WO2018052153A1 - 티오레독신 1에 특이적으로 결합하는 단일클론항체 및 이의 용도 - Google Patents

티오레독신 1에 특이적으로 결합하는 단일클론항체 및 이의 용도 Download PDF

Info

Publication number
WO2018052153A1
WO2018052153A1 PCT/KR2016/010381 KR2016010381W WO2018052153A1 WO 2018052153 A1 WO2018052153 A1 WO 2018052153A1 KR 2016010381 W KR2016010381 W KR 2016010381W WO 2018052153 A1 WO2018052153 A1 WO 2018052153A1
Authority
WO
WIPO (PCT)
Prior art keywords
antigen
seq
antibody
amino acid
acid sequence
Prior art date
Application number
PCT/KR2016/010381
Other languages
English (en)
French (fr)
Inventor
서경훈
강은혜
김일한
정종환
이기세
김미경
Original Assignee
주식회사 이앤에스헬스케어
배재대학교 산학협력단
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 주식회사 이앤에스헬스케어, 배재대학교 산학협력단 filed Critical 주식회사 이앤에스헬스케어
Priority to US16/332,623 priority Critical patent/US11002739B2/en
Priority to CN201680089262.7A priority patent/CN109863176B/zh
Priority to EP16916308.6A priority patent/EP3527589A4/en
Priority to BR112019004901A priority patent/BR112019004901A2/pt
Priority to AU2016422911A priority patent/AU2016422911B2/en
Priority to JP2019515262A priority patent/JP6862542B2/ja
Priority to RU2019110953A priority patent/RU2747929C2/ru
Publication of WO2018052153A1 publication Critical patent/WO2018052153A1/ko

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3015—Breast
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00—Medicinal preparations containing organic active ingredients
    • A61K31/33—Heterocyclic compounds
    • A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/40—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against enzymes
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • G01N33/57407—Specifically defined cancers
    • G01N33/57415—Specifically defined cancers of breast
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565—Complementarity determining region [CDR]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/90—Enzymes; Proenzymes
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/90—Enzymes; Proenzymes
    • G01N2333/902—Oxidoreductases (1.)

