WO2018013918A2 - Treatment and prevention of cytokine release syndrome using a chimeric antigen receptor in combination with a kinase inhibitor - Google Patents

Treatment and prevention of cytokine release syndrome using a chimeric antigen receptor in combination with a kinase inhibitor Download PDF

Info

Publication number
WO2018013918A2
WO2018013918A2 PCT/US2017/042129 US2017042129W WO2018013918A2 WO 2018013918 A2 WO2018013918 A2 WO 2018013918A2 US 2017042129 W US2017042129 W US 2017042129W WO 2018013918 A2 WO2018013918 A2 WO 2018013918A2
Authority
WO
WIPO (PCT)
Prior art keywords
seq
car
composition
amino acid
acid sequence
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2017/042129
Other languages
English (en)
French (fr)
Other versions
WO2018013918A3 (en
Inventor
Saar GILL
Saad KENDERIAN
Marco RUELLA
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Novartis AG
University of Pennsylvania Penn
Original Assignee
Novartis AG
University of Pennsylvania Penn
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to AU2017295886A priority Critical patent/AU2017295886C1/en
Priority to US16/317,943 priority patent/US20190336504A1/en
Priority to SG11201900344YA priority patent/SG11201900344YA/en
Priority to CN202510483434.XA priority patent/CN120285179A/zh
Priority to CN201780054186.0A priority patent/CN110461315B/zh
Priority to EP17746563.0A priority patent/EP3484455A2/en
Priority to JP2019522625A priority patent/JP7219376B2/ja
Application filed by Novartis AG, University of Pennsylvania Penn filed Critical Novartis AG
Priority to CA3030837A priority patent/CA3030837A1/en
Publication of WO2018013918A2 publication Critical patent/WO2018013918A2/en
Publication of WO2018013918A3 publication Critical patent/WO2018013918A3/en
Anticipated expiration legal-status Critical
Priority to JP2022122044A priority patent/JP7584475B2/ja
Priority to AU2023263469A priority patent/AU2023263469A1/en
Priority to JP2024193777A priority patent/JP2025032091A/ja
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/4214Receptors for cytokines
    • A61K40/4217Receptors for interleukins [IL]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/505Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
    • A61K31/519Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with heterocyclic rings
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39558Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/11T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/31Chimeric antigen receptors [CAR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/421Immunoglobulin superfamily
    • A61K40/4211CD19 or B4
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/57Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
    • A61K2039/577Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 tolerising response
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/31Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the route of administration
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/38Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/46Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
    • A61K2239/48Blood cells, e.g. leukemia or lymphoma

Definitions

  • the present invention relates generally to the use of immune effector cells (e.g., T cells or NK cells) engineered to express a Chimeric Antigen Receptor (CAR), in combination with a kinase inhibitor (e.g., a JAK-STAT or a BTK inhibitor), to treat a disease and/or prevent cytokine release syndrome (CRS).
  • CAR Chimeric Antigen Receptor
  • a kinase inhibitor e.g., a JAK-STAT or a BTK inhibitor
  • CAR chimeric antigen receptor
  • CART modified autologous T cell
  • CTL019 The clinical results of the murine derived CART19 (i.e., "CTL019”) have shown promise in establishing complete remissions in patients suffering with CLL as well as in childhood ALL (see, e.g., Kalos et al., Sci Transl Med 3:95ra73 (2011),
  • CAR transformed patient T cells need to persist and maintain the ability to proliferate in response to the target antigen. It has been shown that ALL patient T cells perform can do this with CART 19 comprising a murine scFv (see, e.g., Grupp et al., NEJM 368: 1509-1518 (2013)).
  • Cytokine release syndrome is a serious and common adverse side effect of immune cell-based therapies, e.g., CAR T cell treatment. Severe CRS is a potentially life- threatening toxicity. Deaths with severe cases of CRS have been reported. Diagnosis and management of CRS in response to immune cell-based therapies is routinely based on clinical parameters and symptoms, e.g., see CRS grading scale as described by Lee, D. et al. (2014) Blood 124(2): 188-195. While the interleukin-6 receptor blocker tocilizumab and steroids can reverse CRS, concerns remain that these approaches may impair the anti-tumor effects. Also, there is a lack of preclinical models for CRS after human CART. There is a need for preclinical models for CRS after human CART administration. Also, there is a need for CRS prevention modalities— such modalities would enhance the clinical feasibility of CART therapy.
  • the present disclosure is based, at least in part, on the discovery that a JAK-STAT kinase inhibitor, such as ruxolitinib, can ameliorate cytokine release syndrome (CRS) severity or prevent CRS after CART cell therapy for hematological cancers, such as acute myeloid leukemia (AML), without significantly impairing anti-tumor effect of the CART therapy.
  • a JAK-STAT kinase inhibitor such as ruxolitinib
  • CRS cytokine release syndrome
  • AML acute myeloid leukemia
  • an IL-6 inhibitor e.g., which can be used for CRS prevention/treatment
  • a CAR therapy without decreasing the anti-cancer efficacy of the CAR therapy.
  • treating a subject having a disease described herein, e.g., a cancer described herein, with a combination therapy that includes a CAR- expressing cell and a JAK-STAT or BTK inhibitor is believed to result in improved inhibition or reduction of tumor progression and/or reduced adverse effects (e.g., reduced CRS) in the subject, e.g., as compared to treating a subject having the disease with the CAR-expressing cell or the JAK-STAT or BTK inhibitor alone.
  • compositions and methods of treating disorders such as cancer (e.g., hematological cancers or other B-cell malignancies) using immune effector cells (e.g., T cells or NK cells) that express a Chimeric Antigen
  • CAR Receptor
  • B-cell antigen e.g., CD123 or Cluster of Differentiation 19 protein (CD19)
  • CD19 Cluster of Differentiation 19 protein
  • compositions include, and the methods include administering, immune effector cells (e.g., T cells or NK cells) expressing a CAR (e.g., a B cell targeting CAR), in combination with a kinase inhibitor (e.g., one or more of a JAK-STAT inhibitor and/or a BTK inhibitor).
  • a CAR e.g., a B cell targeting CAR
  • a kinase inhibitor e.g., one or more of a JAK-STAT inhibitor and/or a BTK inhibitor
  • the combination maintains, has better clinical effectiveness, and/or has lower toxicity (e.g., due to prevention of CRS) as compared to either therapy alone.
  • the subject is at risk of, or has, CRS; or the subject has been identified as having or at risk of developing CRS.
  • the disclosure further pertains to the use of engineered cells, e.g., immune effector cells (e.g., T cells or NK cells), to express a CAR molecule that binds to an antigen (e.g., tumor antigen described herein, e.g., a B-cell antigen, e.g., CD123 or CD19, in combination with a kinase inhibitor (e.g., at least one JAK-STAT inhibitor) to treat a disorder associated with expression of a B-cell antigen, e.g., CD123 or CD19 (e.g., a cancer, e.g., a hematological cancer).
  • an antigen e.g., tumor antigen described herein, e.g., a B-cell antigen, e.g., CD123 or CD19
  • a kinase inhibitor e.g., at least one JAK-STAT inhibitor
  • compositions and methods for preventing CRS in a subject by using a combination of a JAK-STAT inhibitor with a CAR-expressing cell e.g., a B cell targeting CAR-expressing cell, e.g., CD123 CAR-expressing cell.
  • compositions and methods for preventing CRS in a subject by using a combination of a BTK inhibitor with a CAR-expressing cell e.g., B cell targeting CAR- expressing cell, e.g., a CD19 CAR-expressing cell
  • a CAR-expressing cell e.g., B cell targeting CAR- expressing cell, e.g., a CD19 CAR-expressing cell
  • the subject is at risk of, or has, CRS; or the subject has been identified as having or at risk of developing CRS.
  • a method of treating a subject e.g., a mammal, having a disease associated with expression of an antigen, e.g., tumor antigen, e.g., tumor antigen described herein.
  • the method comprises administering to the subject an effective amount of a cell e.g., an immune effector cell (e.g., a T cell or NK cell) that expresses a CAR molecule that binds the antigen (e.g., antigen described herein, e.g., tumor antigen, e.g., B-cell antigen), in combination with a JAK-STAT inhibitor, e.g., a JAK-STAT inhibitor described herein, e.g., ruxolitinib.
  • a cell e.g., an immune effector cell (e.g., a T cell or NK cell) that expresses a CAR molecule that binds the antigen (e.g., antigen described herein, e.g., tumor antigen, e.g., B-cell antigen), in combination with a JAK-STAT inhibitor, e.g., a JAK-STAT inhibitor described herein, e.g.
  • a method of providing anti-tumor immunity to a subject e.g., mammal, having a disease associated with expression of an antigen, e.g., tumor antigen, e.g., tumor antigen described herein.
  • an antigen e.g., tumor antigen, e.g., tumor antigen described herein.
  • the method comprises administering to the subject an effective amount of a cell e.g., an immune effector cell (e.g., a T cell or NK cell) that expresses a CAR molecule that binds the antigen (e.g., antigen described herein, e.g., tumor antigen, e.g., B-cell antigen), in combination with a JAK-STAT inhibitor, e.g., a JAK-STAT inhibitor described herein, e.g., ruxolitinib.
  • the CAR molecule binds to CD123, e.g., a CAR molecule that binds CD 123 described herein.
  • cytokine release syndrome e.g., CRS associated with a CAR therapy (e.g., a CAR-expressing cell described herein) in a subject in need thereof, comprising administering a JAK-STAT inhibitor (e.g., ruxolitinib), alone or in combination with the CAR therapy, to the subject, thereby treating and/or preventing CRS in the subject.
  • a JAK-STAT inhibitor e.g., ruxolitinib
  • the subject is at risk of developing, has, or is diagnosed with CRS.
  • the subject has been, is being, or will be administered a CAR therapy, e.g., a CAR-expressing cell described herein.
  • the method further comprises administering an IL-6 inhibitor (e.g., an anti-IL6 receptor inhibitor, e.g., tocilizumab) to the subject.
  • an IL-6 inhibitor e.g., an anti-IL6 receptor inhibitor, e.g., tocilizumab
  • the method comprises administering to the subject (i) a JAK-STAT inhibitor (e.g., ruxolitinib), (ii) a CAR therapy (e.g., CAR-expressing cell described herein), and (iii) an IL-6 inhibitor (e.g., an anti- IL6 receptor inhibitor, e.g., tocilizumab).
  • a JAK-STAT inhibitor e.g., ruxolitinib
  • a CAR therapy e.g., CAR-expressing cell described herein
  • an IL-6 inhibitor e.g., an anti- IL6 receptor inhibitor, e.g., tocilizumab
  • cytokine release syndrome e.g., CRS associated with a CAR therapy, e.g., B cell antigen CAR therapy, e.g., CD19 CAR therapy
  • a BTK inhibitor e.g., ibrutinib
  • the subject is at risk of developing, has, or is diagnosed with CRS.
  • the subject has been, is being, or will be administered a CAR therapy, e.g., a CAR therapy described herein.
  • the subject is identified or has previously been identified as at risk for CRS.
  • the method comprises selecting the subject for administration of the BTK inhibitor.
  • the subject is selected based on (i) his or her risk of developing CRS, (ii) his or her diagnosis of CRS, and/or (iii) whether he or she has been, is being, or will be administered a CAR therapy (e.g., a CAR therapy described herein, e.g., CAR19 therapy, e.g., CTL019).
  • the subject is selected for administration of the BTK inhibitor if the subject is diagnosed with CRS, e.g., severe or non-severe CRS.
  • the subject is selected for administration of the BTK inhibitor if the subject is at risk of (e.g., identified as at risk of) developing CRS.
  • the subject is selected for administration of the BTK inhibitor if the subject has been, is being, or will be administered a CAR therapy (e.g., a CAR therapy described herein, e.g., CAR19 therapy, e.g., CTL019).
  • a CAR therapy e.g., a CAR therapy described herein, e.g., CAR19 therapy, e.g., CTL019
  • the method further comprises administering an IL-6 inhibitor (e.g., an anti-IL6 receptor inhibitor, e.g., tocilizumab) to the subject.
  • an IL-6 inhibitor e.g., an anti-IL6 receptor inhibitor, e.g., tocilizumab
  • the method comprises administering to the subject (i) a BTK inhibitor (e.g., ibrutinib), (ii) a CAR therapy (e.g., CAR-expressing cell described herein), and (iii) an IL-6 inhibitor (e.g., an anti-IL6 receptor inhibitor, e.g., tocilizumab).
  • a BTK inhibitor e.g., ibrutinib
  • a CAR therapy e.g., CAR-expressing cell described herein
  • an IL-6 inhibitor e.g., an anti-IL6 receptor inhibitor, e.g., tocilizumab
  • provided herein is a method of treating or preventing CRS associated with administration of a cell, e.g., a population of cells, expressing a CAR in a subject.
  • a method of treating or preventing CRS associated with administration of a T cell inhibitor therapy e.g., a CD19-inhibiting or depleting therapy, e.g., a therapy that includes a CD19 inhibitor.
  • a CD19-inhibiting or depleting therapy e.g., a therapy that includes a CD19 inhibitor.
  • the CD19-inhibiting or depleting therapy is associated with CRS.
  • the method of treating or preventing CRS comprising administering to the subject an IL-6 inhibitor (e.g., an anti-IL6 receptor inhibitor, e.g., tocilizumab) prior to, simultaneously with, or within 1 day (e.g, within 24 hours, 12 hours, 6 hours, 5, hours, 4 hours, 3 hours, 2 hours, 1 hour or less) of, administration of a dose (e.g., a first dose) of said cell, e.g., said population of cells, expressing a CAR, or said therapy.
  • an IL-6 inhibitor e.g., an anti-IL6 receptor inhibitor, e.g., tocilizumab
  • administration of a dose e.g., a first dose of said cell, e.g., said population of cells, expressing a CAR, or said therapy.
  • the IL-6 inhibitor e.g., tocilizumab
  • a first sign of a symptom of CRS e.g., a fever, e.g., characterized by a temperature of at least 38°C (e.g., at least 38.5 °C), e.g., for two successive measurements in 24 hours (e.g., at least 4, 5, 6, 7, 8 hours, or more, apart)
  • a first sign of a symptom of CRS e.g., a fever, e.g., characterized by a temperature of at least 38°C (e.g., at least 38.5 °C), e.g., for two successive measurements in 24 hours (e.g., at least 4, 5, 6, 7, 8 hours, or more, apart) in the subject.
  • the CAR molecule comprises an antigen binding domain (e.g., B cell antigen binding domain, CD123 binding domain, or CD19 binding domain), transmembrane domain, and an intracellular signaling domain (e.g., an intracellular signaling domain comprising a costimulatory domain and/or a primary signaling domain).
  • an antigen binding domain e.g., B cell antigen binding domain, CD123 binding domain, or CD19 binding domain
  • an intracellular signaling domain e.g., an intracellular signaling domain comprising a costimulatory domain and/or a primary signaling domain.
  • the CAR comprises an antigen binding domain that binds one or more of the following: CD19; CD123; CD22; CD30; CD171; CS-1 (also referred to as CD2 subset 1, CRACC, SLAMF7, CD319, and 19A24); C-type lectin-like molecule-1 (CLL-1 or CLECL1); CD33; epidermal growth factor receptor variant III (EGFRvIII); ganglioside G2 (GD2);
  • ganglioside GD3 (aNeu5Ac(2-8)aNeu5Ac(2-3)bDGalp(l-4)bDGlcp(l-l)Cer); TNF receptor family member B cell maturation (BCMA); Tn antigen ((Tn Ag) or (GalNAca-Ser/Thr)); prostate-specific membrane antigen (PSMA); Receptor tyrosine kinase-like orphan receptor 1 (ROR1); Fms-Like Tyrosine Kinase 3 (FLT3); Tumor-associated glycoprotein 72 (TAG72); CD38; CD44v6; Carcinoembryonic antigen (CEA); Epithelial cell adhesion molecule
  • EPCAM EpCAM
  • B7H3 CD276
  • KIT CD117
  • Interleukin-13 receptor subunit alpha-2 IL-13Ra2 or CD213A2
  • Mesothelin Interleukin 11 receptor alpha
  • PSCA prostate stem cell antigen
  • Protease Serine 21 Testisin or PRSS21
  • vascular endothelial growth factor receptor 2 VEGFR2
  • Lewis(Y) antigen CD24
  • PDGFR- beta Platelet-derived growth factor receptor beta
  • SSEA-4 Stage- specific embryonic antigen-4
  • CD20 Folate receptor alpha; Receptor tyro sine-protein kinase ERBB2 (Her2/neu); Mucin 1, cell surface associated (MUC1);
  • epidermal growth factor receptor EGFR
  • neural cell adhesion molecule NCAM
  • Prostase prostatic acid phosphatase (PAP); elongation factor 2 mutated (ELF2M); Ephrin B2; fibroblast activation protein alpha (FAP); insulin-like growth factor 1 receptor (IGF-I receptor), carbonic anhydrase IX (CAIX); Proteasome (Prosome, Macropain) Subunit, Beta Type, 9 (LMP2); glycoprotein 100 (gplOO); oncogene fusion protein consisting of breakpoint cluster region (BCR) and Abelson murine leukemia viral oncogene homolog 1 (Abl) (bcr-abl); tyrosinase; ephrin type-A receptor 2 (EphA2); Fucosyl GM1; sialyl Lewis adhesion molecule (sLe);
  • EGFR epidermal growth factor receptor
  • NCAM neural cell adhesion molecule
  • ganglioside GM3 (aNeu5Ac(2-3)bDGalp(l-4)bDGlcp(l-l)Cer); transglutaminase 5 (TGS5); high molecular weight-melanoma-associated antigen (HMWMAA); o-acetyl-GD2 ganglioside (OAcGD2); Folate receptor beta; tumor endothelial marker 1 (TEM1/CD248); tumor endothelial marker 7-related (TEM7R); claudin 6 (CLDN6); thyroid stimulating hormone receptor (TSHR); G protein-coupled receptor class C group 5, member D (GPRC5D);
  • chromosome X open reading frame 61 CD97; CD179a; anaplastic lymphoma kinase (ALK); Polysialic acid; placenta- specific 1 (PLAC1); hexasaccharide portion of globoH glycoceramide (GloboH); mammary gland differentiation antigen (NY-BR-1); uroplakin 2 (UPK2); Hepatitis A virus cellular receptor 1 (HAVCR1); adrenoceptor beta 3 (ADRB3); pannexin 3 (PANX3); G protein-coupled receptor 20 (GPR20); lymphocyte antigen 6 complex, locus K 9 (LY6K); Olfactory receptor 51E2 (OR51E2); TCR Gamma Alternate Reading Frame Protein (TARP); Wilms tumor protein (WT1); Cancer/testis antigen 1 (NY-ESO-1);
  • SPA17 X Antigen Family, Member 1A (XAGEl); angiopoietin-binding cell surface receptor 2 (Tie 2); melanoma cancer testis antigen- 1 (MAD-CT-1); melanoma cancer testis antigen-2 (MAD-CT-2); Fos-related antigen 1; tumor protein p53 (p53); p53 mutant; prostein; surviving; telomerase; prostate carcinoma tumor antigen- 1 (PCTA-1 or Galectin 8), melanoma antigen recognized by T cells 1 (MelanA or MARTI); Rat sarcoma (Ras) mutant; human Telomerase reverse transcriptase (hTERT); sarcoma translocation breakpoints; melanoma inhibitor of apoptosis (ML-IAP); ERG (transmembrane protease, serine 2 (TMPRSS2) ETS fusion gene); N-Acetyl glucosaminyl-transferase V (NA
  • LAIR1 Leukocyte-associated immunoglobulin-like receptor 1
  • FCAR Fc fragment of IgA receptor
  • LILRA2 Leukocyte immunoglobulin-like receptor subfamily A member 2
  • CD300LF CD300 molecule-like family member f
  • CLEC12A C-type lectin domain family 12 member A
  • BST2 bone marrow stromal cell antigen 2
  • LY75 lymphocyte antigen 75
  • Glypican-3 Glypican-3 (GPC3); Fc receptor-like 5 (FCRL5); or immunoglobulin lambda-like polypeptide 1 (IGLL1).
  • the CAR molecule is capable of binding an antigen described herein, e.g., an antigen described in the Antigens section below.
  • the antigen comprises a B cell antigen, e.g., CD10, CD19, CD20, CD22, CD34, CD123, FLT-3, ROR1, CD79b, CD179b, and/or CD79a.
  • a B cell antigen e.g., CD10, CD19, CD20, CD22, CD34, CD123, FLT-3, ROR1, CD79b, CD179b, and/or CD79a.
