed significantly less (P ⁇ 0.01) internalization compared to its parental WT strain (FIG. 9A).
- the reduction in internalization seen in ⁇ 720 was even more pronounced when comparing the double mutant AhemBA720 to AhemB, with a 10-fold reduction of inoculum recovery in this 3-h internalization assay (P ⁇ 0.001 , FIG. 9B).
- This initial reduction of internalized bacterial load was still apparent 12 and 24 h post invasion (PI) for the double mutant strain ⁇ / ⁇ 7 ⁇ 720 (FIG. 9C), as illustrated by the 1-log 10 reduction of CFU/ml at both time points compared to that observed for AhemB (P ⁇ 0.001).
- AhemBA720 and AhemB SCVs cause low BMEC disruption.
- AhemB and AhemBA720 SCV strains showed a greater persistence over time in MAC-T cells, as illustrated by their sustained viability at 12 and 24 h PI in comparison with WT and ⁇ 720 strains (FIGs. 9C and 10).
- the percentage of the inoculum recovered from cells stayed nearly the same from 0 to 24 h after lysostaphin addition, both for the double and single hemB mutants, with a slight increase at 12 h, indicating intracellular growth (FIG. 10). Both strains started to decrease at a slow rate after this time of infection.
- the apparent reduction of intracellular CFUs for the WT and ⁇ 720 strains was concomitant with the visual observation of increasing damage to cell monolayers over time, in comparison to that observed with strains of the SCV phenotypes.
- MAC-T cells viability was also evaluated following infection by each of the four strains studied. MAC-T cell viability was evaluated by the MTT method (Kubica et al., 2008). Results show that both SCV strains ⁇ AhemB and AhemBA720) caused significantly less MAC-T killing in this assay in contrast to the WT and ⁇ 720 strains. When compared to AhemB, the WT strain nearly reduced by half the viability of cells at 12 h (FIG. 11 A: WT: 25.4 %; AhemB: 48.4%). This difference was still apparent at 24 h (FIG. 11 B: 16.3% vs.
- results from the BMEC infection assays provided evidence of an additive effect of both AhemB and ⁇ 720 mutations for the attenuation of the WT strain.
- EXAMPLE 18 Strain S. aureus AhemBA720 is attenuated in a mouse IMI model
- the mutant bacterial burden showed a constant decline until complete bacterial clearance was reached at day 12 (shown by the asterisk on FIG. 12).
- the parental WT strain provoked severe invasive infections compared to the mutant, killing 3 of 9 remaining mice at day 2 and 2 of 3 mice at day 7 (FIG. 12; arrows) before glands could be harvested for those groups.
- Mice surviving the WT infection maintained high viable counts (9 log 10 CFU/g of gland) at day 7, an approximate 5 log 10 difference in bacterial burden compared to the double mutant.
- the attenuated strain AhemBA720 appears ideal for vaccination purposes and for intracellular delivery of antigens. Indeed, the low and temporary internalization of AhemBA720 should help stimulation of cell- mediated immunity, a component of the immune response that is important for defense against S. aureus (Fowler and Proctor, 2014).
- EXAMPLE 19 Inflammatory response to ⁇ 720 ⁇ ? ⁇ / ⁇ and WT strains following IMI
- MPO activity was monitored in M2QkhemB infected glands 4 and 12 days after infection. The level of activity was then compared to levels obtained with PBS injected mice. As illustrated in FIG. 15, the apparent neutrophil presence in mutant infected glands was still high 4 days after infection, with MPO activity ranging from 8 to 21 Units/g of gland. Besides, gland involution, the process by which the lactating gland returns to a morphologically near pre-pregnant state, is ordinarily associated with neutrophilic recruitment that allows phagocytosis of apoptotic cells during the remodelling of tissue (Stein, 2007).
- mice glands are already in that normal state of modification, as indicated by their rapid shrinking.