Definitions

  • the present invention relates to a monoclonal antibody that specifically binds to thioredoxin 1 and its use, and more particularly to a monoclonal antibody or antigen-binding fragment thereof that specifically binds to thioredoxin 1, the antibody or its Nucleic acid molecules encoding heavy and / or light chains of antigen-binding fragments, recombinant vectors comprising the nucleic acid molecules, host cells, methods for producing the antibody or antigen-binding fragments thereof, kits for diagnosing breast cancer, and providing information for diagnosing breast cancer It is about a method.
  • Thioredoxin is a small redox protein on the order of 12 kDa that undergoes NADPH dependent reduction by thioredoxin reductase, and includes mammalian thioredoxin 1 (Trx1) and thioredoxin 2 (Trx2).
  • Thioredoxin acts as a growth factor, removes hydrogen peroxide that is toxic in cells, binds DNA to important elements involved in ribonucleotide reductase and transcriptional activity in bacteria, and is involved in transcription in eukaryotic cells. It affects the activity of the factor, nuclear transcription factor kB (NF-kB).
  • NF-kB nuclear transcription factor kB
  • thioredoxin plays an important role in regulating cancer cell growth by affecting apoptosis and tumors, and by breaking the disulfide bonds of other oxidized proteins, it helps to have a reduced activity.
  • Thioredoxin 1 and 2 enzymes have an effect on cell death by removing nitric oxide of cysteine amino acids in mammalian cells and of potential importance in many diseases, including inflammatory diseases, heart attacks, and cancer.
  • immunohistochemical analysis using anti-thioredoxin antibodies shows the expression of thioredoxin in human cancer tissues including liver, colon, pancreas and cervix, which expression is likely to lead to thioredoxin in tumorigenesis. Point to.
  • thioredoxin 1 was expressed in low breast tissue but very high in breast cancer tissue. Oredoxin 1 proved to be useful as a marker for diagnosing breast cancer (Korean Patent No. 10-1058230).
  • Another object of the present invention is to provide a nucleic acid molecule encoding the heavy and / or light chain of the monoclonal antibody or antigen-binding fragment thereof.
  • Still another object of the present invention is to provide a recombinant vector comprising the nucleic acid molecule.
  • Another object of the present invention to provide a host cell comprising the recombinant vector.
  • Still another object of the present invention is to provide a method for producing a monoclonal antibody or antigen-binding fragment thereof that specifically binds thioredoxin 1, comprising culturing the host cell.
  • Another object of the present invention is to provide a breast cancer diagnostic kit comprising the aforementioned monoclonal antibody or antigen-binding fragment thereof.
  • the present invention provides a light chain variable region comprising a light chain CDR1 consisting of an amino acid sequence of SEQ ID NO: 1, a light chain CDR2 consisting of an amino acid sequence of SEQ ID NO: 2 and a light chain CDR3 consisting of an amino acid sequence of SEQ ID NO: 3, And a heavy chain variable region comprising a heavy chain CDR1 consisting of an amino acid sequence of SEQ ID NO: 4, a heavy chain CDR2 consisting of an amino acid sequence of SEQ ID NO: 5, and a heavy chain CDR3 consisting of an amino acid sequence of SEQ ID NO: 6 It provides a monoclonal antibody or antigen-binding fragment thereof that binds to.
  • the antibody may comprise a light chain variable region consisting of the amino acid sequence of SEQ ID NO: 13 and a heavy chain variable region consisting of the amino acid sequence of SEQ ID NO: 14.
  • the antibody may comprise a light chain consisting of the amino acid sequence of SEQ ID NO: 17 and a heavy chain consisting of the amino acid sequence of SEQ ID NO: 18.
  • the present invention also provides a light chain variable region comprising a light chain CDR1 consisting of an amino acid sequence of SEQ ID NO: 7, a light chain CDR2 consisting of an amino acid sequence of SEQ ID NO: 8, and a light chain CDR3 consisting of an amino acid sequence of SEQ ID NO: 9, and an amino acid of SEQ ID NO: 10
  • Monoclonal antibody that specifically binds to thioredoxin 1, comprising a heavy chain CDR1 consisting of a heavy chain CDR1 consisting of a sequence, a heavy chain CDR2 consisting of an amino acid sequence of SEQ ID NO: 11, and a heavy chain CDR3 consisting of an amino acid sequence of SEQ ID NO: 12 Or antigen binding fragments thereof.
  • the antibody may comprise a light chain variable region consisting of the amino acid sequence of SEQ ID NO: 15 and a heavy chain variable region consisting of the amino acid sequence of SEQ ID NO: 16.
  • the antibody may comprise a light chain consisting of the amino acid sequence of SEQ ID NO: 19 and a heavy chain consisting of the amino acid sequence of SEQ ID NO: 20.
  • the antibody may comprise an IgG1 heavy chain and kappa ( ⁇ ) light chain.
  • the antigen binding fragment may be Fab, F (ab '), F (ab') 2 , Fv or a single chain antibody molecule.
  • the antibody may be a chimeric antibody, a humanized antibody or a human antibody.
  • the present invention also provides nucleic acid molecules encoding the heavy and / or light chains of the aforementioned antibodies or antigen-binding fragments thereof.
  • the nucleic acid molecule encoding the light chain may be composed of the nucleotide sequence of SEQ ID NO: 21 or the nucleotide sequence of SEQ ID NO: 23.
  • the nucleic acid molecule encoding the heavy chain may be composed of the nucleotide sequence of SEQ ID NO: 22 or the nucleotide sequence of SEQ ID NO: 24.
  • the present invention also provides a recombinant vector comprising both a nucleic acid molecule encoding the heavy chain, a nucleic acid molecule encoding the light chain or a nucleic acid molecule encoding the heavy and light chain.
  • the present invention also provides a method for producing a monoclonal antibody or antigen-binding fragment thereof that specifically binds thioredoxin 1, comprising culturing the host cell and the host cell comprising the recombinant vector.
  • the present invention also provides a breast cancer diagnostic kit comprising the above-described antibody or antigen-binding fragment thereof.
  • the kit may be an Enzyme Linked Immunosorbent Assay (ELISA) kit.
  • ELISA Enzyme Linked Immunosorbent Assay
  • the ELISA may be any one selected from the group consisting of direct ELISA, indirect ELISA, direct sandwich ELISA and indirect sandwich ELISA.
  • the invention also comprises the steps of (a) contacting the monoclonal antibody or antigen-binding fragment thereof of any one of claims 1 to 4 with a biological sample isolated from a subject suspected of breast cancer; (b) measuring the expression level of thioredoxin 1 protein bound to a monoclonal antibody or antigen-binding fragment thereof in the biological sample through antigen-antibody complex formation; And (c) comparing the expression level of the thioredoxin 1 protein measured in step (b) with the control group and determining the breast cancer patient if the expression level of the protein is higher than that of the control group. It provides a method for providing information necessary for diagnosing breast cancer.
  • the present invention further comprises the steps of: (a) coating a solid support with the monoclonal antibody or antigen-binding fragment thereof of claim 2, 4 or 6; (b) applying a biological sample isolated from the individual suspected of breast cancer to the coated solid support; (c) removing the unbound sample; (d) applying the monoclonal antibody or antigen-binding fragment thereof of claim 1, 3 or 5 to a solid support; (e) removing unbound monoclonal antibodies or antigen binding fragments thereof; (f) measuring the expression level of thioredoxin 1 protein; And (g) comparing the expression level of the thioredoxin 1 protein measured in step (f) with the control group, and determining the breast cancer patient if the expression level of the protein is higher than that of the control group. It provides a method for providing information necessary for diagnosing breast cancer.
  • the expression level of the thioredoxin 1 protein is Western blot, ELISA, sandwich ELISA, radioimmunoassay, radioimmunoproliferation method, oukteroni immune diffusion method, immunoprecipitation assay, complement fixation assay It can be measured by any one method selected from the group consisting of any one or more of the method, immunochromatography, FACS and protein chip method.
  • the isolated biological sample may be any one or more selected from the group consisting of whole blood, serum, plasma, breast tissue and breast cells.
  • antigen refers to a molecule or portion of a molecule that can be bound by an antibody and can also be used in an animal to produce an antibody that can also bind to an epitope of an antigen.
  • the antigen may have one or more epitopes.
  • antibody refers to immunity capable of recognizing and binding to specific targets or antigens, such as carbohydrates, polynucleotides, lipids, polypeptides, etc., via one or more antigen recognition sites, located in the variable region of an immunoglobulin molecule. Globulin molecule.
  • antibody refers to monoclonal antibodies; Polyclonal antibodies; “Antigen binding fragments” of antibodies that possess the ability to specifically bind to a particular antigen (eg, Trx1), such as Fab, Fab ', F (ab') 2 , Fd, Fv, Fc, and the like; Isolated complementarity determining regions (CDRs); Bispecific antibodies; Heterozygous antibodies, mutants thereof; Fusion proteins with antibodies, or antigen-binding fragments thereof (eg, domain antibodies); Single chain (ScFv) and single domain antibodies (eg, shark and camelid antibodies); Maxibody, minibody, intrabody, diabody, triabody, tetrabody, v-NAR and bis-scFv; Humanized antibodies; Chimeric antibodies; And all other modified conformations of immunoglobulin molecules including antigen recognition sites of the required specificity (including, but not limited to, glycosylation variants of antibodies, amino acid sequence variants of antibodies and covalent
  • Antibodies or polypeptides that "specifically bind" with a particular target or antigen are terms well understood in the art, and methods for determining such specific binding are also well known in the art. It is. Certain molecules are shown to exhibit "specific binding” when they react or associate with a particular cell or substance more frequently, more quickly, with greater persistence and / or with greater affinity than with another cell or substance. Is considered. Certain antibodies “specifically bind” to specific targets or antigens when they bind with greater affinity, binding activity, faster and / or greater persistence than binding other substances.
  • binding affinity is intended to refer to the equilibrium dissociation constant of a particular antigen-antibody interaction.
  • K D is the ratio of the dissociation rate (also called “breakaway rate” or “k d ”) to binding rate, or “operating rate” or "k a (association rate constant)”. Therefore, K D is k d / k a , which is expressed as molar concentration (M). It is concluded that the smaller the K D , the stronger the binding affinity. Therefore, 1 ⁇ M of K D indicates weak binding affinity compared to 1 nM of K D.
  • K D values for antibodies can be determined using methods well established in the art. One method of determining the K D of an antibody is to use surface plasmon resonance, typically using a biosensor system, such as a Biacore® system.
  • vector includes nucleic acid molecules capable of carrying other linked nucleic acids.
  • plasmid refers to a circular double stranded DNA loop into which additional DNA segments can be bound.
  • viral vector Another form of the vector is a viral vector, wherein additional DNA segments can be bound to the viral genome.
  • Some vectors can autonomously replicate in the host cell into which they are introduced (eg, bacterial vectors and episomal mammalian vectors with bacterial origin replication).
  • Other vectors eg, non-episomal mammalian vectors
  • certain vectors may direct the expression of genes to which they are operatively linked.
  • vectors are referred to herein as "recombinant expression vectors (or simply," expression vectors ").
  • expression vectors of utility in recombinant DNA techniques are often in the form of plasmids.
  • Vector can be used interchangeably because the plasmid is the most commonly used form of vector, however, the present invention can be used interchangeably with other forms of expression vectors, such as viral vectors (e.g., lack of replication). Retroviruses, adenoviruses and adeno-associated viruses).
  • host cell is used to mean a cell that can be transformed or transformed by a nucleic acid sequence and then express the gene of interest.
  • the term includes the progeny of the parent cell, as long as the selected gene is present, whether the progeny is morphologically or genetically identical to the original parent.
  • the monoclonal antibody of the present invention has excellent binding affinity for thioredoxin 1, which binds specifically to thioredoxin 1, and also has high sensitivity and specificity, and thus may be useful for screening breast cancer patients. Furthermore, detection of thioredoxin 1 using a monoclonal antibody that specifically binds to thioredoxin 1 of the present invention, rather than detection of another conventional breast cancer diagnostic biomarker CA15-3, has sensitivity and specificity. Its superiority can significantly increase the accuracy and reliability of breast cancer diagnosis.
  • FIG. 1 shows a cleavage map of a recombinant vector expressing thioredoxin 1 antigen and isotyping results of the antibody obtained in Example 1.
  • Figure 2 shows the light chain (a) and heavy chain (b) amino acid sequence of the 9G7 (AB1) antibody obtained in Example 1.
  • Figure 3 shows the light chain (a) and heavy chain (b) amino acid sequence of the 2B4 (AB2) antibody obtained in Example 1.
  • FIG. 4 shows a cleavage map of recombinant vectors expressing light chain (a) and heavy chain (b) of antibody B264 with good affinity.
  • Fig. 5 shows a cleavage map of recombinant vectors expressing light chain (a) and heavy chain (b) of antibody B266 with good affinity.
  • Figure 6 confirms the reduced (+) and non-reduced (-) state of the antibody using SDS-PAGE, (a) shows antibody B264, (b) shows antibody B266.
  • Figure 7 confirms the reduced (+) and non-reduced (-) state of antibody B266-1 using SDS-PAGE, the antibody B266-1 is a change in the Fc portion of antibody B266 human IgG1.
  • Figure 9 shows the results of calculating the sensitivity and specificity by ROC analysis of the results by ELISA using antibodies B266-1 and B264.
  • thioredoxin 1 is low in normal breast tissue but very high in breast cancer tissue, and that thioredoxin 1 is useful as a marker for diagnosing breast cancer.
  • the monoclonal antibody of the present invention has excellent binding affinity for thioredoxin 1, which binds specifically to thioredoxin 1, and also has high sensitivity and specificity, and thus may be useful for screening breast cancer patients. Furthermore, detection of thioredoxin 1 using a monoclonal antibody that specifically binds to thioredoxin 1 of the present invention, rather than detection of another conventional breast cancer diagnostic biomarker CA15-3, has sensitivity and specificity. Its superiority can significantly increase the accuracy and reliability of breast cancer diagnosis.
  • the present invention provides a monoclonal antibody or antigen-binding fragment thereof that binds to human thioredoxin-1 (Trx1).
  • Monoclonal antibodies of the present invention can be prepared using a wide variety of techniques known in the art, such as hybridomas, recombinant and phage display techniques, or methods using combinations thereof.
  • monoclonal antibodies can be prepared using hybridoma techniques, such as those known in the art.
  • the term “monoclonal antibody” herein does not limit only antibodies produced through hybridoma technology.
  • the term “monoclonal antibody” refers to an antibody derived from a monoclonal such as any eukaryotic, prokaryotic or phage clone, but not a method of production thereof.
  • mice can be immunized with a target antigen or cells expressing such antigen.
  • an immune response is detected, for example, when an antibody specific for an antigen is detected in mouse serum, the mouse spleen is recovered to separate splenocytes.
  • the splenocytes are then fused with any suitable myeloma cells, such as P3U1, P3X63-Ag8, P3X63-Ag8-U1, P3NS1-Ag4, SP2 / 0-Ag14, P3X63-Ag8-653, etc., using known techniques. .
  • Hybridomas are selected and cloned by limiting dilution.
  • the hybridoma clones are then assessed for their ability to secrete antibodies capable of binding antigen by methods known in the art.
  • ascites containing high levels of antibodies can be made by inoculating a mouse abdominal cavity with a positive hybridoma clone.
  • the recombinant vector having the cleavage map of Figure 1 (a) was transfected into E. coli to prepare a Trx1 antigen. Subsequently, the spleens of mice immunized with the antigen were isolated and fused with myeloma cells (sp2 / 0) to identify cells producing antibodies that react with Trx1 by ELISA.
  • Preferred monoclonal antibodies or antigen-binding fragments thereof of the invention may comprise the following (a) or (b), which may be referred to herein as B264 and B266-1, respectively:
  • a light chain variable region comprising a light chain CDR1 consisting of the amino acid sequence of SEQ ID NO: 1, a light chain CDR2 consisting of the amino acid sequence of SEQ ID NO: 2, and a light chain CDR3 consisting of the amino acid sequence of SEQ ID NO: 3, and an amino acid sequence of SEQ ID NO: 4
  • a heavy chain variable region comprising a heavy chain CDR1 consisting of a heavy chain CDR2 consisting of an amino acid sequence of SEQ ID NO: 5 and a heavy chain CDR3 consisting of an amino acid sequence of SEQ ID NO: 6; or
  • a light chain variable region comprising a light chain CDR1 consisting of the amino acid sequence of SEQ ID NO: 7, a light chain CDR2 consisting of the amino acid sequence of SEQ ID NO: 8, and a light chain CDR3 consisting of the amino acid sequence of SEQ ID NO: 9, and an amino acid sequence of SEQ ID NO: 10
  • a heavy chain variable region comprising a heavy chain CDR1 consisting of a heavy chain CDR2 consisting of an amino acid sequence of SEQ ID NO: 11 and a heavy chain CDR3 consisting of an amino acid sequence of SEQ ID NO: 12;
  • the term “complementarity determining region” refers to the amino acid sequence of the hypervariable region of an immunoglobulin heavy and light chain.
  • the heavy chains (CDRH1, CDRH2 and CDRH3) and light chains (CDRL1, CDRL2 and CDRL3) each contain three CDRs, which provide the major contact residues for the antibody to bind antigen or epitope.
  • Preferred monoclonal antibodies or antigen-binding fragments thereof of the invention may comprise the following (c) or (d), which may be referred to herein as B264 and B266-1, respectively:
  • Preferred monoclonal antibodies or antigen-binding fragments thereof of the invention may comprise the following (e) or (f), which may be referred to herein as B264 and B266, respectively:
  • B264, B265, B266, B267, B268 or B269 Preferred monoclonal antibodies of the invention are referred to as B264, B265, B266, B267, B268 or B269, and most preferably may be B264 or B266-1.
  • B266-1 is a monoclonal antibody in which the Fc portion of B266 has been changed to human IgG1.
  • Naturally occurring antibody structural units typically include tetramers.
  • Each tetramer typically consists of two identical pairs of polypeptide chains, each pair having one full length light chain (typically about 15 kDa) and one full length heavy chain (typically about 50 to 70 kDa) .
  • the amino-terminal region of each of the light and heavy chains typically comprises a variable region of about 100 to 110 or more amino acids involved in antigen recognition.
  • the carboxy-terminal portion of each chain typically defines constant regions involved in effector function.
  • Human light chains are commonly classified as kappa ( ⁇ ) and lambda ( ⁇ ) light chains.
  • Heavy chains are typically classified as mu, delta, gamma, alpha or epsilon and define the isotype of the antibody as IgM, IgD, IgG, IgA and IgE, respectively.
  • IgG has several subclasses including, but not limited to, IgG1, IgG2, IgG3 and IgG4.
  • IgM has, but is not limited to, subclasses including IgM1 and IgM2.
  • IgA is similarly subdivided into subclasses including, but not limited to, IgA1 and IgA2.
  • variable and constant regions are joined by a "J" region of about 12 or more amino acids, and the heavy chain also includes a "D" region of about 10 or more amino acids.
  • the variable region of each light / heavy chain pair typically forms an antigen-binding site.
  • the heavy chain of the monoclonal antibody of the present invention may be IgG1, IgG2a, IgG2b, IgG3, IgA or IgM isotype
  • the light chain may be kappa chain or lambda chain, preferably kappa Light chain and IgG1 heavy chain.
  • antigen-binding fragments thereof means fragments having antigen-binding function, and include Fab, F (ab '), F (ab') 2 and Fv or Single chain antibody molecule molecules and the like.
  • Fab has one antigen-binding site in a structure having variable regions of the light and heavy chains, constant regions of the light chain, and the first constant region of the heavy chain (CH1).
  • F (ab ') differs from Fab in that it has a hinge region comprising one or more cysteine residues at the C-terminus of the heavy chain CH1 domain.
  • F (ab ') 2 is produced when the cysteine residues of the hinge region of Fab' form disulfide bonds.
  • Fv refers to the minimum antibody fragment having only heavy and variable chain regions.
  • Such antibody fragments may be obtained using proteolytic enzymes, for example, restriction digestion of the entire antibody with papain may yield Fab and cleavage with pepsin may yield F (ab ') 2 fragments, preferably Can be produced through genetic recombination techniques.
  • Preferred antibodies of the invention can be chimeric antibodies, humanized antibodies or fully human antibodies.
  • Chimeric antibodies can be prepared by recombinant means by combining the variable light and heavy chain regions (VL and VH) obtained from one species of antibody producing cells with the constant light and heavy chain regions from another species.
  • VL and VH variable light and heavy chain regions
  • chimeric antibodies utilize rodent or rabbit variable regions and human constant regions mainly to produce antibodies with human domains. The production of such chimeric antibodies is well known in the art and can be accomplished by standard means.
  • Human constant regions of chimeric antibodies of the invention are from IgG1, IgG2, IgG3, IgG4, IgG5, IgG6, IgG7, IgG8, IgG9, IgG10, IgG11, IgG12, IgG13, IgG14, IgG15, IgG16, IgG17, IgG18 or IgG19 constant regions. It is further contemplated that it may be selected.
  • Humanized antibodies are engineered to contain even more human-like immunoglobulin domains, which include only the complementarity determining regions of animal derived antibodies. This is accomplished by carefully examining the sequences of the hypervariable loops of the variable regions of monoclonal antibodies and adapting the sequences to the structure of human antibody chains.
  • Fully human antibodies are antibody molecules in which the entire sequence of both light and heavy chains, including CDRs, originate from human genes.
  • the present invention also provides nucleic acid molecules encoding the heavy and / or light chains of the monoclonal antibodies or antigen-binding fragments thereof of the invention.
  • nucleic acid molecule is meant to encompass DNA (gDNA and cDNA) and RNA molecules inclusive, and the nucleotides that are the basic structural units in nucleic acid molecules are natural nucleotides, as well as analogs in which sugar or base sites are modified. (analogue) is also included.
  • sequence of nucleic acid molecules encoding heavy and light chain variable regions of the invention can be modified. Such modifications include addition, deletion, or non-conservative or conservative substitutions of nucleotides.
  • Nucleic acid molecules of the invention are also construed to include nucleotide sequences that exhibit substantial identity to the nucleotide sequences described above. Such substantial identity is at least 80 when aligning the nucleotide sequence of the present invention with any other sequence to the maximum correspondence, and analyzing the aligned sequence using algorithms commonly used in the art.
  • the nucleic acid molecule encoding the light chain of the monoclonal antibody of the present invention may consist of the nucleotide sequence of SEQ ID NO: 21, the nucleic acid molecule encoding the heavy chain consists of the nucleotide sequence of SEQ ID NO: 22 Can be.
  • the nucleic acid molecule encoding the heavy chain of the monoclonal antibody of the present invention may be composed of the nucleotide sequence of SEQ ID NO: 23, the nucleic acid molecule encoding the light chain is the nucleotide sequence of SEQ ID NO: 24 It may be made of.
  • the present invention also provides a recombinant vector comprising both a nucleic acid molecule encoding a heavy chain and a light chain or a nucleic acid molecule encoding the light chain of the monoclonal antibody.
  • the recombinant vector system of the present invention can be constructed through various methods known in the art.
  • Vectors of the present invention can typically be constructed as vectors for cloning or vectors for expression.
  • the vector of the present invention can be constructed using prokaryotic or eukaryotic cells as hosts.
  • the vector of the present invention is an expression vector and the prokaryotic cell is a host
  • powerful promoters capable of promoting transcription e.g., tac promoter, lac promoter, lacUV5 promoter, lpp promoter, pL ⁇ promoter, pR ⁇ promoter
  • rac5 promoter amp promoter
  • recA promoter recA promoter
  • SP6 promoter trp promoter and T7 promoter
  • ribosome binding sites for initiation of translation.
  • E. coli e.g., HB101, BL21, DH5 ⁇ , etc.
  • the promoter and operator sites of the E e.g., HB101, BL21, DH5 ⁇ , etc.
  • Bacillus bacteria can be used as host cells, any promoter capable of expressing Bacillus bacteria or a promoter of the toxin protein gene of Bacillus thuringiensis can be used as a regulatory site.
  • the recombinant vector of the present invention is a plasmid used in the art (eg, pCL, pSC101, pGV1106, pACYC177, ColE1, pKT230, pME290, pBR322, pUC8 / 9, pUC6, pBD9, pHC79, pIJ61, pLAFR1, pHV14, pGEX).
  • Series, pET series and pUC19, etc. phages (eg, ⁇ gt4 ⁇ ⁇ B, ⁇ -Charon, ⁇ z1 and M13, etc.) or viruses (eg, SV40, etc.).
  • promoters derived from the genome of mammalian cells e.g., metallothionine promoter, ⁇ -actin promoter, human heroglobin promoter and human muscle creatine promoter
  • a promoter derived from a mammalian virus e.g., adenovirus late promoter, vaccinia virus 7.5K promoter, SV40 promoter, cytomegalovirus (CMV) promoter, tk promoter of HSV, mouse breast tumor virus (MMTV) promoter, HIV LTR promoter, promoter of Moroni virus Epsteinbar virus (EBV) and Loose sacoma virus (RSV) promoter
  • EBV Moroni virus Epsteinbar virus
  • RSV Loose sacoma virus
  • the recombinant vector of the present invention may be fused with other sequences to facilitate the purification of the antibody expressed therefrom.
  • Sequences to be fused include, for example, glutathione S-transferase (Amersham Pharmacia Biotech, USA); Maltose binding protein (NEB, USA); FLAG (IBI, USA); Tag sequences such as 6x His (hexahistidine; Qiagen, USA), Pre-S1, c-Myc; leading sequences such as ompA and pelB .
  • the protein expressed by the vector of the present invention is an antibody, the expressed antibody can be easily purified through a protein A column or the like without additional sequences for purification.
  • the recombinant vector of the present invention includes antibiotic resistance genes commonly used in the art as a selection marker, for example, ampicillin, gentamycin, carbenicillin, chloramphenicol, streptomycin, kanamycin, geneticin, neomycin And resistance genes for tetracycline.
  • the vector expressing the antibody of the present invention may be a vector system in which the light and heavy chains are simultaneously expressed in one vector, or a system in which the light and heavy chains are expressed in separate vectors, respectively. In the latter case, both vectors are introduced into the host cell via co-transfomation and targeted transformation.
  • Simultaneous transformation is a method of introducing each vector DNA encoding a light chain and a heavy chain into a host cell at the same time, and then selecting cells expressing both the light and heavy chains.
  • Target transformation involves selecting the cells transformed with the vector containing the light (or heavy) chain and transforming the selected cells expressing the light chain with the vector containing the heavy (or light) chain to express both the light and heavy chains. This is the method of finally selecting the cells.
  • the present invention also provides a host cell comprising the recombinant vector of the present invention.
  • the host cell is a cell transformed with the recombinant vector of the present invention.
  • Host cells capable of continuously cloning and expressing the vector of the present invention in a stable manner are known in the art, and any host cell may be used, for example, Escherichia coli), Bacillus subtilis (Bacillus subtilis) and Bacillus Chuo ringen system (B.
  • Bacillus strain Bacillus strain (Bacillus spp such as thuringensis).), Streptomyces (Streptomyces), Pseudomonas (Pseudomonas) (for example, Pseudomonas footage the (Pseudomonas putida)), Proteus Billy's mum (Proteus prokaryotic host cells such as, but not limited to, mirabilis ) or Staphylococcus (eg, Staphylococus carnosus ).
  • Suitable eukaryotic host cells of the vector are multicellular fungi and piapas, such as Aspergillus spp. And Neurospora crassa , belonging to Phylum Ascomycota. Pichia pastoris , Saccharomyces cerevisiae ), unicellular fungi including yeasts such as Schizosaccharomyces , other lower eukaryotic cells, cells of higher eukaryotes such as insect-derived cells, and plants or mammals. Cells can be used.
  • transfection refers to introducing a desired gene into a host cell using the recombinant vector of the present invention, and is used in the same meaning as “transformation”.
  • “transfection” and / or “transformation” into a host cell includes any method of introducing a nucleic acid into an organism, cell, tissue, or organ, and as appropriate to the host cell, as is known in the art, It can be done by selection.
  • These methods include electroporation, plasma fusion, calcium phosphate (CaPO 4 ) precipitation, calcium chloride (CaCl 2 ) precipitation, agitation with silicon carbide fibers, agro bacteria mediated transformation, PEG, dextran sulfate, lipo Pectamine and dry / inhibited mediated transformation methods and the like.
  • the present invention also provides a method for producing a monoclonal antibody or antigen-binding fragment thereof that specifically binds thioredoxin 1, comprising culturing the host cell.
  • Cultivation of host cells for the production of antibodies or antigen-binding fragments thereof may be carried out according to suitable media and culture conditions known in the art.
  • This culture process can be used by those skilled in the art can be easily adjusted according to the strain selected.
  • Cell culture is divided into a batch culture, a fed-batch, and a continuous culture depending on the suspension culture and adhesion culture, the culture method according to the growth method of the cell.
  • the medium used for culturing must adequately meet the requirements of the particular strain.
  • the medium used for culturing animal cells contains various carbon sources, nitrogen sources and trace element components.
  • carbon sources that can be used are glucose, sucrose, lactose, fructose, maltose, carbohydrates such as starch and cellulose, fats such as soybean oil, sunflower oil, castor oil and coconut oil, fatty acids such as palmitic acid, stearic acid and linoleic acid, Alcohols such as glycerol and ethanol, and organic acids such as acetic acid.
  • carbon sources may be used alone or in combination.
  • nitrogen sources examples include organic nitrogen sources and urea such as peptone, yeast extract, gravy, malt extract, corn steep liquor (CSL) and soybean wheat, inorganic urea such as ammonium sulfate, ammonium chloride, ammonium phosphate, ammonium carbonate and ammonium nitrate Contains nitrogen sources. These nitrogen sources may be used alone or in combination.
  • the medium may include potassium dihydrogen phosphate, dipotassium hydrogen phosphate and the corresponding sodium-containing salts as a person. It may also include metal salts such as magnesium sulfate or iron sulfate.
  • amino acids, vitamins, and appropriate precursors may be included.
  • compounds such as ammonium hydroxide, potassium hydroxide, ammonia, phosphoric acid and sulfuric acid can be added to the culture in an appropriate manner to adjust the pH of the culture.
  • antifoaming agents such as fatty acid polyglycol esters can be used to suppress bubble generation.
  • oxygen or oxygen-containing gas eg, air
  • the temperature of the culture is usually 20 ° C to 45 ° C, preferably 25 ° C to 40 ° C.
  • Antibodies obtained by culturing host cells can be used without purification and can be further purified and purified using various conventional methods such as dialysis, salt precipitation and chromatography. Among them, a method using chromatography is most used, and the type and order of columns can be selected from ion exchange chromatography, size exclusion chromatography, affinity chromatography, and the like according to the characteristics of the antibody and the culture method.
  • the present invention also provides a breast cancer diagnostic kit comprising the monoclonal antibody or antigen-binding fragment thereof of the present invention and a method for providing information necessary for diagnosing breast cancer using the same.
  • diagnosis means identifying the presence or characteristic of a pathological condition.
  • diagnosis is to determine whether breast cancer develops.
  • Thioredoxin 1 protein is a diagnostic marker for breast cancer, and the expression level is higher in breast cancer tissues than in normal breast tissues.
  • the breast cancer diagnostic kit may be an Enzyme Linked Immunosorbent Assay (ELISA) kit, preferably one selected from the group consisting of direct ELISA, indirect ELISA, direct sandwich ELISA, and indirect sandwich ELISA. It may be abnormal.
  • the two antibodies included in the sandwich ELISA kit include monoclonal antibody B266-1 as a coating antibody and monoclonal antibody B264 as a detection antibody.
  • the breast cancer diagnostic kits of the present invention may further comprise tools or reagents known in the art for use in immunological assays in addition to antibodies to Trx1.
  • Immunological analysis in the above may include any method that can measure the binding of the antigen and the antibody.
  • Such methods are known in the art and include, for example, Western blots, ELISAs, radioimmunoassays, radioimmunoassays, immunofluorescence assays, immunoblots, ocreronid immunodiffusions, rocket immunoelectrophoresis, tissue immunostaining, immunity Precipitation assay, complement fixation assay, immunochromatography assay, FACS, protein chip, and the like, but are not limited thereto.
  • Tools or reagents used in immunological assays can include suitable carriers or supports, labels capable of producing detectable signals, solubilizers, detergents, stabilizers, and the like.
  • Suitable carriers include, but are not limited to, substrates capable of measuring enzymatic activity, secondary antibodies labeled with suitable buffers, chromophores or fluorescent substances, chromogenic substrates, and reactions when the marker is an enzyme. And the like.
  • Antibodies against Trx1, included in the kits of the present invention can preferably be immobilized to a suitable carrier or support using various methods as disclosed in the literature, and examples of suitable carriers or supports include PBS, polystyrene, polyethylene, poly Propylene, Polyester, Polyacrylonitrile, Fluorine Resin, Agarose, Cellulose, Nitrocellulose, Dextran, Sephadex, Sepharose, Liposome, Carboxymethyl Cellulose, Polyacrylamide, Polyester, Cat Rock, Filter Paper, Ion Exchange Resin , Plastic films, plastic tubes, polyamine-methyl vinyl-ether-maleic acid copolymers, amino acid copolymers, ethylene-maleic acid copolymers, nylon, metals, glass, glass beads, magnetic particles, and the like.
  • Other solid substrates include cell culture plates, ELISA plates, tubes and polymeric membranes.
  • the support may have any possible form, for example spherical (bead), cylindrical (test tube or inner surface of the well), planar (sheet, test strip).
  • Labels capable of generating a detectable signal enable qualitative or quantitative measurement of antigen-antibody complex formation, examples of which include enzymes, fluorescent materials, ligands, luminescent materials, microparticles, redox molecules and radioactive substances. Isotopes, etc. may be used. Enzymes include ⁇ -glucuronidase, ⁇ -D-glucosidase, urease, peroxidase (such as horseradish peroxidase), alkaline phosphatase, acetylcholinesterase, glycoside oxidase, hexokinase, horses.
  • enzymes include ⁇ -glucuronidase, ⁇ -D-glucosidase, urease, peroxidase (such as horseradish peroxidase), alkaline phosphatase, acetylcholinesterase, glycoside oxidase, hexokinase, horses.
  • Late dihydrogenase glucose-6-phosphate dihydrogenase, invertase, luciferase and the like can be used.
  • fluorescent substance fluorescein, isothiocyanate, rhodamine, phycoerythrin, phycocyanin, allophycocyanin, fluorine isothiocyanate, etc. may be used.
  • Ligands include biotin derivatives, and light emitting materials include acridinium ester and luciferin.
  • the microparticles include colloidal gold and colored latex, and the redox molecules include ferrocene, ruthenium complex, biologen, quinone, Ti ion, Cs ion, diimide, 1,4-benzoquinone and hydroquinone.
  • Radioisotopes include 3 H, 14 C, 32 P, 35 S, 36 Cl, 51 Cr, 57 Co, 58 Co, 59 Fe, 90 Y, 125 I, 131 I, 186 Re, and the like. However, any of those that can be used in immunological assays other than those exemplified above may be used.
  • HRP horseradish peroxidase
  • 3-amino-9-ethylcarbazole 5-aminosalicylic acid
  • 4-chloro-1-naphthol 4-chloro-1-naphthol
  • o -Phenylenediamine 2,2'-azino-bis (3-ethylbenzthiazoline-6-sulfonic acid)
  • 3,3-diaminobenzidine 3,3 ', 5,5'-tetramethylbenzidine, o- Dianisidine, or a solution containing 3,3-dimethoxybenzidine
  • HRP horseradish peroxidase
  • alkaline phosphatase when alkaline phosphatase is selected as the enzyme label, a solution containing 5-bromo-4-chloro-3-indolyl phosphate, nitroblue tetrazolium, or p-nitrophenyl phosphate can be used as the substrate.
  • ⁇ -D-galactosidase when ⁇ -D-galactosidase is selected as the enzyme label, o-nitrophenyl- ⁇ -D-galactosid or 5-bromo-4-chloro-3-indole- ⁇ -D-gal is used as a substrate.
  • a solution containing lactopyranoside can be used.
  • various enzymes and enzyme chromogenic substrates known in the art may be used.
  • the method for providing information necessary for diagnosing breast cancer of the present invention may be performed by the following steps:
  • step (c) comparing the expression level of the thioredoxin 1 protein measured in step (b) with the control group and determining the breast cancer patient if the expression level of the protein is higher than that of the control group.
  • the method for providing information necessary for diagnosis in the breast cancer of the present invention may be performed by the following steps:
  • step (g) comparing the expression level of the thioredoxin 1 protein measured in step (f) with the control group, and determining the breast cancer patient if the expression level of the protein is higher than that of the control group.
  • the term “isolated biological sample” refers to tissue (breast tissue), cells (breast cells), whole blood, plasma, serum, blood, saliva, synovial fluid, urine, which differ in the expression level of the Trx1 protein, a breast cancer marker. Sputum, lymphatic fluid, cerebrospinal fluid, tissue autopsy samples (brain, skin, lymph nodes, spinal cord, etc.), cell culture supernatants, or ruptured eukaryotic cells, and the like, and include samples from metastatic lesions as well as the primary lesion of cancer. The expression level of the Trx1 protein can be confirmed by reacting these biological samples with or without manipulation of the monoclonal antibody of the present invention.
  • the term "individual” includes mammals, birds, and the like, including cattle, pigs, sheep, chickens, dogs, humans, and the like, and individuals without suspicion of breast cancer are included without limitation.
  • Primer sequences used to amplify the human thioredoxin 1 gene are shown in Table 2 below.
  • hTrx1 -For TAATGGTCAAACAGATCGAATC (SEQ ID NO 26)
  • hTrx1 -Rev CACCAGTTCGTTAATCGTGGTAATGAAAGCT (SEQ ID NO 27)
  • PCR was performed to amplify the gene for cloning into the plasmid. 10 pmol, dNTP (2.5 mM each), Exprime Taq polymerase, and buffer were added and mixed with the synthesized gene and primers (hTrx1-For, hTrx1-Rev). After 95 degreeC and this reaction for 2 minutes, 95 degreeC 30 second, 55 degreeC 30 second, and 70 degreeC 20 second reaction were repeated 35 times, and it reacted for 70 degreeC 2 minutes, and reaction was complete
  • the plasmid is purified by processing the restriction enzyme to clone to the Eco R V position present in the multi-cloning site (MCS) of the pUC57 plasmid.
  • MCS multi-cloning site
  • the purified gene, the restriction enzyme treated plasmid, ligase and the buffer solution were mixed and reacted.
  • Plasmid E. coli To transform into DH5 ⁇ , the E. coli DH5 ⁇ competent cell line was dissolved at 4 ° C., mixed with the plasmid mixed solution, and reacted at 4 ° C. for 30 minutes. After the reaction, a thermal shock was applied at 42 ° C. for 30 seconds, and then again stabilized at 4 ° C. for 2 minutes. Incubated for at least 16 hours. Plasmids with human thioredoxin 1 gene were selected from colonies grown in the culture medium.
  • Trx1 Expression and Purification of Trx1
  • the E. coli BL21 strain was transformed according to the above-mentioned method to express the protein.
  • the cell line obtained for pure purification of this protein was disrupted by centrifugation (12,000 rpm, 30 minutes, 4 ° C.) using an ultrasonic cell crusher (sonication) to obtain a supernatant.
  • Protein A / G PLUS-Agarose sc-2003, Santa Cruz
  • thioredoxin I expressed by adding the purchased anti-thioredoxin I antibody (LF-MA0055, Abfrontier) to the obtained supernatant
  • the reaction was carried out by addition and purified by centrifugation. Purity and quantification were then confirmed on SDS-PAGE.
  • Purified human thioredoxin 1 protein was injected into mice (BALB / c) mixed with adjuvant, and blood was collected from the mice to confirm antibody production by ELISA. After two immunizations, titers of antibodies (1: 5,000) were found to increase appropriately.
  • Spleens from the immunized mice were removed to isolate B lymphocytes and then fused with cultured myeloma cells (sp2 / 0).
  • the fused cells were cultured in a medium (HAT medium) to which hypoxanthine, aminopterine, and thymidine were added to selectively select fusion cells of only myeloma and B lymphocytes (hybridoma). Incubated.
  • HAT medium hypoxanthine, aminopterine, and thymidine
  • Three antibodies that react with human thioredoxin 1 protein in the obtained hybridoma cells were identified by ELISA. Cells that are ELISA positive were selected for hybridomas that produce antibodies that respond to antigens using the limiting dilution method.
  • hybridomas human immunodeficiency virus
  • ascites The obtained three hybridomas (hybridoma) was injected into the mice to obtain ascites, which was purified purely using Protein A affinity chromatography. Purified antibodies were confirmed by SDS-PAGE.
  • the heavy chain of monoclonal antibody 2B4 was identified as IgG1, the heavy chain of monoclonal antibody 8F3 as IgG12a, the heavy chain of monoclonal antibody 9G7 as IgG2b, and all light chains were kappa ( ⁇ ). It was confirmed that.
  • the heavy and light chain amino acid sequences of 9G7 (AB1) and 2B4 (AB2) of the three monoclonal antibodies obtained in Example 2 were analyzed.
  • the amino acid sequence was determined as a sequence capable of fusion with an Fc region suitable for backtranslation and recombination expression.
  • the sequences determined through the IMTG gap arrangement were arranged and the hypermutation table was used to find the hypermutation and the complete CDR3 moiety.
  • the sequence was confirmed by accurate mass peptide maps (accurate mass peptide maps) and the like (FIGS. 2 and 3), and MS / MS spectra were used to identify overmutations and CDR3.
  • 9G7 (AB1) was selected as 4 species (B266, B297, B268 and B269), and 2B4 (AB2) was 2 species (B264). And B265) to change the base sequence to synthesize a gene.
  • Trx1-Fc antigen Antibody ID 5000 ⁇ (OD Value) AB264-T150514-7 1.171 AB264-T150514-8 0.494 B265-T150514-10 0.378 B265-T150514-9 0.273 B266-T150519-3 0.198 B266-T150519-4 0.181 B267-T150519-5 0.043 B267-T150519-6 0.023 B268-T150519-8 0.015 B268-T150519-7 0.003 B269-T150519-9 0.002 B269-T150519-10 -0.001
  • Trx1-His antigen Antibody ID 5000 ⁇ (OD Value) AB264-T150514-7 1.996 B265-T150514-10 1.465 AB264-T150514-8 1.142 B265-T150514-9 1.03 B267-T150519-5 0.857 B268-T150519-8 0.783 B269-T150519-9 0.77 B268-T150519-7 0.761 B269-T150519-10 0.717 B266-T150519-3 0.696 B266-T150519-4 0.667 B267-T150519-6 0.554
  • amino acid sequences of the high affinity antibodies B264 and B266 are shown in Table 6 below.
  • 100 ⁇ l coating buffer per well (0.015 M Na 2 CO 3 , 0.035 M NaHCO 3 , 0.003 M NaN 3 , pH9.6) and 100 ng coated antibody (coating antibody, B266) were mixed and dispensed, followed by O / N reaction at 4 ° C.
  • 20 ⁇ l of the antigen 50, 25, 12.5 or 0 ng
  • 80 ⁇ l of the detection antibody Biotin-labeled B264; B264-B
  • the reaction was performed for 10 minutes under dark and dark conditions, and treated with 100 ⁇ l of 2.5 M sulfuric acid solution (H 2 SO 4 ; STOP buffer) per well, and the result was confirmed at 450 nm. .
  • plasmids with heavy chains in the recombinant plasmids were co-infected with plasmids with other isotype heavy chains. That is, plasmids having genes encoding heavy chains other than pcDNA3-SSJ12-H among the pcDNA3-SSJ12-L and pcDNA3-SSJ12-H used for expressing 9G7 (AB1) were co-transfected.
  • amino acid sequences of the light chain CDR1 to CDR3 and heavy chain CDR1 to CDR3 of the finally selected monoclonal antibodies B264 and B266-1 are shown in Table 9, and the amino acid sequences of the light chain variable region and heavy chain variable region are shown in Table 10.
  • B264 light chain CDR1 SRISYM (SEQ ID NO: 1) B264 light chain CDR2 DTS (SEQ ID NO: 2) B264 light chain CDR3 HQRSSYP (SEQ ID NO: 3) B264 heavy chain CDR1 GFNIKDTF (SEQ ID NO: 4)
  • B264 heavy chain CDR2 IDPANGNT (SEQ ID NO: 5) B264 heavy chain CDR3 A (SEQ ID NO: 6)
  • B266-1 light chain CDR1 QSIVHSNGNTY (SEQ ID NO: 7) B266-1 light chain CDR2 KVS (SEQ ID NO: 8) B266-1 light chain CDR3 FQGSHVP (SEQ ID NO: 9)
  • B266-1 heavy chain CDR1 GFNIKDTF (SEQ ID NO: 10)
  • B266-1 heavy chain CDR2 IDPANGNT (SEQ ID NO: 11)
  • B266-1 heavy chain CDR3 A (SEQ ID NO: 12)
  • B264 light chain variable region QIVLTQSPAIMSASPGEKVTMTCSASSRISYMYWYQQKPGTSPKRWIYDTSKLASGVPARFSGSGSGTSYSLTISTMEAEDAATYYCHQRSSYP (SEQ ID NO: 13)
  • B266-1 light chain variable region DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVP (SEQ ID NO: 15)
  • 100 ⁇ l coating buffer per well and 100 ng coated antibody (B266-1) were mixed and dispensed, followed by O / N reaction at 4 ° C., the reaction solution was removed, and 200 ⁇ l wash buffer was dispensed and washed per well. This procedure was treated twice.
  • the blank value was high due to the reaction force of B266-1, but the binding degree of B266-1 and B264 increased with increasing antigen concentration. It was confirmed. This indicates that B266-1 and B264 bind antigen.
  • the K D (equilibrium dissociation constant) value B266-1 are 1.1x10 -11, B264 was 1.3x10 -10. If the K D value is between 10 -10 and 10 -12 , it is assessed as having a sensitivity to picomolar (pM) levels of antigens, indicating that B266-1 and B264 have high levels of sensitivity to antigens. have.
  • Sandwich ELISA using the coated antibody (B266-1) was prepared by the following procedure.
  • a coating antibody solution of 1 ⁇ g / ml concentration was prepared by adding 100 ml of coating buffer and 0.1 ml of B266-1 at 1 mg / ml concentration. 100 ⁇ l of the prepared coated antibody solution was dispensed per well of each 96-well plate, followed by reaction at 4 ° C. for 12 hours. The antibody solution was removed and washed by aliquoting 200 ⁇ l 0.05% PBST per well. This washing process was repeated three times. 200 ⁇ l PBSA was treated per well and reacted at 4 ° C. for 4 hours (blocking step). PBSA was removed and the 96-well plate was dried for 3 hours in a thermo-hygrostat (20 ° C., 30% R.H.).
  • the detection antibody (B264) was biotinylated by the following procedure.
  • Standard antigen solution was dispensed into the first column of 96-well plates prepared by coating with the coating antibody. Serum obtained from 20 ⁇ l breast cancer patients was dispensed, followed by 80 ⁇ l (0.3 mg / ml) B264-B solution. After reaction at 37 ° C. for 60 minutes, the antigen and antibody reaction solutions were removed, and 200 ⁇ l PBST was aliquoted and washed. This washing process was repeated three times. 100 ⁇ l of streptavidin-HRP diluted to 1: 400 was dispensed and reacted at 37 ° C. for 30 minutes. After the reaction was completed, the reaction solution was removed, and 200 ⁇ l PBST was dispensed and washed per well. This washing process was repeated three times. 100 ⁇ l TMB solution (Sure Blue) was treated and reacted at room temperature for 15 minutes under dark conditions. 100 ⁇ l of 2N H 2 SO 4 solution was aliquoted and measured at 450 nm absorbance using a microplate reader.
  • Sensitivity and specificity were calculated by analyzing the results of ELISA using monoclonal antibodies B266-1 and B264 against Trx1. When the cut-off value was 10.8 ng / ml, the sensitivity was 93.0% and the specificity was 97.4% (FIG. 9).
  • the monoclonal antibody of the present invention has excellent binding affinity for thioredoxin 1, which binds specifically to thioredoxin 1, and also has high sensitivity and specificity, and thus may be useful for screening breast cancer patients. Furthermore, detection of thioredoxin 1 using a monoclonal antibody that specifically binds to thioredoxin 1 of the present invention, rather than detection of another conventional breast cancer diagnostic biomarker CA15-3, has sensitivity and specificity. Its superiority can significantly increase the accuracy and reliability of breast cancer diagnosis, and thus is highly industrially applicable.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • Molecular Biology (AREA)
  • Engineering & Computer Science (AREA)
  • Medicinal Chemistry (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Biomedical Technology (AREA)
  • Hematology (AREA)
  • Urology & Nephrology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Cell Biology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Oncology (AREA)
  • Analytical Chemistry (AREA)
  • Biotechnology (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Microbiology (AREA)
  • Food Science & Technology (AREA)
  • Hospice & Palliative Care (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Peptides Or Proteins (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)