  • the antigen is CD123. In embodiments, the antigen is CD19. In other embodiments, the antigen is BCMA. In embodiments, the antigen is CLL.
  • the CAR molecule comprises a CD 123 CAR described herein, e.g., a CD123 CAR described in US2014/0322212A1 or US2016/0068601A1, both incorporated herein by reference.
  • the CD 123 CAR comprises an amino acid, or has a nucleotide sequence shown in US2014/0322212A1 or US2016/0068601A1, both incorporated herein by reference.
  • the CAR molecule comprises a CD 19 CAR molecule described herein, e.g., a CD19 CAR molecule described in US-2015-0283178-A1, e.g., CTL019.
  • a CD19 CAR molecule described in US-2015-0283178-A1 e.g., CTL019.
  • the CD 19 CAR comprises an amino acid, or has a nucleotide sequence shown in US-2015-0283178-A1, incorporated herein by reference.
  • CAR molecule comprises a BCMA CAR molecule described herein, e.g., a BCMA CAR described in US-2016-0046724-A1.
  • the BCMA CAR comprises an amino acid, or has a nucleotide sequence shown in US-2016-0046724-A1, incorporated herein by reference.
  • the CAR molecule comprises a CLLl CAR described herein, e.g., a CLLl CAR described in US2016/0051651A1, incorporated herein by reference.
  • the CLLl CAR comprises an amino acid, or has a nucleotide sequence shown in US2016/0051651A1, incorporated herein by reference.
  • the CAR molecule comprises a CD33 CAR described herein, e.ga CD33 CAR described in US2016/0096892A1, incorporated herein by reference.
  • the CD33 CAR comprises an amino acid, or has a nucleotide sequence shown in US2016/0096892A1, incorporated herein by reference.
  • the CAR molecule comprises an EGFRvIII CAR molecule described herein, e.g., an EGFRvIII CAR described US2014/0322275A1, incorporated herein by reference.
  • the EGFRvIII CAR comprises an amino acid, or has a nucleotide sequence shown in US2014/0322275A1, incorporated herein by reference.
  • the CAR molecule comprises a mesothelin CAR described herein, e.g., a mesothelin CAR described in WO 2015/090230, incorporated herein by reference.
  • the mesothelin CAR comprises an amino acid, or has a nucleotide sequence shown in WO 2015/090230, incorporated herein by reference.
  • the CAR molecule is capable of binding CD123 (e.g., wild-type or mutant CD 123).
  • the CAR molecule comprises an anti-CD 123 binding domain comprising one or more (e.g., all three) light chain complementary determining region 1 (LC CDR1), light chain complementary determining region 2 (LC CDR2), and light chain complementary determining region 3 (LC CDR3) of an anti-CD 123 binding domain described herein (e.g., described in US2014/0322212A1 or US2016/0068601A1), and/or one or more (e.g., all three) heavy chain complementary determining region 1 (HC CDR1), heavy chain complementary determining region 2 (HC CDR2), and heavy chain complementary
  • determining region 3 of an anti-CD 123 binding domain described herein (e.g., described in US2014/0322212A1 or US2016/0068601A1), e.g., an anti-CD 123 binding domain comprising one or more, e.g., all three, LC CDRs and one or more, e.g., all three, HC CDRs.
  • the encoded CD 123 binding domain comprises one or more (e.g., all three) light chain complementary determining region 1 (LC CDR1), light chain
  • LC CDR2 complementary determining region 2
  • LC CDR3 light chain complementary determining region 3
  • HC CDR1 heavy chain complementary determining region 1
  • HC CDR2 complementary determining region 2
  • determining region 3 of a CD 123 binding domain described herein, e.g., a CD 123 binding domain comprising one or more, e.g., all three, LC CDRs and one or more, e.g., all three, HC CDRs.
  • the encoded CD123 binding domain e.g., a human or humanized CD 123 binding domain
  • the encoded CD 123 binding domain is a scFv comprising a light chain and a heavy chain of an amino acid sequence of Tables 11A,12A or 12B.
  • the CD123 binding domain (e.g., an scFv) comprises: a light chain variable region comprising an amino acid sequence having at least one, two or three
  • the encoded CD123 binding domain comprises a HC CDRl, a
  • the CD33 binding domain further comprises a LC CDRl, a LC CDR2, and a LC CDR3.
  • the CD 123 binding domain comprises a LC CDRl, a LC CDR2, and a LC CDR3 of any CD 123 light chain binding domain amino acid sequences listed in Table 11A,12A or 12B.
  • the encoded CD 123 binding domain comprises one, two or all of LC CDRl, LC CDR2, and LC CDR3 of any CD 123 light chain binding domain amino acid sequences listed in Table 11A or 12B, and one, two or all of HC CDRl, HC CDR2, and HC CDR3 of any CD 123 heavy chain binding domain amino acid sequences listed in Table HA,12A or 12B.
  • the encoded CD 123 binding domain comprises an amino acid sequence selected from a group consisting of SEQ ID NO: 157-160, 184-215, 478, 480, 483, and 485.
  • the encoded CD123 binding domain (e.g., an scFv) comprises an amino acid sequence having at least one, two or three modifications (e.g., substitutions, e.g., conservative substitutions) but not more than 30, 20 or 10 modifications (e.g., substitutions, e.g., conservative substitutions) of an amino acid sequence of 157-160, 184-215, 478, 480, 483, and 485, or a sequence at least 95% identical to (e.g., with 95-99% identity with) an amino acid sequence of SEQ ID NO: 157-160, 184-215, 478, 480, 483, and 485.
  • the encoded CD 123 binding domain comprises a heavy chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 216-219 or 243-274, or an amino acid sequence having at least one, two or three modifications (e.g., substitutions, e.g., conservative substitutions) but not more than 30, 20 or 10 modifications (e.g., substitutions, e.g., conservative substitutions) of SEQ ID NO: 216-219 or 243-274, or a sequence at least 95% identical to (e.g., with 95-99% identity with) SEQ ID NO: 216-219 or 243-274.
  • modifications e.g., substitutions, e.g., conservative substitutions
  • the encoded CD123 binding domain comprises a heavy chain variable region comprising an amino acid sequence corresponding to the heavy chain variable region of SEQ ID NO:478, 480, 483, or 485, or an amino acid sequence having at least one, two or three modifications (e.g., substitutions, e.g., conservative substitutions) but not more than 30, 20 or 10 modifications (e.g., substitutions, e.g.,
  • the encoded CD 123 binding domain comprises a light chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 275-278 or 302-333, or an amino acid sequence having at least one, two or three modifications (e.g., substitutions, e.g., conservative substitutions) but not more than 30, 20 or 10 modifications (e.g., substitutions, e.g., conservative substitutions) of SEQ ID NO: 275-278 or 302-333, or a sequence at least 95% identical to (e.g., with 95-99% identity with) SEQ ID NO: 275-278 or 302-333.
  • modifications e.g., substitutions, e.g., conservative substitutions
  • the encoded CD 123 binding domain comprises a light chain variable region comprising an amino acid sequence corresponding to the light chain variable region of SEQ ID NO:478, 480, 483, or 485, or an amino acid sequence having at least one, two or three modifications (e.g., substitutions, e.g., conservative substitutions) but not more than 30, 20 or 10 modifications (e.g., substitutions, e.g.,
  • the nucleic acid molecule encoding the scFv comprises a nucleotide sequence selected from the group consisting of SEQ ID NO: 479, 481, 482, 484, or a sequence with at least 95% identity, e.g., 95-99% identity thereof.
  • the nucleic acid molecule comprises a nucleotide sequence encoding the heavy chain variable region and/or the light chain variable region, wherein said nucleotide sequence comprises a portion of a nucleotide sequence selected from the group consisting of SEQ ID NO: 479, 481, 482, and 484, or a sequence with at least 95% identity, e.g., 95-99% identity thereof, corresponding to the heavy chain variable region and/or the light chain variable region.
  • the nucleic acid molecule comprises a nucleotide sequence encoding the heavy chain variable region and/or the light chain variable region, wherein the encoded amino acid sequence is selected from the group consisting of SEQ ID NO: 157-160, or a sequence at least 95% identical (e.g., with 95-99% identity) thereof.
  • the nucleic acid molecule encodes an scFv comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 184-215, or a sequence with at least 95% identity, e.g., 95-99% identity thereof.
  • the nucleic acid molecule comprises a sequence encoding the heavy chain variable region and/or the light chain variable region, wherein the encoded amino acid sequence is selected from the group consisting of SEQ ID NO: 184-215, or a sequence with at least 95% identity, e.g., 95-99% identity thereof.
  • the encoded CD 123 binding domain includes a (Gly4-Ser)n linker, wherein n is 1, 2, 3, 4, 5, or 6, preferably 3 or 4 (SEQ ID NO:26).
  • the light chain variable region and heavy chain variable region of a scFv can be, e.g., in any of the following orientations: light chain variable region-linker-heavy chain variable region or heavy chain variable region-linker-light chain variable region.
  • the CAR molecule is capable of binding CD19 (e.g., wild-type or mutant CD19).
  • the CAR molecule comprises an anti-CD19 binding domain comprising one or more (e.g., all three) light chain complementary determining region 1 (LC CDRl), light chain complementary determining region 2 (LC CDR2), and light chain complementary determining region 3 (LC CDR3) of an anti-CD 123 binding domain described herein, and/or one or more (e.g., all three) heavy chain complementary determining region 1 (HC CDRl), heavy chain complementary determining region 2 (HC CDR2), and heavy chain complementary determining region 3 (HC CDR3) of an anti-CD 19 binding domain described herein, e.g., an anti-CD19 binding domain comprising one or more, e.g., all three, LC CDRs and one or more, e.g., all three, HC CDRs.
  • the anti-CD19 binding domain comprises one or more, e.g., all three, LC CDRs and
  • HC CDR2 complementary determining region 2
  • the anti-CD 19 binding domain has two variable heavy chain regions, each comprising a HC CDRl, a HC CDR2 and a HC CDR3 described herein.
  • the anti-CD 19 binding domain comprises a murine light chain variable region described herein (e.g., in Table 14A) and/or a murine heavy chain variable region described herein (e.g., in Table 14A).
  • the anti-CD 19 binding domain is a scFv comprising a murine light chain and a murine heavy chain of an amino acid sequence of Table 14A.
  • the anti- CD 19 binding domain (e.g., an scFv) comprises: a light chain variable region comprising an amino acid sequence having at least one, two or three modifications (e.g., substitutions) but not more than 30, 20 or 10 modifications (e.g., substitutions) of an amino acid sequence of a light chain variable region provided in Table 14A, or a sequence with at least 95% identity, e.g., 95- 99% identity, with an amino acid sequence of Table 14A; and/or a heavy chain variable region comprising an amino acid sequence having at least one, two or three modifications (e.g., substitutions) but not more than 30, 20 or 10 modifications (e.g., substitutions) of an amino acid sequence of a heavy chain variable region provided in Table 14 A, or a sequence with at least 95% identity, e.g., 95-99% identity, to an amino acid sequence of Table 14A.
  • a light chain variable region comprising an amino acid sequence having at least one, two or three modifications (e.g., substitutions)
  • the anti-CD19 binding domain comprises a sequence of SEQ ID NO: 774, or a sequence with at least 95% identity, e.g., 95-99% identity, thereof.
  • the anti-CD 19 binding domain is a scFv, and a light chain variable region comprising an amino acid sequence described herein, e.g., in Table 14A, is attached to a heavy chain variable region comprising an amino acid sequence described herein, e.g., in Table 14A, via a linker, e.g., a linker described herein.
  • the anti-CD 19 binding domain includes a (Gly 4 - Ser)n linker, wherein n is 1, 2, 3, 4, 5, or 6, preferably 3 or 4 (SEQ ID NO: 26).
  • the light chain variable region and heavy chain variable region of a scFv can be, e.g., in any of the following orientations: light chain variable region-linker-heavy chain variable region or heavy chain variable region-linker-light chain variable region.
  • the CAR molecule comprises a humanized anti-CD 19 binding domain that includes one or more (e.g., all three) light chain complementary determining region 1 (LC CDR1), light chain complementary determining region 2 (LC CDR2), and light chain complementary determining region 3 (LC CDR3) of a humanized anti-CD 19 binding domain described herein, and one or more (e.g., all three) heavy chain complementary determining region 1 (HC CDR1), heavy chain complementary determining region 2 (HC CDR2), and heavy chain complementary determining region 3 (HC CDR3) of a humanized anti-CD19 binding domain described herein, e.g., a humanized anti-CD19 binding domain comprising one or more, e.g., all three, LC CDRs and one or more, e.g., all three, HC CDRs.
  • LC CDR1 light chain complementary determining region 1
  • HC CDR2 light chain complementary determining region 2
  • HC CDR3 light chain complementary determining region 3
  • the humanized anti-CD 19 binding domain comprises at least HC CDR2.
  • the humanized anti-CD19 binding domain comprises one or more (e.g., all three) heavy chain complementary determining region 1 (HC CDR1), heavy chain complementary determining region 2 (HC CDR2), and heavy chain complementary determining region 3 (HC CDR3) of a humanized anti-CD19 binding domain described herein, e.g., the humanized anti- CD ⁇ binding domain has two variable heavy chain regions, each comprising a HC CDR1, a HC CDR2 and a HC CDR3 described herein.
  • the humanized anti-CD 19 binding domain comprises at least HC CDR2.
  • the light chain variable region comprises one, two, three or all four framework regions of VK3_L25 germline sequence.
  • the light chain variable region has a modification (e.g., substitution, e.g., a substitution of one or more amino acid found in the corresponding position in the murine light chain variable region of SEQ ID NO: 773, e.g., a substitution at one or more of positions 71 and 87).
  • the heavy chain variable region comprises one, two, three or all four framework regions of VH4_4-59 germline sequence.
  • the heavy chain variable region has a modification (e.g., substitution, e.g., a substitution of one or more amino acid found in the corresponding position in the murine heavy chain variable region of SEQ ID NO: 773, e.g., a substitution at one or more of positions 71, 73 and 78).
  • the humanized anti-CD 19 binding domain comprises a light chain variable region described herein (e.g., in Table 13 A) and/or a heavy chain variable region described herein (e.g., in Table 13A).
  • the humanized anti-CD19 binding domain is a scFv comprising a light chain and a heavy chain of an amino acid sequence of Table 13 A.
  • the humanized anti-CD 19 binding domain (e.g., an scFv) comprises: a light chain variable region comprising an amino acid sequence having at least one, two or three modifications (e.g., substitutions) but not more than 30, 20 or 10 modifications (e.g., substitutions) of an amino acid sequence of a light chain variable region provided in Table 13 A, or a sequence with at least 95% identity, e.g., 95-99% identity, with an amino acid sequence of Table 13 A; and/or a heavy chain variable region comprising an amino acid sequence having at least one, two or three modifications (e.g., substitutions) but not more than 30, 20 or 10 modifications (e.g., substitutions) of an amino acid sequence of a heavy chain variable region provided in Table 13A, or a sequence with at least 95% identity, e.g., 95-99% identity, to an amino acid sequence of Table 13 A.
  • a light chain variable region comprising an amino acid sequence having at least one, two or three modifications (e.g., substitutions
  • the humanized anti-CD 19 binding domain comprises a sequence selected from the group consisting of SEQ ID NOs: 710-721, or a sequence with at least 95% identity, e.g., 95-99% identity, thereof.
  • the humanized anti-CD 19 binding domain is a scFv, and a light chain variable region comprising an amino acid sequence described herein, e.g., in Table 13 A, is attached to a heavy chain variable region comprising an amino acid sequence described herein, e.g., in Table 13 A, via a linker, e.g., a linker described herein.
  • the antigen recognition domain binds CD19.
  • the CAR comprises an amino acid sequence of a CD 19 CAR described herein.
  • the CAR comprises the amino acid sequence of SEQ ID NO: 773.
  • the humanized anti-CD 19 binding domain includes a (Gly 4 -Ser)n linker, wherein n is 1, 2, 3, 4, 5, or 6, preferably 3 or 4 (SEQ ID NO: 26).
  • the light chain variable region and heavy chain variable region of a scFv can be, e.g., in any of the following orientations: light chain variable region-linker-heavy chain variable region or heavy chain variable region-linker-light chain variable region.
  • the CAR molecule comprises a transmembrane domain of a protein selected from the group consisting of the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137 and CD154.
  • the transmembrane domain comprises a sequence of SEQ ID NO: 6.
  • the transmembrane domain comprises an amino acid sequence having at least one, two or three modifications (e.g., substitutions) but not more than 20, 10 or 5 modifications (e.g., substitutions) of an amino acid sequence of SEQ ID NO: 6, or a sequence with at least 95% identity, e.g., 95-99% identity, to an amino acid sequence of SEQ ID NO: 6.
  • the antigen binding domain (e.g., CD 123 or CD 19 binding domain) is connected to the transmembrane domain by a hinge region, e.g., a hinge region described herein.
  • the encoded hinge region comprises SEQ ID NO:2, SEQ ID NO: 4, or SEQ ID NO:3, or a sequence with at least 95% identity, e.g., 95-99% identity, thereof.
  • the CAR molecule further comprises a sequence encoding a costimulatory domain, e.g., a costimulatory domain described herein.
  • the costimulatory domain comprises a functional signaling domain of a protein selected from the group consisting of OX40, CD2, CD27, CD28, CDS, ICAM-1, LFA-1 (CDl la/CD18), ICOS, and 4-1BB (CD137).
  • the costimulatory domain comprises a sequence of SEQ ID NO: 7.
  • the costimulatory domain comprises a sequence of SEQ ID NO:8.
  • the costimulatory domain comprises a sequence of SEQ ID NO:43.
  • the costimulatory domain comprises a sequence of SEQ ID NO:45. In one embodiment, the costimulatory domain comprises an amino acid sequence having at least one, two or three modifications (e.g., substitutions) but not more than 20, 10 or 5 modifications (e.g., substitutions) of an amino acid sequence of SEQ ID NO: 7, 8, 43, or 45, or a sequence with at least 95% identity, e.g., 95-99% identity, to an amino acid sequence of SEQ ID NO: 7, 8, 43, or 45.
  • the CAR molecule further comprises a sequence encoding an intracellular signaling domain, e.g., an intracellular signaling domain described herein.
  • the intracellular signaling domain comprises a functional signaling domain of 4- 1BB and/or a functional signaling domain of CD3 zeta.
  • the intracellular signaling domain comprises the sequence of SEQ ID NO: 7 and/or the sequence of SEQ ID NO: 9 or 10.
  • the intracellular signaling domain comprises a functional signaling domain of CD27 and/or a functional signaling domain of CD3 zeta.
  • the intracellular signaling domain comprises the sequence of SEQ ID NO: 8 and/or the sequence of SEQ ID NO: 9 or 10.
  • the intracellular signaling domain comprises an amino acid sequence having at least one, two or three modifications (e.g., substitutions) but not more than 20, 10 or 5 modifications (e.g., substitutions) of an amino acid sequence of SEQ ID NO:7 or SEQ ID NO:8 and/or an amino acid sequence of SEQ ID NO:9 or SEQ ID NO: 10, or a sequence with at least 95% identity, e.g., 95-99% identity, to an amino acid sequence of SEQ ID NO:7 or SEQ ID NO:8 and/or an amino acid sequence of SEQ ID NO:9 or SEQ ID NO: 10.
  • the intracellular signaling domain comprises the sequence of SEQ ID NO: 7 or SEQ ID NO:8 and the sequence of SEQ ID NO: 9 or SEQ ID NO: 10, wherein the sequences comprising the intracellular signaling domain are expressed in the same frame and as a single polypeptide chain.
  • the CAR molecule further comprises a leader sequence, e.g., a leader sequence described herein.
  • the leader sequence comprises an amino acid sequence of SEQ ID NO: 1, or a sequence with at least 95% identity, e.g., 95-99% identity, to an amino acid sequence of SEQ ID NO: l.
  • the CAR molecule comprises a leader sequence, e.g., a leader sequence described herein, e.g., a leader sequence of SEQ ID NO: 1, or having at least 95% identity, e.g., 95-99% identity, thereof, a CD 123 binding domain described herein, e.g., a CD123 binding domain comprising a LC CDR1, a LC CDR2, a LC CDR3, a HC CDR1, a HC CDR2 and a HC CDR3 described herein, e.g., a CD 123 binding domain described in Table 11 A or 12A, or a sequence with at least 95% identity, e.g., 95-99% identity, thereof, a hinge region, e.g., a hinge region described herein, e.g., a hinge region of SEQ ID NO:2, or having at least 95% identity, e.g., 95-99% identity, thereof, a transmembrane domain, e.g.,
  • transmembrane domain described herein e.g., a transmembrane domain having a sequence of SEQ ID NO:6 or a sequence having at least 95% identity, e.g., 95-99% identity, thereof, an intracellular signaling domain, e.g., an intracellular signaling domain described herein (e.g., an intracellular signaling domain comprising a costimulatory domain and/or a primary signaling domain).
