WO2018023136A1 - Fcrn antibodies and methods of use thereof - Google Patents

Fcrn antibodies and methods of use thereof Download PDF

Info

Publication number
WO2018023136A1
WO2018023136A1 PCT/US2017/044765 US2017044765W WO2018023136A1 WO 2018023136 A1 WO2018023136 A1 WO 2018023136A1 US 2017044765 W US2017044765 W US 2017044765W WO 2018023136 A1 WO2018023136 A1 WO 2018023136A1
Authority
WO
WIPO (PCT)
Prior art keywords
cdr
seq
sequence
isolated antibody
amino acid
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2017/044765
Other languages
English (en)
French (fr)
Inventor
Leona E. Ling
Sucharita Roy
Nathaniel Washburn
Marilyn Kehry
David J. King
James MEADOR, III
Anthony Manning
Jan HILLSON
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Momenta Pharmaceuticals Inc
Original Assignee
Momenta Pharmaceuticals Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to NZ750462A priority Critical patent/NZ750462B2/en
Priority to BR112019001806-9A priority patent/BR112019001806A2/pt
Priority to SM20240004T priority patent/SMT202400004T1/it
Priority to EP23195791.1A priority patent/EP4282487A3/en
Priority to JP2019504902A priority patent/JP7094941B2/ja
Priority to CN202311567291.8A priority patent/CN117679506A/zh
Priority to KR1020237006882A priority patent/KR102717601B1/ko
Priority to IL302288A priority patent/IL302288B2/en
Priority to RS20240046A priority patent/RS65070B1/sr
Priority to PL17835436.1T priority patent/PL3491025T3/pl
Priority to KR1020247033727A priority patent/KR20240151878A/ko
Priority to AU2017301915A priority patent/AU2017301915B2/en
Priority to SI201731447T priority patent/SI3491025T1/sl
Priority to IL320058A priority patent/IL320058A/en
Priority to LTEPPCT/US2017/044765T priority patent/LT3491025T/lt
Priority to ES17835436T priority patent/ES2968439T3/es
Priority to CN201780060620.6A priority patent/CN109790221B/zh
Priority to HRP20240048TT priority patent/HRP20240048T1/hr
Application filed by Momenta Pharmaceuticals Inc filed Critical Momenta Pharmaceuticals Inc
Priority to US16/321,801 priority patent/US11345751B2/en
Priority to DK17835436.1T priority patent/DK3491025T3/da
Priority to CA3032415A priority patent/CA3032415A1/en
Priority to KR1020197006049A priority patent/KR102505995B1/ko
Priority to SG11201900813RA priority patent/SG11201900813RA/en
Priority to EP17835436.1A priority patent/EP3491025B1/en
Priority to FIEP17835436.1T priority patent/FI3491025T3/fi
Priority to IL264528A priority patent/IL264528B2/en
Publication of WO2018023136A1 publication Critical patent/WO2018023136A1/en
Anticipated expiration legal-status Critical
Priority to US17/661,070 priority patent/US20230049725A1/en
Priority to JP2022100315A priority patent/JP7442575B2/ja
Priority to JP2024023875A priority patent/JP2024059765A/ja
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/283Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against Fc-receptors, e.g. CD16, CD32, CD64
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/04Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/16Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • A61P13/12Drugs for disorders of the urinary system of the kidneys
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P15/00Drugs for genital or sexual disorders; Contraceptives
    • A61P15/06Antiabortive agents; Labour repressants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/06Antipsoriatics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/14Drugs for dermatological disorders for baldness or alopecia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/02Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • A61P21/04Drugs for disorders of the muscular or neuromuscular system for myasthenia gravis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00Drugs for disorders of the senses
    • A61P27/02Ophthalmic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00Drugs for disorders of the senses
    • A61P27/16Otologicals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • A61P31/16Antivirals for RNA viruses for influenza or rhinoviruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • A61P31/18Antivirals for RNA viruses for HIV
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/20Antivirals for DNA viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P5/00Drugs for disorders of the endocrine system
    • A61P5/14Drugs for disorders of the endocrine system of the thyroid hormones, e.g. T3, T4
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • A61P7/04Antihaemorrhagics; Procoagulants; Haemostatic agents; Antifibrinolytic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • A61P7/06Antianaemics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/40Immunoglobulins specific features characterized by post-translational modification
    • C07K2317/41Glycosylation, sialylation, or fucosylation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • the CDR H1 includes, comprises, consists of, or consists essentially of a sequence Zi YAMG (SEQ ID NO: 1 5)
  • the CDR H2 includes, comprises, consists of, or consists essentially of a sequence Z7IGZ2SGZ3QTZ4YADS (SEQ ID NO: 16)
  • the CDR H3 includes, comprises, consists of, or consists essentially of a sequence LAZ5Z6DSY (SEQ ID NO: 17), wherein Xi is a polar or hydrophobic amino acid, X2 is a hydrophobic amino acid, X3 is a polar amino acid, X4 is a polar or acidic amino acid, X5 is a polar or hydrophobic amino acid, ⁇ is a hydrophobic amino acid, Zi is a polar or acidic amino acid, Z2 is a polar or hydrophobic amino acid, Z3 is G, S, or A, Z4 is a
  • the fetal and neonatal alloimmune and/or autoimmune disorder is selected from the group consisting of fetal and neonatal alloimmune thrombocytopenia hemolytic disease of the fetus and newborn, alloimmune pan-thrombocytopenia, congenital heart block, fetal arthrogryposis, neonatal myasthenia gravis, neonatal autoimmune hemolytic anemia, neonatal anti-phospholipid syndrome, neonatal polymyositis, dermatomyositis, neonatal lupus, neonatal scleroderma, Behcet's disease, neonatal Graves' disease, neonatal Kawasaki disease, neonatal autoimmune thyroid disease, and neonatal type I diabetes mellitus.
  • the application features a method of treating an antibody-mediated enhancement of viral disease in a fetus or a neonate, the method comprising administering an antibody to a pregnant subject, wherein the antibody includes, comprises, consists of, or consists essentially of: (1 ) a light chain variable region comprising a CDR L1 , a CDR L2, and a CDR L3 and (2) a heavy chain variable region comprising a CDR H1 , a CDR H2, and a CDR H3, wherein the CDR L1 includes, comprises, consists of, or consists essentially of a sequence X1 GTGSDVGSYNX2VS (SEQ ID NO: 12), the CDR L2 includes, comprises, consists of, or consists essentially of a sequence G DX3X4RPS (SEQ ID NO: 13), the CDR L3 includes, comprises, consists of, or consists essentially of a sequence X5SYX6GSGIYV (SEQ ID NO: 14), the C
  • lymphoproliferative syndrome idiopathic pulmonary fibrosis, IgA nephropathy, insulin dependent diabetes, juvenile arthritis, lichen planus, lupus, Meniere's Disease, mixed connective tissue disease, multiple sclerosis, pernicious anemia, polyarteritis nodosa, polychondritis, polyglandular syndromes, polymyalgia rheumatica, polymyositis, primary agammaglobulinemia, primary biliary cirrhosis, psoriasis, Raynaud's phenomenon, Reiter's syndrome, rheumatic fever, rheumatoid arthritis, sarcoidosis, scleroderma, Sjogren's syndrome, stiff-man syndrome, Takayasu arteritis, temporal arteritis, ulcerative colitis, uveitis, vitiligo, and Wegener's granulomatosis.
  • SIGASGSQTRYADS (SEQ ID NO: 8), SIGSSGAQTRYADS (SEQ ID NO: 7), SIGASGAQTRYADS (SEQ ID NO: 9), SIGASGGQTRYADS (SEQ ID NO: 10), TIGSSGAQTRYADS (SEQ ID NO: 41 ),
  • the isolated antibody includes, comprises, consists of, or consists essentially of: (1 ) a light chain variable region comprising a CDR L1 , a CDR L2, and a CDR L3 and (2) a heavy chain variable region comprising a CDR H1 , a CDR H2, and a CDR H3, wherein the CDR L1 includes, comprises, consists of, or consists essentially of the sequence XiGTGSDVGSYNLVS or TGTGSDVGSYNX2VS, the CDR L2 includes, comprises, consists of, or consists essentially of the sequence GDX3ERPS or GDSX4RPS, the CDR L3 includes, comprises, consists of, or consists essentially of the sequence X5SYAGSGIYV or SSYXeGSGIYV, the CDR H1 includes, comprises, consists of, or consists essentially of the sequence of TYAMG (SEQ ID NO: 4), DYAMG (SEQ ID NO: 5), or NYAMG
  • SIGASGAQTRYADS SEQ ID NO: 9
  • SIGASGGQTRYADS SEQ ID NO: 1 0
  • TIGSSGAQTRYADS SEQ ID NO: 41
  • SIGASGSQTRYADS SEQ ID NO: 42
  • TIGASGAQTRYADS SEQ ID NO: 43
  • TIGASGGQTRYADS SEQ ID NO: 32
  • the CDR H3 includes, comprises, consists of, or consists essentially of the sequence LAZ5GDSY or LAIZeDSY.
  • SIGSSGAQTRYADS SEQ ID NO: 7
  • TIGSSGAQTRYADS SEQ ID NO: 41
  • CDR H3 of sequence LAIGDSY SEQ ID NO: 1 1
  • the CDR L1 of the isolated antibody includes, comprises, consists of, or consists essentially of the sequence TGTGSDVGSYNLVS (SEQ ID NO: 1 )
  • the CDR L2 of the isolated antibody includes, comprises, consists of, or consists essentially of the sequence GDSERPS (SEQ ID NO: 2)
  • the CDR L3 of the isolated antibody includes, comprises, consists of, or consists essentially of the sequence SSYAGSGIYV (SEQ ID NO: 3)
  • the CDR H1 of the isolated antibody includes, comprises, consists of, or consists essentially of the sequence DYAMG (SEQ ID NO: 5)
  • the CDR H2 of the isolated antibody includes, comprises, consists of, or consists essentially of the sequence SIGASGSQTRYADS (SEQ ID NO: 8)
  • the CDR H3 of the isolated antibody includes, comprises, consists of, or consists essentially of the sequence LAIGDSY (SEQ ID NO: 1 1 ).
  • the CDR L1 of the isolated antibody includes, comprises, consists of, or consists essentially of the sequence TGTGSDVGSYNLVS (SEQ ID NO: 1 )
  • the CDR L2 of the isolated antibody includes, comprises, consists of, or consists essentially of the sequence GDSERPS (SEQ ID NO: 2)
  • the CDR L3 of the isolated antibody includes, comprises, consists of, or consists essentially of the sequence SSYAGSGIYV (SEQ ID NO: 3)
  • the CDR H1 of the isolated antibody includes, comprises, consists of, or consists essentially of the sequence NYAMG (SEQ ID NO: 6)
  • the CDR H2 of the isolated antibody includes, comprises, consists of, or consists essentially of the sequence SIGASGAQTRYADS (SEQ ID NO: 9) or TIGASGAQTRYADS (SEQ ID NO: 43)
  • the CDR H3 of the isolated antibody includes, comprises, consists of, or consists essentially of the sequence LAIGDSY (SEQ ID
  • the CDR L1 of the isolated antibody includes, comprises, consists of, or consists essentially of the sequence TGTGSDVGSYNLVS (SEQ ID NO: 1 )
  • the CDR L2 of the isolated antibody includes, comprises, consists of, or consists essentially of the sequence GDSERPS (SEQ ID NO: 2)
  • the CDR L3 of the isolated antibody includes, comprises, consists of, or consists essentially of the sequence SSYAGSGIYV (SEQ ID NO: 3)
  • the CDR H1 of the isolated antibody includes, comprises, consists of, or consists essentially of the sequence TYAMG (SEQ ID NO: 4)
  • the CDR H2 of the isolated antibody includes, comprises, consists of, or consists essentially of the sequence SIGASGGQTRYADS (SEQ ID NO: 10) or TIGASGGQTRYADS (SEQ ID NO: 32)
  • the CDR H3 of the isolated antibody includes, comprises, consists of, or consists essentially of the sequence LAIGDSY (SEQ
  • the CDR L3 of the isolated antibody includes, comprises, consists of, or consists essentially of the sequence SSYAGSGIYV (SEQ ID NO: 3)
  • the CDR H1 of the isolated antibody includes, comprises, consists of, or consists essentially of the sequence TYAMG (SEQ ID NO: 4)
  • the CDR H2 of the isolated antibody includes, comprises, consists of, or consists essentially of the sequence SIGASGSQTRYADS (SEQ ID NO: 8)
  • the CDR H3 of the isolated antibody includes, comprises, consists of, or consists essentially of the sequence LAIGDSY (SEQ ID NO: 1 1 ).
  • the CDR L1 of the isolated antibody includes, comprises, consists of, or consists essentially of a sequence X1GTGSDVGSYNX2VS (SEQ ID NO: 12), the CDR L2 of the isolated antibody includes, comprises, consists of, or consists essentially of a sequence GDX3X4RPS (SEQ ID NO: 13), the CDR L3 of the isolated antibody includes, comprises, consists of, or consists essentially of a sequence X 5 SYX 6 GSGIYV (SEQ ID NO: 14), the CDR H1 of the isolated antibody includes, comprises, consists of, or consists essentially of a sequence Zi YAMG (SEQ ID NO: 15), the CDR H2 of the isolated antibody includes, comprises, consists of, or consists essentially of a sequence Z7IGZ2SGZ3QTZ4YADS (SEQ ID NO: 16), and the CDR H3 of the isolated antibody includes, comprises, consists of, or consists essentially of a sequence LAZ 5 Z
  • Z 5 is I, L, or H
  • Z 6 is G, S, D, Q, or H
  • Z 7 is S or T.
  • the CDR L1 of the isolated antibody includes, comprises, consists of, or consists essentially of the sequence TGTGSDVGSYNLVS (SEQ ID NO: 1 ), the CDR L2 of the isolated antibody includes, comprises, consists of, or consists essentially of the sequence GDSERPS (SEQ ID NO: 1 ), the CDR L2 of the isolated antibody includes, comprises, consists of, or consists essentially of the sequence GDSERPS (SEQ ID NO: 1 ), the CDR L2 of the isolated antibody includes, comprises, consists of, or consists essentially of the sequence GDSERPS (SEQ ID NO: 1 ), the CDR L2 of the isolated antibody includes, comprises, consists of, or consists essentially of the sequence GDSERPS (SEQ ID NO: 1 ), the CDR L2 of the isolated antibody includes, comprises, consists of, or consists essentially of the sequence GDSERPS (SEQ ID NO: 1 ), the CDR L2 of the isolated antibody includes, comprises, consists of, or consists essentially