Abstract

본 발명은 티오레독신 1에 특이적으로 결합하는 항체 및 이의 용도에 관한 것으로, 보다 상세하게는 티오레독신 1에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편, 상기 항체 또는 이의 항원 결합 단편의 중쇄 및/또는 경쇄를 코딩하는 핵산 분자, 상기 핵산 분자를 포함하는 재조합 벡터, 숙주세포, 상기 항체 또는 이의 항원 결합 단편의 제조방법, 유방암 진단용 키트, 유방암 진단에 필요한 정보를 제공하는 방법에 관한 것이다.

Description

티오레독신 1에 특이적으로 결합하는 단일클론항체 및 이의 용도
본 출원은 2016년 09월 13일 출원된 대한민국 특허출원 제 10-2016-0118053 호를 우선권으로 주장하고, 상기 명세서 전체는 본 출원의 참고문헌이다.
본 발명은 티오레독신 1에 특이적으로 결합하는 단일클론항체 및 이의 용도에 관한 것으로, 보다 상세하게는 티오레독신 1에 특이적으로 결합하는 단일클론항체 또는 이의 항원 결합 단편, 상기 항체 또는 이의 항원 결합 단편의 중쇄 및/또는 경쇄를 코딩하는 핵산 분자, 상기 핵산 분자를 포함하는 재조합 벡터, 숙주세포, 상기 항체 또는 이의 항원 결합 단편의 제조방법, 유방암 진단용 키트, 유방암 진단에 필요한 정보를 제공하는 방법에 관한 것이다.
티오레독신(thioredoxin, Trx)은 티오레독신 환원효소에 의해 NADPH 의존 환원을 하는 12kDa 정도의 작은 산화환원 단백질로서, 포유류 티오레독신 1(Trx1) 및 티오레독신 2(Trx2)를 포함한다. 티오레독신은 생장인자로서 작용하며, 세포 내에 독성을 미치는 과산화수소를 제거하고, 박테리아에서 리보뉴클레오티드 환원효소로서의 역할 및 전사활동과 관련되는 중요 요소를 DNA에 결합하는 역할을 하며, 진핵세포에서 전사관련 인자인 NF-kB(nuclear transcription factor kB)의 활성에 영향을 미친다. 따라서, 티오레독신은 세포사멸과 종양에 영향을 주어 암세포 성장을 조절하는데 중요한 역할을 하며, 산화된 다른 단백질의 디설파이드 결합을 끊어주어 다시 환원상태의 활성을 가지게 도와준다. 티오레독신 1과 2 효소는 포유동물 세포 내에서 시스테인 아미노산의 산화질소를 제거하여 세포사멸에 영향을 미치고, 염증 질환, 심장마비, 암을 포함한 많은 질병에서 잠재적인 중요성을 갖는다. 또한, 항-티오레독신 항체를 이용한 면역조직화학적 분석은 간, 결장, 췌장 및 자궁경부를 포함하는 인간 암 조직에서 티오레독신의 발현을 나타내고, 이러한 발현은 종양유발 과정에서 티오레독신의 연류 가능성을 가리킨다.
이러한 배경 하에, 본 발명자들은 유방암의 진단 또는 예후를 조기에 예측할 수 있는 유방암 진당용 마커에 대해 연구하던 중, 티오레독신 1이 정상 유방 조직에서는 낮게 발현되지만 유방암 조직에서는 매우 높게 발현됨을 확인하고 티오레독신 1이 유방암 진단용 마커로서 유용함을 입증하였다(대한민국 등록특허 제10-1058230호).
ELISA(Enzyme-Linked Immunosorbent Assay)를 기반으로 하는 In vitro diagnostics(IVD)를 높은 정확도와 정밀도를 보이도록 개발하기 위하여 같은 항원 단백질의 각각 다른 부위를 높은 친화도(affinity)를 갖는 항체 쌍(2종)이 요구된다. 더불어, 일정한 친화도를 가지는 항체를 적은 금액으로 매번 생산하는 시스템을 갖추는 것도 필요하다. 이에 본 발명에서는 인간 혈청에 존재하는 티오레독신 1(thioredoxin-1, Trx1)을 검출하기 위하여 고성능의 재조합 단일클론항체 2종을 개발하였고, 상기 항체가 티오레독신 1에 매우 특이적으로 결합하여 유방암 환자를 스크리닝 하는데 유용함을 확인하고 본 발명을 완성하였다.
본 발명의 목적은 높은 민감도와 특이도로 유방암을 진단할 수 있는 단일클론항체 또는 이의 항원 결합 단편을 제공하는 것이다.
본 발명의 다른 목적은 상기 단일클론항체 또는 이의 항원 결합 단편의 중쇄 및/또는 경쇄를 코딩하는 핵산분자를 제공하는 것이다.
본 발명의 또 다른 목적은 상기 핵산분자를 포함하는 재조합 벡터를 제공하는 것이다.
본 발명의 다른 목적은 상기 재조합 벡터를 포함하는 숙주세포를 제공하는 것이다.
본 발명의 또 다른 목적은 상기 숙주세포를 배양하는 단계를 포함하는, 티오레독신 1에 특이적으로 결합하는 단일클론항체 또는 이의 항원 결합 단편의 제조방법을 제공하는 것이다.
본 발명의 다른 목적은 전술한 단일클론항체 또는 이의 항원 결합 단편을 포함하는 유방암 진단 키트를 제공하는 것이다.
본 발명의 또 다른 목적은 전술한 단일클론항체 또는 이의 항원 결합 단편을 이용하여 유방암 진단에 필요한 정보를 제공하는 방법을 제공하는 것이다.
상술한 과제를 해결하기 위해 본 발명은, 서열번호 1의 아미노산 서열로 이루어진 경쇄 CDR1, 서열번호 2의 아미노산 서열로 이루어진 경쇄 CDR2 및 서열번호 3의 아미노산 서열로 이루어진 경쇄 CDR3을 포함하는 경쇄 가변영역, 및 서열번호 4의 아미노산 서열로 이루어진 중쇄 CDR1, 서열번호 5의 아미노산 서열로 이루어진 중쇄 CDR2 및 서열번호 6의 아미노산 서열로 이루어진 중쇄 CDR3을 포함하는 중쇄 가변영역을 포함하는, 티오레독신 1에 특이적으로 결합하는 단일클론항체 또는 이의 항원 결합 단편을 제공한다.
본 발명의 바람직한 일실시예에 따르면, 상기 항체는 서열번호 13의 아미노산 서열로 이루어진 경쇄 가변영역 및 서열번호 14의 아미노산 서열로 이루어진 중쇄 가변영역을 포함할 수 있다.
본 발명의 바람직한 다른 일실시예에 따르면, 상기 항체는 서열번호 17의 아미노산 서열로 이루어진 경쇄 및 서열번호 18의 아미노산 서열로 이루어진 중쇄를 포함할 수 있다.
본 발명은 또한, 서열번호 7의 아미노산 서열로 이루어진 경쇄 CDR1, 서열번호 8의 아미노산 서열로 이루어진 경쇄 CDR2 및 서열번호 9의 아미노산 서열로 이루어진 경쇄 CDR3을 포함하는 경쇄 가변영역, 및 서열번호 10의 아미노산 서열로 이루어진 중쇄 CDR1, 서열번호 11의 아미노산 서열로 이루어진 중쇄 CDR2 및 서열번호 12의 아미노산 서열로 이루어진 중쇄 CDR3을 포함하는 중쇄 가변영역을 포함하는, 티오레독신 1에 특이적으로 결합하는 단일클론항체 또는 이의 항원 결합 단편을 제공한다.
본 발명의 바람직한 일실시예에 따르면, 상기 항체는 서열번호 15의 아미노산 서열로 이루어진 경쇄 가변영역 및 서열번호 16의 아미노산 서열로 이루어진 중쇄 가변영역을 포함할 수 있다.
본 발명의 바람직한 다른 일실시예에 따르면, 상기 항체는 서열번호 19의 아미노산 서열로 이루어진 경쇄 및 서열번호 20의 아미노산 서열로 이루어진 중쇄를 포함할 수 있다.
본 발명의 바람직한 다른 일실시예에 따르면, 상기 항체는 IgG1 중쇄 및 카파(κ) 경쇄를 포함할 수 있다.
본 발명의 바람직한 또 다른 일실시예에 따르면, 상기 항원 결합 단편은 Fab, F (ab'), F (ab')2, Fv 또는 단쇄 항체 분자일 수 있다.
본 발명의 바람직한 다른 일실시예에 따르면, 상기 항체는 키메라 항체, 인간화 항체 또는 인간 항체일 수 있다.
본 발명은 또한, 전술한 항체 또는 이의 항원 결합 단편의 중쇄 및/또는 경쇄를 코딩하는 핵산 분자를 제공한다.
본 발명의 바람직한 일실시예에 따르면, 상기 경쇄를 코딩하는 핵산분자는 서열번호 21의 뉴클레오티드 서열 또는 서열번호 23의 뉴클레오티드 서열로 이루어질 수 있다.
본 발명의 바람직한 일실시예에 따르면, 상기 중쇄를 코딩하는 핵산분자는 서열번호 22의 뉴클레오티드 서열 또는 서열번호 24의 뉴클레오티드 서열로 이루어질 수 있다.
본 발명은 또한, 상기 중쇄를 코딩하는 핵산분자, 상기 경쇄를 코딩하는 핵산분자 또는 상기 중쇄 및 경쇄를 코딩하는 핵산분자 모두를 포함하는 재조합 벡터를 제공한다.
본 발명은 또한, 상기 재조합 벡터를 포함하는 숙주세포 및 상기 숙주세포를 배양하는 단계를 포함하는, 티오레독신 1에 특이적으로 결합하는 단일클론항체 또는 이의 항원 결합 단편의 제조방법을 제공한다.
본 발명은 또한, 전술한 항체 또는 이의 항원 결합 단편을 포함하는 유방암 진단 키트를 제공한다.
본 발명의 바람직한 일실시예에 따르면, 상기 키트는 ELISA(Enzyme Linked Immunosorbent Assay) 키트일 수 있다.
본 발명의 바람직한 또 다른 일실시예에 따르면, 상기 ELISA는 직접 ELISA, 간접 ELISA, 직접적 샌드위치 ELISA 및 간접적 샌드위치 ELISA로 이루어진 군에서 선택된 어느 하나일 수 있다.
본 발명은 또한, (a) 제1항 내지 제4항 중 어느 한 항의 단일클론항체 또는 이의 항원 결합 단편을 유방암이 의심되는 개체로부터 분리된 생물학적 시료에 접촉시키는 단계; (b) 항원-항체 복합체 형성을 통해 상기 생물학적 시료에서 단일클론항체 또는 이의 항원 결합 단편에 결합된 티오레독신 1 단백질의 발현 수준을 측정하는 단계; 및 (c) 상기 (b) 단계에서 측정된 티오레독신 1 단백질의 발현 수준을 대조군과 비교하여 대조군에 비해 상기 단백질의 발현 수준이 높으면 유방암 환자로 판정하는 단계; 를 포함하는 유방암 진단에 필요한 정보를 제공하는 방법을 제공한다.
나아가 본 발명은, (a) 고체 지지체를 제2항, 제4항 또는 제6항의 단일클론항체 또는 이의 항원 결합 단편으로 코팅하는 단계; (b) 유방암이 의심되는 개체로부터 분리된 생물학적 시료를 상기 코팅된 고체 지지체에 적용하는 단계; (c) 결합되지 않은 샘플을 제거하는 단계; (d) 제1항, 제3항 또는 제5항의 단일클론항체 또는 이의 항원 결합 단편을 고체 지지체에 적용하는 단계; (e) 결합되지 않은 단일클론항체 또는 이의 항원 결합 단편을 제거하는 단계; (f) 티오레독신 1 단백질의 발현 수준을 측정하는 단계; 및 (g) 상기 (f) 단계에서 측정된 티오레독신 1 단백질의 발현 수준을 대조군과 비교하여, 대조군에 비해 상기 단백질의 발현 수준이 높으면 유방암 환자로 판정하는 단계; 를 포함하는 유방암 진단에 필요한 정보를 제공하는 방법을 제공한다.
본 발명의 바람직한 일실시예에 따르면, 상기 티오레독신 1 단백질의 발현 수준은 웨스턴 블랏, ELISA, 샌드위치 ELISA, 방사선면역분석, 방사 면역 확산법, 오우크테로니 면역 확산법, 면역침전 분석법, 보체 고정 분석법, 면역크로마토그래피 분석법, FACS 및 단백질 칩 방법 중 어느 하나 이상의 방법으로 이루어진 군에서 선택된 어느 하나의 방법으로 측정할 수 있다.
본 발명의 바람직한 또 다른 일실시예에 따르면, 상기 분리된 생물학적 시료는 전혈, 혈청, 혈장, 유방 조직 및 유방 세포로 이루어진 군에서 선택된 어느 하나 이상일 수 있다.
다른 식으로 정의되지 않는 한, 본 명세서에서 사용된 모든 기술적 및 과학적 용어들은 본 발명이 속하는 기술분야에서 숙련된 전문가에 의해서 통상적으로 이해되는 것과 동일한 의미를 갖는다. 일반적으로, 본 명세서에서 사용된 명명법은 본 기술분야에서 잘 알려져 있고 통상적으로 사용되는 것이다.
본원에서 사용되는 주요 용어의 정의는 다음과 같다.
용어 "항원"은 항체에 의해 결합될 수 있고, 또한 항원의 에피토프에 결합될 수 있는 항체를 생산하기 위하여 동물에 사용될 수 있는 분자 또는 분자의 일부를 의미한다. 항원은 하나 이상의 에피토프를 가질 수 있다.
용어 "항체" 또는 "Ab"는 면역글로불린 분자의 가변 영역에 위치한, 하나 이상의 항원 인식 부위를 통하여 특이적 표적 또는 항원, 예컨대 탄수화물, 폴리뉴클레오티드, 지질, 폴리펩티드 등을 인식하고 이와 결합할 수 있는 면역글로불린 분자이다. 본원에 사용된 바와 같은, 용어 "항체"는 단일클론항체; 다클론항체; 특정 항원(예를 들어, Trx1)에 특이적으로 결합할 수 있는 능력을 보유하고 있는 항체의 "항원 결합 단편", 예컨대 Fab, Fab', F(ab')2, Fd, Fv, Fc 등; 단리된 상보성 결정 영역 (CDR); 이중특이적 항체; 이종접합체 항체, 그의 돌연변이체; 항체, 또는 그의 항원-결합성 단편 (예를 들어, 도메인 항체)을 갖는 융합 단백질; 단일 쇄 (ScFv) 및 단일 도메인 항체 [예를 들어, 상어 및 카멜리드(camelid) 항체]; 맥시보디(maxibody), 미니보디(minibody), 인트라보디(intrabody), 디아보디(diabody), 트리아보디(triabody), 테트라보디(tetrabody), v-NAR 및 비스-scFv; 인간화 항체; 키메라 항체; 및 요구되는 특이성의 항원 인식 부위를 포함하는 면역글로불린 분자의 다른 모든 변형된 입체 배치 (항체의 글리코실화 변이체, 항체의 아미노산 서열 변이체 및 공유적으로 변형된 항체 포함)를 포함하지만 이에 제한되지 않는, 어떠한 유형의 항체도 포괄할 수 있다. 항체는 뮤린, 래트, 인간, 또는 다른 모든 기원 (키메라 또는 인간화 항체 포함)일 수 있다.
특정 표적 또는 항원 (예를 들어, Trx1 단백질)과 "특이적으로 결합"하는 항체 또는 폴리펩티드는 관련 기술분야에서 널리 이해되는 용어이고, 이러한 특이적 결합을 결정하는 방법 또한, 관련 기술분야에 널리 공지되어 있다. 특정 분자는 이것이 또 다른 세포 또는 물질과의 경우보다 더 자주, 더 신속하게, 더 큰 지속성으로 및/또는 더 큰 친화도로 특별한 세포 또는 물질과 반응하거나 연합되는 경우에 "특이적 결합"을 나타내는 것으로 여겨진다. 특정 항체는 이것이 다른 물질과 결합하는 것보다 더 큰 친화도, 결합 활성도로, 보다 신속하게 및/또는 더 큰 지속성으로 결합하는 경우에 특정 표적 또는 항원과 "특이적으로 결합"한다.
본원에 사용된 용어 "결합 친화도" 또는 "KD"는 특별한 항원-항체 상호 작용의 평형 해리 상수를 지칭하고자 한다. KD는 해리 속도 ("이탈 속도" 또는 "kd"로 불리우기도 함) 대 결합 속도, 또는 "작동 속도" 또는 "ka(결합속도상수, Association rate constant)"의 비이다. 따라서, KD는 kd/ka이고, 이는 몰 농도 (M)로서 표현된다. KD가 더 작을수록, 결합 친화도는 더 강력해진다는 결론이 나온다. 따라서, 1 μM의 KD는 1 nM의 KD와 비교해서 약한 결합 친화도를 표시한다. 항체에 대한 KD 값은 관련 기술분야에 널리 확립된 방법을 이용하여 결정될 수 있다. 항체의 KD를 결정하는 한 가지 방법은, 전형적으로 바이오센서 시스템, 예컨대 비아코어(Biacore®) 시스템을 사용하여, 표면 플라스몬 공명을 이용하는 것이다.
용어 "벡터"는 연결된 다른 핵산을 운반할 수 있는 핵산 분자를 포함한다. 벡터의 한 형태는 "플라스미드"로, 이는 부가의 DNA 절편이 결합될 수 있는 원형 이중 가닥 DNA 루프를 의미한다. 벡터의 다른 형태는 바이러스 벡터로, 여기에서 부가의 DNA 절편은 바이러스 게놈에 결합될 수 있다. 어떤 벡터는 그들이 도입되는 숙주 세포에서 자율 복제될 수 있다(예: 세균 기원 복제를 갖는 세균 벡터 및 에피솜 포유동물 벡터). 다른 벡터(예: 비-에피솜 포유동물 벡터)가 숙주 세포로 도입시 숙주 세포의 게놈으로 통합될 수 있고, 이에 의해 숙주 게놈을 따라 복제된다. 또한, 어떤 벡터는 그들이 작동적으로 연결된(operatively linked) 유전자의 발현을 지시할 수 있다. 상기 벡터는 본 명세서에서 "재조합 발현 벡터(또는 간단히, "발현 벡터")로 언급된다. 일반적으로, 재조합 DNA 기술에서 유용한 발현 벡터는 종종 플라스미드의 형태로 존재한다. 본 명세서에서, "플라스미드" 및 "벡터"는 플라스미드가 가장 통상적으로 사용되는 벡터의 형태이기 때문에 상호교환적으로 사용될 수 있다. 그러나, 본 발명은 동등한 기능을 하는 다른 형태의 발현 벡터, 예를 들면, 바이러스 벡터(예: 복제 결핍 레트로바이러스, 아데노바이러스 및 아데노-관련 바이러스)를 포함하고자 한다.
용어 "숙주 세포"는 형질전환되거나, 핵산 서열에 의해 형질전환된 다음 선택된 관심 유전자를 발현시킬 수 있는 세포를 의미하기 위하여 사용된다. 상기 용어는 선택된 유전자가 존재하는 한, 자손이 본래 부모와 형태적으로 또는 유전적 구성면에서 동일하든지 간에, 모 세포의 자손을 포함한다.
본 발명의 단일클론항체는 티오레독신 1에 대한 결합 친화도 우수하여 티오레독신 1에 매우 특이적으로 결합하고, 또한 민감도와 특이도가 매우 높아 유방암 환자를 스크리닝하는데 유용하게 사용될 수 있다. 나아가, 기존의 다른 유방암 진단 바이오마커인 CA15-3을 검출하는 것 보다 본 발명의 티오레독신 1에 특이적으로 결합하는 단일클론항체를 사용하여 티오레독신 1을 검출하는 것이 민감도와 특이도가 월등히 우수하여 유방암 진단의 정확성 및 신뢰성을 현저히 높일 수 있다.
도 1은 티오레독신 1 항원을 발현하는 재조합 벡터의 개열지도 및 실시예 1에서 획득한 항체의 아이소타이핑(isotying) 결과를 나타낸 것이다.
도 2는 실시예 1에서 획득한 9G7(AB1) 항체의 경쇄(a) 및 중쇄(b) 아미노산 서열을 나타낸 것이다.
도 3은 실시예 1에서 획득한 2B4(AB2) 항체의 경쇄(a) 및 중쇄(b) 아미노산 서열을 나타낸 것이다.
도 4는 친화도가 좋은 항체 B264의 경쇄(a) 및 중쇄(b)를 발현하는 재조합 벡터의 개열지도를 나타낸 것이다.
도 5는 친화도가 좋은 항체 B266의 경쇄(a) 및 중쇄(b)를 발현하는 재조합 벡터의 개열지도를 나타낸 것이다.
도 6은 SDS-PAGE를 이용한 항체의 환원(+) 및 비-환원(-) 상태를 확인한 것으로, (a)는 항체 B264를, (b)는 항체 B266을 나타낸다.
도 7은 SDS-PAGE를 이용한 항체 B266-1의 환원(+) 및 비-환원(-) 상태를 확인한 것으로, 상기 항체 B266-1은 항체 B266의 Fc 부분이 인간 IgG1으로 변경된 것이다.
도 8은 항체 B266-1과 B264의 친화도(affinity)를 분석한 결과를 나타낸 것으로, (a)는 항체 농도에 따른 반응값과 그에 따른 그래프를 나타낸 것이고, (b)는 프리즘(Prism) 프로그램을 이용한 항체의 친화도를 분석한 결과이다.
도 9는 항체 B266-1과 B264를 이용한 ELISA에 의한 결과를 ROC 분석하여 민감도와 특이도를 계산한 결과를 나타낸 것이다.
이하, 본 발명을 더욱 상세히 설명한다.
상술한 바와 같이, 본 발명자들은 이전 연구를 통해 티오레독신 1이 정상 유방 조직에서는 낮게 발현되지만 유방암 조직에서는 매우 높게 발현됨을 확인하고 티오레독신 1이 유방암 진단용 마커로서 유용함을 입증한 바 있다.
이에, 본 발명자들은 추가 연구를 통해 티오레독신 1에 매우 특이적으로 결합하여 유방암 환자를 스크리닝 하는데 유용한 단일클론항체를 개발하였다. 본 발명의 단일클론항체는 티오레독신 1에 대한 결합 친화도 우수하여 티오레독신 1에 매우 특이적으로 결합하고, 또한 민감도와 특이도가 매우 높아 유방암 환자를 스크리닝하는데 유용하게 사용될 수 있다. 나아가, 기존의 다른 유방암 진단 바이오마커인 CA15-3을 검출하는 것 보다 본 발명의 티오레독신 1에 특이적으로 결합하는 단일클론항체를 사용하여 티오레독신 1을 검출하는 것이 민감도와 특이도가 월등히 우수하여 유방암 진단의 정확성 및 신뢰성을 현저히 높일 수 있다.
본 발명은 인간 티오레독신(Thioredoxin-1, Trx1)에 결합하는 단일클론항체 또는 이의 항원 결합 단편을 제공한다.