  • an intracellular signaling domain e.g., an intracellular signaling domain described herein (e.g., an intracellular signaling domain comprising a costimulatory domain and/or a primary signaling domain).
  • the intracellular signaling domain comprises a costimulatory domain, e.g., a costimulatory domain described herein, e.g., a 4-1BB costimulatory domain having a sequence of SEQ ID NO:7, or having at least 95% identity, e.g., 95-99% identity, thereof, and/or a primary signaling domain, e.g., a primary signaling domain described herein, e.g., a CD3 zeta stimulatory domain having a sequence of SEQ ID NO:9 or SEQ ID NO: 10, or having at least 95% identity, e.g., 95-99% identity, thereof.
  • a costimulatory domain e.g., a costimulatory domain described herein, e.g., a 4-1BB costimulatory domain having a sequence of SEQ ID NO:7, or having at least 95% identity, e.g., 95-99% identity, thereof
  • a primary signaling domain e.g., a primary
  • the intracellular signaling domain comprises a costimulatory domain, e.g., a costimulatory domain described herein, e.g., a 4- IBB costimulatory domain having a sequence of SEQ ID NO:7, and/or a primary signaling domain, e.g., a primary signaling domain described herein, e.g., a CD3 zeta stimulatory domain having a sequence of SEQ ID NO:9 or SEQ ID NO: 10.
  • a costimulatory domain e.g., a costimulatory domain described herein, e.g., a 4- IBB costimulatory domain having a sequence of SEQ ID NO:7
  • a primary signaling domain e.g., a primary signaling domain described herein, e.g., a CD3 zeta stimulatory domain having a sequence of SEQ ID NO:9 or SEQ ID NO: 10.
  • the CAR molecule comprises a leader sequence, e.g., a leader sequence described herein, e.g., a leader sequence of SEQ ID NO: 1, or having at least 95% identity, e.g., 95-99% identity, thereof; an anti-CD19 binding domain described herein, e.g., an anti-CD 19 binding domain comprising a LC CDR1, a LC CDR2, a LC CDR3, a HC CDR1, a HC CDR2 and a HC CDR3 described herein, e.g., a murine anti-CD19 binding domain described in Table 14A, a humanized anti-CD19 binding domain described in Table 13A, or a sequence with 95-99% identify thereof; a hinge region, e.g., a hinge region described herein, e.g., a hinge region of SEQ ID NO: 2, 3, or 4, or having at least 95% identity, e.g., 95-99% identity, thereof; a transmembran
  • the intracellular signaling domain comprises a costimulatory domain, e.g., a costimulatory domain described herein, e.g., a 4- IBB costimulatory domain having a sequence of SEQ ID NO:7, a CD28 costimulatory domain having a sequence of SEQ ID NO:43, a CD27
  • a costimulatory domain e.g., a costimulatory domain described herein, e.g., a 4- IBB costimulatory domain having a sequence of SEQ ID NO:7, a CD28 costimulatory domain having a sequence of SEQ ID NO:43, a CD27
  • costimulatory domain having a sequence of SEQ ID NO: 8, or an ICOS costimulatory domain having a sequence of SEQ ID NO: 45, or having at least 95% identity, e.g., 95-99% identity, thereof, and/or a primary signaling domain, e.g., a primary signaling domain described herein, e.g., a CD3 zeta stimulatory domain having a sequence of SEQ ID NO:9 or SEQ ID NO: 10, or having at least 95% identity, e.g., 95-99% identity, thereof.
  • a primary signaling domain e.g., a primary signaling domain described herein, e.g., a CD3 zeta stimulatory domain having a sequence of SEQ ID NO:9 or SEQ ID NO: 10, or having at least 95% identity, e.g., 95-99% identity, thereof.
  • the CAR molecule comprises (e.g., consists of) an amino acid sequence described in US-2015-0283178-A1, US-2016-0046724-A1, US2014/0322212A1, US2016/0068601A1, US2016/0051651A1, US2016/0096892A1, US2014/0322275A1, or WO2015/090230; or an amino acid sequence having at least one, two, three, four, five, 10, 15, 20 or 30 modifications (e.g., substitutions) but not more than 60, 50 or 40 modifications (e.g., substitutions) of an amino acid sequence described in US-2015-0283178-A1, US-2016- 0046724-A1, US2014/0322212A1, US2016/0068601A1, US2016/0051651A1,
  • US2016/0096892A1, US2014/0322275A1, or WO2015/090230 or an amino acid sequence having 85%, 90%, 95%, 96%, 97%, 98% or 99% identity to an amino acid sequence described in US-2015-0283178-A1, US-2016-0046724-A1, US2014/0322212A1, US2016/0068601A1, US2016/0051651A1, US2016/0096892A1, US2014/0322275A1, or WO2015/090230.
  • the cell expressing the CAR molecule comprises a vector that includes a nucleic acid sequence encoding the CAR molecule.
  • the vector is selected from the group consisting of a DNA, a RNA, a plasmid, a lentivirus vector, adenoviral vector, or a retrovirus vector.
  • the vector is a lentivirus vector.
  • the vector further comprises a promoter.
  • the promoter is an EF-1 promoter.
  • the EF-1 promoter comprises a sequence of SEQ ID NO: 11.
  • the vector is an in vitro transcribed vector, e.g., a vector that transcribes RNA of a nucleic acid molecule described herein.
  • the nucleic acid sequence in the in vitro vector further comprises a poly(A) tail, e.g., a poly A tail described herein, e.g., comprising about 150 adenosine bases (SEQ ID NO:30).
  • the nucleic acid sequence in the in vitro vector further comprises a 3 'UTR, e.g., a 3' UTR described herein, e.g., comprising at least one repeat of a 3'UTR derived from human beta-globulin.
  • the nucleic acid sequence in the in vitro vector further comprises promoter, e.g., a T2A promoter.
  • the cell expressing the CAR molecule is a cell or population of cells as described herein, e.g., a human immune effector cell or population of cells (e.g., a human T cell or a human NK cell, e.g., a human T cell described herein or a human NK cell described herein).
  • a human immune effector cell or population of cells e.g., a human T cell or a human NK cell, e.g., a human T cell described herein or a human NK cell described herein.
  • the human T cell is a CD8+ T cell.
  • the cell is an autologous T cell.
  • the cell is an allogeneic T cell.
  • the cell is a T cell and the T cell is diaglycerol kinase (DGK) deficient. In one embodiment, the cell is a T cell and the T cell is Ikaros deficient. In one embodiment, the cell is a T cell and the T cell is both DGK and Ikaros deficient. It shall be understood that the compositions and methods disclosed herein reciting the term "cell” encompass compositions and methods comprising one or more cells, e.g., a population of cells.
  • DGK diaglycerol kinase
  • the CAR-expressing cell that is administered comprises a regulatable CAR (RCAR), e.g., an RCAR as described herein.
  • the RCAR may comprise, e.g., an intracellular signaling member comprising an intracellular signaling domain and a first switch domain, an antigen binding member comprising an antigen binding domain that binds an antigen (e.g., antigen described herein, e.g., B cell antigen, e.g., CD123 or CD19) and a second switch domain; and a transmembrane domain.
  • the method may further comprise administering a dimerization molecule, e.g., in an amount sufficient to cause dimerization of the first switch and second switch domains.
  • the JAK-STAT inhibitor comprises/is an antibody molecule, a small molecule, a polypeptide, e.g., a fusion protein, or an inhibitory nucleic acid, e.g., a siRNA or shRNA.
  • the JAK-STAT inhibitor is a small molecule, e.g., ruxolitinib, AG490, AZD1480, tofacitinib (tasocitinib or CP-690550), CYT387, fedratinib, baricitinib (INCB039110), lestaurtinib (CEP701), pacritinib (SB 1518), XL019, gandotinib (LY2784544), BMS911543, fedratinib (SAR302503), decemotinib (V-509), INCB39110, GEN1, GEN2, GLPG0634, NS018, and N-(cyanomethyl)-4-[2-(4- morpholinoanilino)pyrimidin-4-yl]benzamide, or pharmaceutically acceptable salts thereof.
  • the JAK-STAT inhibitor is ruxolitinib or a pharmaceutically acceptable
  • the BTK inhibitor comprises/is an antibody molecule, a small molecule, a polypeptide, e.g., a fusion protein, or an inhibitory nucleic acid, e.g., a siRNA or shRNA.
  • the BTK inhibitor is a small molecule, e.g., ibrutinib, GDC-0834, RN-486, CGI-560, CGI- 1764, HM-71224, CC-292, ONO-4059, CNX-774, or LFM-A13, or a pharmaceutically acceptable salt thereof, or a combination thereof.
  • the BTK inhibitor is ibrutinib or a pharmaceutically acceptable salt thereof.
  • an IL-6 inhibitor e.g., used in accordance with any composition or method described herein, comprises an inhibitor of IL-6 signaling, e.g., comprising an IL-6 inhibitor or an IL-6 receptor (IL-6R) inhibitor.
  • IL-6 inhibitors include tocilizumab, siltuximab, apeledoxifene, and soluble glycoprotein 130 (sgpl30) blockers.
  • Exemplary IL-6 inhibitors are described in International Application WO2014011984, which is hereby incorporated by reference. Tocilizumab is described in greater detail herein, e.g., in the "CRS Therapies" section herein.
  • the IL-6 inhibitor is an anti-IL-6 antibody, e.g., an anti-IL-6 chimeric monoclonal antibody such as siltuximab.
  • the inhibitor comprises a soluble gpl30 or a fragment thereof that is capable of blocking IL-6 signalling.
  • the sgpl30 or fragment thereof is fused to a heterologous domain, e.g., an Fc domain, e.g., is a gpl30-Fc fusion protein such as FE301.
  • the IL-6 inhibitor comprises an antibody, e.g., an antibody to the IL-6 receptor, such as sarilumab, olokizumab (CDP6038), elsilimomab, sirukumab (CNTO 136), ALD518/BMS- 945429, ARGX-109, or FM101.
  • the IL-6 inhibitor comprises a small molecule such as CPSI-2364.
  • the disease associated with expression of an antigen is a hyperproliferative disorder, e.g., cancer.
  • the cancer is a solid cancer. In other embodiments, the cancer is a hematological cancer.
  • the hematological cancer is a leukemia.
  • the hematological cancer is acute myeloid leukemia (AML), acute lymphocytic leukemia (ALL), or chronic lymphocytic leukemia (CLL).
  • the hematological cancer is a lymphoma, e.g., mantle cell lymphoma (MCL).
  • the hematological cancer is a B cell malignancy, e.g., B cell leukemia or B cell lymphoma.
  • the hematological cancer is chosen from: chronic lymphocytic leukemia (CLL), mantle cell lymphoma (MCL), multiple myeloma, acute lymphoid leukemia (ALL), Hodgkin lymphoma, B-cell acute lymphoid leukemia (BALL), T-cell acute lymphoid leukemia (TALL), small lymphocytic leukemia (SLL), B cell prolymphocytic leukemia, blastic plasmacytoid dendritic cell neoplasm, Burkitt's lymphoma, diffuse large B cell lymphoma (DLBCL), DLBCL associated with chronic inflammation, follicular lymphoma, pediatric follicular lymphoma, hairy cell leukemia, small cell- or a large cell-follicular lymphoma, malignant lympho
  • CLL chronic
  • AML acute lymphoblastic leukemia
  • ALL acute lymphoblastic leukemia
  • B-cell acute lymphoid leukemia B-cell acute lymphoid leukemia
  • T-cell acute lymphoid leukemia B-cell prolymphocytic leukemia
  • chronic lymphocytic leukemia CML
  • hairy cell leukemia Hodgkin lymphoma, a histiocytic disorder, a mast cell disorder, a myelodysplasia, a myelodysplastic syndrome, a myeloproliferative neoplasm, a plasma cell myeloma, a plasmacytoid dendritic cell neoplasm, or a combination thereof.
  • the disease is a disease associated with expression of a B-cell antigen (e.g., expression of one or more of CD10, CD19, CD20, CD22, CD34, CD123, FLT-3, ROR1, CD79b, CD179b, and/or CD79a).
  • a B-cell antigen e.g., expression of one or more of CD10, CD19, CD20, CD22, CD34, CD123, FLT-3, ROR1, CD79b, CD179b, and/or CD79a.
  • the disease associated with expression of a B-cell antigen is selected from a proliferative disease such as a cancer, a malignancy, or a precancerous condition such as a myelodysplasia, a myelodysplastic syndrome or a preleukemia, or is a non-cancer related indication associated with expression of the B-cell antigen, e.g., one or more of CDIO, CD19, CD20, CD22, CD34, CD123, FLT-3, ROR1, CD79b, CD179b, and/or CD79a.
  • a proliferative disease such as a cancer, a malignancy, or a precancerous condition such as a myelodysplasia, a myelodysplastic syndrome or a preleukemia
  • a non-cancer related indication associated with expression of the B-cell antigen e.g., one or more of CDIO, CD19, CD20, CD22, CD34, CD123, FLT-3,
  • the disease associated with B-cell antigen expression is a "preleukemia” which is a diverse collection of hematological conditions united by ineffective production (or dysplasia) of myeloid blood cells.
  • the disease associated with B-cell antigen expression includes, but is not limited to atypical and/or non-classical cancers, malignancies, precancerous conditions or proliferative diseases expressing the B-cell antigen (e.g., one or more of CDIO, CD19, CD20, CD22, CD34, CD123, FLT-3, ROR1, CD79b, CD179b, and/or CD79a).
  • the disease associated with expression of a B-cell antigen is a hematological cancer, leukemia, lymphoma, MCL, CLL, ALL, Hodgkin lymphoma, or multiple myeloma. Any combination of the diseases associated with B-cell antigen expression described herein can be treated with the methods and compositions described herein.
  • CRS CRS
  • the CRS is a severe CRS, e.g., grade 4 or 5 CRS. In embodiments, the CRS is a less than severe CRS, e.g., grade 1, 2, or 3 CRS. Additional description of CRS is provided in the section entitled "Cytokine Release Syndrome.”
  • the CRS is a CRS distinguished from sepsis, e.g., by a method described herein, e.g., by a method of distinguishing between CRS and sepsis in a subject as described herein.
  • the method of distinguishing between CRS and sepsis comprises acquiring a measure of one or more of the following:
  • the CAR-expressing cell and the inhibitor are administered sequentially, concurrently, or within a treatment interval, e.g., as described herein.
  • the CAR-expressing cell and the inhibitor e.g., JAK-STAT or the inhibitor
  • BTK inhibitor are administered sequentially.
  • the inhibitor e.g., JAK- STAT or BTK inhibitor
  • the inhibitor is administered prior to administration of the CAR-expressing cell.
  • the inhibitor e.g., JAK-STAT or BTK inhibitor
  • the inhibitor e.g., JAK-STAT or BTK inhibitor
  • CAR-expressing cell are administered simultaneously or concurrently.
  • the CAR-expressing cell and the inhibitor are administered in a treatment interval.
  • the treatment interval comprises a single dose of the inhibitor (e.g., JAK-STAT or BTK inhibitor) and a single dose of the CAR-expressing cell (e.g., in any order).
  • the treatment interval comprises multiple doses (e.g., a first and second dose) of the inhibitor (e.g., JAK-STAT or BTK inhibitor) and a dose of the CAR-expressing cell (e.g., in any order).
  • the treatment interval comprises a single dose of the inhibitor (e.g., JAK-STAT or BTK inhibitor) and a single dose of the CAR-expressing cell
  • the dose of inhibitor (e.g., JAK-STAT or BTK inhibitor) and the dose of the CAR-expressing cell are administered simultaneously or concurrently.
  • the dose of the inhibitor (e.g., JAK-STAT or BTK inhibitor) and the dose of the CAR-expressing cell are administered within 2 days (e.g., within 2 days, 1 day, 24 hours, 12 hours, 6 hours, 4 hours, 2 hours, 1 hour, or less) of each other.
  • the treatment interval is initiated upon administration of the first-administered dose and completed upon administration of the later-administered dose.
  • the treatment interval comprises a single dose of the inhibitor (e.g., JAK-STAT or BTK inhibitor) and a single dose of the CAR-expressing cell
  • the dose of the inhibitor e.g., JAK-STAT or BTK inhibitor
  • the dose of the CAR-expressing cell is administered sequentially.
  • the dose of the CAR-expressing cell is administered prior to the dose of the inhibitor (e.g., JAK-STAT or BTK inhibitor), and the treatment interval is initiated upon administration of the dose of the CAR-expressing cell and completed upon administration of the dose of the inhibitor (e.g., JAK-STAT or BTK inhibitor).
  • the dose of the inhibitor (e.g., JAK-STAT or BTK inhibitor) is administered prior to the dose of the CAR-expressing cell, and the treatment interval is initiated upon administration of the dose of the inhibitor (e.g., JAK-STAT or BTK inhibitor) and completed upon administration of the dose of the CAR-expressing cell.
  • the treatment interval further comprises one or more, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more, subsequent doses of the inhibitor (e.g., JAK-STAT or BTK inhibitor).
  • the treatment interval comprises two, three, four, five, six, seven, eight, nine, ten, or more, doses of inhibitor (e.g., JAK-STAT or BTK inhibitor) and one dose of the CAR-expressing cell.
  • the dose of the CAR-expressing cell is administered at least 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, or 2 weeks before or after a dose of inhibitor (e.g., JAK-STAT or BTK inhibitor) is administered.
  • the dose of the CAR-expressing cell is administered at least 1 day, 2 days, 3 days, 4 days, 5, days, 6 days, 7 days, or 2 weeks before or after the first dose of inhibitor (e.g., JAK-STAT or BTK inhibitor) is administered or after the initiation of the treatment interval.
  • inhibitor e.g., JAK-STAT or BTK inhibitor
  • the second inhibitor e.g., JAK-STAT or BTK inhibitor
  • the second inhibitor is administered about 10 h, 12 h, 14 h, 16 h, 18 h, 20 h, 24 h, 1 day, 1.5 days, 2 days, 3 days, or 4 days after the first dose of inhibitor (e.g., JAK-STAT or BTK inhibitor) is administered.
  • the treatment interval comprises multiple doses (e.g., a first and second, and optionally a subsequent dose) of an inhibitor (e.g., JAK-STAT or BTK inhibitor) and a dose of a CAR-expressing cell
  • an inhibitor e.g., JAK-STAT or BTK inhibitor
  • the dose of the CAR-expressing cell and the first dose of the inhibitor are administered simultaneously or concurrently, e.g., within 2 days (e.g., within 2 days, 1 day, 24 hours, 12 hours, 6 hours, 4 hours, 2 hours, or less) of each other.
  • the second dose of the inhibitor (e.g., JAK-STAT or BTK inhibitor) is administered after either (i) the dose of the CAR-expressing cell or (ii) the first dose of the inhibitor (e.g., JAK-STAT or BTK inhibitor), whichever is later.
  • the inhibitor e.g., JAK-STAT or BTK inhibitor
  • the second dose of the inhibitor is administered at least 8 h (e.g., at least 8 h, 9 h, 10 h, 12 h, 14 h, 16 h, 18 h, 20 h, 24 h, 1 day, 1.5 days, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, or more) after (i) or (ii).
  • the inhibitor e.g., JAK-STAT or BTK inhibitor
  • a subsequent dose e.g., third, fourth, or fifth dose, and so on
  • the inhibitor e.g., JAK-STAT or BTK inhibitor
  • the second dose of the inhibitor e.g., JAK-STAT or BTK inhibitor
  • the subsequent dose of the inhibitor is administered at least 8 h (e.g., at least 8 h, 9 h, 10 h, 12 h, 14 h, 16 h, 18 h, 20 h, 24 h, 1 day, 1.5 days, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, or more) after the second dose of the inhibitor (e.g., JAK-STAT or BTK inhibitor).
  • the second dose of the inhibitor e.g., JAK-STAT or BTK inhibitor
  • the treatment interval is initiated upon administration of the first-administered dose and completed upon administration of the second dose (or subsequent dose) of the inhibitor (e.g., JAK-STAT or BTK inhibitor).
  • the dose of inhibitor e.g., JAK-STAT or BTK inhibitor
  • QD once a day
  • BID twice a day
  • Any of the treatment intervals described herein can include one or more doses of the CAR-expressing cells.