  • the light chain variable region of the isolated antibody includes, comprises, consists of, or consists essentially of a sequence having at least 90% identity to the sequence of
  • the heavy chain variable region of the isolated antibody includes, comprises, consists of, or consists essentially of a sequence having at least 90% identity to the sequence of
  • the heavy chain variable region of the isolated antibody includes, comprises, consists of, or consists essentially of a sequence having at least 90% identity to the sequence of
  • the light chain variable region of the isolated antibody includes, comprises, consists of, or consists essentially of a sequence having at least 90% identity to the sequence of
  • the heavy chain variable region of the isolated antibody includes, comprises, consists of, or consists essentially of a sequence having at least 90% identity to the sequence of
  • the light chain variable region of the isolated antibody includes, comprises, consists of, or consists essentially of a sequence having at least 90% identity to the sequence of
  • the light chain variable region of the isolated antibody includes, comprises, consists of, or consists essentially of a sequence having at least 90% identity to the sequence of
  • the light chain variable region of the isolated antibody includes, comprises, consists of, or consists essentially of the sequence of
  • the heavy chain variable region of the isolated antibody includes, comprises, consists of, or consists essentially of the sequence of
  • the light chain variable region of the isolated antibody includes, comprises, consists of, or consists essentially of the sequence of
  • the antibody binds human FcRn with a KD of between 1 pM and 100 nM. In some embodiments, the isolated antibody binds human FcRn with a KD of less than or equal to that of antibody N026.
  • the isolated antibody is lgG1 or variant thereof.
  • the isolated antibody includes, comprises, consists of, or consists essentially of a ⁇ light chain.
  • the isolated antibody is a sialylated antibody.
  • the antibody binds to an epitope on FcRn comprising at least one, two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, fifteen, sixteen, seventeen, eighteen, nineteen, or twenty amino acids selected from the group consisting of K80, A81 , L82, G83, G84, K85, G86, P87, Y88, L1 12, N1 13, G129, D130, W131 , P132, E133, L135, A136, and Q139 of SEQ ID NO: 30.
  • the epitope on FcRn includes, comprises, consists of, or consists essentially of T126W127G128G129D130W131 , W127G128G129D130W131 P132,
  • the epitope on FcRn includes, comprises, consists of, or consists essentially of one or more amino acids within about 3 amino acids or 10 Angstroms of W131 , one or more amino acids within about 5 amino acids or 8 Angstroms Y88, or any two sets of amino amino acids, wherein the first set is or includes W131 and the second set is or includes Y88 of SEQ ID NO: 30.
  • the epitope on FcRn includes, comprises, consists of, or consists essentially of K80, A81 , L82, G83, G84, K85, G86, P87, Y88, L1 12, N1 13, E1 15, G129, D130, W131 , P132, E133, L135, A136, and Q139.
  • the application features an isolated antibody, comprising: (1 ) a light chain variable region comprising a CDR L1 , a CDR L2, and a CDR L3 and (2) a heavy chain variable region comprising a CDR H1 , a CDR H2, and a CDR H3, wherein (a) the CDR L1 includes, comprises, consists of, or consists essentially of TGTGSDVGSYNLVS (SEQ ID NO: 1 ), wherein no more than six single amino acids are deleted or substituted, provided that no amino acids within the subsequence SDVGSYNL are deleted or substituted, (b) the CDR L2 includes, comprises, consists of, or consists essentially of GDSERPS (SEQ ID NO: 2), wherein no more than three single amino acids are deleted or substituted, provided that no amino acids within the subsequence GDSE are deleted or substituted, (c) the CDR L3 includes, comprises, consists of, or consists essentially of SSYAGSGIYV
  • the CDR L3 includes, comprises, consists of, or consists essentially of SSYAGSGIYV (SEQ ID NO: 3) wherein no more than three single amino acids are deleted or substituted, provided that no amino acids within the subsequence YAGSGIY are deleted or substituted
  • the CDR H1 includes, comprises, consists of, or consists essentially of a sequence selected from the group consisting of TYAMG (SEQ ID NO: 4), DYAMG (SEQ ID NO: 5), and NYAMG (SEQ ID NO: 6), wherein no more than three single amino acids are deleted or substituted, provided that no amino acids within the subsequence YA are substituted
  • the CDR H2 includes, comprises, consists of, or consists essentially of a sequence selected from the group consisting of SIGASGSQTRYADS (SEQ ID NO: 8), SIGSSGAQTRYADS (SEQ ID NO: 7), SIGASGAOTRYADS (SIGASGSQTRYADS (SEQ ID NO: 8),
  • the antibody recognizes an amino acid sequence on FcRn comprising TWGGDW, WGGDWP, GGDWPE, GDWPEA, DWPEAL, WPEALA, G GKGPY, G KG PYT, KG PYTL, G PYTLQ, P YTLTQ, and/or YTLQGL in SEQ ID NO: 30.
  • the fetal and neonatal autoimmune and/or autoimmune disorder is fetal and neonatal alloimmune thrombocytopenia.
  • the heavy chain variable region of the isolated antibody includes, comprises, consists of, or consists essentially of a sequence having at least 95%, 97%, 99%, or 100% identity to the sequence of any one of SEQ ID NOs: 20-24, for use in the treatment of a fetal and neonatal alloimmune and/or autoimmune disorder.
  • the light chain variable region of the isolated antibody includes, comprises, consists of, or consists essentially of the sequence of
  • the antibody binds human FcRn with a KD that is less than or equal to that of an antibody having the light chain variable region and heavy chain variable region of N022, N023, N024, N026, or N027, and further having the same Fc region as that of the antibody to which it is being compared.
  • Xi is T, A, S, or I.
  • X2 is L or I.
  • X3 is S, N, or T.
  • X4 is Q, E, or N
  • X5 is C, S, I, or Y.
  • is A or V
  • Zi is E, T, D, or N.
  • Z2 is S or A.
  • Z4 is K or R.
  • Z5 is I, L, or H.
  • the isolated antibody contains a CDR L1 having the sequence of
  • the isolated antibody contains a CDR L1 having the sequence of
  • TGTGSDVGSYNLVS (SEQ ID NO: 1 ), a CDR L2 having the sequence of GDSERPS (SEQ ID NO: 2), a CDR L3 having the sequence of SSYAGSGIYV (SEQ ID NO: 3), a CDR H1 having the sequence of NYAMG (SEQ ID NO: 6), a CDR H2 having the sequence of SIGASGAOTRYADS (SEQ ID NO: 9), and a CDR H3 having the sequence of LAIGDSY (SEQ ID NO: 1 1 ).
  • TGTGSDVGSYNLVS (SEQ ID NO: 1 ), a CDR L2 having the sequence of GDSERPS (SEQ ID NO: 2), a CDR L3 having the sequence of SSYAGSGIYV (SEQ ID NO: 3), a CDR H1 having the sequence of TYAMG (SEQ ID NO: 4), a CDR H2 having the sequence of SIGASGGQTRYADS (SEQ ID NO: 10), and a CDR H3 having the sequence of LAIGDSY (SEQ ID NO: 1 1 ).
  • the isolated antibody contains a CDR L1 having the sequence of
  • TGTGSDVGSYNLVS (SEQ ID NO: 1 ), a CDR L2 having the sequence of GDSERPS (SEQ ID NO: 2), a CDR L3 having the sequence of SSYAGSGIYV (SEQ ID NO: 3), a CDR H1 having the sequence of TYAMG (SEQ ID NO: 4), a CDR H2 having the sequence of SIGASGSQTRYADS (SEQ ID NO: 8), and a CDR H3 having the sequence of LAIGDSY (SEQ ID NO: 1 1 ).
  • the light chain variable region of the isolated antibody of the application has a sequence having at least 90% identity to the sequence of
  • the heavy chain variable region of the isolated antibody of the application has a sequence having at least 90% identity to the sequence of
  • the heavy chain variable region of the isolated antibody of the application has a sequence having at least 90% identity to the sequence of
  • the isolated antibody contains a light chain variable region and a heavy chain variable region, wherein the light chain variable region has a sequence having at least 90% identity to the sequence of
  • the heavy chain variable region of the isolated antibody of the application has a sequence having at least 95%, 97%, 99%, or 100% identity to the sequence of any one of SEQ ID NOs: 20-24.
  • the light chain variable region of the isolated antibody of the application has a sequence having at least 95%, 97%, 99%, or 100% identity to the sequence of SEQ ID NO: 19.
  • the isolated antibody of the application further includes amino acid substitution N297A, relative to the sequence of any one of SEQ ID NOs: 20-24.
  • the isolated antibody of the application further includes any one or more of the following amino acid substitutions: A23V, S30R, L80V, A84T, E85D, A93V, relative to the sequence of any one of SEQ ID NOs: 20-24 and Q38H, V58I, and G99D, relative to the sequence of SEQ ID NO: 19.
  • the isolated antibody contains a light chain variable region and a heavy chain variable region, wherein the light chain variable region has the sequence of
  • the isolated antibody contains a light chain variable region and a heavy chain variable region, wherein the light chain variable region has the sequence of
  • the isolated antibody of the application is a monoclonal antibody.
  • the isolated antibody is lgG1 .
  • the isolated antibody includes a ⁇ light chain.
  • the isolated antibody includes a kappa light chain.
  • the glycosylation site on the Fc region of the isolated antibody is sialylated (e.g., disialylated).
  • the present application features novel antibodies to human neonatal Fc receptor (FcRn). These anti-FcRn antibodies are useful, e.g., to promote clearance of autoantibodies in a subject, to suppress antigen presentation in a subject, to block an immune response, e.g., block an immune complex-based activation of the immune response in a subject, or to treat immunological diseases (e.g., autoimmune diseases) in a subject.
  • FcRn human neonatal Fc receptor
  • anti-FcRn antibodies are also useful in methods of decreasing pathogenic antibody transport across the placenta of a pregnant subject, increasing pathogenic antibody catabolism in a pregnant subject, and treating an antibody-mediated enhancement of viral disease in a fetus or a neonate by administering to a pregnant subject an isolated antibody that binds to FcRn.
  • the pathogenic antibody in the pregnant subject causes a fetal and neonatal alloimmune and/or autoimmune disorder in a fetus in the pregnant subject.
  • the application features an isolated antibody that binds to human FcRn, wherein the antibody binds to at least one amino acid of the sequence of KQGTWGGDWPEAL (SEQ ID NO: 25), wherein the antibody binds to at least one of amino acid residues 5, 12, or 13 of SEQ ID NO: 25, and wherein the antibody inhibits the binding of IgG to human FcRn.
  • the antibody binds to at least one amino acid of the sequence of KQGTWGGDWPEAL (SEQ ID NO: 25), wherein the antibody binds to at least one of amino acid residues 5, 12, or 13 of SEQ ID NO: 25, and wherein the antibody inhibits the binding of IgG to human FcRn.
  • the application features an isolated antibody that binds to human FcRn, wherein the antibody binds to at least one amino acid of the sequence of KQGTWGGDWPEAL (SEQ ID NO: 25), wherein the antibody does not bind to a peptide consisting of the sequence GEEFMNFDLKQGT (SEQ ID NO: 27) or one or more amino acids of the sequence of EEFMNFDL (SEQ ID NO: 28), and wherein the antibody inhibits the binding of IgG to human FcRn.
  • the antibody binds to at least one amino acid of the sequence of KQGTWGGDWPEAL (SEQ ID NO: 25), wherein the antibody does not bind to a peptide consisting of the sequence GEEFMNFDLKQGT (SEQ ID NO: 27) or one or more amino acids of the sequence of EEFMNFDL (SEQ ID NO: 28), and wherein the antibody inhibits the binding of IgG to human FcRn.
  • the antibody binds to at least amino acid residue 5 of SEQ ID NO: 25. In some embodiments, the antibody binds to at least amino acid residue 12 of SEQ ID NO: 25. In some embodiments, the antibody binds to at least amino acid residue 13 of SEQ ID NO: 25.
  • the antibody further binds to at least one amino acid of the sequence of KQGTWGGDWPEAL (SEQ ID NO: 25). In some embodiments, the antibody further binds to at least two amino acids of the sequence of KQGTWGGDWPEAL (SEQ ID NO: 25).
  • the application features a host cell that expresses an isolated anti-FcRn antibody described herein, wherein the host cell includes a nucleic acid molecule that encodes the isolated anti-FcRn antibody or a vector that includes the nucleic acid molecule, wherein the nucleic acid molecule or vector is expressed in the host cell.
  • the host cell is a Chinese hamster ovary (CHO) cell.
  • the application features a pharmaceutical composition including an isolated anti-FcRn antibody described herein and one or more pharmaceutically acceptable carriers or excipients.
  • the antibody is in a therapeutically effective amount.
  • the host cell used in the method is a CHO cell.
  • the immune response is an acute or chronic immune response in the subject.
  • the chronic immune response is activated by a medical condition selected from the group consisting of chronic inflammatory demyelinating polyneuropathy (CIDP), systemic lupus, reactive arthropathies, primary biliary cirrhosis, ulcerative colitis, and antineutrophil cytoplasmic antibody (ANCA)-associated vasculitis.
  • CIDP chronic inflammatory demyelinating polyneuropathy
  • reactive arthropathies reactive arthropathies
  • primary biliary cirrhosis primary biliary cirrhosis
  • ulcerative colitis ulcerative colitis
  • ANCA antineutrophil cytoplasmic antibody
  • the subject has an autoimmune disease.