본 발명의 단일클론항체는 하이브리도마, 재조합 및 파지 디스플레이 기술, 또는 이의 조합을 이용한 방법 등의 당해 기술 분야에 공지된 매우 다양한 기술을 사용하여 제조할 수 있다. 예를 들어, 단일클론항체는 당해 기술 분야에서 공지된 기법 등의 하이브리도마 기법을 이용하여 제조할 수 있다. 본원에서 "단일클론항체"라는 용어는, 하이브리도마 기법을 통해 생산되는 항체만을 한정하는 것은 아니다. 용어 "단일클론항체"는 임의의 진핵 생물, 원핵 생물 또는 파지 클론 등의 단일 클론으로부터 유래되는 항체를 지칭하며, 이의 생산 방법을 지칭하는 것은 아니다.
하이브리도마 기법을 이용한 특이 항체의 생산 및 스크리닝 방법은 당해 기술 분야에서 일상적이며 잘 공지되어 있다. 비제한적인 예로, 마우스를 목적 항원 또는 이러한 항원을 발현하는 세포로 면역화할 수 있다. 면역 반응이 검출되면, 예를 들어, 마우스 혈청에서 항원에 특이적인 항체가 검출되면, 마우스 비장을 회수하여 비장세포를 분리한다. 그 후, 비장세포를 주지의 기법으로 임의의 적합한 골수종 세포, 예를 들어, P3U1, P3X63-Ag8, P3X63-Ag8-U1, P3NS1-Ag4, SP2/0-Ag14, P3X63-Ag8-653 등과 융합한다. 하이브리도마를 선별하고, 제한 희석에 의해 클로닝한다. 그 후, 하이브리도마 클론에 대해 당해 기술 분야에 공지된 방법으로 항원에 결합할 수 있는 항체를 분비하는 세포인지를 평가한다. 일반적으로 항체를 높은 수준으로 포함하는 복수는, 양성의 하이브리도마 클론을 마우스 복강에 접종함으로써 만들 수 있다. 본 발명의 바람직한 일실시예에서는 도 1(a)의 개열지도를 갖는 재조합 벡터를 대장균에 형질감염시켜 Trx1 항원을 제조하였다. 이후, 항원에 의해 면역화된 쥐의 비장을 분리하고 골수종 세포(myeloma cell; sp2/0)와 융합하여 Trx1과 반응하는 항체를 생산하는 세포를 ELISA법으로 확인하였다.
본 발명의 바람직한 단일클론항체 또는 이의 항원 결합 단편은 다음의 (a) 또는 (b)를 포함할 수 있으며, 본원에서 각각 B264 및 B266-1로 지칭될 수 있다:
(a) 서열번호 1의 아미노산 서열로 이루어진 경쇄 CDR1, 서열번호 2의 아미노산 서열로 이루어진 경쇄 CDR2 및 서열번호 3의 아미노산 서열로 이루어진 경쇄 CDR3을 포함하는 경쇄 가변영역, 및 서열번호 4의 아미노산 서열로 이루어진 중쇄 CDR1, 서열번호 5의 아미노산 서열로 이루어진 중쇄 CDR2 및 서열번호 6의 아미노산 서열로 이루어진 중쇄 CDR3을 포함하는 중쇄 가변영역; 또는
(b) 서열번호 7의 아미노산 서열로 이루어진 경쇄 CDR1, 서열번호 8의 아미노산 서열로 이루어진 경쇄 CDR2 및 서열번호 9의 아미노산 서열로 이루어진 경쇄 CDR3을 포함하는 경쇄 가변영역, 및 서열번호 10의 아미노산 서열로 이루어진 중쇄 CDR1, 서열번호 11의 아미노산 서열로 이루어진 중쇄 CDR2 및 서열번호 12의 아미노산 서열로 이루어진 중쇄 CDR3을 포함하는 중쇄 가변영역.
본 명세서에서, 용어“CDR(complementarity determining region)”은 면역글로블린 중쇄 및 경쇄의 고가변 영역(hypervariable region)의 아미노산 서열을 의미한다. 중쇄(CDRH1, CDRH2 및 CDRH3) 및 경쇄(CDRL1, CDRL2 및 CDRL3)에는 각각 3개의 CDR이 포함되어 있으며, 이들 CDR은 항체가 항원 또는 에피토프에 결합하는 데 있어서 주요한 접촉 잔기를 제공한다.
본 발명의 바람직한 단일클론항체 또는 이의 항원 결합 단편은 다음의 (c) 또는 (d)를 포함할 수 있으며, 본원에서 각각 B264 및 B266-1로 지칭될 수 있다:
(c) 서열번호 13의 아미노산 서열로 이루어진 경쇄 가변영역 및 서열번호 14의 아미노산 서열로 이루어진 중쇄 가변영역; 또는
(d) 서열번호 15의 아미노산 서열로 이루어진 경쇄 가변영역 및 서열번호 16의 아미노산 서열로 이루어진 중쇄 가변영역.
본 발명의 바람직한 단일클론항체 또는 이의 항원 결합 단편은 다음의 (e) 또는 (f)를 포함할 수 있으며, 본원에서 각각 B264 및 B266으로 지칭될 수 있다:
(e) 서열번호 17의 아미노산 서열로 이루어진 경쇄 및 서열번호 18의 아미노산 서열로 이루어진 중쇄; 또는
(f) 서열번호 19의 아미노산 서열로 이루어진 경쇄 및 서열번호 20의 아미노산 서열로 이루어진 중쇄.
본 발명의 바람직한 단일클론항체는 B264, B265, B266, B267, B268 또는 B269로 지칭되며, 가장 바람직하게는 B264 또는 B266-1일 수 있다. B266-1은 B266의 Fc 부분이 인간 IgG1으로 변경된 단일클론항체이다.
자연발생적인 항체 구조 단위는 통상 사합체(tetramer)를 포함한다. 상기 사합체는 각각 통상적으로 2개의 동일한 폴리펩티드 쇄의 쌍으로 구성되며, 각 쌍은 1개의 전장 경쇄(통상 분자량이 약 15kDa임) 및 1개의 전장 중쇄(통상 분자량이 약 50 내지 70kDa임)를 갖는다. 경쇄 및 중쇄 각각의 아미노-말단 부위는 통상적으로 항원 인지에 관여하는 약 100 내지 110 또는 그 이상의 아미노산의 가변 영역을 포함한다. 각 쇄의 카복시-말단 부위는 통상적으로 효과기 기능에 관여하는 불변 영역을 한정한다. 인간 경쇄는 통상적으로 카파(κ) 및 람다(λ) 경쇄로서 분류된다. 중쇄는 통상적으로 뮤, 델타, 감마, 알파 또는 입실론으로서 분류되며, 각각 IgM, IgD, IgG, IgA 및 IgE로서 항체의 이소타입을 정의한다. IgG는, 이로써 제한되는 것은 아니지만, IgG1, IgG2, IgG3 및 IgG4를 포함한 몇 개의 서브클래스를 갖는다. IgM은, 이로써 제한되는 것은 아니지만, IgM1 및 IgM2를 포함한 서브클래스를 갖는다. IgA는 유사하게, 이로써 제한되는 것은 아니지만, IgA1 및 IgA2를 포함한 서브클래스로 세분된다. 전장 경쇄 및 중쇄 내에서, 통상적으로 가변 및 불변 영역은 약 12개 이상 아미노산의 "J" 영역에 의해 결합되고, 중쇄는 또한 약 10개 이상 아미노산의 "D" 영역을 포함한다. 각각의 경쇄/중쇄 쌍의 가변 영역은 통상 항원-결합 부위를 형성한다. 본 발명의 바람직한 일실시예에 따르면, 본 발명의 단일클론항체의 중쇄는 IgG1, IgG2a, IgG2b, IgG3, IgA 또는 IgM 이소타입일 수 있고, 경쇄는 카파쇄 또는 람다쇄일 수 있으며, 바람직하게는 카파 경쇄 및 IgG1 중쇄일 수 있다.
본 발명의 단일클론항체 또는 이의 항원 결합 단편에 있어서, "이의 항원 결합 단편"은 항원 결합 기능을 보유하고 있는 단편을 의미하며, Fab, F (ab'), F (ab')2 및 Fv 또는 단쇄 항체 분자 분자 등을 포함한다. 항체 결합 단편 중, Fab는 경쇄 및 중쇄의 가변 영역과 경쇄의 불변 영역 및 중쇄의 첫 번째 불변 영역 (CH1)을 가지는 구조로 1개의 항원결합부위를 가진다. F (ab')는 중쇄 CH1 도메인의 C-말단에 하나 이상의 시스테인 잔기를 포함하는 힌지 영역 (hinge region)을 가진다는 점에서 Fab와 차이가 있다. F (ab')2 는 Fab'의 힌지 영역의 시스테인 잔기가 디설파이드 결합을 이루면서 생성된다. Fv는 중쇄 가변 부위 및 경쇄 가변 부위만을 가지고 있는 최소의 항체조각을 말한다. 이러한 항체 단편은 단백질 가수분해 효소를 이용해서 얻을 수 있고, 예를 들어, 전체 항체를 파파인으로 제한 절단하면 Fab를 얻을 수 있고 펩신으로 절단하면 F (ab')2 단편을 얻을 수 있으며, 바람직하게는 유전자 재조합 기술을 통하여 제작할 수 있다.
본 발명의 바람직한 항체는 키메라 항체, 인간화 항체 또는 완전한 인간 항체일 수 있다.
키메라 항체는 한 종의 항체 생성 세포로부터 수득된 가변 경쇄 및 중쇄 영역(VL 및 VH)과 또 다른 종으로부터의 불변 경쇄 및 중쇄 영역을 조합시킴으로써 재조합 수단에 의해 제조될 수 있다. 통상적으로, 키메라 항체는 주로 인간 도메인을 갖는 항체를 생성시키기 위해 설치류 또는 토끼 가변 영역 및 인간 불변 영역을 이용한다. 이러한 키메라 항체의 생성은 당 분야에 널리 공지되어 있고, 이는 표준 수단에 의해 달성될 수 있다. 본 발명의 키메라 항체의 인간 불변 영역은 IgG1, IgG2, IgG3, IgG4, IgG5, IgG6, IgG7, IgG8, IgG9, IgG10, IgG11, IgG12, IgG13, IgG14, IgG15, IgG16, IgG17, IgG18 또는 IgG19 불변 영역으로부터 선택될 수 있음이 추가로 고려된다.
인간화 항체는 더욱 더 인간과 유사한 면역글로불린 도메인을 함유하도록 공학처리되고, 이는 동물 유래 항체의 상보성 결정 영역만을 포함한다. 이는 모노클로날 항체의 가변 영역의 과가변 루프의 서열을 주의깊게 검사하고, 상기 서열을 인간 항체 사슬의 구조에 적합화시킴으로써 달성된다.
완전한 인간 항체는 CDR을 포함하여 경쇄 및 중쇄 둘 모두의 전체 서열이 인간 유전자로부터 발생한 항체 분자이다.
본 발명은 또한, 본 발명의 단일클론항체 또는 이의 항원 결합 단편의 중쇄 및/또는 경쇄를 코딩하는 핵산 분자를 제공한다.
본 발명에서 용어 "핵산 분자"는 DNA(gDNA 및 cDNA) 그리고 RNA 분자를 포괄적으로 포함하는 의미를 가지며, 핵산 분자에서 기본 구성단위인 뉴클레오타이드는 자연의 뉴클레오타이드뿐만 아니라, 당 또는 염기 부위가 변형된 유사체(analogue)도 포함한다. 본 발명의 중쇄 및 경쇄 가변영역을 코딩하는 핵산 분자의 서열은 변형될 수 있다. 상기 변형은 뉴클레오타이드의 추가, 결실, 또는 비보존적 치환 또는 보존적 치환을 포함한다.
본 발명의 핵산 분자는 상기한 뉴클레오타이드 서열에 대하여 실질적인 동일성을 나타내는 뉴클레오타이드 서열도 포함하는 것으로 해석된다. 상기의 실질적인 동일성은, 상기한 본 발명의 뉴클레오타이드 서열과 임의의 다른 서열을 최대한 대응되도록 정렬(align)하고, 당업계에서 통상적으로 이용되는 알고리즘을 이용하여 정렬된 서열을 분석한 경우에, 최소 80%의 상동성, 일 특정예에서는 최소 90%의 상동성, 다른 특정예에서는 최소 95%의 상동성을 나타내는 뉴클레오타이드 서열을 의미한다.
본 발명의 바람직한 일실시예에 따르면, 본 발명의 단일클론항체의 경쇄를 코딩하는 핵산 분자는 서열번호 21의 뉴클레오티드 서열로 이루어질 수 있고, 중쇄를 코딩하는 핵산 분자는 서열번호 22의 뉴클레오티드 서열로 이루어질 수 있다.
본 발명의 또 다른 바람직한 일실시예에 따르면, 본 발명의 단일클론항체의 중쇄를 코딩하는 핵산 분자는 서열번호 23의 뉴클레오티드 서열로 이루어질 수 있고, 경쇄를 코딩하는 핵산 분자는 서열번호 24의 뉴클레오티드 서열로 이루어질 수 있다.
본 발명은 또한, 상기 단일클론항체의 중쇄를 코딩하는 핵산 분자와 경쇄를 코딩하는 핵산 분자 또는 상기 핵산분자 모두를 포함하는 재조합 벡터를 제공하는 것이다.
본 발명의 재조합 벡터 시스템은 당업계에 공지된 다양한 방법을 통해 구축될 수 있다. 본 발명의 벡터는 전형적으로 클로닝을 위한 벡터 또는 발현을 위한 벡터로서 구축될 수 있다. 또한, 본 발명의 벡터는 원핵 세포 또는 진핵 세포를 숙주로 하여 구축될 수 있다. 예를 들어, 본 발명의 벡터가 발현 벡터이고, 원핵 세포를 숙주로 하는 경우에는, 전사를 진행시킬 수 있는 강력한 프로모터(예컨대, tac 프로모터, lac 프로모터, lacUV5 프로모터, lpp 프로모터, pLλ프로모터, pRλ프로모터, rac5 프로모터, amp 프로모터, recA 프로모터, SP6 프로모터, trp 프로모터 및 T7 프로모터 등), 해독의 개시를 위한 라이보좀 결합 자리 및 전사/해독 종결 서열을 포함하는 것이 일반적이다. 숙주세포로서 E. coli(예컨대, HB101, BL21, DH5α 등)가 이용되는 경우, E. coli 트립토판 생합성 경로의 프로모터 및 오퍼레이터 부위 그리고 파아지 λ의 좌향 프로모터(pLλ프로모터)가 조절부위로서 이용될 수 있다. 숙주세포로서 바실러스 균이 이용되는 경우, 바실러스 츄린겐시스의 독소단백질 유전자의 프로모터 또는 바실러스균에서 발현 가능한 어떠한 프로모터라도 조절부위로 이용될 수 있다.
한편, 본 발명의 재조합 벡터는 당업계에서 사용되는 플라스미드(예: pCL, pSC101, pGV1106, pACYC177, ColE1, pKT230, pME290, pBR322, pUC8/9, pUC6, pBD9, pHC79, pIJ61, pLAFR1, pHV14, pGEX 시리즈, pET 시리즈 및 pUC19 등), 파지(예: λgt4·λB, λ-Charon, λΔz1 및 M13 등) 또는 바이러스(예: SV40 등)를 조작하여 제작될 수 있다.
본 발명의 벡터가 발현 벡터이고, 진핵 세포를 숙주로 하는 경우에는, 포유동물 세포의 지놈으로부터 유래된 프로모터(예: 메탈로티오닌 프로모터, β-액틴 프로모터, 사람 헤로글로빈 프로모터 및 사람 근육크레아틴 프로모터) 또는 포유동물 바이러스로부터 유래된 프로모터(예: 아데노바이러스 후기 프로모터, 백시니아 바이러스 7.5K 프로모터, SV40 프로모터, 사이토메갈로바이러스(CMV) 프로모터, HSV의 tk 프로모터, 마우스 유방 종양 바이러스(MMTV) 프로모터, HIV의 LTR 프로모터, 몰로니 바이러스의 프로모터 엡스타인바 바이러스(EBV)의 프로모터 및 로우스 사코마 바이러스(RSV)의 프로모터)가 이용될 수 있으며, 전사 종결 서열로서 폴리아데닐화 서열을 일반적으로 갖는다.
본 발명의 재조합 벡터는 그로부터 발현되는 항체의 정제를 용이하게 하기 위하여 다른 서열과 융합될 수도 있다. 융합되는 서열은, 예컨대 글루타티온 S-트랜스퍼라제(Amersham Pharmacia Biotech, USA); 말토스 결합 단백질(NEB, USA); FLAG(IBI, USA); 6x His(hexahistidine; Qiagen, USA), Pre-S1, c-Myc와 같은 태그 서열; ompA, pelB와 같은 선도서열 등이 있다. 또한, 본 발명의 벡터에 의해 발현되는 단백질이 항체이기 때문에 정제를 위한 추가적인 서열 없이도, 발현된 항체는 단백질 A 컬럼 등을 통하여 용이하게 정제할 수 있다.
한편, 본 발명의 재조합 벡터는 선택표지로서 당업계에서 통상적으로 이용되는 항생제 내성 유전자를 포함하며, 예를 들어 암피실린, 겐타마이신, 카베니실린, 클로람페니콜, 스트렙토마이신, 카나마이신, 게네티신, 네오마이신 및 테트라사이클린에 대한 내성 유전자가 있다.
본 발명의 항체를 발현하는 벡터는, 경쇄와 중쇄가 하나의 벡터에서 동시에 발현되는 벡터 시스템이거나 또는 경쇄와 중쇄를 각각 별도의 벡터에서 발현시키는 시스템 모두 가능하다. 후자의 경우, 두 벡터는 동시 형질전환(co-transfomation) 및 표적 형질전환(targeted transformation)을 통하여 숙주세포로 도입된다. 동시 형질전환은 경쇄 및 중쇄를 코딩하는 각각의 벡터 DNA를 동시에 숙주세포로 도입한 뒤 경쇄와 중쇄를 모두 발현하는 세포를 선별하는 방법이다. 표적 형질전환은 경쇄(또는 중쇄)를 포함하는 벡터로 형질전환 된 세포를 선별하고 경쇄를 발현하는 선별된 세포를 중쇄(또는 경쇄)를 포함하는 벡터로 다시 형질전환 하여 경쇄 및 중쇄 모두를 발현하는 세포를 최종적으로 선별하는 방법이다.
본 발명은 또한, 본 발명의 재조합 벡터를 포함하는 숙주세포를 제공한다. 상기 숙주세포는 본 발명의 재조합 벡터로 형질전환된 세포이다. 본 발명의 벡터를 안정되면서 연속적으로 클로닝 및 발현시킬 수 있는 숙주 세포는 당업계에 공지되어 어떠한 숙주세포도 이용할 수 있으며, 예를 들어, 대장균(Escherichia coli), 바실러스 서브틸리스(Bacillus subtilis) 및 바실러스 츄린겐시스(B. thuringensis)와 같은 바실러스 속 균주(Bacillus spp.), 스트렙토마이세스(Streptomyces), 슈도모나스(Pseudomonas)(예를 들면, 슈도모나스 푸티다(Pseudomonas putida)), 프로테우스 미라빌리스(Proteus mirabilis) 또는 스타필로코쿠스(Staphylococcus)(예를 들면, 스타필로코쿠스 카르노수스(Staphylococus carnosus))와 같은 원핵 숙주세포를 포함하나, 이로 제한되는 것은 아니다.
상기 벡터의 적합한 진핵세포 숙주세포는 자낭균문(Phylum Ascomycota)에 속하는 아스페츠길루스 속 (Aspergillus spp.) 및 뉴로스포라 크라사(Neurospora crassa) 등의 다세포성 곰팡이 (multicellular fungi)와 피치아 파스토리스(Pichia pastoris), 사카로마이세스 세르비시아(Saccharomyces cerevisiae), 스키조사카로마세스(Schizosaccharomyces)와 같은 효모를 포함하는 단세포성 곰팡이(unicellular fungi), 그 밖의 하등 진핵세포, 곤충-유래 세포와 같은 고등 진핵생물의 세포, 그리고 식물 또는 포유동물로부터 유래한 세포를 이용할 수 있다.
본 발명에서 용어“형질감염”은 본 발명의 재조합 벡터를 이용하여 숙주 세포에 목적하는 유전자를 도입하는 것을 말하며, “형질전환”과 동일한 의미로 사용된다. 따라서, 숙주세포로의“형질감염”및/또는“형질전환”은 핵산을 유기체, 세포, 조직 또는 기관에 도입하는 어떤 방법도 포함되며 당 분야에서 공지된 바와 같이 숙주 세포에 따라 적합한 표준 기술을 선택하여 수행할 수 있다. 이런 방법에는 전기충격유전자전달법(electroporation), 원형질 융합, 인산칼슘(CaPO4) 침전, 염화칼슘(CaCl2) 침전, 실리콘 카바이드 섬유 이용한 교반, 아그로 박테리아 매개된 형질전환, PEG, 덱스트란 설페이트, 리포펙타민 및 건조/억제 매개된 형질전환 방법 등이 포함되나, 이로 제한되지 않는다.
본 발명은 또한, 상기 숙주세포를 배양하는 단계를 포함하는, 티오레독신 1에 특이적으로 결합하는 단일클론항체 또는 이의 항원 결합 단편의 제조방법을 제공한다.
항체 또는 그의 항원 결합 단편 제조를 위한 숙주세포의 배양은 당업계에 알려진 적당한 배지와 배양조건에 따라 이루어질 수 있다. 이러한 배양과정은 당업자라면 선택되는 균주에 따라 용이하게 조정하여 사용할 수 있다. 세포 배양은, 세포의 성장방식에 따라 현탁배양과 부착배양, 배양방법에 따라 회분식, 유가식 및 연속배양식의 방법으로 구분된다. 배양에 사용되는 배지는 특정한 균주의 요구조건을 적절하게 만족시켜야 하다.
동물세포 배양에 사용하는 상기 배지는 다양한 탄소원, 질소원 및 미량원소 성분을 포함한다. 사용될 수 있는 탄소원의 예는, 포도당, 자당, 유당, 과당, 말토오스, 전분 및 셀룰로오스와 같은 탄수화물, 대두유, 해바라기유, 피마자유 및 코코넛유와 같은 지방, 팔미트산, 스테아린산 및 리놀레산과 같은 지방산, 글라이세롤 및 에탄올과 같은 알코올, 그리고 아세트산과 같은 유기산을 포함한다. 이들 탄소원은 단독 또는 조합되어 사용될 수 있다. 사용될 수 있는 질소원의 예는, 펩톤, 효모 추출물, 육즙, 맥아 추출물, 옥수수 침지액(CSL) 및 대두밀과 같은 유기 질소원 및 요소, 황산암모늄, 염화암모늄, 인산암모늄, 탄산암모늄 및 질산암모늄과 같은 무기 질소원을 포함한다. 이들 질소원은 단독 또는 조합되어 사용될 수 있다. 상기 배지에는 인원으로서, 인산이수소칼륨, 인산수소이칼륨 및 대응되는 소듐-함유 염이 포함될 수 있다. 또한, 황산마그네슘 또는 황산철과 같은 금속염을 포함할 수 있다. 그 외에, 아미노산, 비타민, 및 적절한 전구체 등이 포함될 수 있다.