  • the treatment interval comprises multiple doses (e.g., a first and second, and optionally a subsequent dose) of an inhibitor (e.g., JAK-STAT or BTK inhibitor) and a dose of a CAR-expressing cell
  • the dose of the CAR-expressing cell and the first dose of the inhibitor are administered sequentially.
  • the dose of the CAR-expressing cell is administered after administration of the first dose of the inhibitor (e.g., JAK-STAT or BTK inhibitor) but before the administration of the second dose of the inhibitor (e.g., JAK-STAT or BTK inhibitor).
  • a subsequent dose (e.g., third, fourth, or fifth dose, and so on) of the inhibitor is administered after the second dose of the inhibitor (e.g., JAK-STAT or BTK inhibitor).
  • the treatment interval is initiated upon administration of the first dose of the inhibitor (e.g., JAK-STAT or BTK inhibitor) and completed upon administration of the second, third, fourth, fifth, or sixth dose (or subsequent dose) of the inhibitor (e.g., JAK-STAT or BTK inhibitor).
  • the second dose of the inhibitor is administered at least 8 h (e.g., at least 8 h, 9 h, 10 h, 12 h, 14 h, 16 h, 18 h, 20 h, 24 h, 1 day, 1.5 days, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, or more) after administration of the first dose of the inhibitor (e.g., JAK-STAT or BTK inhibitor).
  • the first dose of the inhibitor e.g., JAK-STAT or BTK inhibitor
  • the subsequent dose (e.g., third, fourth, or fifth dose, and so on) of the inhibitor is administered at least 8 h (e.g., at least 8 h, 9 h, 10 h, 12 h, 14 h, 16 h, 18 h, 20 h, 24 h, 1 day, 1.5 days, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, or more) after the second dose of the inhibitor (e.g., JAK-STAT or BTK inhibitor).
  • the inhibitor e.g., JAK-STAT or BTK inhibitor
  • the dose of the CAR-expressing cell is administered at least 1 day (e.g., at least 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, or more) after administration of the first dose of the inhibitor (e.g., JAK-STAT or BTK inhibitor).
  • the inhibitor e.g., JAK-STAT or BTK inhibitor.
  • the second dose of the inhibitor (e.g., JAK-STAT or BTK inhibitor) is administered within 1 day (e.g., within 24 h, 20 h, 18 h, 16 h, 14 h, 12 h, 10 h, 8 h, 6 h, or less) of the administration of the dose of the CAR-expressing cell.
  • the second dose of the inhibitor (e.g., JAK-STAT or BTK inhibitor) is administered concurrently with the dose of the CAR-expressing cell.
  • the second dose of the inhibitor is administered at least 1 day (e.g., at least 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, or more) after administration of the dose of the CAR-expressing cell.
  • the treatment interval comprises continuous dosing of the inhibitor (e.g., JAK-STAT or BTK inhibitor), e.g., once a day, twice a day, three times a day, every 2 days, every 3 days, or every 4 days.
  • the dose (e.g., first dose) of the CAR- expressing cell is administered after the first dose of the inhibitor, e.g., at least 1 day after, e.g., at least 1, 2, 3, 4, 5, 6, 7 days, 1, 2, 3, 4, 5, 6 weeks, 1, 2, 3, 4, 5, 6 months or more after.
  • the dose (e.g., first dose) of the CAR-expressing cell is administered concurrently with (e.g., within 1 day (e.g., within 24 h, 20 h, 18 h, 16 h, 14 h, 12 h, 10 h, 8 h, 6 h, or less, or) the administration of the first dose of the inhibitor.
  • the inhibitor is dosed for at least 1 day after, e.g., at least 1, 2, 3, 4, 5, 6, 7 days, 1, 2, 3, 4, 5, 6 weeks, 1, 2, 3, 4, 5, 6 months or more after, the administration of the first dose of the CAR-expressing cell.
  • the dose of the CAR-expressing cell is administered before administration of the first dose of the inhibitor (e.g., JAK-STAT or BTK inhibitor).
  • the treatment interval is initiated upon administration of the CAR-expressing cell and completed upon administration of the second dose (or subsequent dose) of the inhibitor (e.g., JAK-STAT or BTK inhibitor).
  • the second dose of the inhibitor is administered at least 8 h (e.g., at least 8 h, 9 h, 10 h, 12 h, 14 h, 16 h, 18 h, 20 h, 24 h, 1 day, 1.5 days, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, or more) after administration of the first dose of the inhibitor (e.g., JAK-STAT or BTK inhibitor).
  • the first dose of the inhibitor e.g., JAK-STAT or BTK inhibitor
  • the subsequent dose (e.g., third, fourth, or fifth dose, and so on) of the inhibitor is administered at least 8 h (e.g., at least 8 h, 9 h, 10 h, 12 h, 14 h, 16 h, 18 h, 20 h, 24 h, 1 day, 1.5 days, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, or more) after the second dose of the inhibitor (e.g., JAK-STAT or BTK inhibitor).
  • the inhibitor e.g., JAK-STAT or BTK inhibitor
  • the first dose of the inhibitor is administered at least 1 day (e.g., at least 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, or more) after administration of the CAR-expressing cell.
  • the dose of inhibitor e.g., JAK-STAT or BTK inhibitor
  • QD once a day
  • BID twice a day
  • 10 days 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, or more.
  • any of the treatment intervals described herein can be repeated one or more times, e.g., 1, 2, 3, 4, or 5 more times.
  • the treatment interval is repeated once, resulting in a treatment regimen comprising two treatment intervals.
  • the repeated treatment interval is administered at least 1 day, e.g., 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, or 2 weeks, or more after the completion of the first or previous treatment interval.
  • the repeated treatment interval is administered at least 3 days after the completion of the first or previous treatment interval.
  • any of the treatment intervals described herein can be followed by one or more, e.g., 1, 2, 3, 4, or 5, subsequent treatment intervals.
  • the one or more subsequent treatment interval is different from the first or previous treatment interval.
  • a first treatment interval consisting of a single dose of an inhibitor (e.g., JAK-STAT or BTK inhibitor) and a single dose of a CAR-expressing cell
  • a second treatment interval consisting of multiple doses (e.g., two, three, four, or more doses) of an inhibitor (e.g., JAK- STAT or BTK inhibitor) and a single dose of a CAR-expressing cell.
  • the one or more subsequent treatment intervals is administered at least 1 day, e.g., 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, or 2 weeks, after the completion of the first or previous treatment interval.
  • one or more subsequent doses e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, more doses, of the inhibitor (e.g., JAK-STAT or BTK inhibitor) is administered after the completion of one or more treatment intervals.
  • one or more subsequent doses e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, more doses, of the inhibitor (e.g., JAK-STAT or BTK inhibitor) is administered after the completion of one treatment interval and before the initiation of another treatment interval.
  • a dose of the inhibitor is administered every 8 h, 10 h, 12 h, 14 h, 16 h, 20 h, 24 h, 1 day, 1.5 days, 2 days 3 days, 4 days, 5 days, 7 days, 2 weeks, 3 weeks, or 4 weeks after the completion of one or more, or each, treatment intervals.
  • one, two, or three doses of the inhibitor is administered each day after the completion of one or more, or each, treatment intervals.
  • one or more, e.g., 1, 2, 3, 4, 5, or more, subsequent doses of the CAR-expressing cell are administered after the completion of one or more treatment intervals.
  • one or more subsequent doses, e.g., 1, 2, 3, 4, or 5, or more doses, of the CAR-expressing cell is administered after the completion of one treatment interval and before the initiation of another treatment interval.
  • a dose of the CAR-expressing cell is administered every 2 days, 3 days, 4 days, 5 days, 7 days, 2 weeks, 3 weeks, or 4 weeks after the completion of one or more, or each, treatment intervals.
  • the treatment interval comprises a single dose of a CAR-expressing cell (e.g., a CD123 CAR-expressing cell or CD19 CAR-expressing cell) that is administered concurrently with (e.g., within 2 days (e.g., within 2 days, 1 day, 24 hours, 12 hours, 6 hours, 4 hours, 2 hours, or less, of) a first dose of an inhibitor (e.g., JAK-STAT inhibitor, e.g., ruxolitinib; or BTK inhibitor, e.g., ibrutinib).
  • a CAR-expressing cell e.g., a CD123 CAR-expressing cell or CD19 CAR-expressing cell
  • an inhibitor e.g., JAK-STAT inhibitor, e.g., ruxolitinib; or BTK inhibitor, e.g., ibrutinib.
  • the JAK-STAT inhibitor e.g., ruxolitinib
  • the BTK inhibitor e.g., ibrutinib
  • the JAK-STAT inhibitor e.g., ruxolitinib
  • the BTK inhibitor e.g., ibrutinib
  • QD once a day
  • the treatment interval comprises a single dose of a CAR- expressing cell (e.g., a CD123 CAR-expressing cell or CD19 CAR-expressing cell) that is administered after (e.g., 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 1 week, 2 weeks, 3 weeks, 4 weeks, or more after) administration of a first dose of an inhibitor (e.g., JAK-STAT inhibitor, e.g., ruxolitinib; or BTK inhibitor, e.g., ibrutinib).
  • an inhibitor e.g., JAK-STAT inhibitor, e.g., ruxolitinib; or BTK inhibitor, e.g., ibrutinib.
  • a second dose of the inhibitor is administered after administration of the first dose of the inhibitor (e.g., JAK-STAT inhibitor, e.g., ruxolitinib; or BTK inhibitor, e.g., ibrutinib).
  • a subsequent dose of the inhibitor e.g., JAK-STAT inhibitor, e.g., ruxolitinib; or BTK inhibitor, e.g., ibrutinib
  • a subsequent dose of the inhibitor is administered.
  • the doses of the inhibitor are administered twice a day (BID).
  • the doses of the inhibitor are administered once a day (QD).
  • the treatment interval comprises at least 5 (e.g., at least 5, 6, 7, 8, 9, 10, 12, 14, 16, 18, 20, or more) doses of the inhibitor (e.g., JAK-STAT inhibitor, e.g., ruxolitinib; or BTK inhibitor, e.g., ibrutinib).
  • the treatment interval comprises continuous dosing of the inhibitor (e.g., QD or BID).
  • the treatment interval is for a duration of 1-7 days, 1-5 weeks, or 1-12 months.
  • the subject is administered a single dose of a CAR-expressing cell and a single dose of an inhibitor (e.g., JAK-STAT inhibitor, e.g., ruxolitinib; or BTK inhibitor, e.g., ibrutinib).
  • an inhibitor e.g., JAK-STAT inhibitor, e.g., ruxolitinib; or BTK inhibitor, e.g., ibrutinib.
  • the single dose of the CAR- expressing cell is administered at least 1 day, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 14, 20, 25, 30, 35, 40 days, or 2 weeks, 3 weeks, 4 weeks, or more, after administration of the single dose of the inhibitor (e.g., JAK-STAT inhibitor, e.g., ruxolitinib; or BTK inhibitor, e.g., ibrutinib).
  • the inhibitor e.g., JAK-STAT inhibitor, e.g., ruxolitinib; or BTK inhibitor, e.g., ibrutinib.
  • one or more, e.g., 1, 2, 3, 4, or 5, subsequent doses of a CAR- expressing cell are administered to the subject after the initial dose of the CAR-expressing cell.
  • the one or more subsequent doses of the CAR-expressing cell are administered at least 2 days, e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 14, 20, 25, 30, 35, 40 days, or 2 weeks, 3 weeks, 4 weeks, or more, after the previous dose of the CAR-expressing cell.
  • the one or more subsequent doses of the CAR-expressing cell are administered at least 5 days after the previous dose of the CAR-expressing cell.
  • the subject is administered three doses of the CAR-expressing cell per week or one dose every 2 days.
  • one or more, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more, subsequent doses of the inhibitor are administered after administration of the single dose of the inhibitor (e.g., JAK- STAT inhibitor, e.g., ruxolitinib; or BTK inhibitor, e.g., ibrutinib).
  • the inhibitor e.g., JAK-STAT inhibitor, e.g., ruxolitinib; or BTK inhibitor, e.g., ibrutinib
  • the one or more subsequent doses of the inhibitor are administered at least 5 days, 7 days, 10 days, 14 days, 20 days, 25 days, 30 days, 2 weeks, 3 weeks, 4 weeks, or 5 weeks, after the previous dose of inhibitor (e.g., JAK-STAT inhibitor, e.g., ruxolitinib; or BTK inhibitor, e.g., ibrutinib).
  • the previous dose of inhibitor e.g., JAK-STAT inhibitor, e.g., ruxolitinib; or BTK inhibitor, e.g., ibrutinib.
  • the one or more subsequent doses of the inhibitor are administered every other day, once a day, or twice a day, after the previous dose of inhibitor (e.g., JAK-STAT inhibitor, e.g., ruxolitinib; or BTK inhibitor, e.g., ibrutinib).
  • the one or more subsequent doses of the inhibitor are administered at least 1, 2, 3, 4, 5, 6, or 7 days, after a dose of the CAR-expressing cell, e.g., the initial dose of the CAR- expressing cell.
  • the inhibitor e.g., JAK-STAT inhibitor, e.g., ruxolitinib; or BTK inhibitor, e.g., ibrutinib
  • a dose of the CAR-expressing cell e.g., the initial dose of the CAR- expressing cell.
  • one or more, e.g., 1, 2, 3, 4, or 5 doses of the inhibitor e.g., JAK- STAT inhibitor, e.g., ruxolitinib; or BTK inhibitor, e.g., ibrutinib
  • doses of the inhibitor e.g., JAK- STAT inhibitor, e.g., ruxolitinib; or BTK inhibitor, e.g., ibrutinib
  • the inhibitor e.g., JAK- STAT inhibitor, e.g., ruxolitinib; or BTK inhibitor, e.g., ibrutinib
  • the administration of the one or more doses of the CAR-expressing cell and the one or more doses of inhibitor is repeated, e.g., 1, 2, 3, 4, or 5 more times.
  • inhibitor e.g., JAK-STAT inhibitor, e.g., ruxolitinib; or BTK inhibitor, e.g., ibrutinib
  • Dosages and therapeutic regimens of the therapeutic agents disclosed herein can be determined by a skilled artisan.
  • a dose of CAR-expressing cells comprises at least about 1 x 10 5 , 5 x 10 6 , 1 x 10 7 , 1.5 x 10 7 , 2 x 10 7 , 2.5 x 10 7 , 3 x 10 7 , 3.5 x 10 7 , 4 x 10 7 , 5 x 10 7 , 1 x 10 8 , 1.5 x 10 8 , 2 x 10 8 , 2.5 x 10 8 , 3 x 10 8 , 3.5 x 10 8 , 4 x 10 8 , 5 x 10 8 , 1 x 10 9 , 2 x 10 9 , or 5 x 10 9 cells.
  • a dose of CAR- expressing cells comprises at least about 1-5 x 10 7 to 1-5 x 108. In some embodiments, the subject is administered about 1-5 x 10 CAR-expressing cells. In other embodiments, the subject is administered about 1-5 x 10 CAR-expressing cells.
  • the CAR-expressing cell is administered at a dose (e.g., total dose) of 1.5 x 10 7 to 5 x 10 9 cells per kg (e.g., 0.3 x 10 6 to 1 x 10 s cells per kg).
  • the total dose does not exceed 1.5 x 10 10 cells/kg, e.g., administered over time in multiple doses, e.g., does not exceed 1.5 x 10 9 cells/kg, e.g., does not exceed 1.5 x 108 cells/kg.
  • up to 10, 9, 8, 7, 6, 5, 4, 3, or 2 doses of cells are administered.
  • one, two, three, four, five or 6 doses of the cells are administered to the mammal, e.g., in a treatment interval of one, two, three, four or more weeks.
  • up to 6 doses are administered in two weeks. The doses may the same or different.
  • a lower dose is administered initially, followed by one or more higher doses.
  • the lower dose is about lxlO 5 to lxlO 9 cells/kg, or lxlO 6 to lxlO 8 cells/kg; and the higher dose is about 2xl0 5 to 2xl0 9 cells/kg or 2xl0 6 to 2xl0 8 cells/kg, followed by 3-6 doses of about 4xl0 5 to 4xl0 9 cells/kg, or 4xl0 6 to 4xl0 8 cells/kg.
  • the CAR-expressing cells are administered to the subject according to a dosing regimen comprising a total dose of cells administered to the subject by dose fractionation, e.g., one, two, three or more separate administration of a partial dose.
  • a first percentage of the total dose is administered on a first day of treatment
  • a second percentage of the total dose is administered on a subsequent (e.g., second, third, fourth, fifth, sixth, or seventh or later) day of treatment
  • a third percentage e.g., the remaining percentage
  • the total dose is administered on a yet subsequent (e.g., third, fourth, fifth, sixth, seventh, eighth, ninth, tenth, or later) day of treatment.
  • a total cell dose includes 1 to 5 x 10 7 or 1 to 5 x 108 CAR-expressing cells.
  • the total dose is administered over multiple doses (e.g., a first dose, a second dose, and optionally a third dose, and so on).
  • the first dose comprises about 10% of the total dose (e.g., about 1 x 10 cells/kg), e.g., administered on a first day.
  • the second dose comprises about 30% of the total dose (e.g., about 3 x 10 cells/kg), e.g., administered on a subsequent days (e.g., 1, 2, 3, 4, 5, 6, or 7 days after the first dose).
  • the second dose is administered if the subject is clinically stable after the first dose.
  • a subsequent dose e.g., third, optionally fourth, etc. dose
  • is administered to the subject e.g., where the sum of the first dose, second dose, and subsequent dose add up to the total dose.
  • the time between each dose is at least 1 day (e.g., at least 1, 2, 3, 4, 5, 6, 7 days, 1, 2, or 3 weeks, or more). In embodiments, the time between the second dose and the third dose, and/or between the third dose and the fourth dose, and/or between the fourth dose and the fifth dose, is at least 1 week (e.g., at least 1, 2, 3, 4 weeks, or more).
  • the dose of the inhibitor e.g. , JAK-STAT inhibitor or BTK inhibitor
  • the dose of the inhibitor is administered every 1, 2, 3, 4, 5, 6, or 7 days, or twice a day, or three times a day.
  • a JAK-STAT inhibitor e.g., ruxolitinib
  • a dose of 2.5 mg to 50 mg e.g., 2.5-5 mg, 5- 10 mg, 10- 15 mg, 15-20 mg, 20-25 mg, 25-30 mg, 30-35 mg, 35-40 mg, 40-45 mg, or 45-50 mg
  • twice daily e.g., 5 mg to 100 mg total per day.
  • a BTK inhibitor e.g., ibrutinib (PCI-32765)
  • PCI-32765 is administered (e.g., orally) at a dose of about 250 mg, 300 mg, 350 mg, 400 mg, 420 mg, 440 mg, 460 mg, 480 mg, 500 mg, 520 mg, 540 mg, 560 mg, 580 mg, 600 mg (e.g., 250 mg, 420 mg or 560 mg) daily for a period of time, e.g., daily for 21 day cycle, or daily for 28 day cycle.
  • 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 or more cycles of the BTK inhibitor, e.g., ibrutinib are administered.
  • the method comprises administering the inhibitor (e.g., BTK inhibitor, e.g., ibrutinib; or JAK-STAT inhibitor, e.g., ruxolitinib) to the subject, reducing the amount (e.g., ceasing administration) of the inhibitor, and subsequently administering the CAR-expressing cell (e.g., a CAR19- or CAR123- expressing cell) to the subject.
  • the inhibitor e.g., BTK inhibitor, e.g., ibrutinib; or JAK-STAT inhibitor, e.g., ruxolitinib
  • the CAR-expressing cell e.g., a CAR19- or CAR123- expressing cell
  • the method comprises administering the inhibitor (e.g., BTK inhibitor, e.g., ibrutinib; or JAK-STAT inhibitor, e.g., ruxolitinib) to the subject and
  • the inhibitor e.g., BTK inhibitor, e.g., ibrutinib; or JAK-STAT inhibitor, e.g., ruxolitinib
  • a combination of the inhibitor and the CAR-expressing cell e.g., a CAR19- or CAR 123 -expressing cell
  • the method comprises administering the inhibitor (e.g., BTK inhibitor, e.g., ibrutinib, or JAK-STAT inhibitor, e.g., ruxolitinib) to the subject, reducing the amount (e.g., ceasing or discontinuing administration) of the inhibitor, and subsequently administering a combination of the CAR-expressing cell (e.g., a CAR19- or CAR123- expressing cell) and a second inhibitor (e.g., a second inhibitor other than the first inhibitor) to the subject.