- MPO levels in mutant infected glands went through a substantial decline between day 4 and 12, (P ⁇ 0.01). MPO levels were then considered to be back to a normal level at day 12 showing no significant difference from that obtained with the PBS-injected mice.
- the inflammatory response of L720 hemB infected glands goes back to normal levels with bacterial clearance (FIG. 15).
- EXAMPLE 20 Immunization with 720G hemB generates a strong humoral response against several S. aureus bovine intramammary infection isolates.
- mice were immunized with different doses of the live vaccine and serum total IgGs were assayed for binding to whole cell extracts of a variety of S. aureus bovine isolates.
- doses of 10 6 , 10 7 and 10 8 CFUs, administered subcutaneously in the neck triggered no adverse effect such as modification of mice behavior or signs of inflammation or necrosis at the immunization site throughout the immunization period.
- immunization using increasing amounts of the live double mutant ATCC 29213 A720AhemB yielded increasing titers of systemic IgG antibodies against a whole cell extract of its own antigens (FIG. 15B).
- the titers of the immune sera were significantly higher than those of the preimmune sera, demonstrating specificity of antibody production against S. aureus antigens present in the live vaccine.
- immunization using increasing amounts of A720AhemB also yielded a consequential rise of antibody titers against a variety S. aureus strains isolated from bovine mastitis, including strains from the major spa types found in Canada and elsewhere in the world (FIG. 15C).
- SCV strain having some residual intracellular capabilities can allow immune cells recruitment without establishing a severe infection.
- Such an SCV strain may act as a live-attenuated vaccine that adequately stimulates the immune response to combat pathogens with intracellular abilities.
- EXAMPLE 21 Material and methods - SACOL0442, SACOL0720, SACOL0029 and a fusion between SACOL1867 and SACOL0029 + attenuated live bacteria (vaccine #7)
- mice The immunogenic properties of recombinant S. aureus proteins encoded by the SACOL0442, SACOL0720, SACOL0029 genes and a fusion of SACOL0029 and SACOL1867 genes in combination, or not, with the live attenuated bacterial strain S. aureus 72QAhemB were evaluated in mice.
- the mice well tolerated a dose of 10 3 , 10 5 , 10 6 , 10 7 and 10 8 CFU by subcutaneous injections in the neck and intramuscular injections in the thigh.
- the dose of 10 5 and the subcutaneous route were selected for the following experiments.
- CD-1 female mice were randomly divided into 3 groups: group 1 (5 mice) received a mixed protein dose (protein Mix); group 2 (5 mice) received an attenuated bacteria (A720hhemB) dose ( ⁇ 720 ⁇ / ⁇ ? ⁇ ); group 3 (6 mice) received a combination of mixed proteins and attenuated bacteria (combination). CD-1 female mice were immunized by two subcutaneous injections in the neck two weeks apart.
- the proteins and bacterial strains doses were diluted in PBS as previously described and administered in a final volume of 100 ⁇ for each group of mice. No adverse side effects were observed during the totality of the experimental immunization period.
- Blood samples were taken just before the first priming injection (preimmune serums) and ten days after the boost immunization (immune serums). The blood aliquots were allowed to clot at room temperature for an hour, centrifuged at 10,000 g for 10 min at 4°C. The sera were harvested and kept at -20°C until subsequent analysis.
- Nunc MaxiSorpTM 96-well plates (Thermo Fisher Scientific Inc., Rochester, NY) were coated with 75 ⁇ of each of the test antigen (6.67 ⁇ / ⁇ diluted in carbonate/bicarbonate buffer, Sigma Aldrich, Oakville, ON) and incubated overnight at room temperature. The plates were then saturated with PBS containing 5% skim milk powder for 1 h at 37°C. One hundred microliters of four-fold serial dilutions of the sera in PBS containing 3% milk and 0.025% TweenTM 20 were loaded into the plates and incubated for 1 h at 37°C. The plates were washed three times with PBS containing 0.05% TweenTM 20.