  • the autoimmune disease may be alopecia areata, ankylosing spondylitis, antiphospholipid syndrome, Addison's disease, hemolytic anemia, autoimmune hepatitis, hepatitis, Behcets disease, bullous pemphigoid, cardiomyopathy, celiac sprue-dermatitis, chronic fatigue immune dysfunction syndrome, chronic inflammatory demyelinating polyneuropathy, Churg-Strauss syndrome, cicatricial pemphigoid, limited scleroderma (CREST syndrome), cold agglutinin disease, Crohn's disease, dermatomyositis, discoid lupus, essential mixed cryoglobulinemia, fibromyalgia, fibromyositis, Graves' disease, Hashimoto's thyroiditis, hypothyroidism, inflammatory bowel disease, autoimmune lymphoproliferative syndrome, idiopathic pulmonary a
  • the fetal and neonatal alloimmune and/or autoimmune disorder is selected from the group consisting of fetal and neonatal alloimmune thrombocytopenia (FNAIT), hemolytic disease of the fetus and newborn (HDFN), alloimmune pan-thrombocytopenia, congenital heart block, fetal arthrogryposis, neonatal myasthenia gravis, neonatal autoimmune hemolytic anemia, neonatal anti-phospholipid syndrome, neonatal polymyositis, dermatomyositis, neonatal lupus, neonatal scleroderma. Behcet's disease, neonatal Graves' disease, neonatal Kawasaki disease, neonatal autoimmune thyroid disease, and neonatal type I diabetes mellitus.
  • FNAIT fetal and neonatal alloimmune thrombocytopenia
  • HDFN hemolytic disease of the fetus and newborn
  • the pathogenic antibody is an IgG antibody.
  • the viral disease is caused by a virus selected from the group consisting of an alpha virus infection, flavivirus infection, Zika virus infection, Chikungunya virus infection, Ross River virus infection, severe acute respiratory syndrome coronavirus infection, Middle East respiratory syndrome, avian influenza infection, influenza virus infection, human respiratory syncytial virus infection, Ebola virus infection, yellow fever virus infection, dengue virus infection, human immunodeficiency virus infection, respiratory syncytial virus infection, Hantavirus infection, Getah virus infection, Sindbis virus infection, Bunyamwera virus infection, West Nile virus infection, Japanese encephalitis virus B infection, rabbitpox virus infection, lactate dehydrogenase elevating virus infection, reovirus infection, rabies virus infection, foot-and-mouth disease virus infection, porcine reproductive and respiratory syndrome virus infection, simian hemorrhagic fever virus infection, equine infectious anemia virus infection, caprine arthritis virus infection, African swine fever virus infection, lentivirus infection,
  • the pregnant subject has a history of having had a previous fetus or neonate that had a fetal and neonatal alloimmune and/or autoimmune disorder.
  • the isolated anti-FcRn antibody of the application binds rodent, e.g., mouse or rat FcRn. In some embodiments, the isolated anti-FcRn antibody of the application binds rodent, e.g., mouse or rat, FcRn with a KD of less than 200, 1 50, 1 00, 50, or 40 pM.
  • antibody herein is used in the broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments so long as they exhibit FcRn antigen- binding activity.
  • Antibody fragments comprise a portion of an intact antibody, preferably the antigen binding or variable region of the intact antibody.
  • antibody fragments include Fab, Fab', F(ab')2, and Fv fragments, diabodies, linear antibodies, single-chain antibody molecules, and multispecific antibodies.
  • isolated antibody refers to an antibody which has been separated and/or recovered from a component of its manufacturing host cell environment. Contaminant components of its manufacturing host cell environment are materials which would interfere with research, diagnostic, or therapeutic uses of the antibody. Contaminant components may include enzymes, hormones, and other proteinaceous or nonproteinaceous solutes.
  • an antibody is purified (1 ) to greater than 95% by weight of antibody as determined by, for example, the Lowry method, and in some embodiments, to greater than 99% by weight; (2) to a degree sufficient to obtain at least 1 5 residues of N-terminal or internal amino acid sequence by use of, for example, a spinning cup sequenator, or (3) to homogeneity by SDS-PAGE under reducing or non-reducing conditions using, for example, Coomassie blue or silver stain.
  • An isolated antibody includes the antibody in situ within recombinant cells. Ordinarily, however, an isolated antibody will be prepared by at least one purification step.
  • a pharmaceutical preparation of an isolated antibody typically has less than 250 ppm (e.g., less than 200ppm, 150ppm. 100 ppm) of host cell proteins (HCP) as determined by an ELISA based HCP assay performed as recommended by an FDA "Guidance for Industry" document.
  • HCP host cell proteins
  • the term "monoclonal antibody” refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., individual antibodies in the population have the same primary sequence except for possible naturally occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific and directed against a single antigenic site (i.e., an epitope on human FcRn). In contrast to polyclonal antibody preparations which typically include different antibodies directed against different epitopes, each monoclonal antibody is directed against a single epitope on the antigen.
  • the modifier "monoclonal” indicates the character of the antibody as being obtained from a substantially homogenous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
  • the actual linear amino acid sequence may contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a CDR (defined further herein) or FR (defined further herein) of the variable region.
  • a heavy chain variable region may include a single inserted residue (i.e., residue 52a according to Kabat) after residue 52 of CDR H2 and inserted residues (i.e., residues 82a, 82b, 82c, etc. according to Kabat) after residue 82 of heavy chain FR.
  • the Kabat numbering of residues may be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a "standard" Kabat numbered sequence.
  • complementary determining regions and “CDRs” refer to the regions of an antibody variable domain which are hypervariable in sequence and/or form structurally defined loops.
  • a CDR is also known as a hypervariable region.
  • the light chain and heavy chain variable regions each has three CDRs.
  • the light chain variable region contains CDR L1 , CDR L2, and CDR L3.
  • the heavy chain variable region contains CDR H1 , CDR H2, and CDR H3.
  • Each CDR may include amino acid residues from a complementarity determining region as defined by Kabat (i.e.
  • FcRn refers to a neonatal Fc receptor that binds to the Fc region of an
  • IgG antibody e.g., an lgG1 antibody.
  • An exemplary FcRn is human FcRn having UniProt ID No. P55899. Human FcRn is believed to be responsible for maintaining the half-life of IgG by binding and trafficking constitutively internalized IgG back to the cell surface for the recycling of IgG.
  • TWO molecules that have high affinity for each other generally bind readily, tend to remain bound longer, and exhibit a small KD.
  • One method for determining the KD of an antibody to human FcRn is described in Example 2 ("the SPR (Surface Plasmon Resonance) method"). Using this method the KD of N022, N023, N024, N026, and N027 was 31 , 31 .4, 35.5, 36.5, and 19.3 pM, respectively.
  • the term "inhibit IgG binding to FcRn” refers to the ability of an anti-FcRn antibody to block or inhibit the binding of IgG (e.g., lgG1 ) to human FcRn.
  • an anti- FcRn antibody binds FcRn, for example, at the site on human FcRn to which IgG binds.
  • the anti- FcRn antibody is able to inhibit the binding of IgG (e.g., a subject's autoantibodies) to FcRn.
  • the molecule e.g., an anti-FcRn antibody
  • the binding of IgG is reduced by 10%, 20%, 30%, 50%, 70%, 80%, 90%, 95%, or even 100%.
  • the term "inhibit pathogenic antibody binding to FcRn” refers to the ability of an anti-FcRn antibody to block or inhibit the binding of a pathogenic antibody (e.g., pathogenic IgG antibody) to human FcRn.
  • a pathogenic antibody e.g., pathogenic IgG antibody
  • an anti-FcRn antibody binds FcRn, for example, at the site on human FcRn to which the pathogenic antibody binds.
  • the anti-FcRn antibody is able to inhibit the binding of pathogenic antibodies (e.g., pathogenic IgG antibodies) to FcRn.
  • the molecule e.g., an anti-FcRn antibody
  • the binding of pathogenic antibodies to FcRn is reduced by 10%, 20%, 30%, 50%, 70%, 80%, 90%, 95%, or even 100%.
  • hydrophobic amino acid refers to an amino acid having relatively low- water solubility. Hydrophobic amino acids are glycine, leucine, isoleucine, alanine, phenylalanine, methionine, tryptophan, valine, and proline. Particularly preferred hydrophobic amino acids in the present disclosure are alanine, leucine, isoleucine, and valine.
  • polar amino acid refers to an amino acid having a chemical polarity in its side chain induced by atoms with different electronegativity. The polarity of a polar amino acid is dependent on the electronegativity between atoms in the side chain of the amino acid and the asymmetry of the structure of the side chain.
  • Polar amino acids are serine, threonine, cysteine, histidine, methionine, tyrosine, tryptophan, asparagine, and glutamine.
  • Particularly preferred polar amino acids in the present disclosure are serine, threonine, asparagine, glutamine, cysteine, and tyrosine.
  • acidic amino acid refers to an amino acid whose side chain contains a carboxylic acid group having a pKa between 3.5 and 4.5. Acidic amino acids are aspartic acid and glutamic acid.
  • the term "basic amino acid” refers to an amino acid whose side chain contains an amino group having a pKa between 9.5 and 13. Basic amino acids are histidine, lysine, and arginine.
  • percent (%) identity refers to the percentage of amino acid (or nucleic acid) residues of a candidate sequence, e.g., an anti-FcRn antibody, that are identical to the amino acid (or nucleic acid) residues of a reference sequence, e.g., a wild-type anti-FcRn antibody, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent identity (i.e., gaps can be introduced in one or both of the candidate and reference sequences for optimal alignment and nonhomologous sequences can be disregarded for comparison purposes).
  • A is the number of amino acid (or nucleic acid) residues scored as identical in the alignment of the candidate sequence and the reference sequence
  • B is the total number of amino acid (or nucleic acid) residues in the reference sequence.
  • the percent amino acid (or nucleic acid) sequence identity of the candidate sequence to the reference sequence would not equal to the percent amino acid (or nucleic acid) sequence identity of the reference sequence to the candidate sequence.
  • a reference sequence aligned for comparison with a candidate sequence may show that the candidate sequence exhibits from 50% to 100% identity across the full length of the candidate sequence or a selected portion of contiguous amino acid (or nucleic acid) residues of the candidate sequence.
  • the length of the candidate sequence aligned for comparison purpose is at least 30%, e.g., at least 40%, e.g., at least 50%, 60%, 70%, 80%, 90%, or 100% of the length of the reference sequence.
  • a substitution, deletion, or insertion may comprise a certain number of amino acids, (e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9, 1 0, 1 1 , 12, 13, 14, 15, or more).
  • substitution, deletion, or insertion comprises, e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, ... or n amino acids.
  • the number or substitutions, deletions, or insertions can comprise a percent of the total sequence (e.g., 1 %, 5%, 1 0%, 15%, 20%, or more) where the number of substitutions, deletions, or insertions alters 5%, 10%, 15%, 20% or more, of the amino acids in the total sequence.
  • the term "fetal and neonatal alloimmune and/or autoimmune disorder” refers to an immune disorder in a fetus and/or neonate that is caused by the transplacental transfer of maternal antibodies (e.g., pathogenic maternal antibodies) directed against fetal and/or neonate antigens.
  • pathogenic antibodies in a pregnant subject may transfer through the placenta to the fetus and react against antigens from the fetus (e.g., antigens that the fetus inherited from the fetus' father), thus causing, e.g., fetal and neonatal alloimmune and/or autoimmune disorders.
  • antigens from the fetus e.g., antigens that the fetus inherited from the fetus' father
  • an antibody may bind to a viral surface protein and the antibody/virus complex may bind to an FcRn receptor on a cell surface through interaction between the antibody and the receptor. Subsequently, the antibody/virus complex may get internalized into the cell.
  • vector refers to a nucleic acid molecule capable of transporting another nucleic acid molecule to which it has been linked.
  • plasmid refers to a circular double stranded DNA loop into which additional DNA segments may be ligated.
  • phage vector Another type of vector is a viral vector, wherein additional DNA segments may be ligated into the viral genome.
  • viral vector is capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors).
  • vectors e.g., non-episomal mammalian vectors
  • vectors can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome.
  • certain vectors are capable of directing the expression of genes to which they are operatively linked.
  • Such vectors are referred to herein as "recombinant expression vectors" (or simply, “recombinant vectors”).
  • expression vectors of utility in recombinant DNA techniques are often in the form of plasmids.