배양 중에 수산화암모늄, 수산화칼륨, 암모니아, 인산 및 황산과 같은 화합물을 배양물에 적절한 방식으로 첨가하여, 배양물의 pH를 조정할 수 있다. 또한, 배양 중에는 지방산 폴리글리콜 에스테르와 같은 소포제를 사용하여 기포 생성을 억제할 수 있다. 또한, 배양물의 호기상태를 유지하기 위하여, 배양물 내로 산소 또는 산소-함유 기체(예, 공기)를 주입한다. 배양물의 온도는 보통 20℃ 내지 45℃, 바람직하게는 25℃ 내지 40℃이다.
숙주세포를 배양하여 수득한 항체는 정제하지 않은 상태로 사용될 수 있으며 추가로 다양한 통상의 방법, 예를 들면 투석, 염 침전 및 크로마토그래피 등을 이용하여 고순도로 정제하여 사용될 수 있다. 그 중에서 크로마토그래피를 이용하는 방법이 가장 많이 사용되며, 컬럼의 종류와 순서는 항체의 특성, 배양방법 등에 따라 이온교환 크로마토그래피, 크기배제 크로마토그래피, 친화성 크로마토그래피 등에서 선택할 수 있다.
본 발명은 또한, 본 발명의 단일클론항체 또는 이의 항원 결합 단편을 포함하는 유방암 진단 키트 및 이를 이용하여 유방암 진단에 필요한 정보를 제공하는 방법을 제공한다.
본 발명에서 용어, "진단"은 병리 상태의 존재 또는 특징을 확인하는 것을 의미한다. 본 발명의 목적상, 진단은 유방암 발병 여부를 확인하는 것이다.
티오레독신 1 단백질은 유방암 진단 마커로서, 정상 유방 조직에 비해 유방암 조직에서 발현 수준이 높게 나타난다.
본 발명의 바람직한 일실시예에 따르면, 상기 유방암 진단 키트는 ELISA(Enzyme Linked Immunosorbent Assay) 키트일 수 있으며, 바람직하게는 직접 ELISA, 간접 ELISA, 직접적 샌드위치 ELISA 및 간접적 샌드위치 ELISA로 이루어진 군에서 선택된 1종 이상일 수 있다. 본 발명의 바람직한 일실시예에서는 샌드위치 ELISA 키트에 포함된 2종의 항체는, 코팅 항체로서 단일클론항체 B266-1, 검출 항체로서 단일클론항체 B264가 포함된다.
본 발명의 유방암 진단 키트는 Trx1에 대한 항체 이외에 면역학적 분석에 사용되는 당업계에 공지된 도구 또는 시약을 추가로 포함할 수 있다.
상기에서 면역학적 분석은 항원과 항체의 결합을 측정할 수 있는 있는 방법이라면 모두 포함될 수 있다. 이러한 방법들은 당 분야에 공지되어 있으며, 예를 들어, 웨스턴블랏, ELISA, 방사선면역분석법, 방사면역 확산법, 면역형광분석법, 면역 블롯, 오우크레로니 면역 확산법, 로케트 면역전기영동, 조직면역 염색, 면역 침전분석법, 보체 고정 분석법, 면역크로마토그래피 분석법, FACS, 단백질 칩 등이 있으나, 이에 제한되는 것은 아니다.
면역학적 분석에 사용되는 도구 또는 시약으로는 적합한 담체 또는 지지체, 검출 가능한 신호를 생성할 수 있는 표지, 용해제, 세정제, 및 안정화제 등을 포함할 수 있다. 적합한 담체로는, 이에 한정되지는 않으나, 또한, 표지물질이 효소인 경우에는 효소활성을 측정할 수 있는 기질, 적당한 완충용액, 발색 효소 또는 형광물질로 표지된 2차 항체, 발색 기질 및 반응 정지제 등을 포함할 수 있다.
본 발명의 키트에 포함되는, Trx1에 대한 항체는 바람직하게는 적합한 담체 또는 지지체에 문헌에 개시된 바와 같은 다양한 방법을 이용하여 고정될 수 있으며, 적합한 담체 또는 지지체의 예로는 PBS, 폴리스틸렌, 폴리에틸렌, 폴리프로필렌, 폴리에스테르, 폴리아크릴로니트릴, 불소 수지, 아가로스, 셀룰로즈, 니트로셀룰로즈, 덱스트란, 세파덱스, 세파로즈, 리포솜, 카복시메틸 셀룰로즈, 폴리아크릴아미드, 폴리스테린, 반려암, 여과지, 이온교환수지, 플라스틱 필름, 플라스틱 튜브, 폴리아민-메틸 비닐-에테르-말레산 공중합체, 아미노산 공중합체, 에틸렌-말레산 공중합체, 나일론, 금속, 유리, 글래스 비드, 또는 자성 입자 등이 포함된다. 그 외의 다른 고체 기질로는 세포 배양 플레이트, ELISA 플레이트, 튜브 및 폴리머성 막이 있다. 상기 지지체는 임의의 가능한 형태, 예를 들어 구형 (비드), 원통형 (시험관 또는 웰 내면), 평면형 (시트, 시험 스트립)을 가질 수 있다.
검출 가능한 신호를 생성할 수 있는 표지는 항원-항체 복합체의 형성을 정성 또는 정량적으로 측정가능하게 하며, 이의 예로는 효소, 형광물질, 리간드, 발광물질, 미소입자 (microparticle), 레독스 분자 및 방사성 동위원소 등을 사용할 수 있다. 효소로는 β-글루쿠로니다제, β-D-글루코시다제, 우레아제, 퍼옥시다아제 (호스라디시 퍼옥시다제 등), 알칼라인 포스파타아제, 아세틸콜린에스테라아제, 글리코즈 옥시다아제, 헥소키나제, 말레이트 디하이드로게나아제, 글루코스-6-인산디하이드로게나아제, 인버타아제, 루시퍼라아제 등을 사용할 수 있다. 형광물질로는 플루오레신, 이소티오시아네이트, 로다민, 피코에리테린, 피코시아닌, 알로피코시아닌, 플루오르신이소티옥시아네이트 등을 사용할 수 있다. 리간드로는 바이오틴 유도체 등이 있으며, 발광물질로는 아크리디늄 에스테르, 루시페린 등이 있다. 미소입자로는 콜로이드 금, 착색된 라텍스 등이 있고 레독스 분자로는 페로센, 루테늄 착화합물, 바이올로젠, 퀴논, Ti 이온, Cs 이온, 디이미드, 1,4-벤조퀴논, 하이드로퀴논 등이 있다. 방사성 동위원소로는 3H, 14C, 32P, 35S, 36Cl, 51Cr, 57Co, 58Co, 59Fe, 90Y, 125I, 131I, 186Re 등이 있다. 그러나 상기 예시된 것들 외에 면역학적 분석법에 사용할 수 있은 것이라면 어느 것이라도 사용할 수 있다.
효소 발색 기질로서, 예를 들어 효소 표지로서 호스라디시 퍼옥시다제 (HRP) 를 선택한 경우에는 기질로 3-아미노-9-에틸카르바졸, 5-아미노살리실산, 4-클로로-1-나프톨, o-페닐렌디아민, 2,2'-아지노-비스(3-에틸벤즈티아졸린-6-술폰산), 3,3-디아미노벤지딘, 3,3',5,5'-테트라메틸벤지딘, o-디아니시딘, 또는 3,3-디메톡시벤지딘 포함 용액을 사용할 수 있다. 또한, 효소 표지로서 알칼라인 포스파타아제를 선택한 경우에는 기질로 5-브로모-4-클로로-3-인돌릴 포스페이트, 니트로블루 테트라졸륨, 또는 p-니트로페닐 포스페이트 포함 용액을 사용할 수 있다. 또한, 효소 표지로서 β-D-갈락토시다제를 선택한 경우에는 기질로 o-니트로페닐-β-D-갈락토시드 또는 5-브로모-4-클로로-3-인돌-β-D-갈락토피라노시드 포함 용액을 사용할 수 있다. 이 외에도 당업계에 알려진 다양한 효소 및 효소 발색 기질을 사용할 수 있다.
본 발명의 바람직한 일실시예에 따르면, 본 발명의 유방암 진단에 필요한 정보를 제공하는 방법은 다음의 단계로 수행될 수 있다:
(a) 본 발명의 단일클론항체 또는 이의 항원 결합 단편 중 어느 1 종을 유방암이 의심되는 개체로부터 분리된 생물학적 시료에 접촉시키는 단계;
(b) 항원-항체 복합체 형성을 통해 상기 생물학적 시료에서 단일클론항체 또는 이의 항원 결합 단편에 결합된 티오레독신 1 단백질의 발현 수준을 측정하는 단계; 및
(c) 상기 (b) 단계에서 측정된 티오레독신 1 단백질의 발현 수준을 대조군과 비교하여 대조군에 비해 상기 단백질의 발현 수준이 높으면 유방암 환자로 판정하는 단계.
본 발명의 바람직한 다른 일실시예에 따르면, 본 발명의 유방암에 진단에 필요한 정보를 제공하는 방법은 다음의 단계로 수행될 수 있다:
(a) 고체 지지체를 제2항, 제4항 또는 제6항의 단일클론항체 또는 이의 항원 결합 단편으로 코팅하는 단계;
(b) 유방암이 의심되는 개체로부터 분리된 생물학적 시료를 상기 코팅된 고체 지지체에 적용하는 단계;
(c) 결합되지 않은 샘플을 제거하는 단계;
(d) 제1항, 제3항 또는 제5항의 단일클론항체 또는 이의 항원 결합 단편으로 고체 지지체에 적용하는 단계;
(e) 결합되지 않은 단일클론항체 또는 이의 항원 결합 단편을 제거하는 단계;
(f) 티오레독신 1 단백질의 발현 수준을 측정하는 단계; 및
(g) 상기 (f) 단계에서 측정된 티오레독신 1 단백질의 발현 수준을 대조군과 비교하여, 대조군에 비해 상기 단백질의 발현 수준이 높으면 유방암 환자로 판정하는 단계.
본 발명에서, 용어 "분리된 생물학적 시료"란, 유방암 마커인 Trx1 단백질의 발현 수준이 차이나는 조직(유방 조직), 세포(유방 세포), 전혈, 혈장, 혈청, 혈액, 타액, 활액, 뇨, 객담, 림프액, 뇌척수액, 조직 부검 시료(뇌, 피부, 림프절, 척수 등), 세포 배양 상등액, 또는 파열된 진핵세포 등을 포함하며, 암의 원발 병소 뿐 아니라 전이 병소에서 유래한 시료를 포함한다. 이들 생물학적 시료를 조작하거나 조작하지 않은 상태로 본 발명의 단일클론항체와 반응시켜 Trx1 단백질의 발현 수준을 확인할 수 있다.
본 발명에서 용어 "개체"는 소, 돼지, 양, 닭, 개, 인간 등을 포함하는 포유 동물, 조류 등을 포함하며, 유방암이 의심되는 개체는 제한없이 포함된다.
이하, 본 발명의 이해를 돕기 위하여 실시예 등을 들어 상세하게 설명하기로 한다. 그러나, 본 발명에 따른 실시예들은 여러 가지 다른 형태로 변형될 수 있으며, 본 발명의 범위가 하기 실시예들에 한정되는 것으로 해석되어서는 안될 것이다. 본 발명의 실시예들은 당업계에서 평균적인 지식을 가진 자에게 본 발명을 보다 상세하게 설명하기 위해 제공되는 것이다.
[ 실시예 1]
인간 티오레독신 1( Trx1 ) 항원 제조
1-1. Trx1 발현 벡터의 제조
인간 티오레독신 1 단백질을 암호화하는 유전자를 대장균에서 발현하기 위하여 대장균 codon usage에 근거하여 유전자를 합성하였다. 합성된 인간 티오레독신 1 유전자 서열은 다음 표 1과 같다.
염기서열
Trx 1 유전자 ATGGTCAAACAGATCGAATCAAAAACCGCATTTCAAGAAGCCCTGGACGCCGCTGGTGACAAACTGGTCGTGGTGGACTTTAGTGCTACCTGGTGCGGCCCGTGTAAAATGATTAAACCGTTTTTCCATAGCCTGTCTGAAAAATACAGTAACGTTATCTTTCTGGAAGTGGATGTTGATGACTGCCAGGACGTCGCGAGCGAATGCGAAGTGAAATGTATGCCGACGTTCCAGTTTTTCAAAAAAGGTCAAAAAGTCGGTGAATTTAGCGGTGCCAACAAAGAAAAACTGGAAGCCACGATTAACGAACTGGTG (서열번호 25)
인간 티오레독신 1 유전자를 증폭하기 위하여 사용한 프라이머 서열은 다음 표 2와 같다.
hTrx1 -For TAATGGTCAAACAGATCGAATC (서열번호 26 )
hTrx1 -Rev CACCAGTTCGTTAATCGTGGTAATGAAAGCT (서열번호 27 )
플라스미드에 클로닝하기 위하여 유전자를 증폭하고자 PCR(Polymerase chain reaction)을 수행하였다. 주형으로 사용하고자 합성한 유전자, 프라이머 (hTrx1-For, hTrx1-Rev) 각각 10 pmol, dNTP (각각 2.5 mM), Exprime Taq polymerase와 완충용액을 첨가하여 혼합한다. 이 용액을 95℃, 2분 반응 후, 95℃ 30 초, 55℃ 30초, 70℃ 20초 반응을 35회 반복 후, 70℃ 2분 반응하고 반응을 종결하였다. 증폭한 유전자를 정제한 후, pUC57 플라스미드의 multi-cloning site(MCS)에 존재하는 EcoR V 위치에 클로닝하기 위하여 플라스미드에 해당 제한효소를 처리하여 정제한다. 정제한 유전자와 제한효소가 처리된 플라스미드, 리가아제(Ligase)와 완충용액을 혼합하고, 반응하였다. 플라스미드를 E. coli DH5α로 형질전환하기 위하여 E. coli DH5α competent 세포주를 4℃에서 녹인 후, 플라스미드 혼합용액과 혼합하고 4℃에서 30분 반응하였다. 반응 후, 42℃에서 30초 열충격을 가한 후, 다시 4℃에서 2분 동안 안정화하고, 항생제 (ampicillin 50 ㎍/㎖)를 포함하는 LB(Luria-Burtani) 고체 배지에 분주하여 고르게 흡수시켜 37℃에서 16시간 이상 배양하였다. 배양한 배지에서 자란 콜로니 중 인간 티오레독신 1 유전자를 가지는 플라스미드를 선별하였다.
1-2. Trx1의 발현 및 정제
선별된 인간 티오레독신 1 유전자를 가지는 플라스미드를 정제한 후, 단백질을 발현하기 위하여 E. coli BL21 균주에 위에 언급한 방법에 따라 형질전환하였다. 형질전환된 균주로부터 티오레독신 1 단백질을 발현하기 위하여, 37℃ 하에서 OD600=0.5까지 항생제를 포함하는 LB 액체배지에서 균주를 배양한 후, 1 mM 농도가 되도록 IPTG (Isopropyl β-D-thiogalactopyranoside)를 첨가하여 3시간 더 배양하였다. 이후, 단백질 발현 여부를 SDS-PAGE로 확인하였다. 이 단백질을 순수 정제하기 위하여 수득한 세포주를 초음파 세포파쇄기(sonication)을 이용하여 파쇄 수, 원심분리 (12,000 rpm, 30 분, 4℃)하여 상등액을 얻었다. 얻은 상등액에 구매한 항 티오레독신 I 항체(LF-MA0055, Abfrontier)를 첨가하여 발현한 티오레독신 I과 결합한 후, 항체와 결합하는 Protein A/G PLUS-Agarose(sc-2003, Santa Cruz)를 첨가하여 반응하고, 원심분리하여 정제하였다. 이후, 순도 및 정량을 SDS-PAGE 상에서 확인하였다.
[ 실시예 2]
Trx1에 특이적인 단일클론항체의 생산 및 정제
2-1. 마우스의 면역화
정제된 인간 티오레독신 1 단백질을 생쥐(BALB/c)에 adjuvant와 혼합하여 주사하고 생쥐의 혈액을 채취하여 항체 생성여부를 ELISA 로 확인하였다. 2회 면역 후 항체의 역가(1:5,000)가 적정하게 증가함을 확인하였다.
2-2. 세포 융합 및 하이브리도마의 제조
면역된 생쥐에서 비장을 떼어내어 B 림프구를 분리한 다음, 배양한 골수종(myeloma) 세포(sp2/0)와 융합시켰다. 융합된 세포를 하이포크산틴(hypoxanthine), 아미놉테린(aminopterine) 및 티미딘(thymidine)이 첨가되어 있는 배지(HAT medium)에서 배양하여 골수종과 B 림프구만 융합된 세포(hybridoma)를 선택적으로 선별하여 배양하였다.
2-3. Trx1에 특이적인 단일클론항체를 생산하는 하이브리도마 세포의 선별
얻어진 하이브리도마(hybridoma) 세포 중에서 인간 티오레독신 1 단백질과 반응하는 항체 3종을 ELISA를 이용하여 확인하였다. ELISA 양성반응인 세포를 한계희석법(Limiting dilution method)을 이용하여 항원에 반응하는 항체를 생산하는 하이브리도마(hybridoma)를 선별하였다.
2-4. 단일클론항체의 생산 및 정제
획득한 3종의 하이브리도마(hybridoma)를 생쥐에 주입하여 복수를 획득하고, 이를 Protein A affinity chromatography를 이용하여 순수 정제하였다. 정제된 항체는 SDS-PAGE로 확인하였다.
[ 실시예 3]
단일클론항체의 이소타입 확인
Rapid ELISA Mouse mAbs Isotyping Kit(Pierce, Cat. 37503) 키트를 사용하여 상기 실시예 2에서 획득한 3종의 항체의 이소타입을 확인하였다.
그 결과, 도 1(b)에 나타난 바와 같이, 단일클론항체 2B4의 중쇄는 IgG1, 단일클론항체 8F3의 중쇄는 IgG12a, 단일클론항체 9G7의 중쇄는 IgG2b로 확인되었으며, 경쇄는 모두 카파(κ)임을 확인하였다.
[ 실시예 4]
단일클론항체 9G7(AB1)과 2B4(AB2)의 아미노산 서열 분석
상기 실시예 2에서 획득한 3종의 단일클론항체 중 9G7(AB1)과 2B4(AB2)의 중쇄 및 경쇄 아미노산 서열을 분석하였다. 역번역(backtranslation)과 재조합 발현(recombination expression)에 적합한 Fc 영역과의 융합이 가능한 서열로서 아미노산 서열을 결정하였다. IMTG 갭(gap) 배열을 통해 결정된 서열을 배열하고, 과돌연변이(hypermutation) 표를 이용하여 과돌연변이 및 완전한 CDR3 부분을 찾았다. 정확한 질량 펩타이드 맵(accurate mass peptide maps) 등을 통해 서열을 확인하고(도 2 및 3), MS/MS 스펙트럼을 이용하여 과돌연변이와 CDR3를 확인하였다.
[ 실시예 5]
ELISA를 이용한 친화도 비교 및 항체 결정
상기 과정을 통하여 획득한 아미노산 서열 중 과돌연변이(hypermutation)가 가능한 위치를 선정하였고, 이에 따라 9G7(AB1)은 4종(B266, B297, B268 및 B269)으로, 2B4(AB2)는 2종(B264 및 B265)으로 염기서열에 변화를 주어 유전자를 합성하였다. 얻어진 6종(B264~B269)을 발현하여 각각의 항체의 항원에 대한 친화도를 ELISA를 통하여 확인하였다 (표 3 내지 표 5에 제시된 T 이후 번호는 각각의 생산 batch 번호를 나타냄).
3 가지 종류의 항원, 즉, 아무것도 결합하지 않은(naked) Trx1, Fc가 결합된 Trx1(Trx1-Fc) 및 His 태그가 결합된 Trx1(Trx1-His) 각각에 대하여 직접(direct) ELISA를 통해 친화도를 확인하였고, 그 결과를 하기 표 3 내지 5에 순서대로 나타냈다. 표 3 내지 5에 나타난 바와 같이, IgG1(κ)는 B264, IgG2b(κ)는 B266이 3가지 항원에 대하여 가장 좋은 친화도를 나타냈다.
아무것도 결합하지 않은 Trx1 항원에 대한 반응 결과
Antibody ID 5000×(OD Value)
AB264-T150514-7 2.0575
B265-T150514-10 1.3225
AB264-T150514-8 1.1635
B265-T150514-9 0.9515
B267-T150519-5 0.8155
B269-T150519-9 0.735
B268-T150519-8 0.716
B268-T150519-7 0.670
B266-T150519-3 0.6625
B266-T150519-4 0.6615
B269-T150519-10 0.626
B267-T150519-6 0.522
Trx1-Fc 항원에 대한 반응 결과
Antibody ID 5000×(OD Value)
AB264-T150514-7 1.171
AB264-T150514-8 0.494
B265-T150514-10 0.378
B265-T150514-9 0.273
B266-T150519-3 0.198
B266-T150519-4 0.181
B267-T150519-5 0.043
B267-T150519-6 0.023
B268-T150519-8 0.015
B268-T150519-7 0.003
B269-T150519-9 0.002
B269-T150519-10 -0.001
Trx1-His 항원에 대한 반응 결과
Antibody ID 5000×(OD Value)
AB264-T150514-7 1.996
B265-T150514-10 1.465
AB264-T150514-8 1.142
B265-T150514-9 1.03
B267-T150519-5 0.857
B268-T150519-8 0.783
B269-T150519-9 0.77
B268-T150519-7 0.761
B269-T150519-10 0.717
B266-T150519-3 0.696
B266-T150519-4 0.667
B267-T150519-6 0.554
친화도가 높은 항체 B264 및 B266의 아미노산 서열은 하기 표 6과 같다.
　 아미노산 서열
B264 경쇄 QIVLTQSPAIMSASPGEKVTMTCSASSRISYMYWYQQKPGTSPKRWIYDTSKLASGVPARFSGSGSGTSYSLTISTMEAEDAATYYCHQRSSYPTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC (서열번호 17)