- HRP horseradish peroxidase
- the secondary antibodies used were a goat anti-mouse IgG, lgG2a and lgG1 (Jackson ImmunoResearch Laboratories Inc., West Grove, PA), diluted 1/5000 respectively in PBS containing 3% milk and 0.025% TweenTM 20. After 1 h of incubation at 37°C followed by 3 washes, peroxidase activity was detected with 3,3',5,5'-tetramethylbenzidine (TMB) reagent (KPL Inc., Gaithersburg, MD) according to the manufacturer's recommendations.
- TMB 3,3',5,5'-tetramethylbenzidine
- EXAMPLE 22 The fusion of antigens and the combination with a live attenuated S. aureus strain induces high antibody titers in mice - vaccine #7
- the antigens and live attenuated S. aureus strain A720AhemB are produced as described in Example 21. Mice are immunized and IgGs detected as described in Example 21.
- EXAMPLE 23 The live attenuated S. aureus strain significantly improves antibody immune response against some specific antigens - vaccine #7
- the antigens and live attenuated S. aureus strain A720AhemB are produced as described in Example 21. Mice are immunized and IgGs detected as described in Example 21.
- EXAMPLE 24 The live attenuated S. aureus strain induces significant antibody titers against additional surface proteins of S. aureus - vaccine #7
- the antigens and live attenuated S. aureus strain A720AhemB are produced as described in Example 21. Mice are immunized and IgGs detected as described in Example 21.
- EXAMPLE 25 The live attenuated S. aureus strain significantly balances the Th1/Th2 immune response - vaccine #7
- the antigens and live attenuated S. aureus strain A720AhemB are produced as described in Example 21.
- Serum lgG2a and lgG1 isotypes against the SACOL0029-1867 fusion protein were detected in serums of vaccinated mice as previously described and the ratio of lgG2a to lgG1 titers of each mouse was determined.
- lgG2a isotype is associated with the Th1 immune response in mice, whereas lgG1 is a marker for the Th2 response.
- SCC somatic cells
- CFU bacterial counts
- Examples 21 to 25 above show that even if a strong antibody response was obtained by the immunization with different antigens (including e.g., SACOL0029-1867 fusion) in a protein mix composition, the immunization of mice with a combination of these antigens with a live attenuated strain significantly improved immune responses against S.
- antigens including e.g., SACOL0029-1867 fusion
- aureus by inducing higher antibody titers against some specific antigens (e.g., SACOL0029), by the production of antibodies against other staphylococcal proteins (e.g., ClfA), and by achieving a more balanced lgG2a/lgG1 ratio, a good marker of a stronger Th1 type response, against the antigens coadministered with the live strain.
- some specific antigens e.g., SACOL0029
- ClfA staphylococcal proteins
- EXAMPLE 26 Expression of recombinant proteins in strain S. aureus AhemBAllO - Vaccines #8, 9, 10 etc.
- aureus AhemBA720 strain Certain protein antigens proposed herein are predicted to be an exotoxin, enterotoxin or superantigen (e.g., SACOL0442) or proteins useful for protection against host defenses (e.g., SACOL0720) and could potentially interfere with the mammalian immune system and antibody production, and/or show some toxicity in the host. Although such interference was not observed with the vaccine composition and formulations described here, it may be useful to modify the protein or polypeptide expressed in the S. aureus AhemBA720 strain so that the cloned genes do not complement its virulence.
- SACOL0442 enterotoxin or superantigen
- SACOL0720 proteins useful for protection against host defenses
- Lysates are then centrifuged for 25 min at 13 000 rpm at 4 °C in order to remove cell debris, before following with protein digestion with trypsin, reduction and alkylation were done by standard procedures before sample Injection for protein detection using the MRM method of LC-MS/MS.
- EXAMPLE 27 Mouse immunization with attenuated strains expressing antigens - Vaccines #8, etc.