  • the term "subject" refers to a mammal, e.g., preferably a human. Mammals include, but are not limited to, humans and domestic and farm animals, such as monkeys (e.g., a cynomolgus monkey), mice, dogs, cats, horses, and cows, etc.
  • monkeys e.g., a cynomolgus monkey
  • mice dogs, cats, horses, and cows, etc.
  • terapéuticaally effective amount refers to an amount, e.g., pharmaceutical dose, effective in inducing a desired biological effect in a subject or patient or in treating a patient having a condition or disorder described herein. It is also to be understood herein that a
  • therapeutically effective amount may be interpreted as an amount giving a desired therapeutic effect, either taken in one dose or in any dosage or route, taken alone or in combination with other therapeutic agents.
  • no more than refers to an amount that is less than equal to. This may be an amount in integers. For example, no more than two substitutions can refer to 0, 1 , or 2 substitutions.
  • treatment refers to reducing, decreasing, decreasing the risk of, or decreasing the side effects of a particular disease or condition. Reducing, decreasing, decreasing the risk of, or decreasing the side effects of are relative to a subject who did not receive treatment, e,g, a control, a baseline, or a known control level or measurement.
  • FIG. 2 shows graphs that show the effects of antibodies N023, N024, N026, and N027 on IgG catabolism in transgenic mice.
  • FIG. 3 shows graphs that show the dose-dependent effects of antibody N027 on IgG levels and target occupancy in transgenic mice.
  • FIGS. 4A-4C show graphs that show the selective induction of IgG catabolism and target occupancy in cynomolgus monkeys following administration of different doses of antibody N027.
  • FIG. 5 shows a graph that shows the biodistribution of N027 in transgenic mice.
  • FIG. 7 shows an experimental timeline and two graphs that show the efficacy of N027 in a mouse chronic idiopathic thrombocytopenia purpura (ITP) model in transgenic mice.
  • ITP chronic idiopathic thrombocytopenia purpura
  • FIGS. 8A-8C show graphs that show the dose-dependent FcRn occupancy achieved with N027 in aortic endothelial cells, venous endothelial cells, and placental trophoblast, respectively.
  • FIGS. 9A-9C show graphs that show 1 00% FcRn occupancy by N027 results in increased intracellular IgG accumulation in aortic endothelial cells, venous endothelial cells, and placental trophoblast, respectively.
  • FIG. 10 shows a graph that shows the amount of time it takes to achieve 100% FcRn occupancy by N027.
  • FIGS. 11 A and 11 B show graphs that show N027 treatment does not alter FcRn turnover rates in human endothelial and villous trophoblast cells, respectively.
  • FIGS. 13A and 13B show graphs that show the effect of N027 treatment on dynamics of IgG trafficking in human endothelial cells and human placental trophoblasts, respectively.
  • FIG. 14 shows images of a comparison of the N027 Fab binding site on FcRn with Fc and albumin binding sites. Fab and Fc binding sites overlap with each other but are distinct from the albumin binding site.
  • FIG. 15 shows images of the epitope on the N027 Fab surface (left) and paratope on the FcRn surface (right).
  • FIG. 16 shows the N027 Fab:FcRn epitope and paratope mapped to sequences.
  • FIG. 17 is a graph that shows transplacental transfer of antipyrine over four hours of perfusion
  • FIG. 18 is a graph that shows transplacental transfer of N027 over four hours of perfusion.
  • FIG. 19 is a graph showing maternal IgG concentrations after treatment with N027 during gestation.
  • FIG. 20 is a graph showing fetal IgG levels after treatment of mothers with N027 during gestation. DETAILED DESCRIPTION
  • the present disclosure features isolated antibodies that bind to human neonatal Fc receptor (FcRn) with high affinity.
  • the present disclosure features anti-FcRn antibodies, methods and
  • compositions for preparing anti-FcRn antibodies and methods for blocking FcRn activity, reducing immune complex-based activation of an immune response, and treating immunological diseases.
  • anti-FcRn antibodies can be used to decrease pathogenic antibody transport across the placenta of a pregnant subject, to increase pathogenic antibody catabolism in a pregnant subject, and to treat an antibody-mediated enhancement of viral disease in a fetus or a neonate.
  • Anti-FcRn antibodies can be used to decrease pathogenic antibody transport across the placenta of a pregnant subject, to increase pathogenic antibody catabolism in a pregnant subject, and to treat an antibody-mediated enhancement of viral disease in a fetus or a neonate.
  • an anti- FcRn antibody refers to an antibody that can bind to human FcRn and inhibit IgG (e.g., IgG
  • the antibody is a monoclonal antibody. In other embodiments, the antibody is a polyclonal antibody. In some embodiment, the antibody is lgG1 . In some embodiment, the antibody includes a ⁇ light chain. In some embodiment, the antibody is a sialylated antibody. In some embodiments, the antibody is selected from the group consisting of a chimeric antibody, an affinity matured antibody, a humanized antibody, and a human antibody. In certain embodiments, the antibody is an antibody fragment, e.g., a Fab, Fab', Fab'-SH, F(ab') 2 , or scFv.
  • the antibody is a chimeric antibody.
  • an antibody contains antigen binding sequences from a non-human donor grafted to a heterologous non-human, human, or humanized sequence (e.g., framework and/or constant domain sequences).
  • the non-human donor is a mouse.
  • an antigen binding sequence is synthetic, e.g., obtained by mutagenesis (e.g., phage display screening, etc.).
  • a chimeric antibody has non-human (e.g., mouse) variable regions and human constant regions.
  • a mouse light chain variable region is fused to a human ⁇ light chain.
  • a mouse heavy chain variable region is fused to a human lgG1 constant region.
  • the disclosure features an isolated antibody that binds to human neonatal Fc receptor (FcRn), the isolated antibody including: (1 ) a light chain variable region including a CDR L1 , a CDR L2, and a CDR L3 and (2) a heavy chain variable region comprising a CDR H1 , a CDR H2, and a CDR H3, wherein the CDR L1 includes the sequence SDVGSYNL(SEQ ID NO: 33) or VG_YNL(SEQ ID NO: 34), wherein the can be any amino acid, the CDR L2 includes the sequence GDSE (SEQ ID NO: 35), the CDR L3 includes the sequence YAGSGIY (SEQ ID NO: 36), the CDR H1 includes the sequence TYA(SEQ ID NO: 37), the CDR H2 includes the sequence SIGASGSQTR (SEQ ID NO: 38) or
  • SI_AS_SQ_R (SEQ ID NO: 39), wherein the "_" can be any amino acid
  • the CDR H3 includes the sequence LAI (SEQ ID NO: 40), and, optionally, wherein (a) the CDR L1 has a deletion or has more than two amino acid substitutions relative to the sequence of TGTGSDVGSYNLVS (SEQ ID NO: 1 ), (b) the CDR L2 has a deletion or has more than one amino acid substitution relative to the sequence of
  • the disclosure features an isolated antibody that binds to human FcRn, wherein the antibody binds to an epitope on FcRn comprising at least one, two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, fifteen, sixteen, seventeen, eighteen, nineteen, or twenty amino acids selected from the group consisting of K80, A81 , L82, G83, G84, K85, G86, P87, Y88, L1 12, N1 13, E1 15, G129, D130, W131 , P132, E133, L135, A136, and Q139 of SEQ ID NO: 30, which corresponds to amino acids K103, A1 04, L105, G106, G107, K108, G109, P1 10, Y1 1 1 , L135, N136, E138, G152, D153, W154, P155, E156, L158, A159, Q162, respectively, of wildtype FcRn.
  • the epitope corresponds to amino acids K
  • the disclosure features an isolated antibody that binds to FcRn, wherein the antibody binds to: (a) at least one amino acid of the sequence of KOGTWGGDWPEAL (SEQ ID NO: 25); and (b) a at least one amino acid of the sequence of FKALGGKGPYTL (SEQ ID NO: 26), wherein the antibody inhibits the binding of IgG to human FcRn.
  • the disclosure also features an isolated antibody that binds to human FcRn, wherein the antibody binds to at least one amino acid of the sequence of KOGTWGGDWPEAL (SEQ ID NO: 25), wherein the antibody binds to at least one of amino acid residues 5, 12, or 13 of SEQ ID NO: 25, and wherein the antibody inhibits the binding of IgG to human FcRn.
  • the antibody binds to at least one amino acid of the sequence of KOGTWGGDWPEAL (SEQ ID NO: 25), wherein the antibody binds to at least one of amino acid residues 5, 12, or 13 of SEQ ID NO: 25, and wherein the antibody inhibits the binding of IgG to human FcRn.
  • the disclosure also features an isolated antibody that binds to human FcRn, wherein the antibody binds to at least one amino acid of the sequence of KOGTWGGDWPEAL (SEQ ID NO: 25), wherein the antibody does not bind to a peptide consisting of the sequence EFMNFDLKQGT (SEQ ID NO: 25), wherein the antibody does not bind to a peptide consisting of the sequence EFMNFDLKQGT (SEQ ID NO: 25).
  • the anti-FcRn antibody described herein binds to at least one amino acid of the sequence of WGGDWPEAL (SEQ ID NO: 29). In some embodiments, the anti-FcRn antibody binds to at least amino acid residue 5 of SEQ ID NO: 25. In some embodiments, the anti-FcRn antibody binds to at least amino acid residue 12 of SEQ ID NO: 25. In some embodiments, the anti-FcRn antibody binds at least amino acid residue 13 of SEQ ID NO: 25.
  • the anti-FcRn antibody binds to at least one amino acid of the sequence of FKALGGKGPYTL (SEQ ID NO: 26).
  • the anti-FcRn antibody may also bind to t least two amino acids of the sequence of FKALGGKGPYTL (SEQ ID NO: 26).
  • the disclosure also features an isolated antibody that binds to human FcRn, wherein the antibody binds to at least one amino acid of the sequence of FKALGGKGPYTL (SEQ ID NO: 26), and wherein the antibody inhibits the binding of IgG to human FcRn.
  • the anti-FcRn antibody binds to at least two amino acids of the sequence of FKALGGKGPYTL (SEQ ID NO: 26). In some embodiments, the anti-FcRn antibody further binds to at least one amino acid of the sequence of KQGTWGGDWPEAL (SEQ ID NO: 25). In some embodiments, the anti-FcRn antibody further binds to at least two amino acids of the sequence of KQGTWGGDWPEAL (SEQ ID NO: 25). In some embodiments, the anti-FcRn antibody binds to at least one of amino acid residues 5, 12, or 13 of SEQ ID NO: 25.
  • the anti-FcRn antibody binds to at least amino acid residue 5 of SEQ ID NO: 25. In some embodiments, the anti-FcRn antibody binds to at least amino acid residue 12 of SEQ ID NO: 25. In some embodiments, the anti-FcRn antibody binds to at least amino acid residue 13 of SEQ ID NO: 25.
  • the disclosure features an isolated antibody capable of binding to human FcRn.
  • the isolated antibody contains: (1 ) a light chain variable region that includes a CDR L1 , a CDR L2, and a CDR L3 and (2) a heavy chain variable region that includes a CDR H1 , a CDR H2, and a CDR H3, wherein the CDR L1 has a sequence having at least 92% identity to the sequence of
  • the CDR L2 has a sequence having at least 85% identity to the sequence of GDSERPS (SEQ ID NO: 2)
  • the CDR L3 has a sequence having at least 90% identity to the sequence of SSYAGSGIYV (SEQ ID NO: 3)
  • the CDR H1 has a sequence having at least 80% identity to the sequence of TYAMG (SEQ ID NO: 4), DYAMG (SEQ ID NO: 5), or NYAMG (SEQ ID NO: 6)
  • the CDR H2 has a sequence having at least 92% identity to the sequence of SIGSSGAQTRYADS (SEQ ID NO: 7), SIGASGSOTRYADS (SEQ ID NO: 8), SIGASGAOTRYADS (SEQ ID NO: 9), SIGASGGOTRYADS (SEQ ID NO: 1 0), TIGSSGAQTRYADS (SEQ ID NO: 41 ), SIGASGSOTRYADS (SEQ ID NO: 42),
  • the antibody binds human FcRn with a KD of less than 200, 150, 1 00, 50, or 40 pM. In some embodiments, the antibody binds human FcRn with a KD that is less than or equal (e.g., less than) to that of an antibody having the light chain variable region and heavy chain variable region of N022, N023, N024, N026, or N027, and further having the same Fc region as the antibody being compared.
  • an isolated antibody has a CDR L1 that comprises, consists of, consists essentially of, or has the sequence of X1 GTGSDVGSYNX2VS (SEQ ID NO: 12), a CDR L2 that comprises, consists of, consists essentially of, or has the sequence of G DX3X4RPS (SEQ ID NO: 13), a CDR L3 that comprises, consists of, consists essentially of, or has the sequence of X5SYX6GSGIYV (SEQ ID NO: 14), a CDR H1 that comprises, consists of, consists essentially of, or has the sequence of Zi YAMG (SEQ ID NO: 15), a CDR H2 that comprises, consists of, consists essentially of, or has the sequence of Z7IGZ2SGZ3QTZ4YADS (SEQ ID NO: 16), and a CDR H3 that comprises, consists of, consists essentially of, or has the sequence of LAZ5Z6DSY (SEQ ID NO: 12), a
  • an isolated antibody has a CDR L1 that has the sequence of TGTGSDVGSYNLVS (SEQ ID NO: 1 ), a CDR L2 that has the sequence of GDSERPS (SEQ ID NO: 2), a CDR L3 that has the sequence of SSYAGSGIYV (SEQ ID NO: 3), a CDR H1 that has the sequence of ZiYAMG (SEQ ID NO: 15), a CDR H2 that has the sequence of Z7IGZ2SGZ3QTRYADS (SEQ ID NO: 1 8),
  • Z3 is G, S or A, and Z7 is S or T.
  • Table 1 shows the amino acid sequences of the light and heavy chain complementary determining regions (CDRs) of some exemplary anti-FcRn antibodies.
  • Table 2 shows the SEQ ID NOs of the light and heavy chain variable regions of these exemplary anti-FcRn antibodies.
  • the light chain variable region of an isolated antibody has a sequence having at least 90% identity to the sequence of
  • the heavy chain variable region of an isolated antibody has a sequence having at least 90% identity to the sequence of