  • the inhibitor e.g., BTK inhibitor, e.g., ibrutinib, or JAK-STAT inhibitor, e.g., ruxolitinib
  • a combination of the CAR-expressing cell e.g., a CAR19- or CAR123- expressing cell
  • a second inhibitor e.g., a second inhibitor other than the first inhibitor
  • the first inhibitor is a BTK inhibitor and the second inhibitor is a BTK inhibitor other than the first BTK inhibitor, e.g., other than ibrutinib.
  • the first inhibitor is a JAK-STAT inhibitor and the second inhibitor is a JAK-STAT inhibitor other than the first JAK-STAT inhibitor, e.g., other than ruxolitinib.
  • the first inhibitor is a JAK-STAT inhibitor and the second inhibitor is a BTK inhibitor.
  • the first inhibitor is a BTK inhibitor and the second inhibitor is a JAK-STAT inhibitor.
  • the second BTK inhibitor is chosen from one or more of GDC-0834, RN-486, CGI-560, CGI- 1764, HM-71224, CC-292, ONO- 4059, CNX-774, or LFM-A13, or a combination thereof.
  • the second JAK- STAT inhibitor is chosen from one or more of AG490, AZD1480, tofacitinib (tasocitinib or CP-690550), or CYT387.
  • the cells expressing a CAR molecule are administered at a dose and/or dosing schedule described herein.
  • any method described herein further comprises administering a therapy to prevent or treat CRS.
  • the therapy comprises an IL-6 inhibitor (e.g., an anti-IL6 receptor inhibitor, e.g., an anti-IL6 receptor inhibitor, e.g., tocilizumab).
  • the therapy comprises an IL-6 inhibitor in combination with one or more (or all) of a vasoactive medication, an immunosuppressive agent, a corticosteroid, or mechanical ventilation.
  • the method comprises administering the IL-6 inhibitor (e.g., tocilizumab) prior to (e.g., at least 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 days or 1, 2, 3, or 4 weeks prior to) administration of a dose (e.g., a first dose) of a CAR-expressing cell (e.g., CAR-expressing cell described herein).
  • a dose e.g., a first dose
  • the method comprises administering the IL-6 inhibitor (e.g., tocilizumab) concurrently with administration of a dose (e.g., a first dose) of a CAR- expressing cell (e.g., CAR-expressing cell described herein).
  • the method comprises administering the IL-6 inhibitor (e.g., tocilizumab) after the administration of a dose (e.g., a first dose) of a CAR-expressing cell (e.g., CAR-expressing cell described herein), e.g., but prior to or within 1 week (e.g., within 1 week, 7, 6, 5, 4, 3, 2, 1 day or less) of a first sign of a fever in the subject.
  • a dose e.g., a first dose
  • a CAR-expressing cell e.g., CAR-expressing cell described herein
  • the method comprises administering the IL-6 inhibitor (e.g., tocilizumab) after the administration of a dose (e.g., a first dose) of a CAR-expressing cell (e.g., CAR-expressing cell described herein), and within 1 week (e.g., within 1 week, 7, 6, 5, 4, 3, 2, 1 day or less) of the development of a temperature of at least 38°C (e.g., at least 38.5 °C) in the subject, e.g., for two successive measurements in 24 hours (e.g., at least 4 hours apart).
  • the subject has (e.g., is diagnosed with or identified as having) a high tumor burden prior to treatment with the CAR-expressing cell.
  • a high tumor burden comprises at least 40% blasts (e.g., at least 40%, 45%, 50%, 60%, 70%, 80%, 90%, 95%, or more, blasts) in bone marrow of the subject prior to administration of the CAR- expressing cell (e.g., about 1-5 days prior to administration of the CAR-expressing cell).
  • blasts e.g., at least 40%, 45%, 50%, 60%, 70%, 80%, 90%, 95%, or more, blasts
  • the method comprises administering a dose of tocilizumab of about 5-15 mg/kg, e.g., 8-12 mg/kg (e.g., about 8 mg/kg, about 9 mg/kg, about 10 mg/kg, about 11 mg/kg, or about 12 mg/kg).
  • the CAR molecule is introduced into T cells, e.g., using in vitro transcription, and the subject (e.g., human) receives an initial administration of cells comprising a CAR molecule, and one or more subsequent administrations of cells comprising a CAR molecule, wherein the one or more subsequent administrations are administered less than 15 days, e.g., 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, or 2 days after the previous administration.
  • more than one administration of cells comprising a CAR molecule are administered to the subject (e.g., human) per week, e.g., 2, 3, or 4 administrations of cells comprising a CAR molecule are administered per week.
  • the subject receives more than one administration of cells comprising a CAR molecule per week (e.g., 2, 3 or 4 administrations per week) (also referred to herein as a cycle), followed by a week of no administration of cells comprising a CAR molecule, and then one or more additional administration of cells comprising a CAR molecule (e.g., more than one
  • the administration of the cells comprising a CAR molecule per week is administered to the subject.
  • the subject e.g., human subject
  • the cells comprising a CAR molecule are administered every other day for 3 administrations per week.
  • the cells comprising a CAR molecule are administered for at least two, three, four, five, six, seven, eight or more weeks.
  • the combination of the kinase inhibitor and the cells expressing a CAR molecule are administered as a first line treatment for the disease, e.g., the cancer, e.g., the cancer described herein.
  • the combination of the kinase inhibitor and the cells expressing a CAR molecule, e.g., a CAR molecule described herein are administered as a second, third, fourth line treatment for the disease, e.g., the cancer, e.g., the cancer described herein.
  • any of the methods described herein further comprise performing lymphodepletion on a subject, e.g., prior to administering the one or more cells that express a CAR molecule described herein, e.g., a CAR molecule that binds CD19 or CD123.
  • the lymphodepletion can comprise, e.g., administering one or more of melphalan, Cytoxan, cyclophosphamide, and fludarabine.
  • the subject is (e.g., is identified as) at risk of developing, has, or is diagnosed with CRS.
  • the subject has been, is being, or will be administered a CAR therapy, e.g., a CAR therapy described herein.
  • a CAR therapy e.g., a CAR therapy described herein.
  • the subject has been, is being, or will be administered a CAR 123 -expressing cell or a CAR19-expressing cell.
  • the method comprises identifying (and optionally selecting) a subject i) at risk of developing CRS; or ii) having CRS.
  • the method comprises selecting the subject for administration of the inhibitor (e.g., JAK-STAT inhibitor or BTK inhibitor).
  • the subject is selected based on (i) his or her risk of developing CRS, (ii) his or her diagnosis of CRS, and/or (iii) whether he or she has been, is being, or will be administered a CAR therapy (e.g., a CAR therapy described herein, e.g., CAR19 therapy, e.g., CTL019; or a CD123 CAR therapy).
  • a CAR therapy e.g., a CAR therapy described herein, e.g., CAR19 therapy, e.g., CTL019; or a CD123 CAR therapy.
  • the subject is selected for administration of the JAK-STAT or BTK inhibitor if the subject is diagnosed with CRS, e.g., severe or non-severe CRS. In embodiments, the subject is selected for administration of the JAK-STAT or BTK inhibitor if the subject is at risk of (e.g., identified as at risk of) developing CRS. In embodiments, the subject is selected for administration of the JAK-STAT or BTK inhibitor if the subject has been, is being, or will be administered a CAR therapy (e.g., a CAR therapy described herein, e.g., CAR19 therapy, e.g., CTL019; or a CAR123 therapy).
  • a CAR therapy e.g., a CAR therapy described herein, e.g., CAR19 therapy, e.g., CTL019; or a CAR123 therapy.
  • the subject is identified as at risk for CRS if the subject has a high tumor burden, e.g., prior to administration of a CAR therapy (e.g., a CAR therapy described herein).
  • a CAR therapy e.g., a CAR therapy described herein.
  • the subject is identified as at risk for CRS by acquiring a CRS risk status for the subject, wherein said CRS risk status comprises a measure of one, two, three, four, five, six, seven, eight, nine, ten, or more (all) of the following:
  • sgpl30 or IFN-gamma or a combination thereof in the subject, e.g., in a sample (e.g., a blood sample), e.g., wherein the subject is an adult or pediatric subject;
  • sgpl30 the level or activity of sgpl30, IFN-gamma, or ILlRa, or a combination thereof (e.g., a combination of any two or all three of sgpl30, IFN-gamma, and ILlRa), in the subject, e.g., a sample (e.g., a blood sample), e.g., wherein the subject is an adult or pediatric subject;
  • sgpl30 the level or activity of sgpl30, IFN-gamma, or MIP1 -alpha, or a combination thereof (e.g., a combination of any two or all three of sgpl30, IFN-gamma, and MIPl- alpha), in the subject, e.g., in a sample (e.g., a blood sample), e.g., wherein the subject is a pediatric subject,
  • sgpl30, MCP1, or eotaxin the level or activity of sgpl30, MCP1, or eotaxin, or a combination thereof (e.g., a combination of any two or all three of sgpl30, MCP1, or eotaxin), in the subject, e.g., in a sample (e.g., a blood sample), e.g., wherein the subject is an adult or a pediatric subject;
  • the level or activity of IL-2, eotaxin, or sgpl30, or a combination thereof e.g., a combination of any two or all three of IL-2, eotaxin, or sgpl30
  • a sample e.g., a blood sample
  • the subject is an adult or a pediatric subject
  • the level or activity of IFN-gamma, IL-2, or eotaxin, or a combination thereof e.g., a combination of any two or all three of IFN-gamma, IL-2, or eotaxin
  • a sample e.g., a blood sample
  • the subject is a pediatric subject;
  • x the level or activity of IFN-gamma, IL-13, or MIPl -alpha, or a combination thereof (e.g., a combination of any two or all three of IFN-gamma, IL-13, and MIPl -alpha), in a sample (e.g., a blood sample), e.g., wherein the subject is a pediatric subject; or
  • xi the level or activity of IFN-gamma or MIPl -alpha, or a combination thereof, in a sample (e.g., a blood sample), e.g., wherein the subject is a pediatric subject;
  • CRS risk status is indicative of the subject's risk for developing CRS, e.g., severe CRS.
  • Any of the aforesaid methods can further comprise, responsive to a determination of the
  • CRS risk status performing one, two, or more (all) of:
  • BTK inihibitor e.g., ibrutinib
  • JAK-STAT inhibitor e.g., ruxolitinib
  • an altered dosing of the CAR-expressing cell therapy altering the schedule or time course of the CAR-expressing cell therapy; administering a therapy to treat CRS, e.g., a therapy chosen from one or more of: an IL- 6 inhibitor (e.g., an anti-IL6 receptor inhibitor, e.g., tocilizumab), a vasoactive medication, an immunosuppressive agent, a corticosteroid, or mechanical ventilation; and/or
  • CRS e.g., a standard of care for a particular cancer type.
  • the CRS risk status comprises a measure of the level or activity of sgpl30, IFN-gamma, or IL-13, or a combination thereof (e.g., a combination of any two or all three of sgpl30, IFN-gamma, and IL-13), in the subject, e.g., in a sample (e.g., a blood sample), e.g., wherein the subject is an adult or pediatric subject.
  • a sample e.g., a blood sample
  • the CRS risk status is indicative of whether the subject is at high risk or low risk of developing severe CRS.
  • the CRS can be of clinical grade 1-3, or can be severe CRS of clinical grade 4-5.
  • the methods are performed on a subject that does not have a symptom (e.g., a clinical symptom) of CRS, e.g., one or more of low blood pressure or a fever; or severe CRS, e.g., one or more of grade 4 organ toxicity or need for mechanical ventilation.
  • a symptom e.g., a clinical symptom
  • CRS CRS
  • severe CRS e.g., one or more of grade 4 organ toxicity or need for mechanical ventilation.
  • a high level or activity of IFN-gamma, sgpl30, MCP1, IL-10, or disease burden, or any combination thereof is indicative of a high risk of severe CRS.
  • a low level or activity of IL13, ILlRa, MlPla, or eoxtaxin, or any combination thereof is indicative of a high risk of severe CRS.
  • a subject at high risk of severe CRS has, or is identified as having, a greater level or activity of sgpl30 or IFN-gamma or a combination thereof (e.g., in a sample, e.g., a blood sample), e.g., relative to a reference.
  • a subject at high risk of severe CRS has, or is identified as having a greater level or activity of sgpl30, a greater level or activity of IFN- gamma, or a lower level or activity of ILlRa, or a combination thereof (e.g., in a sample, e.g., a blood sample), e.g., relative to a reference.
  • the subject at high risk of severe CRS is identified as having a greater level or activity of sgpl30 and a greater level or activity of IFN-gamma; a greater level or activity of sgpl30 and a lower level or activity of ILlRa; a greater level or activity of IFN-gamma and a lower level or activity of ILlRa; or a greater level or activity of sg l30, a greater level or activity of IFN-gamma, and a lower level or activity of ILIRa, e.g., compared to a reference.
  • the reference is a subject at low risk of severe CRS or a control level or activity.
  • the subject can be a human, e.g., an adult or pediatric subject.
  • a subject at high risk of severe CRS has, or is identified as having, a greater level or activity of sgpl30 or IFN-gamma or a combination thereof, and a greater level of bone marrow disease, in the subject (e.g., in a sample, e.g., a blood sample), e.g., relative to a reference, e.g., compared to a subject at low risk of severe CRS or compared to a control level or activity.
  • the subject at high risk of severe CRS is identified as having a greater level of sgpl30 and IFN-gamma; sgpl30 and bone marrow disease; IFN-gamma and bone marrow disease; or sgpl30, IFN-gamma and bone marrow disease, e.g., compared to a reference, e.g., a subject at low risk of severe CRS or a control level or activity.
  • the subject can be a human, e.g., a pediatric subject.
  • a subject at high risk of severe CRS is identified as having a greater level or activity of sgpl30, a greater level or activity of IFN-gamma, or a lower level or activity of MIP1 -alpha, or a combination thereof (e.g., in a sample, e.g., a blood sample) compared to a reference, e.g., a subject at low risk of severe CRS or compared to a control level or activity.
  • a subject at high risk of severe CRS is identified as having a greater level or activity of sgpl30 and a greater level or activity of IFN-gamma; a greater level or activity of sgpl30 and a lower level or activity of MIP1 -alpha; a greater level or activity of IFN-gamma and a lower level or activity of MIPl -alpha; a greater level or activity of sgpl30, a greater level or activity of IFN-gamma, and a lower level or activity of MlPl-alpha, e.g., compared to a reference, e.g., a subject at low risk of severe CRS or compared to a control level or activity.
  • a subject at high risk of severe CRS is identified as having a greater level or activity of sgpl30, a greater level or activity of MCPl, or a lower level or activity of eotaxin, or a combination thereof (e.g., in a sample, e.g., a blood sample) compared to a reference, e.g., a subject at low risk of severe CRS or compared to a control level or activity.
  • a subject at high risk of severe CRS is identified as having: a greater level or activity of sgpl30 and a greater level or activity of MCPl, a greater level or activity of sgpl30 and a lower level or activity of eotaxin, a greater level or activity of MCPl and a lower level or activity of eotaxin, a greater level or activity of sg l30, a greater level or activity of MCP1, and a lower level or activity of eotaxin, compared to a reference, e.g., a subject at low risk of severe CRS or compared to a control level or activity.
  • a subject at high risk of severe CRS is identified as having an altered (e.g., greater) level or activity of IL-2, a lower level or activity of eotaxin, or a greater level or activity of sgpl30, or a combination thereof (e.g., in a sample, e.g., a blood sample) compared to a reference, e.g., a subject at low risk of severe CRS or compared to a control level or activity.
  • a subject at high risk of severe CRS is identified as having: an altered (e.g., greater) level or activity of IL-2 and a lower level or activity of eotaxin, an altered (e.g., greater) level or activity of IL-2 and a greater level or activity of sgpl30, a lower level or activity of eotaxin and a greater level or activity of sgpl30, an altered (e.g., greater) level or activity of IL-2, a lower level or activity of eotaxin, and a greater level or activity of sgpl30, compared to a reference, e.g., a subject at low risk of severe CRS or compared to a control level or activity.
  • a reference e.g., a subject at low risk of severe CRS or compared to a control level or activity.
  • a subject at high risk of severe CRS is identified as having a greater level or activity of IFN-gamma, an altered (e.g., greater) level or activity of IL-2, or a lower level or activity of eotaxin, or a combination thereof (e.g., in a sample, e.g., a blood sample) compared to a reference, e.g., a subject at low risk of severe CRS or compared to a control level or activity.
  • the subject is a pediatric subject.
  • a subject at high risk of severe CRS is identified as having: a greater level or activity of IFN-gamma and an altered (e.g., greater) level or activity of IL-2, a greater level or activity of IFN-gamma and a lower level or activity of eotaxin, an altered (e.g., greater) level or activity of IL-2 and a lower level or activity of eotaxin, a greater level or activity of IFN- gamma, an altered (e.g., greater) level or activity of IL-2, and a lower level or activity of eotaxin, compared to a reference, e.g., a subject at low risk of severe CRS or compared to a control level or activity.
  • a reference e.g., a subject at low risk of severe CRS or compared to a control level or activity.
  • a subject at high risk of severe CRS is identified as having a greater level or activity of IL-10 or a greater level of disease burden, or a combination thereof (e.g., in a sample, e.g., a blood sample) compared to a reference, e.g., a subject at low risk of severe CRS or compared to a control level or activity.
  • the subject is a pediatric subject.
  • a subject at high risk of severe CRS is identified as having a greater level or activity of IFN-gamma or a lower level of IL-13, or a combination thereof (e.g., in a sample, e.g., a blood sample) compared to a reference, e.g., a subject at low risk of severe CRS or compared to a control level or activity.
  • the subject is a pediatric subject.
  • a subject at high risk of severe CRS is identified as having a greater level or activity of IFN-gamma, a lower level or activity of IL-13, a lower level or activity of MIP1 -alpha, or a combination thereof (e.g., in a sample, e.g., a blood sample) compared to a reference, e.g., a subject at low risk of severe CRS or compared to a control level or activity.
  • the subject is a pediatric subject.
  • a subject at high risk of severe CRS is identified as having: a greater level or activity of IFN-gamma or a lower level or activity of IL-13, a greater level or activity of IFN- gamma or a lower level or activity of MIPl -alpha, a lower level or activity of IL-13 or a lower level or activity of MIPl -alpha, a greater level or activity of IFN-gamma, a lower level or activity of IL-13, and a lower level or activity of MlPl-alpha, compared to a reference, e.g., a subject at low risk of severe CRS or compared to a control level or activity.
  • a subject at high risk of severe CRS is identified as having a greater level or activity of IFN-gamma or a lower level or activity of MIPl -alpha, or a combination thereof (e.g., in a sample, e.g., a blood sample) compared to a reference, e.g., a subject at low risk of severe CRS or compared to a control level or activity.
  • the subject is a pediatric subject.
  • a greater level or activity of IL2 indicates that a subject is at high risk of severe CRS.
  • a greater level or activity of IL2 indicates that a subject is at low risk of severe CRS.
  • a greater level of a marker described herein is a level greater than or equal to 1, 2, 5, 10, 20, 50, 100, 200, 500, 1000, 2000, 5000, 10,000, 20,000, 50,000, 100,000, 200,000, or 500,000 pg/ml.
  • a greater level of sgpl30 is greater than or equal to 150,000, 200,000, 210,000, 215,000, 218,000, 218,179,
  • a greater level of IFN- gamma is greater than or equal to 6, 7, 8, 9, 10, 10.4272, 10.5, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 27.6732, 28, 29, 30, 31, 32, 33, 34, 35, 40, 50, 60, 70, 75, 80, 85, 90, 91, 92, 93, 94, 94.8873, 95, 96, 97, 98, 99, 100, 105, 110, 115, or 120 pg/ml.
  • a greater level of IL-10 is greater than or equal to 5, 6, 7, 8, 9, 10, 11, 11.7457, 12, 13, 14, 15, 16, 17, 18, 19, or 20 pg/ml.
  • a greater tumor burden is greater than or equal to 25, 30, 35, 40, 45, 50, 51.9, 55, 60, 65, 70, or 75%.
  • a lower level of sgpl30, IFN-gamma, IL-10, or tumor burden is a level less than or equal to any of the values in this paragraph.
  • a lower level of a marker described herein is a level greater than or equal to 1, 2, 5, 10, 20, 50, 100, 200, 500, 1000, 2000, 5000, 10,000,
  • a lower level of ILIRa is less than or equal to 550, 575, 600, 625, 650, 657.987, 675, 700, 720, or 750 pg/ml.