- CD-1 female mice are vaccinated by two subcutaneous injections two weeks apart.
- Each of the S. aureus AhemBA720 strains carrying or not one of the constructed expression vectors are diluted in saline and administered in a final volume of 100 ⁇ per dose.
- Group 1 receives a double-mutant strain alone; group 2 receives a double-mutant strain expressing fusion SACOL0029-1867; group 3 receives a double-mutant strain expressing fusion SACOL0029-0442; group 4 receives a double-mutant strain expressing fusion SACOL0029- 0720; group 5 receives a mixture of double-mutant strains, one expressing fusion SACOL0029-1867 and the other expressing fusion SACOL0029-0442; group 6 receives a mixture of double-mutant strains, one expressing fusion SACOL0029-1867 and the other expressing fusion SACOL0029-0720; and group 7 receives a mixture of double-mutant strains.
- Blood samples are taken just before the first injection and twelve days after the second one. The samples are allowed to clot at room temperature for an hour, then centrifuged at 2 000 g for 10 min at 4°C. The supernatants (sera) are harvested and kept at -20°C until subsequent analysis. Mice are euthanized at day 27 and blood is collected by cardiac puncture. The immune sera are recovered, aliquoted and stored as for the pre-immune sera.
- ELISA enzyme-linked immunosorbent assay
- serum polyclonal IgG antibodies directed towards S. aureus whole cells (Wood strain) or specific recombinant proteins.
- Anti-mouse IgG-HRP horseradish peroxidase
- TMB 3,3',5,5'-tetramethylbenzidine
- GraXSR proteins interact with the VraFG ABC transporter to form a five-component system required for cationic antimicrobial peptide sensing and resistance in Staphylococcus aureus. Antimicrob. Agents Chemother. 56:1047-58.
- Garzoni Garzoni, C, P. Francois, A. Huyghe, S. Couzinet, C. Tapparel, Y. Charbonnier, A. Renzoni, S. Lucchini, D.P.
- Bacterial c-di-GMP is an immunostimulatory molecule. J Immunol. 178:2171-2181.
- Staphylocidal action of thrombin-induced platelet microbicidal protein is not solely dependent on transmembrane potential. These include: Staphylocidal Action of Thrombin-induced Platelet Microbicidal Protein Is Not Solely Dependent on Transmembrane Pot 64.
- the toxic shock syndrome exotoxin structural gene is not detectably transmitted by a prophage. Nature 305:709-12.
- Th1-Th17 cells mediate protective adaptive immunity against Staphylococcus aureus and Candida albicans infection in mice.
- Maresso AW Schneewind O. Sortase as a target of anti-infective therapy. Pharmacol Rev. 2008 Mar;60(1):128- 41.
- SigB is a dominant regulator of virulence in Staphylococcus aureus small-colony variants. PLoS One 8:e65018.
- Staphylococcus aureus SigB activity promotes a strong fibronectin-bacterium interaction which may sustain host tissue colonization by small-colony variants isolated from cystic fibrosis patients.
- Staphylococcus aureus SigB activity promotes a strong fibronectin-bacterium interaction which may sustain host tissue colonization by small-colony variants isolated from cystic fibrosis patients.
- SCVs Staphylococcus aureus Small Colony Variants
- Staphylococcus aureus enterotoxin D is secreted in milk and stimulates specific antibody responses in cows in the course of experimental intramammary infection. Infect Immun. 74:3507-3512.
- Staphylococcus aureus small-colony variants are adapted phenotypes for intracellular persistence. J. Infect. Dis. 202:1031-40.
- HMMTOP transmembrane topology prediction server Bioinformatics 17, 849-850.