B264 중쇄 EVQLQQSGAELVKPGASVKLSCTASGFNIKDTFMHWVKQRPEQGLEWIGRIDPANGNTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCALLQYSAMDYWGQGTSVTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPSGPISTINPCPPCKECHKCPAPNLEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPPPAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNMKTSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPG (서열번호 18)
B266 경쇄 DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC (서열번호 19)
B266 중쇄 QVQLQQSGAELARPGASVKMSCKASGYTFTSYTMHWVKQRPGQGLEWIGYINPTSDYTNYNQKFKDKATLTADKSSSTAYMQLSSLTSEDSAVYFCASEGGFLYYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK (서열번호 20)
[실시예 6]
항체 B264 및 B266의 생산
6-1. 항체 B264 및 B266의 발현 플라스미드 제조
상기 표 6과 같이 항체 B264 및 B266의 아미노산 서열이 밝혀졌기 때문에 상기 항체들의 경쇄 및 중쇄에 상응하는 유전자를 화학적으로 합성하는 것이 가능하다. 합성된 유전자 서열은 하기 표 7에 나타냈다. 합성된 유전자는 pcDNA3.0 에 클로닝하였다.
　 유전자 서열
B264 경쇄 GACGTGCTGATGACACAGACACCACTCAGCCTCCCTGTGAGCCTGGGCGACCAGGCCTCTATTTCTTGCCGGTCTAGCCAGAGCATCGTGCACTCCAACGGCAACACATACTTGGAGTGGTATCTACAGAAGCCCGGCCAGTCCCCTAAGCTGCTGATATACAAGGTGTCTAACCGCTTCTCCGGCGTGCCCGACAGGTTCTCTGGCAGCGGCTCTGGCACCGACTTCACCCTCAAAATATCTAGGGTGGAGGCCGAGGACCTGGGCGTGTACTACTGCTTCCAGGGCTCCCACGTTCCATACACATTCGGCGGCGGCACAAAGTTGGAAATTAAGCGCGCTGACGCAGCCCCAACAGTGAGCATCTTTCCTCCATCCTCTGAACAACTTACCTCTGGAGGAGCCTCTGTGGTGTGTTTCCTGAACAACTTCTACCCAAAGGACATCAATGTGAAGTGGAAGATTGATGGCTCTGAGAGACAGAATGGAGTGCTGAACTCCTGGACAGACCAGGACAGCAAGGACAGCACCTACAGTATGAGTAGCACCCTGACCCTGACCAAGGATGAATATGAGAGACACAACTCCTACACTTGTGAGGCTACCCACAAGACCAGCACCAGCCCAATTGTCAAATCCTTCAACAGGAATGAGTGTTAA (서열번호 21)
B264 중쇄 CTCCACAGGTGTACACCATTCCACCTCCCAAGGAGCAGATGGCCAAGGATAAAGTCAGTCTGACCTGCATGATAACAGACTTCTTCCCTGAAGACATTACTGTGGAGTGGCAGTGGAATGGGCAGCCAGCGGAGAACTACAAGAACACTCAGCCCATCATGGACACAGATGGCTCTTACTTCGTCTACAGCAAGCTCAATGTGCAGAAGAGCAACTGGGAGGCAGGAAATACTTTCACCTGCTCTGTGTTACATGAGGGCCTGCACAACCACCATACTGAGAAGAGCCTCTCCCACTCTCCTGGTAAATAA (서열번호 22)
B266 경쇄 CAGATCGTGCTCACACAGTCTCCAGCCATCATGAGCGCCTCTCCTGGCGAGAAGGTGACAATGACCTGCTCTGCCTCTAGCCGCATTTCTTACATGTACTGGTATCAGCAGAAGCCAGGCACCTCCCCTAAGAGGTGGATATACGACACATCCAAGCTGGCCTCCGGCGTGCCCGCCCGGTTCAGCGGCTCTGGCAGCGGCACAAGCTACTCCCTGACAATTAGCACGATGGAGGCCGAGGACGCCGCCACATACTACTGCCACCAGCGCTCGTCCTACCCAACATTCGGCGCCGGCACAAAATTGGAACTGAAGAGAGCTGACGCAGCCCCAACAGTGAGCATCTTTCCTCCATCCTCTGAACAACTTACCTCTGGAGGAGCCTCTGTGGTGTGTTTCCTGAACAACTTCTACCCAAAGGACATCAATGTGAAGTGGAAGATTGATGGCTCTGAGAGACAGAATGGAGTGCTGAACTCCTGGACAGACCAGGACAGCAAGGACAGCACCTACAGTATGAGTAGCACCCTGACCCTGACCAAGGATGAATATGAGAGACACAACTCCTACACTTGTGAGGCTACCCACAAGACCAGCACCAGCCCAATTGTCAAATCCTTCAACAGGAATGAGTGTTAA (서열번호 23)
B266 중쇄 CAATTTCTAAGATTAAGGGCCTGGTGCGCGCCCCTCAGGTGTACATTCTGCCTCCTCCCGCCGAGCAGCTGAGCCGGAAGGACGTGTCCCTCACATGCCTCGTGGTGGGCTTCAACCCTGGCGACATTAGCGTGGAGTGGACATCTAACGGCCACACAGAAGAAAACTACAAGGACACAGCCCCTGTGCTCGACTCCGACGGCTCTTACTTCATATACTCTAAGCTGAACATGAAAACATCTAAGTGGGAAAAGACCGACTCTTTCTCTTGCAACGTGCGGCACGAGGGCCTGAAGAACTACTACCTCAAGAAAACCATTAGCAGAAGTCCAGGCTAA (서열번호 24)
6-2. 항체 B264 및 B266의 발현 및 정제
B264 항체를 발현하기 위하여 pcDNA3-SSJ11-L과 pcDNA3-SSJ11-H를, B266 항체를 발현하기 위하여 pcDNA3-SSJ12-L와 pcDNA3-SSJ12-H를 HEK293 세포주에 공동 형질감염(co-transfection)하여 7일 동안 배양하였다. 세포주를 배양하며 배양액으로 분비된 재조합 단일클론항체를 단백질 A 크로마토그래피를 이용하여 수득 및 정제하였다. 재조합 단일클론항체를 포함하는 용리제(eluent)를 한외여과(ultrafiltration)로 농축하고, 0.2 ㎛ 멸균필터를 이용하여 걸러 고순도의 항체를 수득하였다.
순수 정제된 항체는 SDS-PAGE를 통하여 순도와 크기 등을 확인하였다. SDS-PAGE 결과, 도 6에 나타난 바와 같이 항체 B264 및 B266은 환원(reducing) 조건에서 중쇄가 47 kDa, 경쇄가 25 kDa으로, 비환원(non-reducing) 조건에서 150 kDa 으로 예상한 크기에 부합하게 발현됨을 확인하였다.
[ 실시예 7]
샌드위치(Sandwich) ELISA를 통한 획득된 2종의 단일클론항체의 페어링 (pairing) 여부 확인
웰(well) 당 100 ㎕ 코팅 버퍼(coating buffer) (0.015 M Na2CO3, 0.035 M NaHCO3, 0.003 M NaN3, pH9.6)와 100 ng 코팅 항체(coating antibody, B266)를 섞어 분주 후, 4℃, O/N 반응하였다. 1% BSA를 포함하는 PBS(PBSA; 차단 버퍼)를 웰 당 200 ㎕ 분주한 후, 상온에서 60분 반응하였다. 이후 항원(50, 25, 12.5 또는 0 ng) 20 ㎕를 분주하고, 검출 항체(비오틴-표지된 B264; B264-B) 80 ㎕를 분주한 후, 37℃, 90분 반응하였다. 반응용액을 제거한 후, 0.05% 트윈 20을 포함하는 PBS(PBST; 세척 버퍼)를 웰 당 200 ㎕ 분주하여 세척하였다. 상기의 과정을 3회 처리하였다.
1:200으로 희석한 스트렙타비딘-HRP를 웰 당 100 ㎕ 을 처리한 후, 37℃, 30분 반응시키고, 반응용액을 제거한 후, 0.05% 트윈 20을 포함하는 PBS(PBST; 세척 버퍼)를 웰 당 200 ㎕ 분주하여 세척하였다. 상기의 과정을 3회 처리하였다.
웰 당 TMB 용액 100 ㎕를 분주한 후, 암조건, 상온 하에서 10분 반응시키고, 웰 당 2.5 M 황산 용액(H2SO4; STOP buffer) 100 ㎕를 처리한 후, 450 nm에서 결과를 확인하였다.
그 결과, 표 8에 나타난 바와 같이, 항원에 농도에 따라 반응값이 증가함을 확인함으로써 이들의 항체가 항원을 검출하는 것으로 확인되었다. 단, 항원이 없는 경우의 O.D. 측정치가 높으므로 항체를 이용한 성능 향상 실험이 요구된다.
코팅 항체로 B266, 검출 항체로 B264를 사용한 샌드위치 ELISA
Trx1 (ng/㎖) 0 12.5 25 50
O.D.450nm 0.828 1.226 1.506 2.257
[실시예 8]
항체의 성능 향상을 위한 Fc 부분 이소타입 변경
항체의 발현시스템이 하이브리도마를 이용하는 것이 아닌 재조합 플라스미드를 이용한 일시적인 형질감염(transient transfection)이므로, 재조합 플라스미드 중 중쇄를 가진 플라스미드를 다른 이소타입의 중쇄를 가진 플라스미드로 공동 감염시켰다. 즉, 9G7(AB1)을 발현하기 위하여 사용하는 pcDNA3-SSJ12-L와 pcDNA3-SSJ12-H 중 pcDNA3-SSJ12-H가 아닌 다른 중쇄를 암호화하는 유전자를 가진 플라스미드를 공동 형질감염하였다.
이러한 방법을 통하여 B266의 Fc 부분이 인간 IgG1으로 변경된 항체(B266-1)를 획득하였다. 이 항체를 SDS-PAGE를 통하여 성상을 확인하였다(도 7).
최종적으로 선정된 단일클론항체 B264 및 B266-1의 경쇄 CDR1 내지 CDR3 및 중쇄 CDR1 내지 CDR3의 아미노산 서열은 표 9에 나타내었고, 경쇄 가변영역 및 중쇄 가변영역의 아미노산 서열은 표 10에 나타내었다.
아미노산 서열
B264 경쇄 CDR1 SRISYM (서열번호 1)
B264 경쇄 CDR2 DTS (서열번호 2)
B264 경쇄 CDR3 HQRSSYP (서열번호 3)
B264 중쇄 CDR1 GFNIKDTF (서열번호 4)
B264 중쇄 CDR2 IDPANGNT (서열번호 5)
B264 중쇄 CDR3 A (서열번호 6)
B266-1 경쇄 CDR1 QSIVHSNGNTY (서열번호 7)
B266-1 경쇄 CDR2 KVS (서열번호 8)
B266-1 경쇄 CDR3 FQGSHVP (서열번호 9)
B266-1 중쇄 CDR1 GFNIKDTF (서열번호 10)
B266-1 중쇄 CDR2 IDPANGNT (서열번호 11)
B266-1 중쇄 CDR3 A (서열번호 12)
아미노산 서열
B264 경쇄 가변영역 QIVLTQSPAIMSASPGEKVTMTCSASSRISYMYWYQQKPGTSPKRWIYDTSKLASGVPARFSGSGSGTSYSLTISTMEAEDAATYYCHQRSSYP (서열번호 13)
B264 중쇄 가변영역 EVQLQQSGAELVKPGASVKLSCTASGFNIKDTFMHWVKQRPEQGLEWIGRIDPANGNTKYDPKFQGKATITADTSSNTAYLQLSSLTSED TAVYYCA (서열번호:14)
B266-1 경쇄 가변영역 DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVP (서열번호:15)
B266-1중쇄 가변영역 EVQLQQSGAELVKPGASVKLSCTASGFNIKDTFMHWVKQRPEQGLEWIGRIDPANGNTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCA (서열번호:16)
[ 실시예 9]
샌드위치 ELISA를 통한 획득된 B266-1과 B264의 단일클론항체의 페어링 여부 확인
웰 당 100 ㎕ 코팅 버퍼와 100 ng 코팅 항체(B266-1)를 섞어 분주 후, 4℃, O/N 반응시키고, 반응용액을 제거한 후, 웰 당 200 ㎕ 세척 버퍼를 분주하여 세척하였다. 이 과정을 2회 처리하였다.
웰 200 ㎕ PBSA를 분주한 후, 상온에서 120분 반응시키고, 항원(25 또는 0 ng) 20 ㎕를 분주하고, 검출 항체(B264-B) 80 ㎕를 분주한 후, 37℃, 90분 반응시켰다. 반응용액을 제거한 후, 웰 당 200 ㎕ 세척 버퍼를 분주하여 세척하였다. 이 과정을 3회 처리하였다.
1:200으로 희석한 스트렙타비딘-HRP를 웰 당 100 ㎕ 을 처리한 후, 37℃, 30분 반응시키고, 반응용액을 제거한 후, 웰 당 200 ㎕ 세척 버퍼를 분주하여 세척하였다. 이 과정을 3회 처리하였다.
웰 당 TMB 용액 100 ㎕를 분주한 후, 암조건, 상온 하에서 10분 반응시키고, 웰 당 정지 버퍼 100 ㎕를 처리한 후, 450 nm에서 결과 확인하였다.
그 결과, 표 11에 나타난 바와 같이 항원에 적절하게 반응함을 확인하였고, 실시예 6에서 사용한 항체에 비해 블랭크(blank) 값이 감소함을 확인하였다.
코팅 항체로 B266-1, 검출 항체로 B264를 사용한 샌드위치 ELISA
Trx1 (ng/㎖) 0 25
O.D.450nm 0.425 0.415 1.571 1.426
[ 실시예 10]
항원에 대한 단일클론항체의 친화도 분석
항원 Trx1에 특이적으로 작용하는 2종의 단일클론항체는 플라스미드를 이용한 일시적 형질감염 시스템을 이용하여 발현됨으로써 안정적으로 생산된다. 이에 항원에 대한 친화도(affinity)를 확인하기 위하여 ELISA를 이용하여 분석하였다(도 8a).
웰 당 100 ㎕ 코팅 버퍼와 100 ng Trx1을 섞어 분주 후, 4℃, 16시간 이상 반응시키고, 반응용액을 제거한 후, 웰 당 200 ㎕ PBSA를 분주하여 37℃, 120분 반응시켰다. 반응용액을 제거한 후, 제작된 항체 B266-1 또는 B264 항체를 0.1 μM 부터 1/5로 희석하여 웰 당 100 ㎕씩 분주하고, 37℃, 120분 반응시켰다. 반응용액을 제거한 후, 웰 당 200 ㎕ 세척 버퍼를 분주하여 세척하였다. 이 과정을 3회 처리하였다.
항체 B266-1은 인간 IgG-HRP(1:4000으로 희석)를, B264는 마우스 IgG-HRP(1:4000으로 희석)를 각각 100 ㎕ 분주하고, 37℃, 60분 반응시켰다. 반응용액을 제거한 후, 웰 당 200 ㎕ 분주하여 세척하였다. 이 과정을 3회 처리하였다.
웰 당 TMB 용액 100 ㎕를 분주한 후, 암조건, 상온 하에서 10분 반응시키고, 웰 당 정지 버퍼 100 ㎕을 처리한 후, 450 nm에서 결과를 확인하였다. 획득한 결과값은 Prism (Graphpad사)을 이용하여 분석하였다(도 8b).
코팅 항체 B266-1과 검출 항체 B264의 친화도를 분석한 결과, B266-1의 반응력으로 인하여 블랭크(blank) 값이 높으나, B266-1과 B264은 항원의 농도가 증가함에 따라 결합 정도도 증가함을 확인하였다. 이는 B266-1과 B264가 항원과 결합함을 나타낸다. Prism 프로그램을 이용한 분석에 따라 KD (equilibrium dissociation constant)값을 구하면 B266-1은 1.1ｘ10-11, B264는 1.3ｘ10-10였다. KD 값이 10-10에서 10-12 사이일 경우 피코몰(pM) 수준의 항원에 대한 민감도를 가지는 것으로 평가되므로, B266-1과 B264는 높은 수준의 항원에 대한 민감도를 갖는다는 것을 알 수 있다.
[ 실시예 11]
유방암 환자의 혈청에서의 샌드위치 ELISA 시험
코팅 항체 (B266-1)를 이용한 샌드위치 ELISA를 다음과 같은 과정으로 준비하였다.
코팅 버퍼 100 ㎖과 1 ㎎/㎖ 농도의 B266-1 0.1 ㎖을 첨가하여 1 ㎍/㎖ 농도의 코팅 항체 용액을 제조하였다. 제조된 코팅 항체 용액을 각 96-웰 플레이트의 웰 당 100 ㎕씩 분주한 후, 4℃, 12시간 반응시켰다. 항체 용액을 제거하고, 웰 당 200 ㎕ 0.05% PBST를 분주하여 세척하였다. 이 세척 과정을 3번 반복하였다. 웰 당 200 ㎕ PBSA를 처리하고, 4℃, 4시간 반응(차단 공정)시켰다. PBSA를 제거하고, 96-웰 플레이트를 항온항습기 (20℃, 30%R.H.)에서 3시간 건조시켰다.
다음으로, 검출 항체 (B264)를 다음과 같은 과정으로 비오틴화(biotinylation)하였다.
20 ㎎/㎖ 비오틴-7-NHS에 DMSO(dimethyl sulfoxide)를 섞어 2 ㎎/㎖ 비오틴-7-NHS를 만들었다. 1㎎/㎖ B264 항체당 2 ㎎/㎖ 비오틴-7-NHS 15㎕(30㎍)를 섞어 15~25℃, 2시간 반응시켰다. 아미콘 울트라-15(Millipore)에 반응용액을 넣고, PBS 용액으로 최종부피까지 채워준 후, 0.5 ㎖가 남을 때까지 3,600ｘg로 원심분리 하였다. 이 과정을 3번 반복하였다. 아미콘 필터 내부에 남은 항체 용액(비오틴화된 B264; B264-B)을 1.5 ㎖ 튜브로 옮긴 후, PBSA를 이용하여 최종 농도를 0.3 ㎎/㎖로 만들었다.
다음으로, 유방암 환자의 혈청으로부터 인간 Trx1 항원 검출을 다음과 같은 과정으로 수행하였다.
코팅 항체로 코팅하여 준비한 96-웰 플레이트의 첫번째 줄(column)에 표준항원용액을 분주하였다. 20 ㎕ 유방암 환자로부터 획득된 혈청을 분주한 후, 80 ㎕(0.3 ㎎/㎖) B264-B 용액을 분주하였다. 이후 37℃, 60분 반응시킨 다음, 항원 및 항체 반응용액을 제거하고, 웰 당 200 ㎕ PBST를 분주하여 세척하였다. 이 세척 과정을 3번 반복하였다. 1:400으로 희석한 스트렙타비딘-HRP(R&D Systems) 100 ㎕를 분주하고 37℃, 30분 반응시켰다. 반응 종료 후, 반응용액을 제거하고, 웰 당 200 ㎕ PBST를 분주하여 세척하였다. 이 세척 과정을 3번 반복하였다. 100 ㎕ TMB 용액(Sure Blue)를 처리하고 상온, 15분 동안 암조건하에서 반응시켰다. 2N H2SO4 용액 100 ㎕을 분주하고, 마이크로플레이트 리더(microplate reader)를 이용하여 450 nm 흡광도로 측정하였다.
마지막으로, ROC 분석을 다음과 같은 과정으로 수행하였다.
Trx1에 대한 단일클론항체인 B266-1과 B264를 이용한 ELISA에 의한 결과를 분석하여 민감도(sensitivity)와 특이도(specificity)를 계산하였다. 컷-오프 값(cut-off value)이 10.8 ng/㎖일 때, 민감도는 93.0%, 특이도는 97.4%임을 확인하였다(도 9).
[ 실시예 12]
유방암을 진단하는 다른 ELISA 키트와의 비교 분석
본 실시예에서는 재조합 단일클론항체인 B266-1과 B264의 성능을 평가하기 위하여, 유방암 여부를 진단하는 다른 바이오마커인 CA15-3을 검출하는 다른 ELISA 키트와 비교 분석하였다(표 12).
그 결과, 표 12에 나타난 바와 같이, 본 발명의 Trx1에 특이적으로 결합하는 단일클론항체의 사용 시, 민감도 및 특이도가 CA15-3에 비해 월등히 높았다.
본 발명의 키트와 AxSYM CA15-3 키트 비교
Trx1 CA15-3 (AxSYM)
Sensitivity(%) 93 54
Specificity(%) 97.4 94
Test sample Serum Serum과 plasma
본 발명의 단일클론항체는 티오레독신 1에 대한 결합 친화도 우수하여 티오레독신 1에 매우 특이적으로 결합하고, 또한 민감도와 특이도가 매우 높아 유방암 환자를 스크리닝하는데 유용하게 사용될 수 있다. 나아가, 기존의 다른 유방암 진단 바이오마커인 CA15-3을 검출하는 것 보다 본 발명의 티오레독신 1에 특이적으로 결합하는 단일클론항체를 사용하여 티오레독신 1을 검출하는 것이 민감도와 특이도가 월등히 우수하여 유방암 진단의 정확성 및 신뢰성을 현저히 높일 수 있으므로, 산업상 이용가능성이 크다.