  • the heavy chain variable region of an isolated antibody has a sequence having at least 90% identity to the sequence of
  • the heavy chain variable region of an isolated antibody has a sequence having at least 90% identity to the sequence of
  • the heavy chain variable region of an isolated antibody has a sequence having at least 90% identity to the sequence of
  • the heavy chain variable region of an isolated antibody has a sequence having at least 90% identity to the sequence of EVQLLESGGGLVQPGGSLRLSCAASGFTFSTYAMGWVRQAPGKGLEWVSSIGASGSQTRYADSVKGRF TISRDNSKNTLYLQMNSLRAEDTAVYYCARLAIGDSYWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGG TAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSN TKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWY VDGVEVHNAKTKPREEQYASTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQ VYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN
  • the disclosure features an isolated antibody including a light chain variable region and a heavy chain variable region, where the light chain variable region has a sequence having at least 90% identity to the sequence of
  • the disclosure features an isolated antibody including a light chain variable region and a heavy chain variable region, where the light chain variable region has a sequence having at least 90% identity to the sequence of
  • the disclosure features an isolated antibody including a light chain variable region and a heavy chain variable region, where the light chain variable region has a sequence having at least 90% identity to the sequence of QSALTQPASVSGSPGQSITISCTGTGSDVGSYNLVSWYQQHPGKAPKLMIYGDSERPSGVSNRFSGSKS GNTASLTISGLQAEDEADYYCSSYAGSGIYVFGTGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLI SDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEK TVAPTECS (SEQ ID NO: 1 9); and the heavy chain variable region has a sequence having at least 90% identity to the sequence of
  • the disclosure features an isolated antibody including a light chain variable region and a heavy chain variable region, where the light chain variable region has a sequence having at least 90% identity to the sequence of
  • the heavy chain variable region of the antibody has a sequence having at least 95%, 97%, 99%, or 100% identity to the sequence of any one of SEQ ID NOs: 20-24.
  • the light chain variable region has a sequence having at least 95%, 97%, 99%, or 100% identity to the sequence of SEQ ID NO: 19.
  • the antibodies may further contain amino acid substitutions, additions, and/or deletions outside of the CDRs (i.e., in framework regions (FRs)).
  • An amino acid substitution, addition, and/or deletion can be a substitution, addition, and/or deletion of one or more amino acids (e.g., 1 , 2, 3, 4, 5, 6, 7, 8, or more).
  • An amino acid substitution, addition, and/or deletion can be a substitution, addition, and/or deletion of eight or fewer, seven or fewer, six or fewer, five or fewer, four or fewer, three or fewer, or two or fewer single amino acids.
  • the antibodies may further include any one or more of the following amino acid substitutions: A23V, S30R, L80V, A84T, E85D, A93V, relative to the sequence of any one of SEQ ID NOs: 20-24, and Q38H, V58I, and G99D, relative to the sequence of SEQ ID NO: 1 9.
  • the antibodies may include amino acid substitutions, additions, and/or deletions in the constant regions (e.g., Fc region) of the antibody that, e.g., lead to decreased effector function, e.g., decreased complement-dependent cytolysis (CDC), antibody-dependent cell-mediated cytolysis (ADCC), and/or antibody-dependent cell-mediated phagocytosis (ADCP), and/or decreased B- cell killing.
  • the constant regions are not involved directly in binding an antibody to its target, but exhibit various effector functions, such as participation of the antibody in antibody-dependent cellular toxicity.
  • the antibodies are characterized by decreased binding (i.e., absence of binding) to human complement factor C1 q and/or human Fc receptor on natural killer (NK) cells. In other embodiments, the antibodies are characterized by decreased binding (i.e., absence of binding) to human FcyRI, FcyRIIA, and/or FCYRII IA.
  • antibodies may be of the IgG class and contain one or more amino acid substitutions E233, L234, G236, D265, D270, N297, E31 8, K320, K322, A327, A330, P331 , and/or P329 (numbering according to the EU index of Kabat (Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991 ))).
  • the antibodies contain the mutations L234A/L235A or D265A/N297A.
  • an anti- FcRn antibody contains amino acid substitution N297A, relative to the sequence of any one of SEQ ID NOs: 20-24, such that the antibody is changed to an aglycosylated form.
  • the resulting effectorless antibody shows very little binding to complement or Fc receptors (i.e., complement C1 q binding), indicating low CDC potential.
  • the antibodies may include those having specific amino acid changes that improve stability of the antibody.
  • some antibodies may undergo an allotype change from G1 m17.1 to G1 m17 by substituting amino acids D355 and L357 (relative to the sequence of any one of SEQ ID NOs: 20-24) to glutamic acid and methionine, respectively.
  • the antibodies e.g., N022-N024, N026, and N027, do not contain a C- terminal lysine, e.g., a C-terminal lysine at residue 446 relative to the sequence of any one of SEQ ID NOs: 20-24.
  • compositions that contain one or more anti-FcRn antibodies described herein
  • compositions and methods containing one or more anti-FcRn antibodies described herein are useful to promote catabolism and clearance of pathogenic antibodies, e.g., IgG and IgG autoantibodies in a subject, to reduce the immune response, e.g., to block immune complex-based activation of the immune response in a subject, and to treat immunological conditions or diseases in a subject.
  • pathogenic antibodies e.g., IgG and IgG autoantibodies
  • compositions and methods are useful to reduce or treat an immune complex-based activation of an acute or chronic immune response.
  • the acute immune response may be activated by a medical condition selected from the group consisting of pemphigus vulgaris, lupus nephritis, myasthenia gravis, Guillain-Barre syndrome, antibody-mediated rejection, catastrophic anti-phospholipid antibody syndrome, immune complex-mediated vasculitis, glomerulus, a channelopathy, neuromyelitis optica, autoimmune hearing loss, idiopathic thrombocytopenia purpura (ITP), autoimmune haemolytic anaemia (AIHA), immune neutropenia, dialated cardiomyopathy, and serum sickness.
  • a medical condition selected from the group consisting of pemphigus vulgaris, lupus nephritis, myasthenia gravis, Guillain-Barre syndrome, antibody-mediated rejection, catastrophic anti-phospholipid antibody syndrome, immune complex-mediated vasculitis, glomerulus,
  • Diseases and disorders that may benefit from FcRn inhibition by the isolated anti-FcRn antibodies described herein include diseases and disorders in a fetus and/or neonate that are caused by the transfer of maternal pathogenic antibodies (e.g., maternal pathogenic IgG antibodies) across the placenta from a pregnant subject to the fetus and/or neonate.
  • maternal pathogenic antibodies e.g., maternal pathogenic IgG antibodies
  • the pathogenic antibodies in the pregnant subject may attack the antigens of the fetus (e.g., antigens the fetus inherited from the fetus' father), causing the fetus or the neonate to have a fetal and neonatal alloimmune and/or autoimmune disorder.
  • the antigens of the fetus e.g., antigens the fetus inherited from the fetus' father
  • the fetus or the neonate may have a fetal and neonatal alloimmune and/or autoimmune disorder.
  • the methods described herein may be used to treat an antibody-mediated enhancement of viral disease.
  • the viral diseases that are enhanced by pathogenic antibodies include, but are not limited to, viral diseases caused by an alpha virus infection, flavivirus infection, Zika virus infection, Chikungunya virus infection, Ross River virus infection, severe acute respiratory syndrome coronavirus infection, Middle East respiratory syndrome, avian influenza infection, influenza virus infection, human respiratory syncytial virus infection, Ebola virus infection, yellow fever virus infection, dengue virus infection, human
  • immunodeficiency virus infection respiratory syncytial virus infection, Hantavirus infection, Getah virus infection, Sindbis virus infection, Bunyamwera virus infection, West Nile virus infection, Japanese encephalitis virus B infection, rabbitpox virus infection, lactate dehydrogenase elevating virus infection, reovirus infection, rabies virus infection, foot-and-mouth disease virus infection, porcine reproductive and respiratory syndrome virus infection, simian hemorrhagic fever virus infection, equine infectious anemia virus infection, caprine arthritis virus infection, African swine fever virus infection, lentivirus infection, BK papovavirus infection, Murray Valley encephalitis virus infection, enterovirus infection, cytomegalovirus infection, pneumovirus infection, morbillivirus infection, and measles virus infection.
  • the blockade of human FcRn by anti-FcRn antibodies may be of therapeutic benefit in diseases that are driven by pathogenic antibodies (e.g., pathogenic IgG antibodies).
  • pathogenic antibodies e.g., pathogenic IgG antibodies.
  • the ability of FcRn blockade to induce overall pathogenic antibody catabolism and removal of multiple species of pathogenic antibodies without perturbing serum albumin, small circulating metabolites, or lipoproteins offers a method to expand the utility and accessibility of a pathogenic antibody removal strategy to patients with pathogenic antibody-driven autoimmune disease pathology.
  • the dominant mechanism of action of an anti-FcRn antibody may be to increase the catabolism of pathogenic antibodies in circulation and decrease pathogenic antibody and immune complex deposition in affected tissues.
  • the anti-FcRn antibodies described herein may be administered to a pregnant subject who has or is at risk of having a medical condition that activates an immune response in the pregnant subject.
  • the pregnant subject may have had, in the past, a medical condition that activated an immune response in the pregnant subject.
  • the pregnant subject has a history of having had a previous fetus or neonate that had a fetal and neonatal alloimmune and/or autoimmune disorder.
  • the anti-FcRn antibodies described herein may be administered to a pregnant subject if a pathogenic antibody associated with an immune disease is detected in a biological sample (e.g., a blood or urine sample) obtained from the pregnant subject.
  • a biological sample e.g., a blood or urine sample
  • the pathogenic antibody detected in the biological sample of the pregnant subject is known to bind to an antigen from the fetus in the pregnant subject (e.g., an antigen that the fetus inherited from the fetus' father).
  • the anti-FcRn antibodies described herein may be administered to a subject who is planning to become pregnant and who has or is at risk of having a medical condition that activates an immune response in the pregnant subject, and/or who has had, in the past, a medical condition that activated an immune response in the pregnant subject.
  • a subject is planning to become pregnant and has a history of having had a previous fetus or neonate that had a fetal and neonatal alloimmune and/or autoimmune disorder.
  • the anti-FcRn antibodies described herein may be administered to a subject who is planning to become pregnant and whose biological sample contains a pathogenic antibody associated with an immune disease.
  • the anti-FcRn antibodies described herein may be administered to a subject (e.g., a pregnant subject) to reduce or treat an immune response activated by an autoimmune disease.
  • the autoimmune disease may be, for example, alopecia areata, ankylosing spondylitis, antiphospholipid syndrome, Addison's disease, hemolytic anemia, warm autoimmune hemolytic anemia (wAIHA), anti-factor antibodies, heparin induced thrombocytopenia (HICT), sensitized transplant, autoimmune hepatitis, hepatitis, Behcet's disease, bullous pemphigoid, cardiomyopathy, celiac sprue- dermatitis, chronic fatigue immune dysfunction syndrome, chronic inflammatory demyelinating polyneuropathy, Churg-Strauss syndrome, cicatricial pemphigoid, limited scleroderma (CREST syndrome), cold agglutinin disease, Crohn's disease, dermatomyositis
  • the running buffer was switched to freshly prepared buffer, either HBSP+ (0.01 M HEPES, 0.15 M NaCI, 0.05% P20, pH 7.4) or Sodium Phosphate Buffer (0.02 M Sodium Phosphate, 0.15 M NaCI, 0.05% P20, pH 6.0) as appropriate, which was used for the remainder of the assay and for all dilutions.
  • the chip was preconditioned using one injection each of 0.5% SDS, 50mM NaOH and 10mM HCI at 30 ⁇ /min for 60 seconds (s).
  • a mouse anti-Human Fc mAb from GE Healthcare (BR100839) was diluted to 10 ⁇ g/ml in 10 mM acetate buffer pH 5.0 and approximately 5,700 response units (RU) was immobilized using standard amine coupling chemistry in the horizontal orientation onto a GLC sensor chip.
  • the anti-hFcRn mAbs to be tested were captured onto the surface in the vertical orientation, with the goal of immobilizing approximately 200 response units (RU) per interaction spot.
  • the rhFcRn was diluted in a five-point threefold dilution series starting at 1 .25 g/ml, leaving one lane as buffer-only for a double reference.
  • Table 3 shows that five anti-FcRn antibodies, N022, N023, N024, N026, and N027, all bind with high affinity to human FcRn at pH 7.4.