- Proteomics uncovers extreme heterogeneity in the Staphylococcus aureus exoproteome due to genomic plasticity and variant gene regulation. Proteomics 285(47)36794-36803.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Genetics & Genomics (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Biomedical Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Molecular Biology (AREA)
- Immunology (AREA)
- General Engineering & Computer Science (AREA)
- Zoology (AREA)
- Biotechnology (AREA)
- Wood Science & Technology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Microbiology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Communicable Diseases (AREA)
- Epidemiology (AREA)
- Mycology (AREA)
- Oncology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicinal Preparation (AREA)
Priority Applications (20)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2019542759A JP7181208B2 (ja) | 2016-10-21 | 2017-10-20 | ワクチン構築物およびブドウ球菌感染症に対するその使用 |
| MYPI2019002159A MY195369A (en) | 2016-10-21 | 2017-10-20 | Vaccine Constructs and uses Thereof Against Staphylococcus Infections |
| EP17863203.0A EP3529260A4 (en) | 2016-10-21 | 2017-10-20 | VACCINE CONSTRUCTIONS AND THEIR USES AGAINST STAPHYLOCOCCUS INFECTIONS |
| NZ751880A NZ751880A (en) | 2016-10-21 | 2017-10-20 | Vaccine constructs and uses thereof against staphylococcus infections |
| CN201780064991.1A CN109843910A (zh) | 2016-10-21 | 2017-10-20 | 对抗葡萄球菌感染的疫苗构建体及其用途 |
| CR20190249A CR20190249A (es) | 2016-10-21 | 2017-10-20 | Constructos de vacuna y sus usos contrainfecciones causadas por staphylococcus |
| SG11201901483QA SG11201901483QA (en) | 2016-10-21 | 2017-10-20 | Vaccine constructs and uses thereof against staphylococcus infections |
| CA3037070A CA3037070A1 (en) | 2016-10-21 | 2017-10-20 | Vaccine constructs and uses thereof against staphylococcus infections |
| MX2019004539A MX2019004539A (es) | 2016-10-21 | 2017-10-20 | Constructos de vacuna y sus usos contra infecciones causadas por staphylococcus. |
| AU2017346974A AU2017346974B2 (en) | 2016-10-21 | 2017-10-20 | Vaccine constructs and uses thereof against staphylococcus infections |
| RU2019115303A RU2766354C2 (ru) | 2016-10-21 | 2017-10-20 | Вакцинные конструкты и их применения против инфекций стафилококка |
| BR112019007796A BR112019007796A2 (pt) | 2016-10-21 | 2017-10-20 | construção de vacina e seus usos contra infecções causadas por staphylococcus |
| KR1020197014191A KR20190082229A (ko) | 2016-10-21 | 2017-10-20 | 스타필로코커스 감염에 대한 백신 구성체 및 이의 용도 |
| US16/337,457 US11324815B2 (en) | 2016-10-21 | 2017-10-20 | Vaccine constructs and uses thereof against Staphylococcus infections |
| IL265869A IL265869A (en) | 2016-10-21 | 2019-04-07 | Compound structures and their uses against staphylococcus infections |
| PH12019500843A PH12019500843A1 (en) | 2016-10-21 | 2019-04-16 | Vaccine contructs and uses thereof against staphylococcus infections |
| CONC2019/0005169A CO2019005169A2 (es) | 2016-10-21 | 2019-05-21 | Constructos de vacuna y sus usos contra infecciones causadas por staphylococcus |
| US17/713,683 US20220288183A1 (en) | 2016-10-21 | 2022-04-05 | Vaccine constructs and uses thereof against staphylococcus infections |
| AU2022204585A AU2022204585A1 (en) | 2016-10-21 | 2022-06-28 | Vaccine constructs and uses thereof against staphylococcus infections |
| JP2022183528A JP2023025066A (ja) | 2016-10-21 | 2022-11-16 | ワクチン構築物およびブドウ球菌感染症に対するその使用 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201662411120P | 2016-10-21 | 2016-10-21 | |