Claims (31)

  1. 서열번호 1의 아미노산 서열로 이루어진 경쇄 CDR1, 서열번호 2의 아미노산 서열로 이루어진 경쇄 CDR2 및 서열번호 3의 아미노산 서열로 이루어진 경쇄 CDR3을 포함하는 경쇄 가변영역, 및 서열번호 4의 아미노산 서열로 이루어진 중쇄 CDR1, 서열번호 5의 아미노산 서열로 이루어진 중쇄 CDR2 및 서열번호 6의 아미노산 서열로 이루어진 중쇄 CDR3을 포함하는 중쇄 가변영역을 포함하는, 티오레독신 1에 특이적으로 결합하는 단일클론항체 또는 이의 항원 결합 단편.
  2. 서열번호 7의 아미노산 서열로 이루어진 경쇄 CDR1, 서열번호 8의 아미노산 서열로 이루어진 경쇄 CDR2 및 서열번호 9의 아미노산 서열로 이루어진 경쇄 CDR3을 포함하는 경쇄 가변영역, 및 서열번호 10의 아미노산 서열로 이루어진 중쇄 CDR1, 서열번호 11의 아미노산 서열로 이루어진 중쇄 CDR2 및 서열번호 12의 아미노산 서열로 이루어진 중쇄 CDR3을 포함하는 중쇄 가변영역을 포함하는, 티오레독신 1에 특이적으로 결합하는 단일클론항체 또는 이의 항원 결합 단편.
  3. 제1항에 있어서, 상기 항체는 서열번호 13의 아미노산 서열로 이루어진 경쇄 가변영역 및 서열번호 14의 아미노산 서열로 이루어진 중쇄 가변영역을 포함하는 것을 특징으로 하는 단일클론항체 또는 이의 항원 결합 단편.
  4. 제2항에 있어서, 상기 항체는 서열번호 15의 아미노산 서열로 이루어진 경쇄 가변영역 및 서열번호 16의 아미노산 서열로 이루어진 중쇄 가변영역을 포함하는 것을 특징으로 하는 단일클론항체 또는 이의 항원 결합 단편.
  5. 제1항에 있어서, 상기 항체는 서열번호 17의 아미노산 서열로 이루어진 경쇄 및 서열번호 18의 아미노산 서열로 이루어진 중쇄를 포함하는 것을 특징으로 하는 단일클론항체 또는 이의 항원 결합 단편.
  6. 제2항에 있어서, 상기 항체는 서열번호 19의 아미노산 서열로 이루어진 경쇄 및 서열번호 20의 아미노산 서열로 이루어진 중쇄를 포함하는 것을 특징으로 하는 단일클론항체 또는 이의 항원 결합 단편.
  7. 제1항 내지 제4항 중 어느 한 항에 있어서, 상기 항체는 IgG1 중쇄 및 카파(κ) 경쇄를 포함하는 것을 특징으로 하는 단일클론항체 또는 이의 항원 결합 단편.
  8. 제1항 내지 제6항 중 어느 한 항에 있어서, 상기 항원 결합 단편은 Fab, F (ab'), F (ab')2, Fv 또는 단쇄 항체 분자인 것을 특징으로 하는 단일클론항체 또는 이의 항원 결합 단편.
  9. 제1항 내지 제6항 중 어느 한 항에 있어서, 상기 항체는 키메라 항체, 인간화 항체 또는 인간 항체인 것을 특징으로 하는 단일클론항체 또는 이의 항원 결합 단편.
  10. 제1항의 단일클론항체 또는 이의 항원 결합 단편의 경쇄를 코딩하는 핵산분자.
  11. 제10항에 있어서, 상기 핵산분자는 서열번호 21의 뉴클레오티드 서열로 이루어진 것을 특징으로 하는 핵산분자.
  12. 제1항의 단일클론항체 또는 이의 항원 결합 단편의 중쇄를 코딩하는 핵산분자.
  13. 제12항에 있어서, 상기 핵산분자는 서열번호 22의 뉴클레오티드 서열로 이루어진 것을 특징으로 하는 핵산분자.
  14. 제2항의 단일클론항체 또는 이의 항원 결합 단편의 경쇄를 코딩하는 핵산분자.
  15. 제14항에 있어서, 상기 핵산분자는 서열번호 23의 뉴클레오티드 서열로 이루어진 것을 특징으로 하는 핵산분자.
  16. 제2항의 단일클론항체 또는 이의 항원 결합 단편의 중쇄를 코딩하는 핵산분자.
  17. 제16항에 있어서, 상기 핵산분자는 서열번호 24의 뉴클레오티드 서열로 이루어진 것을 특징으로 하는 핵산분자.
  18. 제10항의 경쇄를 코딩하는 핵산분자, 제12항의 중쇄를 코딩하는 핵산분자 또는 상기 핵산분자 모두를 포함하는 재조합 벡터.
  19. 제14항의 경쇄를 코딩하는 핵산분자, 제16항의 중쇄를 코딩하는 핵산분자 또는 상기 핵산분자 모두를 포함하는 재조합 벡터.
  20. 제18항의 재조합 벡터를 포함하는 숙주세포.
  21. 제19항의 재조합 벡터를 포함하는 숙주세포.
  22. 제20항 또는 제21항의 숙주세포를 배양하는 단계를 포함하는, 티오레독신 1에 특이적으로 결합하는 단일클론항체 또는 이의 항원 결합 단편의 제조방법.
  23. 제1항 내지 제6항 중 어느 한 항의 단일클론항체 또는 이의 항원 결합 단편을 포함하는 유방암 진단 키트.
  24. 제23항에 있어서, 상기 키트는 ELISA(Enzyme Linked Immunosorbent Assay) 키트인 것을 특징으로 하는 유방암 진단 키트.
  25. 제24항에 있어서, 상기 ELISA는 직접 ELISA, 간접 ELISA, 직접적 샌드위치 ELISA 및 간접적 샌드위치 ELISA로 이루어진 군에서 선택된 1종 이상인 것을 특징으로 하는 유방암 진단 키트.
  26. (a) 제1항 내지 제6항 중 어느 한 항의 단일클론항체 또는 이의 항원 결합 단편을 유방암이 의심되는 개체로부터 분리된 생물학적 시료에 접촉시키는 단계;
    (b) 항원-항체 복합체 형성을 통해 상기 생물학적 시료에서 단일클론항체 또는 이의 항원 결합 단편에 결합된 티오레독신 1 단백질의 발현 수준을 측정하는 단계; 및
    (c) 상기 (b) 단계에서 측정된 티오레독신 1 단백질의 발현 수준을 대조군과 비교하여 대조군에 비해 상기 단백질의 발현 수준이 높으면 유방암 환자로 판정하는 단계;
    를 포함하는 유방암 진단에 필요한 정보를 제공하는 방법.
  27. 제26항에 있어서, 상기 티오레독신 1 단백질의 발현 수준은 웨스턴 블랏, ELISA, 샌드위치 ELISA, 방사선면역분석, 방사 면역 확산법, 오우크테로니 면역 확산법, 면역침전 분석법, 보체 고정 분석법, 면역크로마토그래피 분석법, FACS 및 단백질 칩 방법 중 어느 하나 이상의 방법으로 이루어진 군에서 선택된 어느 하나의 방법으로 측정하는 것을 특징으로 하는 유방암 진단에 필요한 정보를 제공하는 방법.
  28. 제26항에 있어서, 상기 분리된 생물학적 시료는 전혈, 혈청, 혈장, 유방 조직 및 유방 세포로 이루어진 군에서 선택된 어느 하나 이상인 것을 특징으로 하는 유방암 진단에 필요한 정보를 제공하는 방법.
  29. (a) 고체 지지체를 제2항, 제4항 또는 제6항의 단일클론항체 또는 이의 항원 결합 단편으로 코팅하는 단계;
    (b) 유방암이 의심되는 개체로부터 분리된 생물학적 시료를 상기 코팅된 고체 지지체에 적용하는 단계;
    (c) 결합되지 않은 샘플을 제거하는 단계;
    (d) 제1항, 제3항 또는 제5항의 단일클론항체 또는 이의 항원 결합 단편을 고체 지지체에 적용하는 단계;
    (e) 결합되지 않은 단일클론항체 또는 이의 항원 결합 단편을 제거하는 단계;
    (f) 티오레독신 1 단백질의 발현 수준을 측정하는 단계; 및
    (g) 상기 (f) 단계에서 측정된 티오레독신 1 단백질의 발현 수준을 대조군과 비교하여, 대조군에 비해 상기 단백질의 발현 수준이 높으면 유방암 환자로 판정하는 단계;
    를 포함하는 유방암 진단에 필요한 정보를 제공하는 방법.
  30. 제29항에 있어서, 상기 티오레독신 1 단백질의 발현 수준은 웨스턴 블랏, ELISA, 샌드위치 ELISA, 방사선면역분석, 방사 면역 확산법, 오우크테로니 면역 확산법, 면역침전 분석법, 보체 고정 분석법, 면역크로마토그래피 분석법, FACS 및 단백질 칩 방법 중 어느 하나 이상의 방법으로 이루어진 군에서 선택된 어느 하나의 방법으로 측정하는 것을 특징으로 하는 유방암 진단에 필요한 정보를 제공하는 방법.
  31. 제29항에 있어서, 상기 분리된 생물학적 시료는 전혈, 혈청, 혈장, 유방 조직 및 유방 세포로 이루어진 군에서 선택된 어느 하나 이상인 것을 특징으로 하는 유방암 진단에 필요한 정보를 제공하는 방법.
PCT/KR2016/010381 2016-09-13 2016-09-13 티오레독신 1에 특이적으로 결합하는 단일클론항체 및 이의 용도 WO2018052153A1 (ko)