  • the equilibrium dissociation constant, KD, of the anti-FcRn antibodies ranged from 1 9.4 pM (N027) to 36.5 pM (N026) for binding to human FcRn at pH 7.4, 298K.
  • Table 3 also shows the rapid on-rates and slow off-rates of the five anti-FcRn antibodies. At pH 7.4,
  • anti-FcRn antibodies to compete with IgG for binding to human or cynomolgus monkey FcRn was evaluated on human embryonic kidney (HEK) 293 cells ectopically expressing cell surface, glycophosphatidylinositol (GPI)-linked FcRn.
  • HEK human embryonic kidney
  • GPI glycophosphatidylinositol
  • Human and cynomolgus monkey FcRn alpha amino acid sequences exhibit 97.5% sequence identity.
  • Nine amino acid residues of 355 are different between human and cynomolgus monkey FcRn alpha, but none are in the epitope-mapped binding region.
  • the level of cell-bound IgG was determined using 66 nM of fluorescent probe-labeled, nonspecific IgG.
  • the binding of IgG to cell surface FcRn was done at pH 6.0, which allows the Fc portion of IgG to interact with FcRn.
  • the amount of cell-bound IgG significantly decreased as the concentration of the anti-FcRn antibody (N022-N024, N026, or N027) increased.
  • the binding of IgG was inhibited in a concentration- and saturation-dependent manner by each of the five exemplary anti- FcRn antibodies , demonstrating the ability of the anti-FcRn antibodies, N022-N024, N026, and N027, to effectively compete with and inhibit binding of IgG to FcRn at pH 6.0.
  • the EC50 values of the antibodies ranged between 2 and 6 nM.
  • FcRn is a type I transmembrane protein with the IgG and albumin binding domains oriented to the luminal side of endosomal membranes or to the cell surface when transported to the plasma membrane.
  • the binding of anti-FcRn antibodies to cell surface, membrane-associated FcRn on HEK293 cells at pH 7.4 mimics binding in a physiologically-relevant environment and at the pH where only the Fab domain and not the Fc domain of the antibodies interact with FcRn.
  • This assay was able to distinguish antibodies with better binding to endogenous human FcRn.
  • the binding of anti-FcRn antibodies to THP-1 cells is concentration dependent. All antibodies, e.g., N022-N024, N026, and N027, showed better binding affinities than lgG1 .
  • Antibody N027 displayed the highest binding affinity with an EC50 value of 3.0 nM.
  • N027 or human lgG1 isotype control antibody labeled with fluorophore were administered i.v. to homozygous B6.Cg-Fcgrf im ' Dcr Tg(FCGRT)32Dcr/DcrJ mice at 30 mg/kg.
  • Levels of labeled antibody were measured in individual organs by quantitative ex vivo fluorescence imaging.
  • the biodistribution of N027 in various organs in mice is similar to that of an isotype control antibody.
  • N027 was dosed therapeutically i.v. at 5 mg/kg (arrow), on day 6 post disease induction and randomization.
  • N027 potently inhibits collagen antibody-induced arthritis in human transgenic FcRn mice when dosed therapeutically.
  • FIG. 7 shows that N027 when dosed
  • HAECs primary human aortic endothelial cells
  • HVTs placental trophoblasts
  • HVTs Placental trophoblast cells
  • Example 12 - N027 concentrations achieving 100% receptor occupancy result in increased intracellular IgG accumulation
  • HAVECs and HUVECs Human endothelial cells were cultured in endothelial cell culture (EBM-2, Lonza) while human placental trophoblasts (HVTs) were cultured in trophoblast media (ScienCell). Cell monolayers were then pulsed for 4-5 hours at 37 S C in 1 ml_ media containing either:
  • confluent vascular endothelial cell (H UVEC) monolayers were incubated with or without a saturating concentration of N027 (1 6.6 ⁇ ⁇ ) in EBM-2 media for the indicated times at 37 S C (FIG . 1 0).
  • H UVEC confluent vascular endothelial cell
  • cells were washed and harvested with cold HyQtase, followed by fixing and permeabilization . These cells were then incubated in permeabilization buffer + 1 0% human serum and VivoTag645-labeled N027 (1 0 ⁇ g/mL) for 30 minutes at 4 S C in the dark.
  • the FcRn turnover rates of human vascular endothelial cells (HUVECs) and placental trophoblasts (HVTs) were compared in the presence and absence of N027.
  • Cells were cultured in 75 cm 2 flask in 25% D2O (Deuterium Oxide, from Aldrich) containing media for three days. After three days, the media was replaced with normal media containing N027 (1 00 ⁇ g/mL) or control IgG (1 00 ⁇ / ⁇ ) or mock treatment. Cells were then harvested from the flasks at indicated times post media change (FIGS. 1 1 A and 1 1 B). The cell monolayers were washed; cells were harvested, pelleted, and individual pellets were lysed and digested separately.
  • N027 was compared in human vascular endothelial cells (HUVECs) and placental trophoblasts (HVTs).
  • HVTs placental trophoblasts
  • Cells were grown on glass coverslips in EBM-2/TM media. Live cells were incubated in media containing DyLight594-N027 (2 ⁇ g/mL) for 1 hour at 37 S C. Cells were then washed and imaged live on fluorescence microscope in confocal mode with 60X dry objective using appropriate filters.
  • Representative single cell images show similar localization pattern of N027 bound to the endocytic pool of FcRn in both cell types (FIGS. 1 2A and 12B) . The circle in the center of the cell indicates the location of the nucleus.
  • Example 16 Effect of N027 treatment on dynamics of IgG trafficking : Intracellular IgG
  • N027 treatment was compared across FcRn expressing target cell types such as human vascular endothelial cells (HUVECs) and placental trophoblasts (HVTs).
  • FcRn expressing target cell types such as human vascular endothelial cells (HUVECs) and placental trophoblasts (HVTs).
  • HVTs placental trophoblasts
  • EBM-2 media Lida, Waterville
  • TM1 media SamnCell
  • Confluent cell monolayers were then pulsed in 1 ml media containing either N027 (2 ⁇ g/ml) + VivoTag645-lgG (50 ⁇ g/mL) or isotype control IgG (2 ⁇ g/mL) + VivoTag645-lgG (50 ⁇ ⁇ ) for 20 hours at 37 S C.
  • the following chase conditions were used: the N027+Dyl_ight 488-lgG pulsed set was chased in the presence of N027 (2 ⁇ g/mL); the lsotype+ DyLight 488-IVIG pulsed set was chased in the presence of isotype control IgG (2 ⁇ g/mL) and the set without any IgG-treatments was chased in media only.
  • Cells were washed, incubated in BD Cytofix/Cytoperm solution for 30 min at 4 S C in the dark, washed with perm wash buffer followed by incubation in perm wash buffer + 10% normal mouse serum + 5 ig/m ⁇ mouse anti-human Lampl antibody for overnight at 4 S C in the dark.
  • Plate-like crystals grew in several conditions over the course of 4 days to 7 weeks.
  • the crystal that ultimately led to the structure of the complex grew in a mother liquor consisting of 10% PEG 1000, 10% PEG 8000.
  • the crystal was cryoprotected by soaking for about 2 minutes in a solution of 25% PEG 1000, 10% PEG 8000, 100 mM NaCI before mounting in a cryoloop and plunge-freezing in liquid nitrogen.
  • X-ray diffraction data were collected at the Stanford Synchrotron Radiation Lightsource (SSRL) on beamline BL9-2, using a Dectris Pilatus 6M detector and a wavelength of 0.97946 A.
  • the diffraction images were processed to a resolution of 2.7A using HKL-2000 followed by various programs in the CCP4 (Collaborative Computational Project, Number 4) software suite. Details of data collection and processing are contained in Table 6.
  • the 2.7A structure of the N027 Fab:FcRn complex was solved by molecular replacement using search models consisting of a complete FcRn (heterodimer of large and small subunits, p51 and p14, respectively) from Protein Data Bank (PDB) ID No. 4k71 and individual heavy and light chains of human Fab from PDB ID No. 5v7u with the program Phaser. There is one complete complex in the
  • the epitope of FcRn defined by the crystal structure is composed primarily of amino acids on the FcRn/p51 subunit but four amino acids from the p2-microglobulin/p14 subunit are also involved.
  • the interaction between the N027 Fab and FcRn buries approximately 1020 A 2 , with 470 A 2 between the light chain and FcRn, 414 A 2 between the heavy chain and FcRn, and 136 A 2 between the light chain and p2-microglobulin. All three CDR loops from both chains of the N027 Fab are involved in the paratope with CDR H2 and CDR L1 together contributing about half of the interacting amino acid with eight apiece.
  • CDRs H1 , H3, and L2 contribute three amino acids each and CDR L3 contributes five.
  • Three amino acids (KSG) at positions 66-68 Kabat in the light chain framework between CDRs L2 and L3 are also involved in binding.
  • the epitope/paratope interface is fully defined by the electron density and has been fully modeled unambiguously.
  • the Fab binding epitope on FcRn overlaps the canonical Fc binding site so tight binding by the FcRn antibodies is expected to block Fc binding. Additionally, the albumin binding site remains accessible. Additionally, a N-acetylglucosamine is present on Gln1 02 of FcRn that is well- defined by the electron density.
  • Pregnant female cynomolgus monkeys were dosed weekly from Gestation Day 45 (GD45) to C- section at GD100 (mid-gestation) or GD140 (late gestation).
  • GD45 Gestation Day 45
  • GD100 mid-gestation
  • GD140 late gestation
  • a cohort of animals was also included in the study that were allowed to deliver their infants (birth day [BD1 ]).
  • the design study is depicted in Table 8.
  • IgG concentrations were measured in maternal and neonatal blood samples using a standard validated total IgG ELISA (Table 9). Briefly, polystyrene plates (96-well) were coated with commercially available anti-human IgG antigen. The coated plate(s) were washed to remove unbound sample and then blocked using with blocking buffer followed by a wash to remove the residual blocking buffer. Serum samples were diluted and added to the anti-human IgG coated wells and incubated at room temperature for 60 ⁇ 5 minutes. Each well was washed before addition of secondary (detection) antibody conjugated to horseradish peroxidase (HRP) and incubated at room temperature for 60 ⁇ 5
  • HR horseradish peroxidase
  • Tetramethylbenzidine (TMB) substrate was subsequently added to each well and incubated at room temperature for 20 ⁇ 5 minutes on a plate shaker, before addition of 2N H2SO4 to stop the enzymatic reaction. The absorbance of each well was read at 450 nm using the SpectraMax® 190 microplate reader.
  • Any commercially available or proprietary pair of anti-human IgG capture antibody and HRP conjugated anti-human IgG detection antibody that recognizes total IgG and is cross-reactive with cynomolgus monkey IgG can be used to measure total cynomolgus monkey IgG in an ELISA.
  • the IgG detection antibody can be, for example, intact IgG, polyclonal serum antibody, monoclonal antibody, or a Fab(2) fragment.
  • N027 administration resulted in dose-independent reductions in serum IgG levels in adult females beginning 72 hours postdose, and the greatest reductions in serum IgG concentrations were observed for both the 100 and 300 mg/kg dosed animals at the GD51 -53: predose time point (FIG. 19).
  • the serum IgG values for Group 2 (1 00 mg/kg) trended toward predose levels in a dose-dependent manner, beginning at the GD65-67: predose time point and continuing until the next dose administrations on
  • N027 The transfer of N027 from maternal circulation to fetal circulation was evaluated by measuring the level of N027 FcRn occupancy in fetal circulating monocytes. N027 receptor occupancy was assessed on monocytes, granulocytes, B-lymphocytes, and T-lymphocytes using a flow cytometric (FACS) assay to measure the binding of fluorescent-labeled N027 to free/unbound FcRn in the presence and absence of saturating concentrations of N027. The unsaturated samples demonstrated the percentages of free or unbound FcRn receptor present on each leukocyte subset at each predose and postdose time point.
  • FACS flow cytometric
  • N027 receptor occupancy was not detected in the whole blood of fetuses on day GD100 and GD140, or in neonates on BD1 , in the context of the unsaturated sample analysis as described above.
  • the maternal perfusate was equilibrated with a gas mixture made of 95% O2 and 5% CO2, and the fetal perfusate with a mixture of 95% N2 and 5% CO2. All experiments were carried out at a temperature of 37°C.
  • Each placental lobule was perfused for an initial control period of one hour to allow the tissue to stabilize to its new environment using an open-open configuration of the perfusion system.
  • Perfusion was terminated if one of the following occurred during the control period: a volume loss in the fetal circuit in an excess of 3 mL/h, or a pO ⁇ difference between the fetal vein and the artery less than 60 mmHg, indicating inadequate perfusion overlap between the two circuits.
  • the control period was followed by an experimental period of four hours using a closed-closed configuration (i.e., re-circulation of the medium) of the perfusion system. The latter was initiated by replacing the medium of the maternal and fetal reservoirs and the addition of 3 mg/ml of BSA.
  • N027 across the human placental lobule was tested for three different concentrations: 0.3 mg/ml, 3 mg/ml, and 30 mg/ml. Fourteen individual placentae were perfused for four hours with N027 being added to the maternal perfusate at 0.3 mg/ml, 3 mg/ml, and 30 mg/ml. Samples from the maternal artery and fetal vein, in 0.5 mL aliquots, were taken at 0, 15, 30, 60, 90, 120, 150, 1 80, 210 and 240 minutes during the experimental period. Antipyrine was employed as a positive control to validate the integrity of the circuits (FIGS. 17-18).