| US62/411,120 | 2016-10-21 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/337,457 A-371-Of-International US11324815B2 (en) | 2016-10-21 | 2017-10-20 | Vaccine constructs and uses thereof against Staphylococcus infections |
| US17/713,683 Division US20220288183A1 (en) | 2016-10-21 | 2022-04-05 | Vaccine constructs and uses thereof against staphylococcus infections |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2018072031A1 true WO2018072031A1 (en) | 2018-04-26 |
Family
ID=62018642
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/CA2017/051253 Ceased WO2018072031A1 (en) | 2016-10-21 | 2017-10-20 | Vaccine constructs and uses thereof against staphylococcus infections |
Country Status (24)
| Country | Link |
|---|---|
| US (2) | US11324815B2 (OSRAM) |
| EP (1) | EP3529260A4 (OSRAM) |
| JP (2) | JP7181208B2 (OSRAM) |
| KR (1) | KR20190082229A (OSRAM) |
| CN (1) | CN109843910A (OSRAM) |
| AR (1) | AR109847A1 (OSRAM) |
| AU (2) | AU2017346974B2 (OSRAM) |
| BR (1) | BR112019007796A2 (OSRAM) |
| CA (1) | CA3037070A1 (OSRAM) |
| CL (1) | CL2019001048A1 (OSRAM) |
| CO (1) | CO2019005169A2 (OSRAM) |
| CR (1) | CR20190249A (OSRAM) |
| DO (1) | DOP2019000102A (OSRAM) |
| IL (1) | IL265869A (OSRAM) |
| MX (2) | MX2019004539A (OSRAM) |
| MY (1) | MY195369A (OSRAM) |
| NZ (1) | NZ751880A (OSRAM) |
| PE (1) | PE20191320A1 (OSRAM) |
| PH (1) | PH12019500843A1 (OSRAM) |
| RU (2) | RU2022100889A (OSRAM) |
| SG (2) | SG10201912431XA (OSRAM) |
| TW (1) | TW201819402A (OSRAM) |
| UY (1) | UY37448A (OSRAM) |
| WO (1) | WO2018072031A1 (OSRAM) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2022125928A1 (en) * | 2020-12-11 | 2022-06-16 | Bayer Animal Health Gmbh | Methods and compositions for improved production of an antigen for use in an s. aureus vaccine |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN113777317A (zh) * | 2020-06-09 | 2021-12-10 | 首都医科大学附属北京世纪坛医院 | 尿液主穹隆蛋白及其多肽片段在烧伤中的应用 |
| WO2026014994A1 (ko) * | 2024-07-12 | 2026-01-15 | 주식회사 더윤헬스텍 | 젖소 유방염 유래 대장균 또는 황색 포도알균 변이주 및 이를 포함하는 백신 조성물 |
| US12161970B1 (en) | 2024-08-09 | 2024-12-10 | Jiaxing Research Institute, Zhejiang University | CO2 desorption system suitable for limited space in complex sailing region and flexible control method |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CA2758490A1 (en) * | 2009-04-14 | 2010-10-21 | Novartis Ag | Compositions for immunising against staphylococcus aureus |
| CA2792956A1 (en) * | 2010-03-17 | 2011-09-22 | Socpra - Sciences Et Genie, S.E.C. | Bacterial vaccine components from staphylococcus aureus and uses thereof |
Family Cites Families (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CA1288774C (en) | 1985-01-07 | 1991-09-10 | Deborah A. Eppstein | 1,2-dialkoxy-w-trialkylammonium cationic surfactants |
| US6228844B1 (en) | 1991-11-12 | 2001-05-08 | Vical Incorporated | Stimulating vascular growth by administration of DNA sequences encoding VEGF |
| US7060458B1 (en) | 1997-08-14 | 2006-06-13 | Wyeth | Nucleic acid and amino acid sequences relating to Staphylococcus epidermidis for diagnostics and therapeutics |
| US6380370B1 (en) * | 1997-08-14 | 2002-04-30 | Genome Therapeutics Corporation | Nucleic acid and amino acid sequences relating to Staphylococcus epidermidis for diagnostics and therapeutics |
| US6833134B2 (en) | 2000-06-12 | 2004-12-21 | University Of Saskacthewan | Immunization of dairy cattle with GapC protein against Streptococcus infection |