  • a lower level of MCP1 is less than or equal to 3500, 4000, 4100, 4200, 4300, 4400, 4500, 4600, 4636.52, 4700, 4800, 4900, 5000, or 5500 pg/ml.
  • a lower level of eotaxin is less than or equal to 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 29.0902, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, or 40 pg/ml.
  • a lower level of MlPla is less than or equal to 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 30.1591, 31, 32, 33, 34, 35, 36, 37, 38, 39, or 40 pg/ml.
  • a greater level of ILIRa, MCP1, eotaxin, or MlPla is a level greater than or equal to any of the values in this paragraph.
  • the sensitivity is at least 0.75, 0.79, 0.80, 0.82,
  • the specificity is at least 0.75, 0.77, 0.80, 0.85, 0.86, 0.89, 0.90, 0.92, 0.94, 0.95, 0.96, 0.97, 0.98, 0.99, or 1.0.
  • the PPV is at least 0.62, 0.65, 0.70, 0.71, 0.75, 0.80, 0.82, 0.83, 0.85, 0.90, 0.91, 0.92, 0.95, 0.96, 0.97, 0.98, 0.99, or 1.0.
  • the NPV is at least 0.80, 0.85, 0.90, 0.92, 0.94, 0.95, 0.96, 0.97, 0.98, 0.99, or 1.0.
  • a measure of eotaxin comprises a measure of one or more of (e.g., two or all of) eotaxin-1, eotaxin-2, and eotaxin-3. In some embodiments, a measure of eotaxin comprises a measure of eotaxin-1 and eotaxin-2, eotaxin-1 and eotaxin-3, or eotaxin-2 and eotaxin-3.
  • any of the methods disclosed herein can further include the step of acquiring a measure of the level or activity of one, two, three, four, five, ten, twenty or more of a cytokine chosen from sTNFR2, IP10, SIL1R2, sTNFRl, M1G, VEGF, sILRl, TNFa, IFNa, GCSF, sRAGE, IL4, IL10, IL1R1, IFN- ⁇ , IL6, IL8, sIL2Ra, sgpl30, sIL6R, MCP1, ⁇ , ⁇ , or GM- CSF, or a combination thereof, in the subject, e.g., in a sample (e.g., a blood sample) from the subject.
  • a sample e.g., a blood sample
  • a subject having, or at high risk of having, severe CRS has, or is identified as having, a greater level or activity of one or more (e.g., two, three, four, five, ten, fifteen, twenty, or all) of a cytokine chosen from sTNFR2, IP10, SIL1R2, sTNFRl, M1G, VEGF, sILRl, TNFa, IFNa, GCSF, sRAGE, IL4, IL10, IL1R1, IFN- ⁇ , IL6, IL8, sIL2Ra, sgpl30, sIL6R, MCP1, ⁇ , ⁇ , or GM-CSF or a combination thereof, compared to a reference, e.g., a subject at low risk of severe CRS or compared to a control level or activity.
  • a cytokine chosen from sTNFR2, IP10, SIL1R2, sTNFRl, M1G, VEGF, sIL
  • Any of the methods disclosed herein can further include the step of acquiring a measure of the level or activity of one, two, three, four, five, six, seven, eight, or all of a cytokine chosen from IFN- ⁇ , IL10, IL6, IL8, IP10, MCP1, M1G, sIL2Ra, GM-CSF, or TNFa, or or a combination thereof, in the subject, e.g., in a sample (e.g., a blood sample) from the subject.
  • a sample e.g., a blood sample
  • a subject having, or at high risk of having, severe CRS has, or is identified as having, a greater level or activity of one or more (e.g., two, three, four, five, six, seven, eight, or all) of a cytokine chosen from IFN- ⁇ , IL10, IL6, IL8, IP10, MCP1, M1G, sIL2Ra, GM-CSF, or TNFa or a combination thereof, compared to a reference, e.g., a subject at low risk of severe CRS or compared to a control level or activity.
  • a cytokine chosen from IFN- ⁇ , IL10, IL6, IL8, IP10, MCP1, M1G, sIL2Ra, GM-CSF, or TNFa or a combination thereof.
  • Any of the methods disclosed herein can further include the step of acquiring a measure of the level or activity of one, two, three, four, five, six, or all of a cytokine chosen from IFN- ⁇ , IL10, IL6, IL8, IP10, MCP1, M1G, or sIL2Ra, or or a combination thereof, in the subject, e.g., in a sample (e.g., a blood sample) from the subject.
  • a sample e.g., a blood sample
  • a subject having, or at high risk of having, severe CRS has, or is identified as having, a greater level or activity of one or more (e.g., two, three, four, five, six, or all) of a cytokine chosen from IFN- ⁇ , IL10, IL6, IL8, IP10, MCP1, M1G, or sIL2Ra, or a combination thereof, compared to a reference, e.g., a subject at low risk of severe CRS or compared to a control level or activity.
  • a cytokine chosen from IFN- ⁇ , IL10, IL6, IL8, IP10, MCP1, M1G, or sIL2Ra, or a combination thereof.
  • any the methods disclosed herein can further include the step of determining the level of C-reactive protein (CRP) in a sample (e.g., a blood sample) from the subject.
  • CRP C-reactive protein
  • a subject at low risk of severe CRS has, or is identified as having, a CRP level of less than 7 mg/dL (e.g., 7, 6.8, 6, 5, 4, 3, 2, 1 mg/dL or less).
  • a subject at high risk of severe CRS has, or is identified as having, a greater level of CRP in a sample (e.g., a blood sample) compared to a subject at low risk of severe CRS or compared to a control level or activity.
  • the greater level or activity is at least 2-fold greater (e.g., at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 40, 50, 100, 500, 1000- fold or greater) compared to a subject at low risk of severe CRS or compared to a control level or activity.
  • the methods, disclosed herein further include the step of selecting or altering the therapy, e.g., the CAR-expressing cell therapy, for the subject, based on the CRS risk status acquired.
  • the therapy is altered such that it is discontinued, or a subsequent (e.g., second, third, or fourth) dose of the therapy (e.g., the CAR-expressing cells) is at a lower dose than the previous dose.
  • a subsequent (e.g., second, third, or fourth) dose of CAR-expressing cells comprises a different CAR or different cell type than the previous CAR-expressing cell therapy administered to the subject.
  • the measure of one or more of biomarkers is obtained from a sample (e.g., a blood sample) acquired from the subject.
  • a sample e.g., a blood sample
  • the subject e.g., a sample from the subject
  • the subject is evaluated while receiving the CAR-expressing cell therapy.
  • the subject e.g., a sample from the subject, is evaluating after receiving the CAR-expressing cell therapy.
  • the subject e.g., a sample from the subject, is evaluated 10 days or less (e.g., 1-10 days, 1-9 days, 1-8 days, 1-7 days, 1-6 days, 1-5 days, 1-4 days, 1-3 days, or 1-2 days, 5 days or less, 4 days or less, 3 days or less, 2 days or less, 1 day or less, e.g., 1, 3, 5, 10, 12, 15, 20 hours) after infusion with the CAR-expressing cell therapy.
  • the subject is evaluated 5 days or less, 4 days or less, 3 days or less, 2 days or less, 1 day or less (e.g., but no earlier than 1, 3, 5, 10, 12, 15, 20 hours, after infusion of the CAR-expressing therapy).
  • the measure of one or more of biomarkers comprises detection of one or more of nucleic acid (e.g., mRNA) levels or protein levels.
  • the method comprises determining whether a subject has severe CRS.
  • the method includes acquiring a CRS risk status, e.g., in response to an immune cell based therapy, e.g., a CAR-expressing cell therapy (e.g., a CAR 19-expres sing cell therapy or a CAR 123 -expressing cell therapy) for the subject, wherein said CRS risk status includes a measure of one, two, or more (all) of the following:
  • cytokines chosen from sTNFR2, IP 10, SIL1R2, sTNFRl, M1G, VEGF, sILRl, TNFa, IFNa, GCSF, sRAGE, IL4, IL10, IL1R1, IFN- ⁇ , IL6, IL8, sIL2Ra, sgpl30, sIL6R, MCPl, MlPla, ⁇ , or GM-CSF, or analytes chosen from C-reactive protein (CRP), ferritin, lactate dehydrogenase (LDH), aspartate aminotransferase (AST), or blood urea nitrogen (BUN), alanine
  • CRP C-reactive protein
  • LDH lactate dehydrogenase
  • AST aspartate aminotransferase
  • BUN blood urea nitrogen
  • ALT aminotransferase
  • Cr creatinine
  • fibrinogen or a combination thereof, in a sample (e.g., a blood sample);
  • IL6, IL6R the level or activity of IL6, IL6R, or sgpl30, or a combination thereof (e.g., a combination of any two or all three of IL6, IL6R, and sgpl30), in a sample (e.g., a blood sample); or
  • IL6, IFN-gamma, or IL2R the level or activity of IL6, IFN-gamma, or IL2R, or a combination thereof (e.g., a combination of any two or all three of IL6, IFN-gamma, and IL2R), in a sample (e.g., a blood sample);
  • an elevated level of the cytokines (i)-(iii), or all analytes except fibrinogen, is indicative of severe CRS.
  • low fibrinogen is indicative of severe CRS.
  • compositions and compositions for use are provided.
  • the disclosure features a composition (e.g., one or more dosage formulations, combinations, or one or more pharmaceutical compositions) comprising a cell expressing a CAR described herein (e.g., CD 123 CAR) and an inhibitor (e.g., JAK-STAT inhibitor, e.g., ruxolitinib) described herein.
  • a CAR described herein e.g., CD 123 CAR
  • an inhibitor e.g., JAK-STAT inhibitor, e.g., ruxolitinib
  • the CAR-expressing cell and the inhibitor can be in the same or different formulation or pharmaceutical composition.
  • the CAR-expressing cell and the one or more kinase inhibitors can be present in a single dose form, or as two or more dose forms.
  • compositions disclosed herein are for use as a medicament.
  • compositions disclosed herein are used in the treatment of a disease associated with expression of an antigen described herein, e.g., a B-cell antigen (e.g., CD123 or CD19).
  • an antigen described herein e.g., a B-cell antigen (e.g., CD123 or CD19).
  • the disclosure features a composition (e.g., one or more dosage formulations, combinations, or one or more pharmaceutical compositions) comprising a cell expressing a CAR described herein (e.g., CD 123 CAR) and an inhibitor (e.g. , JAK-STAT inhibitor) described herein, for use in a method of treating (or in the preparation of a medicament for treating) a disease associated with expression of an antigen (e.g., B cell antigen, e.g., CD123 or CD19), e.g., a cancer described herein.
  • a CAR described herein e.g., CD 123 CAR
  • an inhibitor e.g., JAK-STAT inhibitor
  • the disclosure features a composition (e.g., one or more dosage formulations, combinations, or one or more pharmaceutical compositions) comprising a cell expressing a CAR described herein (e.g., CD123 CAR or CD19 CAR) and an inhibitor (e.g. , JAK-STAT inhibitor or BTK inhibitor) described herein, for use in a method of preventing CRS in a subject.
  • a CAR described herein e.g., CD123 CAR or CD19 CAR
  • an inhibitor e.g. , JAK-STAT inhibitor or BTK inhibitor
  • the invention pertains to a cell expressing a CAR molecule described herein for use as a medicament in combination with a kinase inhibitor, e.g., a kinase inhibitor described herein (e.g., a BTK inhibitor such as ibrutinib, or JAK-STAT inhibitor such as ruxolitinib), e.g., to prevent CRS in a subject.
  • a kinase inhibitor e.g., a BTK inhibitor such as ibrutinib, or JAK-STAT inhibitor such as ruxolitinib
  • a kinase inhibitor described herein e.g., a BTK inhibitor such as ibrutinib, or JAK-STAT inhibitor such as ruxolitinib
  • the invention pertains to a kinase inhibitor described herein (e.g., a BTK inhibitor such as ibrutinib, or JAK-STAT inhibitor such as ruxolitinib) for use as a medicament in combination with a cell expressing a CAR molecule described herein, e.g., to prevent CRS in a subject.
  • a kinase inhibitor described herein e.g., a BTK inhibitor such as ibrutinib, or JAK-STAT inhibitor such as ruxolitinib
  • the invention pertains to a cell expressing a CAR molecule described herein for use in combination with a kinase inhibitor, e.g., a kinase inhibitor described herein (e.g., a BTK inhibitor such as ibrutinib, or JAK-STAT inhibitor such as ruxolitinib), in the treatment of a disease expressing the B-cell antigen (e.g., CD 19 or CD 123).
  • a kinase inhibitor e.g., a BTK inhibitor such as ibrutinib, or JAK-STAT inhibitor such as ruxolitinib
  • a disease expressing the B-cell antigen e.g., CD 19 or CD 123.
  • the invention pertains to a kinase inhibitor described herein (e.g., a BTK inhibitor such as ibrutinib, or JAK-STAT inhibitor such as ruxolitinib), for use in combination with a cell expressing a CAR molecule described herein, in the treatment of a disease expressing the B-cell antigen (e.g., CD19 or CD123).
  • a BTK inhibitor such as ibrutinib, or JAK-STAT inhibitor such as ruxolitinib
  • a cell expressing a CAR molecule described herein in the treatment of a disease expressing the B-cell antigen (e.g., CD19 or CD123).
  • the invention pertains to a kinase inhibitor described herein (e.g., a BTK inhibitor such as ibrutinib, or JAK-STAT inhibitor such as ruxolitinib), for use in combination with a cell expressing a CAR molecule described herein, in the reduction of one or more side effects of a CAR therapy described herein.
  • a cell expressing a CAR molecule described herein for use e.g., as a medicament
  • a cytokine e.g., IL-7, IL- 15 and/or IL-21 as described herein.
  • the invention pertains to a cytokine described herein for use (e.g., as a medicament) in combination with a cell expressing a CAR molecule described herein.
  • the invention pertains to a cell expressing a CAR molecule described herein for use (e.g., as a medicament) in combination with a cytokine, e.g., IL-7, IL- 15 and/or IL-21 as described herein, in the treatment of a disease expressing a B cell antigen, e.g., CD123 or CD19.
  • the invention pertains to a cytokine described herein for use (e.g., as a medicament) in combination with a cell expressing a CAR molecule described herein, in the treatment of a disease expressing B cell antigen, e.g., CD123 or CD19.
  • a cytokine described herein for use (e.g., as a medicament) in combination with a cell expressing a CAR molecule described herein, in the treatment of a disease expressing B cell antigen, e.g., CD123 or CD19.
  • the present disclosure provides a method of distinguishing between CRS and sepsis in a subject, comprising acquiring a measure of one or more of the following:
  • ⁇ - ⁇ ⁇ - ⁇ , sIL-2Ra, sTNFRI, and sTNFRII, wherein a level or activity that is higher than a reference is indicative of CRS;
  • the method comprises administering a therapy (e.g., a therapy described herein) to treat CRS if the measure is indicative of CRS. In embodiments, the method comprises administering a therapy to treat sepsis if the measure is indicative of sepsis.
  • a therapy e.g., a therapy described herein
  • kits for distinguishing between CRS and sepsis in a patient comprising a set of reagents that specifically detects the level or activity of one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 2, 22, or all of) genes or proteins chosen from:
  • GM-CSF HGF, IFN- ⁇ , IFN-a, IL-10, IL-15, IL-5, IL-6, IL-8, IP-10, MCP1, MIG, MIP- 1 ⁇ , sIL-2Ra, sTNFRI, sTNFRII, CD163, IL- ⁇ , sCD30, sIL-4R, sRAGE, sVEGFR-1, and sVEGFR-2; and
  • said instructions for use provide that if one or more of (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or all of) the detected level or activity of GM-CSF, HGF, IFN- ⁇ , IFN-a, IL-10, IL-15, IL-5, IL-6, IL-8, IP-10, MCP1, MIG, ⁇ - ⁇ , sIL-2Ra, sTNFRI, or sTNFRII is greater than a reference value, the subject is likely to have CRS,
  • the subject is likely to have sepsis.
  • one or more of e.g., 2, 3, 4, 5, 6, or all of
  • reaction mixture comprising: a set of reagents that specifically detects the level or activity of one or more (e.g., 2, 3,
  • a biological sample e.g., a blood sample.
  • the biological sample is from a subject treated with a CAR-expressing cell therapy and/or having a symptom of CRS and/or sepsis.
  • the present disclosure also provides, in certain aspects, a method of identifying sepsis in a subject, comprising acquiring a measure of one or more of the following:
  • the present disclosure provides a method of treating one or more of a neurological toxicity, CRS, or posterior reversible encephalopathy syndrome (PRES), comprising administering to a subject in need thereof a therapeutically effective amount of cyclophosphamide.
  • the present disclosure provides cyclophosphamide for use in treating neurological toxicity, CRS, or posterior reversible encephalopathy syndrome (PRES).
  • the administration of cyclophosphamide is subsequent to a cell- based therapy, e.g., a cell-based therapy for cancer, a CD19-inhibiting therapy, or a CD 19- depleting therapy, or the subject has been previously treated with a cell-based therapy, e.g., a cell-based therapy for cancer, a CD 19 -inhibiting therapy, or a CD19-depleting therapy.
  • a cell-based therapy e.g., a cell-based therapy for cancer, a CD 19 -inhibiting therapy, or a CD19-depleting therapy.
  • the administration of cyclophosphamide is prior to, at the same time as, or after the cell-based therapy.
  • the patient has, or is identified as having, CRS, PRES, or both.
  • the subject has been treated with a CD 19 inhibiting or depleting therapy.
  • the CD 19 inhibitor is a CD 19 antibody, e.g., a CD 19 bispecific antibody (e.g., a bispecific T cell engager that targets CD19, e.g., blinatumomab).
  • a CD 19 antibody e.g., a CD 19 bispecific antibody (e.g., a bispecific T cell engager that targets CD19, e.g., blinatumomab).
  • the therapy comprises a CAR-expressing cell, e.g., an anti-BCMA CAR or anti- CD ⁇ CAR.
  • the subect suffers from a neurological toxicity, e.g., focal deficits (e.g., cranial nerve palsy or hemiparesis) or global abnormalities (e.g., generalized seizures, confusion), or status epilepticus.
  • the subject does not have any clinical symptoms of CRS.
  • the subject has one or more clinical symptoms of CRS.
  • the subject has, or is identified as having, elevated IL-6 relative to a reference, e.g., to the subject's level of IL-6 prior to therapy with a CAR-expressing cell.
  • the subject has, or is identified as having, elevated serum levels of a cytokine associated with CRS (e.g., IL-6 and/or IL-8) relative to a reference.
  • a cytokine associated with CRS e.g., IL-6 and/or IL-8
  • the subject has, or is identified as having, elevated levels of a cytokine associated with CRS (e.g., CSF IL-6 and/or IL-8) relative to a reference.
  • the subject is treated or has been treated with a therapy for CRS such as tocilizumab or a corticosteroid (e.g.,
  • the subject has, or is identified as having, an increase in circulating, activated CR-expressing cells. In embodiments, the subject has, or is identified as having, CAR-expressing cells in the CSF.
  • all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, suitable methods and materials are described below. All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting.
  • Headings, sub-headings or numbered or lettered elements e.g., (a), (b), (i) etc, are presented merely for ease of reading.
  • the use of headings or numbered or lettered elements in this document does not require the steps or elements be performed in alphabetical order or that the steps or elements are necessarily discrete from one another.
  • Other features, objects, and advantages of the invention will be apparent from the description and drawings, and from the claims.
  • Figure 1A is a schematic illustrating the experiments performed as described in Example 1, e.g., to generate a mouse model of CRS after CART.
  • Figure IB is a graph showing the expansion of CART cells after AML injection.
  • Figure 1C is a survival curve showing the survival of mice after a high dose of CART123.
  • Figure ID is a panel of graphs showing the levels of various cytokines in mice treated with high dose CART123.
  • Figure 2A is a schematic illustrating the experiments performed as described in Example 1, e.g., to determine the effect of ruxolitinib on CRS after CART therapy.
  • Figure 2B is a graph showing the change in weight of the mice, as measured by % change from baseline, which is plotted on the y axis against time on the x axis.
  • Figure 2C is a graph showing the disease burden, as measured by leukemic cells/ul (huCD45 dim cells), from serial retro-orbital bleedings, which is plotted on the y axis against time on the x axis.
  • Figure 2D is a graph showing the change in weight of the mice when treated with ruxolitinib.
  • FIG. 2E is a graph showing the absolute CD3+cell counts from serial retro-orbital bleedings from the mice. Serial retro-orbital bleedings were performed at the indicated time points on x-axis. Absolute CD3+cell count is plotted on the Y axis.