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • General Chemical & Material Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Immunology (AREA)
  • Virology (AREA)
  • Diabetes (AREA)
  • Molecular Biology (AREA)
  • Hematology (AREA)
  • Oncology (AREA)
  • Communicable Diseases (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Dermatology (AREA)
  • Neurology (AREA)
  • Endocrinology (AREA)
  • Rheumatology (AREA)
  • Pulmonology (AREA)
  • Transplantation (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Cardiology (AREA)
  • Neurosurgery (AREA)
  • Obesity (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Ophthalmology & Optometry (AREA)
PCT/US2017/044765 2016-07-29 2017-07-31 Fcrn antibodies and methods of use thereof Ceased WO2018023136A1 (en)

Priority Applications (29)

Application Number Priority Date Filing Date Title
CN201780060620.6A CN109790221B (zh) 2016-07-29 2017-07-31 Fcrn抗体及其使用方法
SM20240004T SMT202400004T1 (it) 2016-07-29 2017-07-31 Anticorpi fcrn e loro metodi di utilizzo
EP23195791.1A EP4282487A3 (en) 2016-07-29 2017-07-31 Fcrn antibodies and methods of use thereof
JP2019504902A JP7094941B2 (ja) 2016-07-29 2017-07-31 Fcrn抗体及びその使用方法
CN202311567291.8A CN117679506A (zh) 2016-07-29 2017-07-31 Fcrn抗体及其使用方法
KR1020237006882A KR102717601B1 (ko) 2016-07-29 2017-07-31 FcRn 항체 및 이의 사용 방법
IL302288A IL302288B2 (en) 2016-07-29 2017-07-31 FCRN antibodies and methods of using them
RS20240046A RS65070B1 (sr) 2016-07-29 2017-07-31 Fcrn antitela i postupci njihove upotrebe
PL17835436.1T PL3491025T3 (pl) 2016-07-29 2017-07-31 Przeciwciała anty-FcRn i sposoby ich stosowania
KR1020247033727A KR20240151878A (ko) 2016-07-29 2017-07-31 FcRn 항체 및 이의 사용 방법
AU2017301915A AU2017301915B2 (en) 2016-07-29 2017-07-31 FcRn antibodies and methods of use thereof
SI201731447T SI3491025T1 (sl) 2016-07-29 2017-07-31 Protitelesa fcrn in njihovi načini uporabe
IL320058A IL320058A (en) 2016-07-29 2017-07-31 Fcrn antibodies and methods of use thereof
LTEPPCT/US2017/044765T LT3491025T (lt) 2016-07-29 2017-07-31 Fcrn antikūnai ir jų panaudojimo būdai
ES17835436T ES2968439T3 (es) 2016-07-29 2017-07-31 Anticuerpos FcRn y procedimientos de uso de los mismos
NZ750462A NZ750462B2 (en) 2017-07-31 Fcrn antibodies and methods of use thereof
BR112019001806-9A BR112019001806A2 (pt) 2016-07-29 2017-07-31 anticorpos para fcrn e métodos de uso dos mesmos
HRP20240048TT HRP20240048T1 (hr) 2016-07-29 2017-07-31 Fcrn antitijela i postupci njihove uporabe
US16/321,801 US11345751B2 (en) 2016-07-29 2017-07-31 FcRn antibodies and methods of use thereof
DK17835436.1T DK3491025T3 (da) 2016-07-29 2017-07-31 Fcrn-antistoffer og anvendelsesmetoder heraf
CA3032415A CA3032415A1 (en) 2016-07-29 2017-07-31 Fcrn antibodies and methods of use thereof
KR1020197006049A KR102505995B1 (ko) 2016-07-29 2017-07-31 FcRn 항체 및 이의 사용 방법
SG11201900813RA SG11201900813RA (en) 2016-07-29 2017-07-31 Fcrn antibodies and methods of use thereof
EP17835436.1A EP3491025B1 (en) 2016-07-29 2017-07-31 Fcrn antibodies and methods of use thereof
FIEP17835436.1T FI3491025T3 (fi) 2016-07-29 2017-07-31 Fcrn-vasta-aineita ja menetelmiä niiden käyttämiseksi
IL264528A IL264528B2 (en) 2016-07-29 2017-07-31 fcrn antibodies and methods of using them
US17/661,070 US20230049725A1 (en) 2016-07-29 2022-04-28 FcRn Antibodies and Methods of Use Thereof
JP2022100315A JP7442575B2 (ja) 2016-07-29 2022-06-22 Fcrn抗体及びその使用方法
JP2024023875A JP2024059765A (ja) 2016-07-29 2024-02-20 Fcrn抗体及びその使用方法

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201662368770P 2016-07-29 2016-07-29
US201662368803P 2016-07-29 2016-07-29
US62/368,803 2016-07-29
US62/368,770 2016-07-29

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US16/321,801 A-371-Of-International US11345751B2 (en) 2016-07-29 2017-07-31 FcRn antibodies and methods of use thereof
US17/661,070 Continuation US20230049725A1 (en) 2016-07-29 2022-04-28 FcRn Antibodies and Methods of Use Thereof

Publications (1)

Publication Number Publication Date
WO2018023136A1 true WO2018023136A1 (en) 2018-02-01

Family

ID=61016731

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2017/044765 Ceased WO2018023136A1 (en) 2016-07-29 2017-07-31 Fcrn antibodies and methods of use thereof

Country Status (22)

Country Link
US (2) US11345751B2 (enExample)
EP (2) EP3491025B1 (enExample)
JP (3) JP7094941B2 (enExample)
KR (3) KR102717601B1 (enExample)
CN (2) CN117679506A (enExample)
AU (1) AU2017301915B2 (enExample)
BR (1) BR112019001806A2 (enExample)
CA (1) CA3032415A1 (enExample)
DK (1) DK3491025T3 (enExample)
ES (1) ES2968439T3 (enExample)
FI (1) FI3491025T3 (enExample)
HR (1) HRP20240048T1 (enExample)
HU (1) HUE065780T2 (enExample)
IL (3) IL302288B2 (enExample)
LT (1) LT3491025T (enExample)
PL (1) PL3491025T3 (enExample)
PT (1) PT3491025T (enExample)
RS (1) RS65070B1 (enExample)
SG (1) SG11201900813RA (enExample)
SI (1) SI3491025T1 (enExample)
SM (1) SMT202400004T1 (enExample)
WO (1) WO2018023136A1 (enExample)

Cited By (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2018208231A1 (en) * 2017-05-11 2018-11-15 National University Of Singapore Targeted prevention of maternal to foetal vertical transmission of infection
WO2019118791A1 (en) * 2017-12-13 2019-06-20 Momenta Pharmaceuticals, Inc. Fcrn antibodies and methods of use thereof
WO2019226758A1 (en) * 2018-05-23 2019-11-28 The Jackson Laboratory Anti-ngly-1 antibodies and methods of use
WO2020018910A1 (en) * 2018-07-20 2020-01-23 Momenta Pharmaceuticals, Inc. Fcrn antibody compositions
WO2020236695A1 (en) * 2019-05-17 2020-11-26 Alexion Pharmaceuticals, Inc. Use of anti-fcrn antibodies in the treatment of pemphighus and pemphigoid diseases
WO2021022249A1 (en) * 2019-08-01 2021-02-04 Momenta Pharmaceuticals, Inc. Fcrn antibodies and methods of use thereof
CN113301903A (zh) * 2018-07-20 2021-08-24 动量制药公司 FcRn抗体的组合物及其使用方法
US11345751B2 (en) 2016-07-29 2022-05-31 Momenta Pharmaceuticals, Inc. FcRn antibodies and methods of use thereof
CN114728180A (zh) * 2019-11-19 2022-07-08 依牧诺万科学有限公司 使用抗FcRn抗体治疗温性自身免疫性溶血性贫血的方法
US11732047B2 (en) 2015-01-30 2023-08-22 Momenta Pharmaceuticals, Inc. FcRn antibodies and methods of use thereof
WO2024147074A1 (en) * 2023-01-06 2024-07-11 argenx BV Methods for treating pots using fcrn antagonists
US12202900B2 (en) 2018-06-08 2025-01-21 argenx BV Compositions and methods for treating immune thrombocytopenia
US12240875B2 (en) 2017-12-08 2025-03-04 argenx BV Use of FCRN antagonists for treatment of generalized myasthenia gravis
US12344678B2 (en) 2022-06-15 2025-07-01 argenx BV FcRn/HSA binding molecules and methods of use
US12403175B2 (en) 2020-01-08 2025-09-02 argenx BV Methods for treating pemphigus disorders