| GB0107661D0 (en) | 2001-03-27 | 2001-05-16 | Chiron Spa | Staphylococcus aureus |
| MXPA05005045A (es) | 2002-11-12 | 2005-07-01 | Brigham & Womens Hospital | Vacuna de polisacarido para infecciones estafilococicas. |
| CN1569893A (zh) | 2003-07-21 | 2005-01-26 | 中国人民解放军军事医学科学院基础医学研究所 | 金葡菌毒力因子调控蛋白的抗原表位及其模拟表位和用途 |
| RU2419628C2 (ru) | 2004-09-22 | 2011-05-27 | ГлаксоСмитКлайн Байолоджикалз с.а. | Иммуногенная композиция для применения в вакцинации против стафилококков |
| BRPI0516974A (pt) * | 2004-10-21 | 2008-09-30 | Wyeth Corp | composição imunogênica compreendendo um polipeptìdeo; um método para induzir uma resposta imune contra staphylococcus epidermidis; um método para induzir uma resposta imune contra staphylococcus aureus; um método para a detecção e/ou identificação de staphylococcus epidermidis; um método para a detecção e/ou identificação de anticorpos para staphylococcus epidermidis |
| KR100729954B1 (ko) | 2004-12-01 | 2007-06-20 | 주식회사 엘지생명과학 | Sec1 변이 단백질의 제형 및 그것의 제형화 방법 |
| CA2667788A1 (en) | 2006-10-30 | 2008-12-18 | The University Of Western Ontario | Staphylococcus aureus specific anti-infectives |
| EP2411046B1 (en) | 2009-03-23 | 2017-12-06 | Epitopix, LLC | Polypeptides and immunizing compositions containing gram positive polypeptides and methods of use |
| BR112013032774B1 (pt) | 2011-06-19 | 2020-05-05 | Univ New York | composições compreendendo proteína luke isolada ou polipeptídeo da mesma, uma proteína lukd isolada ou polipeptídeo da mesma ou sua combinação, bem como seu uso |
-
2017
- 2017-10-20 BR BR112019007796A patent/BR112019007796A2/pt not_active IP Right Cessation
- 2017-10-20 JP JP2019542759A patent/JP7181208B2/ja active Active
- 2017-10-20 US US16/337,457 patent/US11324815B2/en active Active
- 2017-10-20 RU RU2022100889A patent/RU2022100889A/ru unknown
- 2017-10-20 MY MYPI2019002159A patent/MY195369A/en unknown
- 2017-10-20 TW TW106136089A patent/TW201819402A/zh unknown
- 2017-10-20 CA CA3037070A patent/CA3037070A1/en active Pending
- 2017-10-20 PE PE2019000844A patent/PE20191320A1/es unknown
- 2017-10-20 AU AU2017346974A patent/AU2017346974B2/en not_active Ceased
- 2017-10-20 RU RU2019115303A patent/RU2766354C2/ru active
- 2017-10-20 CR CR20190249A patent/CR20190249A/es unknown
- 2017-10-20 WO PCT/CA2017/051253 patent/WO2018072031A1/en not_active Ceased
- 2017-10-20 SG SG10201912431XA patent/SG10201912431XA/en unknown
- 2017-10-20 CN CN201780064991.1A patent/CN109843910A/zh active Pending
- 2017-10-20 NZ NZ751880A patent/NZ751880A/en unknown
- 2017-10-20 AR ARP170102922A patent/AR109847A1/es not_active Application Discontinuation
- 2017-10-20 SG SG11201901483QA patent/SG11201901483QA/en unknown
- 2017-10-20 KR KR1020197014191A patent/KR20190082229A/ko not_active Abandoned
- 2017-10-20 UY UY0001037448A patent/UY37448A/es unknown
- 2017-10-20 EP EP17863203.0A patent/EP3529260A4/en active Pending
- 2017-10-20 MX MX2019004539A patent/MX2019004539A/es unknown
-
2019
- 2019-04-07 IL IL265869A patent/IL265869A/en unknown
- 2019-04-16 PH PH12019500843A patent/PH12019500843A1/en unknown
- 2019-04-17 MX MX2023001219A patent/MX2023001219A/es unknown
- 2019-04-17 DO DO2019000102A patent/DOP2019000102A/es unknown
- 2019-04-17 CL CL2019001048A patent/CL2019001048A1/es unknown
- 2019-05-21 CO CONC2019/0005169A patent/CO2019005169A2/es unknown
-
2022
- 2022-04-05 US US17/713,683 patent/US20220288183A1/en not_active Abandoned