  • Figure 2F is a set of graphs showing the level of inflammatory cytokines from mouse serum obtained by retro-orbital bleeding of the mice one week after CAR123 injection.
  • Figure 2G is a survival plot showing the survival of mice treated with 60 mg/kg ruxolitinib in combination with CART 123.
  • Figure 2H is a flow cytometry plot showing an analysis of peripheral blood from surviving mice treated with ruxolitinib at 70 days post AML injection (gated on live human CD45 positive cells).
  • Figure 3A is a schematic of the experiments described in Example 2, in particular the generation of a model for CRS after CART 19 treatment in B cell neoplasms.
  • Figure 3B is an image of spleen from a representative mouse sacrificed before T cell treatment, showing high tumor burden.
  • Figure 3C is a flow cytometry plot showing a high level of circulating neoplastic B cells present in the peripheral blood (PB) at time of randomization (gating strategy: time gate, lymphocytes, single cells, live gate, huCD45+ muCD45-).
  • Figure 3D is a survival curve showing that mice treated with CART 19 experienced a significantly reduced overall survival.
  • Figure 3E is a panel of graphs showing a Luminex analysis of serum human cytokines, which revealed significantly increased cytokines in PB of mice receiving CART 19 as compared as no treatment.
  • Figure 4A is a schematic showing the experiments in Example 2, e.g., administration of CART 19 in combination with ibrutinib or vehicle in the mouse model generated in Example 2.
  • Figure 4B is a survival curve showing that mice treated with CART 19 plus ibrutinib experienced a significantly increased overall survival.
  • Figure 4C is a graph showing the number of CD 19+ cells in peripheral blood after vehicle or ibrutinib treatment.
  • Figure 4D is a graph showing that T cell expansion was not negatively affected by ibrutinib treatment (rather, T cell expansion was augmented by ibrutinib treatment).
  • Figure 4E is a panel of graphs showing the level of serum cytokines from mice treated with CART 19 or CART19+ibrutinib analyzed by Luminex; a significant reduction in all the cytokines involved in CRS was observed.
  • Figure 5 is a graph showing serum cytokine concentrations in xenograft mice bearing primary pediatric ALL treated with CD 19 CAR T cells. NSG mice were given 10 6 primary ALL and 5xl0 6 autologous CD19 CAR T cells seven days later. Serum was collected 3 days following T cell delivery, and a subgroup of animals was given tocilizumab on days 1 and 3 after T cells. Cytokine concentrations were measured in pg/mL.
  • Figure 6 is a graph showing serum cytokine concentrations in xenograft mice bearing an ALL cell line treated with CD19 CAR T cells.
  • NSG mice were engrafted with 10 6 Nalm-6 ALL cells and seven days later given 5xl0 6 CD19 CAR T cells derived from a normal donor. Serum was collected 3 days following T cell delivery, and a subgroup of animals was given tocilizumab on days 1 and 3 after T cells. Cytokine concentrations are measured in pg/mL.
  • Figure 7A-7J are graphs showing cytokine expression after cellular co-culture. T cells, targets and APCs were combined at a ratio of 10:50: 1, respectively. Supernatants were collected after 18 hours of co-culture. Cytokine levels are measured in pg/mL. Significant differences are denoted with either a * or **, and represent a p value of ⁇ 0.05.
  • Figure 8A-8E are graphs showing cytokine secretion from co-culture experiments combining monocyte-lineage cells with T cells and targets.
  • Monocyte-lineage cells were differentiated in vitro, and T cells, targets and APCs were combined at a ratio of 10:50: 1, respectively.
  • Supernatants were collected at 18 and 48 hours and analyzed for cytokine concentrations, measured in pg/mL.
  • Figure 9A-9C are graphs showing transcriptional analysis of isolated cell populations.
  • RNA transcripts were quantified from each cell population and log counts of each are displayed.
  • Figure 10 is a graph showing transcript profile of activated CD 19 CAR T cells and monocyte-lineage APCs.
  • Cells were harvested from trans- well co-culture of CD 19 CAR T cells, Nalm-6 leukemia and pooled monocytes after 18 hours. Transcript counts from T cells are displayed in blue, and counts from APCs in red.
  • FIGS. 11A-11C are graphs showing T cell degranulation in the presence of APCs.
  • T cells expressing either (A) no CAR molecule, (B) GD2-targeted CAR or (C) CD19-targeted CAR were combined with CD19+ target ALL cell line Nalm-6. Degranulation was measured by quantification of CD 107a surface expression.
  • Figure 12 is a diagram showing NanoString analysis of PBMCs collected from patients with ALL treated with CD 19 CAR T cells.
  • Peripheral blood was collected on first day of fever after engineered T cell infusion. The first seven patients had T cells detectable in peripheral blood with no detectable ALL, while the last three patients had only ALL cells and no detectable T cells.
  • Figure 13 is a set of images showing microscopic analysis of peripheral blood T cells collected at time of first fever after CD 19 CAR T cell infusion in patients with acute lymphoblastic leukemia. Images captured at lOOOx magnification.
  • a and “an” refers to one or to more than one (i.e., to at least one) of the grammatical object of the article.
  • an element means one element or more than one element.
  • CAR Chimeric Antigen Receptor
  • the domains in the CAR polypeptide construct are in the same polypeptide chain, e.g., comprise a chimeric fusion protein.
  • the domains in the CAR polypeptide construct are not contiguous with each other, e.g., are in different polypeptide chains, e.g., as provided in an RCAR as described herein.
  • the stimulatory molecule of the CAR is the zeta chain associated with the T cell receptor complex.
  • the cytoplasmic signaling domain comprises a primary signaling domain (e.g., a primary signaling domain of CD3-zeta).
  • the cytoplasmic signaling domain further comprises one or more functional signaling domains derived from at least one costimulatory molecule as defined below.
  • the costimulatory molecule is chosen from 4-1BB (i.e., CD137), CD27, ICOS, and/or CD28.
  • the CAR comprises a chimeric fusion protein comprising an extracellular antigen recognition domain, a transmembrane domain and an intracellular signaling domain comprising a functional signaling domain derived from a stimulatory molecule. In one aspect, the CAR comprises a chimeric fusion protein comprising an extracellular antigen recognition domain, a transmembrane domain and an intracellular signaling domain comprising a functional signaling domain derived from a co- stimulatory molecule and a functional signaling domain derived from a stimulatory molecule.
  • the CAR comprises a chimeric fusion protein comprising an extracellular antigen recognition domain, a transmembrane domain and an intracellular signaling domain comprising two functional signaling domains derived from one or more co-stimulatory molecule(s) and a functional signaling domain derived from a stimulatory molecule.
  • the CAR comprises a chimeric fusion protein comprising an extracellular antigen recognition domain, a transmembrane domain and an intracellular signaling domain comprising at least two functional signaling domains derived from one or more co-stimulatory molecule(s) and a functional signaling domain derived from a stimulatory molecule.
  • the CAR comprises an optional leader sequence at the amino-terminus (N-ter) of the CAR fusion protein.
  • the CAR further comprises a leader sequence at the N-terminus of the extracellular antigen recognition domain, wherein the leader sequence is optionally cleaved from the antigen recognition domain (e.g., aa scFv) during cellular processing and localization of the CAR to the cellular membrane.
  • the antigen recognition domain e.g., aa scFv
  • a CAR that comprises an antigen binding domain e.g., a scFv, a single domain antibody, or TCR (e.g., a TCR alpha binding domain or TCR beta binding domain)) that specifically binds a specific tumor marker X, wherein X can be a tumor marker as described herein, is also referred to as XCAR.
  • a CAR that comprises an antigen binding domain that specifically binds CD 123 is referred to as CD 123 CAR or CAR123.
  • a CAR that comprises an antigen binding domain that specifically binds CD 19 is referred to as CD19 CAR or CAR19.
  • the CAR comprises a CTL019 CAR as described herein.
  • the CAR can be expressed in any cell, e.g., an immune effector cell as described herein (e.g., a T cell or an NK cell).
  • a therapy that comprises a CAR-expressing cell is referred to herein as a CAR-therapy.
  • a therapy that comprises a CD 123 CAR-expressing cell, or a CD 19 CAR is referred to herein as a CD123 CAR therapy or a CD19 CAR therapy, respectively.
  • the term "signaling domain" refers to the functional portion of a protein which acts by transmitting information within the cell to regulate cellular activity via defined signaling pathways by generating second messengers or functioning as effectors by responding to such messengers.
  • alpha subunit of the IL-3 receptor refers interchangeably to an antigenic determinant known to be detectable on leukemia precursor cells.
  • the human and murine amino acid and nucleic acid sequences can be found in a public database, such as GenBank, UniProt and Swiss-Prot.
  • amino acid sequence of human IL3Ra can be found at Accession No. NP
  • CD 123 includes proteins comprising mutations, e.g., point mutations, fragments, insertions, deletions and splice variants of full length wild-type CD 123.
  • CD19 refers to the Cluster of Differentiation 19 protein, which is an antigenic determinant detectable on leukemia precursor cells.
  • the human and murine amino acid and nucleic acid sequences can be found in a public database, such as GenBank, UniProt and Swiss-Prot.
  • the amino acid sequence of human CD19 can be found as UniProt/Swiss-Prot Accession No. P15391 and the nucleotide sequence encoding of the human CD19 can be found at Accession No. NM_001178098.
  • CD19 includes proteins comprising mutations, e.g., point mutations, fragments, insertions, deletions and splice variants of full length wild-type CD19.
  • CD19 is expressed on most B lineage cancers, including, e.g., acute lymphoblastic leukaemia, chronic lymphocyte leukaemia and non-Hodgkin lymphoma. Other cells with express CD 19 are provided below in the definition of "disease associated with expression of CD19.” It is also an early marker of B cell progenitors. See, e.g., Nicholson et al. Mol. Immun. 34 (16-17): 1157-1165 (1997).
  • the antigen-binding portion of the CART recognizes and binds an antigen within the extracellular domain of the CD19 protein.
  • the CD19 protein is expressed on a cancer cell.
  • CD20 refers to an antigenic determinant known to be detectable on B cells.
  • Human CD20 is also called membrane-spanning 4-domains, subfamily A, member 1 (MS4A1).
  • MS4A1 membrane-spanning 4-domains, subfamily A, member 1
  • the human and murine amino acid and nucleic acid sequences can be found in a public database, such as GenBank, UniProt and Swiss-Prot.
  • the amino acid sequence of human CD20 can be found at Accession Nos. NP_690605.1 and
  • NP_068769.2 and the nucleotide sequence encoding transcript variants 1 and 3 of the human CD20 can be found at Accession No. NM_152866.2 and NM_021950.3, respectively.
  • the antigen-binding portion of the CAR recognizes and binds an antigen within the extracellular domain of the CD20 protein.
  • the CD20 protein is expressed on a cancer cell.
  • CD22 refers to an antigenic determinant known to be detectable on leukemia precursor cells.
  • the human and murine amino acid and nucleic acid sequences can be found in a public database, such as GenBank, UniProt and Swiss-Prot.
  • the amino acid sequences of isoforms 1-5 human CD22 can be found at Accession Nos. NP 001762.2, NP 001172028.1, NP 001172029.1, NP 001172030.1, and NP
  • the antigen-binding portion of the CAR recognizes and binds an antigen within the extracellular domain of the CD22 protein.
  • the CD22 protein is expressed on a cancer cell.
  • ROR1 refers to an antigenic determinant known to be detectable on leukemia precursor cells.
  • the human and murine amino acid and nucleic acid sequences can be found in a public database, such as GenBank, UniProt and Swiss-Prot.
  • the amino acid sequences of isoforms land 2 precursors of human ROR1 can be found at Accession Nos. NP_005003.2 and NP_001077061.1, respectively, and the mRNA sequences encoding them can be found at Accession Nos. NM_005012.3 and
  • the antigen-binding portion of the CAR recognizes and binds an antigen within the extracellular domain of the ROR1 protein.
  • the ROR1 protein is expressed on a cancer cell.
  • CD33 refers to the Cluster of Differentiation 33 protein, which is an antigenic determinant detectable on leukemia cells as well on normal precursor cells of the myeloid lineage.
  • the human and murine amino acid and nucleic acid sequences can be found in a public database, such as GenBank, UniProt and Swiss-Prot.
  • the amino acid sequence of human CD33 can be found as UniProt/Swiss-Prot Accession No. P20138 and the nucleotide sequence encoding of the human CD33 can be found at Accession No. NM_001772.3.
  • the antigen-binding portion of the CAR recognizes and binds an epitope within the extracellular domain of the CD33 protein or fragments thereof.
  • the CD33 protein is expressed on a cancer cell.
  • CD33 includes proteins comprising mutations, e.g., point mutations, fragments, insertions, deletions and splice variants of full length wild-type CD33.
  • BCMA refers to B-cell maturation antigen.
  • BCMA also known as TNFRSF17, BCM or CD269
  • TNFRSF17 tumor necrosis receptor
  • BCM tumor necrosis receptor
  • APRIL proliferation inducing ligand
  • the gene for BCMA is encoded on chromosome 16 producing a primary mRNA transcript of 994 nucleotides in length (NCBI accession NM_001192.2) that encodes a protein of 184 amino acids (NP_001183.2).
  • a second antisense transcript derived from the BCMA locus has been described, which may play a role in regulating BCMA expression. (Laabi Y. et al., Nucleic Acids Res., 1994, 22: 1147-1154).
  • BCMA includes proteins comprising mutations, e.g., point mutations, fragments, insertions, deletions and splice variants of full length wild-type BCMA.
  • CLL-1 refers to C-type lectin-like molecule- 1, which is an antigenic determinant detectable on leukemia precursor cells and on normal immune cells.
  • C- type lectin-like- 1 (CLL-1) is also known as MICL, CLEC12A, CLEC-1, Dendritic Cell- Associated Lectin 1, and DCAL-2.
  • the human and murine amino acid and nucleic acid sequences can be found in a public database, such as GenBank, UniProt and Swiss-Prot.
  • the amino acid sequence of human CLL-1 can be found as UniProt/Swiss-Prot Accession No.
  • the antigen-binding portion of the CAR recognizes and binds an epitope within the extracellular domain of the CLL- 1 protein or a fragment thereof.
  • the CLL-1 protein is expressed on a cancer cell.
  • EGFR refers to any mammalian mature full-length epidermal growth factor receptor, including human and non-human forms.
  • the 1186 amino acid human EGFR is described in Ullrich et al, Nature 309:418-425 (1984)) and GenBank Accession No. AF125253 and SwissProt Acc No P00533-2.
  • EGFRvIII refers to Epidermal growth factor receptor variant III. EGFRvIII is the most common variant of EGFR observed in human tumors but is rarely observed in normal tissue. This protein results from the in-frame deletion of exons 2-7 and the generation of a novel glycine residue at the junction of exons 1 and 8 within the extra-cellular domain of the
  • EGFRvIII is expressed in 24% to 67% of GBM, but not in normal tissues.
  • EGFRvIII is also known as type III mutant, delta-EGFR, EGFRde2-7, and EGFR and is described in U.S. Pat. Nos. 6,455,498, 6,127,126, 5,981,725, 5,814,317, 5,710,010, 5,401,828, and 5,212,290.
  • Expression of EGFRvIII may result from a chromosomal deletion, and may also result from aberrant alternative splicing. See Sugawa et al, 1990, Proc. Natl. Acad. Sci. 87:8602-8606.
  • mesothelin refers to the 40-kDa protein, mesothelin, which is anchored at the cell membrane by a glycosylphosphatidyl inositol (GPI) linkage and an amino- terminal 31-kDa shed fragment, called megkaryocyte potentiating factor (MPF). Both fragments contain N-glycosylation sites.
  • GPI glycosylphosphatidyl inositol
  • MPF megkaryocyte potentiating factor
  • Both fragments contain N-glycosylation sites.
  • the term also refers to a soluble splice variant of the 40-kDa carboxyl-terminal fragment also called "soluble mesothelin/MPF-related".
  • the term refers to a human mesothelin of GenBank accession number AAH03512.1, and naturally cleaved portions thereof, e.g., as expressed on a cell membrane, e.g., a cancer cell membrane.
  • antibody refers to a protein, or polypeptide sequence derived from an immunoglobulin molecule which specifically binds with an antigen.
  • Antibodies can be polyclonal or monoclonal, multiple or single chain, or intact
  • immunoglobulins may be derived from natural sources or from recombinant sources.
  • Antibodies can be tetramers of immunoglobulin molecules.
  • antibody fragment refers to at least one portion of an intact antibody, or recombinant variants thereof, and refers to the antigen binding domain, e.g., an antigenic determining variable region of an intact antibody, that is sufficient to confer recognition and specific binding of the antibody fragment to a target, such as an antigen.
  • antibody fragments include, but are not limited to, Fab, Fab', F(ab') 2 , and Fv fragments, scFv antibody fragments, linear antibodies, single domain antibodies such as sdAb (either VL or VH), camelid VHH domains, and multi- specific antibodies formed from antibody fragments such as a bivalent fragment comprising two Fab fragments linked by a disulfide brudge at the hinge region, and an isolated CDR or other epitope binding fragments of an antibody.
  • An antigen binding fragment can also be incorporated into single domain antibodies, maxibodies, minibodies, nanobodies, intrabodies, diabodies, triabodies, tetrabodies, v-NAR and bis-scFv (see, e.g., Hollinger and Hudson, Nature Biotechnology 23: 1126-1136, 2005).
  • Antigen binding fragments can also be grafted into scaffolds based on polypeptides such as a fibronectin type III (Fn3)(see U.S. Patent No.: 6,703,199, which describes fibronectin polypeptide minibodies).
  • scFv refers to a fusion protein comprising at least one antibody fragment comprising a variable region of a light chain and at least one antibody fragment comprising a variable region of a heavy chain, wherein the light and heavy chain variable regions are contiguously linked via a short flexible polypeptide linker, and capable of being expressed as a single chain polypeptide, and wherein the scFv retains the specificity of the intact antibody from which it is derived.
  • an scFv may have the VL and VH variable regions in either order, e.g., with respect to the N-terminal and C-terminal ends of the polypeptide, the scFv may comprise VL-linker-VH or may comprise VH-linker-VL.
  • CDR complementarity determining region
  • HCDR1, HCDR2, and HCDR3 three CDRs in each heavy chain variable region
  • LCDR1, LCDR2, and LCDR3 three CDRs in each light chain variable region
  • the precise amino acid sequence boundaries of a given CDR can be determined using any of a number of well-known schemes, including those described by Kabat et al. (1991), “Sequences of Proteins of Immunological Interest,” 5th Ed.
  • the CDR amino acid residues in the heavy chain variable domain (VH) are numbered 31-35 (HCDR1), 50-65 (HCDR2), and 95-102 (HCDR3); and the CDR amino acid residues in the light chain variable domain (VL) are numbered 24-34 (LCDR1), 50-56 (LCDR2), and 89-97 (LCDR3).
  • the CDR amino acids in the VH are numbered 26-32 (HCDR1), 52-56 (HCDR2), and 95-102 (HCDR3); and the CDR amino acid residues in the VL are numbered 26-32 (LCDR1), 50-52 (LCDR2), and 91-96 (LCDR3).
  • the CDRs correspond to the amino acid residues that are part of a Kabat CDR, a Chothia CDR, or both.
  • the CDRs correspond to amino acid residues 26-35 (HCDR1), 50-65 (HCDR2), and 95-102 (HCDR3) in a VH, e.g., a mammalian VH, e.g., a human VH; and amino acid residues 24-34 (LCDR1), 50-56 (LCDR2), and 89-97 (LCDR3) in a VL, e.g., a mammalian VL, e.g., a human VL.
  • the portion of the CAR composition of the invention comprising an antibody or antibody fragment thereof may exist in a variety of forms where the antigen binding domain is expressed as part of a contiguous polypeptide chain including, for example, a single domain antibody fragment (sdAb), a single chain antibody (scFv) and a humanized or human antibody (Harlow et al., 1999, In: Using Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, NY; Harlow et al., 1989, In: Antibodies: A Laboratory Manual, Cold Spring Harbor, New York; Houston et al., 1988, Proc. Natl. Acad. Sci. USA 85:5879-5883; Bird et al., 1988, Science 242:423-426).
  • the antigen binding domain of a CAR composition of the invention comprises an antibody fragment.
  • the CAR comprises an antibody fragment that comprises a scFv.