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN116234827A (zh) * 2021-09-03 2023-06-06 舒泰神(北京)生物制药股份有限公司 特异性识别FcRn的抗体及其应用
CN113912730B (zh) * 2021-12-14 2022-03-04 北京科诺信诚科技有限公司 缓释的抗FcRn抗体或抗原结合片段及其应用

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20140308206A1 (en) * 2011-06-02 2014-10-16 Dyax Corp. Fc receptor binding proteins
US20150118240A1 (en) * 2012-05-14 2015-04-30 Ucb Biopharma Sprl Anti-FcRn Antibodies
US20160194397A1 (en) * 2008-04-25 2016-07-07 Dyax Corp. Fc receptor binding proteins

Family Cites Families (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP1660128A4 (en) 2003-08-08 2009-01-21 Univ New York State Res Found ANTI-CORR ANTI-BODIES FOR THE TREATMENT OF AUTO / ALLO-IMMUNE DISORDERS
CN101124245A (zh) 2003-11-12 2008-02-13 比奥根艾迪克Ma公司 新生儿Fc受体(FcRn)-结合多肽变体、二聚体Fc结合蛋白及其相关方法
WO2007087289A2 (en) 2006-01-25 2007-08-02 The Research Foundation Of State University Of New York Anti-fcrn antibodies for treatement of auto/allo immune conditions
JP2009529339A (ja) 2006-03-13 2009-08-20 アブリンクス エン.ヴェー. Il−6を標的とするアミノ酸配列およびそれを含みil−6介在シグナル伝達に関連する疾患および疾病を治療するポリペプチド
CA2766065C (en) 2009-06-30 2020-07-21 Research Development Foundation Immunoglobulin fc polypeptides
ES2802274T3 (es) 2013-05-02 2021-01-18 Momenta Pharmaceuticals Inc Glicoproteínas sialiladas
KR101815265B1 (ko) * 2013-06-20 2018-01-04 한올바이오파마주식회사 FcRn 특이적 인간 항체 및 이를 포함하는 자가면역 질환 치료용 조성물
JP6449441B2 (ja) * 2014-04-30 2019-01-09 ハノル バイオファーマ カンパニーリミテッドHanall Biopharma Co., Ltd. FcRn特異的ヒト抗体及びこれを含む自己免疫疾患治療用組成物
CN118638229A (zh) 2015-01-30 2024-09-13 动量制药公司 Fcrn抗体及其使用方法
ES2956662T3 (es) 2015-05-12 2023-12-26 Syntimmune Inc Anticuerpos anti-FcRn humanizados con afinidad madurada
WO2018023136A1 (en) 2016-07-29 2018-02-01 Momenta Pharmaceuticals, Inc. Fcrn antibodies and methods of use thereof

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20160194397A1 (en) * 2008-04-25 2016-07-07 Dyax Corp. Fc receptor binding proteins
US20140308206A1 (en) * 2011-06-02 2014-10-16 Dyax Corp. Fc receptor binding proteins
US20150118240A1 (en) * 2012-05-14 2015-04-30 Ucb Biopharma Sprl Anti-FcRn Antibodies

Non-Patent Citations (6)

* Cited by examiner, † Cited by third party
Title
"Process Scale Purification of Antibodies", 2009, JOHN WILEY & SONS, INC.
"Recombinant Gene Expression: Reviews and Protocols (Methods in Molecular Biology)", 20 July 2004, HUMANA PRESS
"Therapeutic Peptides and Proteins: Formulation, Processing and Delivery Systems", 2006, CRC PRESS
"Therapeutic Proteins: Methods and Protocols (Methods in Molecular Biology)", 28 June 2012, HUMANA PRESS
JUNGHANS ET AL., PROC NATL ACAD SCI USA, vol. 93, 1996, pages 5512
KABAT: "Sequences of Proteins of Immunological Interest", 1991, PUBLIC HEALTH SERVICE

Cited By (30)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11732047B2 (en) 2015-01-30 2023-08-22 Momenta Pharmaceuticals, Inc. FcRn antibodies and methods of use thereof
US11345751B2 (en) 2016-07-29 2022-05-31 Momenta Pharmaceuticals, Inc. FcRn antibodies and methods of use thereof
WO2018208231A1 (en) * 2017-05-11 2018-11-15 National University Of Singapore Targeted prevention of maternal to foetal vertical transmission of infection
US11673955B2 (en) 2017-05-11 2023-06-13 National University Of Singapore Targeted prevention of maternal to foetal vertical transmission of infection
US12240875B2 (en) 2017-12-08 2025-03-04 argenx BV Use of FCRN antagonists for treatment of generalized myasthenia gravis
WO2019118791A1 (en) * 2017-12-13 2019-06-20 Momenta Pharmaceuticals, Inc. Fcrn antibodies and methods of use thereof
AU2018386193B2 (en) * 2017-12-13 2025-04-24 Momenta Pharmaceuticals, Inc. FcRn antibodies and methods of use thereof
US11773168B2 (en) 2017-12-13 2023-10-03 Momenta Pharmaceuticals, Inc. FcRn antibodies and methods of use thereof
WO2019226758A1 (en) * 2018-05-23 2019-11-28 The Jackson Laboratory Anti-ngly-1 antibodies and methods of use
US12054558B2 (en) 2018-05-23 2024-08-06 The Jackson Laboratory Anti-NGly-1 antibodies and methods of use
US12202900B2 (en) 2018-06-08 2025-01-21 argenx BV Compositions and methods for treating immune thrombocytopenia
CN113301903A (zh) * 2018-07-20 2021-08-24 动量制药公司 FcRn抗体的组合物及其使用方法
WO2020018910A1 (en) * 2018-07-20 2020-01-23 Momenta Pharmaceuticals, Inc. Fcrn antibody compositions
EP3823978A4 (en) * 2018-07-20 2022-12-14 Momenta Pharmaceuticals, Inc. Fcrn antibody compositions
JP7599419B2 (ja) 2018-07-20 2024-12-13 モメンタ ファーマシューティカルズ インコーポレイテッド Fcrn抗体組成物
JP2021531347A (ja) * 2018-07-20 2021-11-18 モメンタ ファーマシューティカルズ インコーポレイテッド Fcrn抗体組成物
CN113518783A (zh) * 2018-07-20 2021-10-19 动量制药公司 FcRn抗体组合物
JP7457704B2 (ja) 2018-07-20 2024-03-28 モメンタ ファーマシューティカルズ インコーポレイテッド Fcrn抗体の組成物およびその使用の方法
IL280278B2 (en) * 2018-07-20 2025-10-01 Momenta Pharmaceuticals Inc Fcrn antibody preparations
AU2019307959B2 (en) * 2018-07-20 2025-09-25 Momenta Pharmaceuticals, Inc. FcRn antibody compositions
IL280278B1 (en) * 2018-07-20 2025-06-01 Momenta Pharmaceuticals Inc Fcrn antibody compositions
JP2021531346A (ja) * 2018-07-20 2021-11-18 モメンタ ファーマシューティカルズ インコーポレイテッド Fcrn抗体の組成物およびその使用の方法
AU2019312139B2 (en) * 2018-07-20 2025-02-06 Momenta Pharmaceuticals, Inc. Compositions of FcRn antibodies and methods of use thereof
EP3826641A4 (en) * 2018-07-20 2022-04-20 Momenta Pharmaceuticals, Inc. Compositions of fcrn antibodies and methods of use thereof
WO2020236695A1 (en) * 2019-05-17 2020-11-26 Alexion Pharmaceuticals, Inc. Use of anti-fcrn antibodies in the treatment of pemphighus and pemphigoid diseases
WO2021022249A1 (en) * 2019-08-01 2021-02-04 Momenta Pharmaceuticals, Inc. Fcrn antibodies and methods of use thereof
CN114728180A (zh) * 2019-11-19 2022-07-08 依牧诺万科学有限公司 使用抗FcRn抗体治疗温性自身免疫性溶血性贫血的方法
US12403175B2 (en) 2020-01-08 2025-09-02 argenx BV Methods for treating pemphigus disorders
US12344678B2 (en) 2022-06-15 2025-07-01 argenx BV FcRn/HSA binding molecules and methods of use
WO2024147074A1 (en) * 2023-01-06 2024-07-11 argenx BV Methods for treating pots using fcrn antagonists

Also Published As

Publication number Publication date
LT3491025T (lt) 2023-11-27
PL3491025T3 (pl) 2024-03-25
JP7094941B2 (ja) 2022-07-04
SMT202400004T1 (it) 2024-03-13
FI3491025T3 (fi) 2024-01-12
IL302288B2 (en) 2025-09-01
KR102505995B1 (ko) 2023-03-08
IL320058A (en) 2025-06-01
HRP20240048T1 (hr) 2024-03-29
KR20230035439A (ko) 2023-03-13
EP3491025B1 (en) 2023-10-18
IL264528B1 (en) 2023-05-01
EP4282487A2 (en) 2023-11-29
CN117679506A (zh) 2024-03-12
JP2024059765A (ja) 2024-05-01
BR112019001806A2 (pt) 2019-05-07
SI3491025T1 (sl) 2024-02-29
US20210238275A1 (en) 2021-08-05
IL264528A (enExample) 2019-03-31
US20230049725A1 (en) 2023-02-16
IL302288A (en) 2023-06-01
KR20190037285A (ko) 2019-04-05
ES2968439T3 (es) 2024-05-09
RS65070B1 (sr) 2024-02-29
IL264528B2 (en) 2023-09-01
KR102717601B1 (ko) 2024-10-16
AU2017301915B2 (en) 2024-09-12
JP2019526540A (ja) 2019-09-19
NZ750462A (en) 2024-04-26
EP4282487A3 (en) 2024-02-14
CA3032415A1 (en) 2018-02-01
EP3491025A4 (en) 2020-05-27
SG11201900813RA (en) 2019-02-27
JP7442575B2 (ja) 2024-03-04
CN109790221B (zh) 2023-12-26
DK3491025T3 (da) 2024-01-15
JP2022126783A (ja) 2022-08-30
IL302288B1 (en) 2025-05-01
HUE065780T2 (hu) 2024-06-28
CN109790221A (zh) 2019-05-21
PT3491025T (pt) 2024-01-18
US11345751B2 (en) 2022-05-31
EP3491025A1 (en) 2019-06-05
AU2017301915A1 (en) 2019-02-28
KR20240151878A (ko) 2024-10-18

Similar Documents

Publication Publication Date Title
US20230049725A1 (en) FcRn Antibodies and Methods of Use Thereof
US20240158509A1 (en) Fcrn antibodies and methods of use thereof
CN107567460B (zh) Fcrn抗体及其使用方法
HK40104376A (en) Fcrn antibodies and methods of use thereof
KR102904658B1 (ko) FcRn 항체 및 이의 사용 방법
HK40002836A (en) Fcrn antibodies and methods of use thereof
HK40002836B (en) Fcrn antibodies and methods of use thereof
CA2972822C (en) Fcrn antibodies and methods of use thereof
BR122024008593A2 (pt) Anticorpo isolado que se liga ao fcrn humano, seus usos e seu método de preparação, bem como molécula de ácido nucleico, vetor, célula hospedeira e composição farmacêutica

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17835436

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3032415

Country of ref document: CA

Ref document number: 2019504902

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112019001806

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 20197006049

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2017301915

Country of ref document: AU

Date of ref document: 20170731

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2017835436

Country of ref document: EP

Effective date: 20190228

ENP Entry into the national phase

Ref document number: 112019001806

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20190129

WWE Wipo information: entry into national phase

Ref document number: P-2024/0046

Country of ref document: RS

WWD Wipo information: divisional of initial pct application

Ref document number: 320058

Country of ref document: IL