- 2022-06-28 AU AU2022204585A patent/AU2022204585A1/en not_active Abandoned
- 2022-11-16 JP JP2022183528A patent/JP2023025066A/ja not_active Withdrawn
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CA2758490A1 (en) * | 2009-04-14 | 2010-10-21 | Novartis Ag | Compositions for immunising against staphylococcus aureus |
| CA2792956A1 (en) * | 2010-03-17 | 2011-09-22 | Socpra - Sciences Et Genie, S.E.C. | Bacterial vaccine components from staphylococcus aureus and uses thereof |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2022125928A1 (en) * | 2020-12-11 | 2022-06-16 | Bayer Animal Health Gmbh | Methods and compositions for improved production of an antigen for use in an s. aureus vaccine |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20220288183A1 (en) | Vaccine constructs and uses thereof against staphylococcus infections | |
| Lin | Novel approaches for Campylobacter control in poultry | |
| JP2022078317A (ja) | Staphylococcus aureusに対して免疫化するための組成物 | |
| Bartolini et al. | Recombinant outer membrane vesicles carrying Chlamydia muridarum HtrA induce antibodies that neutralize chlamydial infection in vitro | |
| US11129884B2 (en) | Bacterial vaccine components and uses thereof | |
| US20230256071A1 (en) | Virulent aeromonas vaccines and methods | |
| Chen et al. | Vaccination with a trivalent Klebsiella pneumoniae vaccine confers protection in a murine model of pneumonia | |
| Huang et al. | Biochemical and immunological characterization of truncated fragments of the receptor-binding domains of C. difficile toxin A | |
| HK40007546A (en) | Vaccine constructs and uses thereof against staphylococcus infections | |
| KR101680052B1 (ko) | 탄저병의 예방 또는 치료를 위한 약제학적 조성물 | |
| Simborio et al. | Strategies for the development of an effective vaccine against Brucellosis | |
| Lowry | Identification of novel gene products associated with virulence of Brucella abortus using gene discovery and targeted approaches | |
| EP2892552A1 (en) | An immunogenic composition comprising an inactivated recombinant non-pathogenic bacterium |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 17863203 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2017346974 Country of ref document: AU Date of ref document: 20171020 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 3037070 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2019542759 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112019007796 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 20197014191 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: NC2019/0005169 Country of ref document: CO Ref document number: CR2019-000249 Country of ref document: CR |
|
| ENP | Entry into the national phase |
Ref document number: 2017863203 Country of ref document: EP Effective date: 20190521 |
|
| WWP | Wipo information: published in national office |
Ref document number: NC2019/0005169 Country of ref document: CO |
|
| ENP | Entry into the national phase |
Ref document number: 112019007796 Country of ref document: BR Kind code of ref document: A2 Effective date: 20190417 |
|
| WWP | Wipo information: published in national office |
Ref document number: CR2019-000249 Country of ref document: CR |
|
| WWG | Wipo information: grant in national office |
Ref document number: NC2019/0005169 Country of ref document: CO |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: CR2019-000249 Country of ref document: CR |