Priority Applications (7)

Application Number Priority Date Filing Date Title
US16/332,623 US11002739B2 (en) 2016-09-13 2016-09-13 Monoclonal antibody specifically binding to thioredoxin 1, and use thereof
CN201680089262.7A CN109863176B (zh) 2016-09-13 2016-09-13 与硫氧还蛋白1特异性结合的单克隆抗体及其用途
EP16916308.6A EP3527589A4 (en) 2016-09-13 2016-09-13 MONOCLONAL ANTIBODIES BINDING SPECIFICALLY TO THIOREDOXIN 1 AND ITS USE
BR112019004901A BR112019004901A2 (pt) 2016-09-13 2016-09-13 anticorpo monoclonal ou um fragmento de ligação ao antígeno do mesmo, seu método de preparação, molécula de ácido nucleico, vetor recombinante, célula hospedeira, kit de diagnóstico e método para fornecer informações
AU2016422911A AU2016422911B2 (en) 2016-09-13 2016-09-13 Monoclonal antibody specifically binding to thioredoxin 1, and use thereof
JP2019515262A JP6862542B2 (ja) 2016-09-13 2016-09-13 チオレドキシン１に特異的に結合する単一クローン抗体およびその用途
RU2019110953A RU2747929C2 (ru) 2016-09-13 2016-09-13 Моноклональное антитело, специфически связывающееся с тиоредоксином-1, и его применение

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR10-2016-0118053 2016-09-13
KR1020160118053A KR101982782B1 (ko) 2016-09-13 2016-09-13 티오레독신 1에 특이적으로 결합하는 단일클론항체 및 이의 용도

Publications (1)

Publication Number Publication Date
WO2018052153A1 true WO2018052153A1 (ko) 2018-03-22

Family

ID=61619658

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2016/010381 WO2018052153A1 (ko) 2016-09-13 2016-09-13 티오레독신 1에 특이적으로 결합하는 단일클론항체 및 이의 용도

Country Status (9)

Country Link
US (1) US11002739B2 (ko)
EP (1) EP3527589A4 (ko)
JP (1) JP6862542B2 (ko)
KR (1) KR101982782B1 (ko)
CN (1) CN109863176B (ko)
AU (1) AU2016422911B2 (ko)
BR (1) BR112019004901A2 (ko)
RU (1) RU2747929C2 (ko)
WO (1) WO2018052153A1 (ko)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2018349387B2 (en) * 2017-10-12 2022-05-19 E&S Healthcare Co., Ltd. Thioredoxin 1 epitope and monoclonal antibody specifically binding thereto

Families Citing this family (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20220127679A1 (en) * 2019-02-13 2022-04-28 Bertis Inc Composition for cancer diagnosis
JPWO2021201202A1 (ko) * 2020-04-02 2021-10-07
CN113999819B (zh) * 2021-11-10 2023-11-28 青岛硕景生物科技有限公司 分泌抗Trx蛋白单克隆抗体的杂交瘤细胞株、抗Trx蛋白单克隆抗体
CN117487008B (zh) * 2023-09-26 2024-05-28 武汉爱博泰克生物科技有限公司 抗人Lin28A蛋白的兔单克隆抗体及其应用

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JPH06261783A (ja) * 1993-03-16 1994-09-20 Toyota Central Res & Dev Lab Inc チオレドキシンに特異的に反応するモノクローナル抗体
WO2005117930A2 (en) * 2004-06-04 2005-12-15 Sloan-Kettering Institute For Cancer Research Use of thioredoxin measurements for diagnostics and treatments
CN101493464A (zh) * 2009-03-09 2009-07-29 昆明理工大学 诊断乳腺癌的分子标记物
WO2010107158A1 (ko) * 2009-03-16 2010-09-23 배재대학교 산학협력단 티오레독신 1을 유효성분으로 하는 유방암 진단용 마커, 및 이를 이용한 유방암 진단 키트
KR20160118053A (ko) 2015-04-01 2016-10-11 (주)넥스티지 테이프 부착 시스템

Family Cites Families (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2336168A1 (en) * 1997-04-15 2011-06-22 Sankyo Company Limited Novel protein and method for producing the protein
US6531648B1 (en) * 1998-12-17 2003-03-11 Syngenta Participations Ag Grain processing method and transgenic plants useful therein
JP4516456B2 (ja) * 2005-03-15 2010-08-04 オリンパスイメージング株式会社 撮像装置
US20110039277A1 (en) * 2008-04-18 2011-02-17 Pier Mastroberardino Methods of Labeling Proteins
CZ2008606A3 (cs) * 2008-10-09 2010-04-21 Ústav molekulární genetiky, v.v.i. Akademie ved Ceské republiky Rekombinantní protein upravený pro prímou radiojodaci a jeho výroba a použití
US9382587B2 (en) * 2009-03-16 2016-07-05 Paichai University Industry-Academic Cooperation Foundation Diagnosis of breast cancer based on expression level of thioredoxin-1
US20130157292A1 (en) * 2011-12-14 2013-06-20 Paichai University Industry-Academic Cooperation Foundation Composition for the diagnosis of ovarian cancer or pneumonia comprising thioredoxin 1 as active ingredient and use thereof

Patent Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JPH06261783A (ja) * 1993-03-16 1994-09-20 Toyota Central Res & Dev Lab Inc チオレドキシンに特異的に反応するモノクローナル抗体
WO2005117930A2 (en) * 2004-06-04 2005-12-15 Sloan-Kettering Institute For Cancer Research Use of thioredoxin measurements for diagnostics and treatments
CN101493464A (zh) * 2009-03-09 2009-07-29 昆明理工大学 诊断乳腺癌的分子标记物
WO2010107158A1 (ko) * 2009-03-16 2010-09-23 배재대학교 산학협력단 티오레독신 1을 유효성분으로 하는 유방암 진단용 마커, 및 이를 이용한 유방암 진단 키트
KR101058230B1 (ko) 2009-03-16 2011-08-22 배재대학교 산학협력단 티오레독신 1을 유효성분으로 하는 유방암 진단용 마커, 및이를 이용한 유방암 진단 키트
KR20160118053A (ko) 2015-04-01 2016-10-11 (주)넥스티지 테이프 부착 시스템

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
DATABASE Protein 28 February 2003 (2003-02-28), "immunoglobulin light chain kappa [Mus musculus]", XP055586280, retrieved from NCBI Database accession no. CAD68984.1 *
PARK ET AL.: "Thioredoxin 1 as a Serum Marker for Breast Cancer and Its Use in Combination with CEA or CA 15-3 for Improving the Sensitivity of Breast Cancer Diagnoses", BMC RESEARCH NOTES, vol. 7, no. 7, 6 January 2014 (2014-01-06), pages 1 - 12, XP021173712 *
See also references of EP3527589A4

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2018349387B2 (en) * 2017-10-12 2022-05-19 E&S Healthcare Co., Ltd. Thioredoxin 1 epitope and monoclonal antibody specifically binding thereto
US11953502B2 (en) 2017-10-12 2024-04-09 E&S Healthcare Co., Ltd. Thioredoxin 1 epitope, encoding nucleic acid and methods of binding a monoclonal antibody

Also Published As

Publication number Publication date
JP2019532630A (ja) 2019-11-14
EP3527589A1 (en) 2019-08-21
KR20180029673A (ko) 2018-03-21
CN109863176A (zh) 2019-06-07
CN109863176B (zh) 2023-04-21
AU2016422911A1 (en) 2019-04-04
RU2747929C2 (ru) 2021-05-17
EP3527589A4 (en) 2020-08-26
KR101982782B1 (ko) 2019-05-28
RU2019110953A3 (ko) 2020-10-15
AU2016422911B2 (en) 2021-04-01
BR112019004901A2 (pt) 2019-06-25
US11002739B2 (en) 2021-05-11
US20200200750A1 (en) 2020-06-25
JP6862542B2 (ja) 2021-04-21
RU2019110953A (ru) 2020-10-15

Similar Documents

Publication Publication Date Title
WO2019074333A9 (ko) 티오레독신 1 에피토프 및 이에 특이적으로 결합하는 단일클론항체
WO2018052153A1 (ko) 티오레독신 1에 특이적으로 결합하는 단일클론항체 및 이의 용도
CN110167967B (zh) 针对抗pd-l1抗体的独特型抗体及其用途
WO2020036403A1 (ko) 메르스 코로나바이러스 s 단백질에 대한 단클론 항체 및 그 용도
WO2017010744A1 (ko) 엑소좀 단백질 ｅｉｆ3ａ 특이반응 오토항체검출용 항원 조성물 및 이를 이용한 간암진단법
WO2017116212A1 (ko) 마이코박테리아 유래 항원에 특이적으로 결합하는 항체 또는 그의 항원 결합 단편
WO2023038477A1 (ko) 코로나바이러스 뉴클레오캡시드 단백질에 특이적인 항체 및 이의 용도
WO2022154288A1 (ko) 단백질 키나아제 a의 촉매 서브 유닛 알파에 특이적으로 결합하는 단일클론항체 및 이를 활용한 암 진단 용도
WO2022231321A1 (ko) Sars-cov-2 rbd 항원 특이적 항체를 포함하는 진단용 조성물 또는 키트
WO2017179862A1 (ko) 안정성이 개선된 ｈｅｒ２에 특이적으로 결합하는 항체
WO2021112640A1 (ko) 항-tm4sf4 항체 및 이의 용도
WO2020159229A1 (ko) Ccsp-2에 특이적으로 결합하는 단일클론항체 및 이의 용도
WO2018182266A1 (ko) 항-emap ii 항체 및 이의 용도
WO2021137655A1 (ko) SUPER-REPRESSOR IκB에 대한 항체 및 이의 용도
KR102269281B1 (ko) 개 인플루엔자 바이러스에 특이적인 단일클론항체 및 이의 용도
RU2797266C2 (ru) Эпитоп тиоредоксина-1 и моноклональное антитело, специфически связывающееся с ним
KR102298278B1 (ko) 돼지 인플루엔자 바이러스에 특이적인 단일클론항체 및 이의 용도
WO2022092644A1 (ko) Wars 중화항체 및 이의 용도
RU2791264C2 (ru) Моноклональное антитело, специфично связывающееся с эпитопом тиоредоксина-1, его получение и применение
WO2021107725A1 (ko) Cobll1 단백질 특이 항체 또는 이의 항원 결합 단편, 및 이의 용도
WO2022265439A1 (ko) 항-tm4sf4 인간화 항체 및 이의 용도
CN116802212A (zh) 胃泌酸调节素结合分子及其用途
JP2019210211A (ja) ウシプロカルシトニンを特異的に認識する抗体、その抗原結合断片、および、その使用

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16916308

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2019515262

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112019004901

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2016422911

Country of ref document: AU

Date of ref document: 20160913

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2016916308

Country of ref document: EP

Effective date: 20190415

ENP Entry into the national phase

Ref document number: 112019004901

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20190313