  • binding domain or "antibody molecule” (also referred to herein as “anti-target (e.g., CD 123) binding domain”) refers to a protein, e.g., an
  • an antibody molecule is a multispecific antibody molecule, e.g., it comprises a plurality of immunoglobulin variable domain sequences, wherein a first immunoglobulin variable domain sequence of the plurality has binding specificity for a first epitope and a second immunoglobulin variable domain sequence of the plurality has binding specificity for a second epitope.
  • a multispecific antibody molecule is a bispecific antibody molecule. A bispecific antibody has specificity for no more than two antigens.
  • a bispecific antibody molecule is characterized by a first immunoglobulin variable domain sequence which has binding specificity for a first epitope and a second
  • immunoglobulin variable domain sequence that has binding specificity for a second epitope.
  • antibody heavy chain refers to the larger of the two types of polypeptide chains present in antibody molecules in their naturally occurring conformations, and which normally determines the class to which the antibody belongs.
  • antibody light chain refers to the smaller of the two types of polypeptide chains present in antibody molecules in their naturally occurring conformations. Kappa ( ⁇ ) and lambda ( ⁇ ) light chains refer to the two major antibody light chain isotypes.
  • recombinant antibody refers to an antibody which is generated using recombinant DNA technology, such as, for example, an antibody expressed by a bacteriophage or yeast expression system.
  • the term should also be construed to mean an antibody which has been generated by the synthesis of a DNA molecule encoding the antibody and which DNA molecule expresses an antibody protein, or an amino acid sequence specifying the antibody, wherein the DNA or amino acid sequence has been obtained using recombinant DNA or amino acid sequence technology which is available and well known in the art.
  • antigen or "Ag” refers to a molecule that provokes an immune response. This immune response may involve either antibody production, or the activation of specific immunologically-competent cells, or both.
  • antibody production or the activation of specific immunologically-competent cells, or both.
  • any macromolecule including virtually all proteins or peptides, can serve as an antigen.
  • antigens can be derived from recombinant or genomic DNA.
  • any DNA which comprises a nucleotide sequences or a partial nucleotide sequence encoding a protein that elicits an immune response therefore encodes an "antigen" as that term is used herein.
  • an antigen need not be encoded solely by a full length nucleotide sequence of a gene. It is readily apparent that the present invention includes, but is not limited to, the use of partial nucleotide sequences of more than one gene and that these nucleotide sequences are arranged in various combinations to encode polypeptides that elicit the desired immune response.
  • an antigen need not be encoded by a "gene” at all. It is readily apparent that an antigen can be generated synthesized or can be derived from a biological sample, or might be macromolecule besides a polypeptide. Such a biological sample can include, but is not limited to a tissue sample, a tumor sample, a cell or a fluid with other biological components.
  • anti-tumor effect refers to a biological effect which can be manifested by various means, including but not limited to, e.g., a decrease in tumor volume, a decrease in the number of tumor cells, a decrease in the number of metastases, an increase in life expectancy, decrease in tumor cell proliferation, decrease in tumor cell survival, or amelioration of various physiological symptoms associated with the cancerous condition.
  • An "anti-tumor effect” can also be manifested by the ability of the peptides, polynucleotides, cells and antibodies of the invention in prevention of the occurrence of tumor in the first place.
  • anti-cancer effect refers to a biological effect which can be manifested by various means, including but not limited to, e.g., a decrease in tumor volume, a decrease in the number of cancer cells, a decrease in the number of metastases, an increase in life expectancy, decrease in cancer cell proliferation, decrease in cancer cell survival, or amelioration of various physiological symptoms associated with the cancerous condition.
  • An "anti-cancer effect” can also be manifested by the ability of the peptides, polynucleotides, cells and antibodies in prevention of the occurrence of cancer in the first place.
  • anti-tumor effect refers to a biological effect which can be manifested by various means, including but not limited to, e.g., a decrease in tumor volume, a decrease in the number of tumor cells, a decrease in tumor cell proliferation, or a decrease in tumor cell survival.
  • autologous refers to any material derived from the same individual to whom it is later to be re-introduced into the individual.
  • allogeneic refers to any material derived from a different animal of the same species as the individual to whom the material is introduced. Two or more individuals are said to be allogeneic to one another when the genes at one or more loci are not identical. In some aspects, allogeneic material from individuals of the same species may be sufficiently unlike genetically to interact antigenic ally.
  • xenogeneic refers to a graft derived from an animal of a different species.
  • apheresis refers to the art-recognized extracorporeal process by which the blood of a donor or patient is removed from the donor or patient and passed through an apparatus that separates out selected particular constituent(s) and returns the remainder to the circulation of the donor or patient, e.g., by retransfusion.
  • an apheresis sample refers to a sample obtained using apheresis.
  • combination refers to either a fixed combination in one dosage unit form, or a combined administration where a compound of the present invention and a combination partner (e.g. another drug as explained below, also referred to as “therapeutic agent” or “co- agent”) may be administered independently at the same time or separately within time intervals, especially where these time intervals allow that the combination partners show a cooperative, e.g. synergistic effect.
  • a combination partner e.g. another drug as explained below, also referred to as “therapeutic agent” or “co- agent”
  • the single components may be packaged in a kit or separately.
  • One or both of the components e.g., powders or liquids
  • co-administration or “combined administration” or the like as utilized herein are meant to encompass administration of the selected combination partner to a single subject in need thereof (e.g. a patient), and are intended to include treatment regimens in which the agents are not necessarily administered by the same route of
  • the term "pharmaceutical combination” as used herein means a product that results from the mixing or combining of more than one active ingredient and includes both fixed and non-fixed combinations of the active ingredients.
  • the term "fixed combination” means that the active ingredients, e.g. a compound of the present invention and a combination partner, are both administered to a patient simultaneously in the form of a single entity or dosage.
  • non-fixed combination means that the active ingredients, e.g. a compound of the present invention and a combination partner, are both administered to a patient as separate entities either simultaneously, concurrently or sequentially with no specific time limits, wherein such administration provides therapeutically effective levels of the two compounds in the body of the patient.
  • cocktail therapy e.g. the administration of three or more active ingredients.
  • cancer refers to a disease characterized by the rapid and uncontrolled growth of aberrant cells. Cancer cells can spread locally or through the bloodstream and lymphatic system to other parts of the body. Examples of various cancers are described herein and include but are not limited to, breast cancer, prostate cancer, ovarian cancer, cervical cancer, skin cancer, pancreatic cancer, colorectal cancer, renal cancer, liver cancer, brain cancer, lymphoma, leukemia, lung cancer and the like.
  • tumor and “cancer” are used interchangeably herein, e.g., both terms encompass solid and liquid, e.g., diffuse or circulating, tumors. As used herein, the term “cancer” or “tumor” includes premalignant, as well as malignant cancers and tumors.
  • “Derived from” indicates a relationship between a first and a second molecule. It generally refers to structural similarity between the first molecule and a second molecule and does not connotate or include a process or source limitation on a first molecule that is derived from a second molecule. For example, in the case of an intracellular signaling domain that is derived from a CD3zeta molecule, the intracellular signaling domain retains sufficient CD3zeta structure such that is has the required function, namely, the ability to generate a signal under the appropriate conditions.
  • disease associated with expression of a B-cell antigen includes, but is not limited to, a disease associated with expression of one or more of CD 19, CD20, CD22 or ROR1, or a condition associated with cells which express, or at any time expressed, one or more of CD19, CD20, CD22 or ROR1, including, e.g., proliferative diseases such as a cancer or malignancy or a precancerous condition such as a myelodysplasia, a myelodysplastic syndrome or a preleukemia; or a noncancer related indication associated with cells which express one or more of CD19, CD20, CD22 or ROR1.
  • proliferative diseases such as a cancer or malignancy or a precancerous condition such as a myelodysplasia, a myelodysplastic syndrome or a preleukemia
  • a noncancer related indication associated with cells which express one or more of CD19, CD20, CD22 or ROR1.
  • a disease associated with expression of the B-cell antigen may include a condition associated with cells which do not presently express the B-cell antigen, e.g., because the antigen expression has been downregulated, e.g., due to treatment with a molecule targeting the B-cell antigen, e.g., a B-cell targeting CAR, but which at one time expressed the antigen.
  • the phrase "disease associated with expression of a B-cell antigen" includes a disease associated with expression of CD19, as described herein.
  • disease associated with expression of CD19 includes, but is not limited to, a disease associated with expression of CD19 or condition associated with cells which express, or at any time expressed, CD19 including, e.g., proliferative diseases such as a cancer or malignancy or a precancerous condition such as a myelodysplasia, a myelodysplastic syndrome or a preleukemia; or a noncancer related indication associated with cells which express CD19.
  • a disease associated with expression of CD19 may include a condition associated with cells which do not presently express CD19, e.g., because CD19 expression has been downregulated, e.g., due to treatment with a molecule targeting CD19, e.g., a CD19 CAR, but which at one time expressed CD19.
  • a cancer associated with expression of CD19 is a hematological cancer.
  • the hematolical cancer is a leukemia or a lymphoma.
  • a cancer associated with expression of CD19 includes cancers and malignancies including, but not limited to, e.g., one or more acute leukemias including but not limited to, e.g., B-cell acute Lymphoid Leukemia (BALL), T-cell acute Lymphoid Leukemia (TALL), acute lymphoid leukemia (ALL); one or more chronic leukemias including but not limited to, e.g., chronic myelogenous leukemia (CML), Chronic Lymphoid Leukemia (CLL).
  • BALL B-cell acute Lymphoid Leukemia
  • TALL T-cell acute Lymphoid Leukemia
  • ALL acute lymphoid leukemia
  • chronic leukemias including but not limited to, e.g., chronic myelogenous leukemia (CML), Chronic Lymphoid Leukemia (CLL).
  • Additional cancers or hematologic conditions associated with expression of CD19 comprise, but are not limited to, e.g., B cell prolymphocytic leukemia, blastic plasmacytoid dendritic cell neoplasm, Burkitt's lymphoma, diffuse large B cell lymphoma, Follicular lymphoma, Hairy cell leukemia, small cell- or a large cell-follicular lymphoma, malignant lymphoproliferative conditions, MALT lymphoma, mantle cell lymphoma (MCL), Marginal zone lymphoma, multiple myeloma, myelodysplasia and myelodysplastic syndrome, non-Hodgkin lymphoma, Hodgkin lymphoma, plasmablastic lymphoma, plasmacytoid dendritic cell neoplasm, Waldenstrom macroglobulinemia, and "preleukemia" which are a diverse collection of hematological conditions united by ineffective production (or dysplasia)
  • Further diseases associated with expression of CD19 expression include, but not limited to, e.g., atypical and/or non-classical cancers, malignancies, precancerous conditions or proliferative diseases associated with expression of CD19.
  • Non-cancer related indications associated with expression of CD19 include, but are not limited to, e.g., autoimmune disease, (e.g., lupus), inflammatory disorders (allergy and asthma) and transplantation.
  • the tumor antigen-expressing cells express, or at any time expressed, mRNA encoding the tumor antigen.
  • the tumor antigen -expressing cells produce the tumor antigen protein (e.g., wild-type or mutant), and the tumor antigen protein may be present at normal levels or reduced levels.
  • the tumor antigen -expressing cells produced detectable levels of a tumor antigen protein at one point, and subsequently produced substantially no detectable tumor antigen protein.
  • disease associated with expression of CD 123 includes but is not limited to, a disease associated with expression of CD 123 or condition associated with a cell which expresses CD123 (e.g., wild-type or mutant CD123) including, e.g., a proliferative disease such as a cancer or malignancy; a precancerous condition such as a myelodysplasia, a myelodysplastic syndrome or a preleukemia; or a non-cancer related indication associated with a cell which expresses CD123 (e.g., wild-type or mutant CD123).
  • a proliferative disease such as a cancer or malignancy
  • a precancerous condition such as a myelodysplasia, a myelodysplastic syndrome or a preleukemia
  • a non-cancer related indication associated with a cell which expresses CD123 (e.g., wild-type or mutant CD123).
  • a cancer associated with expression of CD123 is a hematological cancer.
  • the disease includes AML, ALL, hairy cell leukemia, Prolymphocytic leukemia, Chronic myeloid leukemia (CML), Hodgkin lymphoma, Blastic plasmacytoid dendritic cell neoplasm, lymphoblastic B-cell leukemia (B-cell acute lymphoid leukemia, BALL), acute lymphoblastic T-cell leukemia (T-cell acute lymphoid leukemia (TALL);
  • CD 123 expression include, but are not limited to, e.g., atypical and/or non- classical cancers, malignancies, precancerous conditions or proliferative diseases associated with expression of CD 123.
  • Non-cancer related indications associated with expression of CD 123 may also be included.
  • disease associated with expression of CD33 includes but is not limited to, a disease associated with a cell which expresses CD33 (e.g., wild-type or mutant CD33) or condition associated with a cell which expresses CD33 (e.g., wild-type or mutant CD33) including, e.g., a proliferative disease such as a cancer or malignancy or a precancerous condition such as a myelodysplasia, a myelodysplastic syndrome or a preleukemia; or a noncancer related indication associated with a cell which expresses CD33 (e.g., wild-type or mutant CD33).
  • a proliferative disease such as a cancer or malignancy or a precancerous condition such as a myelodysplasia, a myelodysplastic syndrome or a preleukemia
  • a noncancer related indication associated with a cell which expresses CD33 (e.g., wild-type or mutant CD33).
  • a disease associated with expression of CD33 may include a condition associated with a cell which do not presently express CD33, e.g., because CD33 expression has been downregulated, e.g., due to treatment with a molecule targeting CD33, e.g., a CD33 inhibitor described herein, but which at one time expressed CD33.
  • a cancer associated with expression of CD33 e.g., wild-type or mutant CD33 is a hematological cancer.
  • a hematological cancer includes but is not limited to acute myeloid leukemia (AML), myelodysplasia and myelodysplastic syndrome, myelofibrosis and myeloproliferative neoplasms, acute lymphoid leukemia (ALL), hairy cell leukemia,
  • AML acute myeloid leukemia
  • ALL acute lymphoid leukemia
  • hairy cell leukemia hairy cell leukemia
  • CD33 Prolymphocytic leukemia, chronic myeloid leukemia (CML), Blastic plasmacytoid dendritic cell neoplasm, and the like.
  • Further disease associated with expression of CD33 (e.g., wild-type or mutant CD33) expression include, but are not limited to, e.g., atypical and/or non-classical cancers, malignancies, precancerous conditions or proliferative diseases associated with expression of CD33 (e.g., wild-type or mutant CD33).
  • Non-cancer related indications associated with expression of CD33 may also be included.
  • a non-cancer related indication associated with expression of CD33 includes but is not limited to, e.g., autoimmune disease, (e.g., lupus), inflammatory disorders (allergy and asthma) and transplantation.
  • the tumor antigen-expressing cell expresses, or at any time expressed, mRNA encoding the tumor antigen.
  • the tumor antigen-expressing cell produces the tumor antigen protein (e.g., wild-type or mutant), and the tumor antigen protein may be present at normal levels or reduced levels.
  • the tumor antigen-expressing cell produced detectable levels of a tumor antigen protein at one point, and subsequently produced substantially no detectable tumor antigen protein.
  • disease associated with expression of BCMA includes, but is not limited to, a disease associated with a cell which expresses BCMA (e.g., wild-type or mutant BCMA) or condition associated with a cell which expresses BCMA (e.g., wild-type or mutant BCMA) including, e.g., proliferative diseases such as a cancer or malignancy or a precancerous condition such as a myelodysplasia, a myelodysplastic syndrome or a preleukemia; or a noncancer related indication associated with a cell which expresses BCMA (e.g., wild-type or mutant BCMA).
  • proliferative diseases such as a cancer or malignancy or a precancerous condition such as a myelodysplasia, a myelodysplastic syndrome or a preleukemia
  • a noncancer related indication associated with a cell which expresses BCMA (e.g., wild-type or mutant BCMA).
  • a disease associated with expression of BCMA may include a condition associated with a cell which does not presently express BCMA, e.g., because BCMA expression has been downregulated, e.g., due to treatment with a molecule targeting BCMA, e.g., a BCMA inhibitor described herein, but which at one time expressed BCMA.
  • a cancer associated with expression of BCMA e.g., wild-type or mutant BCMA
  • the hematogical cancer is a leukemia or a lymphoma.
  • a cancer associated with expression of BCMA is a malignancy of differentiated plasma B cells.
  • a cancer associated with expression of BCMA(e.g., wild-type or mutant BCMA) includes cancers and malignancies including, but not limited to, e.g., one or more acute leukemias including but not limited to, e.g., B-cell acute Lymphoid Leukemia ("BALL"), T-cell acute Lymphoid Leukemia (“TALL”), acute lymphoid leukemia (ALL); one or more chronic leukemias including but not limited to, e.g., chronic myelogenous leukemia (CML), Chronic Lymphoid Leukemia (CLL).
  • BALL B-cell acute Lymphoid Leukemia
  • TALL T-cell acute Lymphoid Leukemia
  • ALL acute lymphoid leukemia
  • chronic leukemias including but not limited to, e.g., chronic myelogenous leukemia (CML), Chronic
  • Additional cancers or hematologic conditions associated with expression of BMCA comprise, but are not limited to, e.g., B cell prolymphocytic leukemia, blastic plasmacytoid dendritic cell neoplasm, Burkitt's lymphoma, diffuse large B cell lymphoma, Follicular lymphoma, Hairy cell leukemia, small cell- or a large cell-follicular lymphoma, malignant lymphoproliferative conditions, MALT lymphoma, mantle cell lymphoma, Marginal zone lymphoma, multiple myeloma, myelodysplasia and myelodysplastic syndrome, non-Hodgkin's lymphoma, plasmablastic lymphoma, plasmacytoid dendritic cell neoplasm, Waldenstrom macroglobulinemia, and "preleukemia" which are a diverse collection of hematological conditions united by ineffective production (or dys
  • the cancer is multiple myeloma, Hodgkin's lymphoma, non-Hodgkin's lymphoma, or glioblastoma.
  • a disease associated with expression of BCMA includes a plasma cell proliferative disorder, e.g., asymptomatic myeloma (smoldering multiple myeloma or indolent myeloma), monoclonal gammapathy of undetermined significance (MGUS), Waldenstrom's macroglobulinemia, plasmacytomas (e.g., plasma cell dyscrasia, solitary myeloma, solitary plasmacytoma, extramedullary plasmacytoma, and multiple plasmacytoma), systemic amyloid light chain amyloidosis, and POEMS syndrome (also known as Crow-Fukase syndrome, Takatsuki disease, and PEP syndrome). Further diseases associated with expression of BCMA (e.g., wild-type or mutant BCMA)
  • BCMA precancerous conditions or proliferative diseases associated with expression of BCMA
  • BCMA e.g., wild-type or mutant BCMA
  • a cancer described herein e.g., a prostate cancer (e.g., castrate-resistant or therapy-resistant prostate cancer, or metastatic prostate cancer), pancreatic cancer, or lung cancer.
  • Non-cancer related conditions that are associated with BCMA include viral infections; e.g., HIV, fungal invections, e.g., C. neoformans; autoimmune disease; e.g. rheumatoid arthritis, system lupus erythematosus (SLE or lupus), pemphigus vulgaris, and Sjogren's syndrome; inflammatory bowel disease, ulcerative colitis; transplant- related allospecific immunity disorders related to mucosal immunity; and unwanted immune responses towards biologies (e.g., Factor VIII) where humoral immunity is important.
  • viral infections e.g., HIV, fungal invections, e.g., C. neoformans
  • autoimmune disease e.g. rheumatoid arthritis, system lupus erythematosus (SLE or lupus), pemphigus vulgaris, and Sjogren's syndrome
  • inflammatory bowel disease e.
  • a non-cancer related indication associated with expression of BCMA includes but is not limited to, e.g., autoimmune disease, (e.g., lupus), inflammatory disorders (allergy and asthma) and transplantation.
  • the tumor antigen-expressing cell expresses, or at any time expressed, mRNA encoding the tumor antigen.
  • the tumor antigen -expressing cell produces the tumor antigen protein (e.g., wild-type or mutant), and the tumor antigen protein may be present at normal levels or reduced levels.
  • the tumor antigen -expressing cell produced detectable levels of a tumor antigen protein at one point, and subsequently produced substantially no detectable tumor antigen protein.
  • disease associated with expression of CLL-1 includes, but is not limited to, a disease associated with a cell which expresses CLL-1 or condition associated with a cell which expresses CLL-1 including, e.g., proliferative diseases such as a cancer or malignancy or a precancerous condition such as a myelodysplasia, a myelodysplastic syndrome or a preleukemia; or a noncancer related indication associated with a cell which expresses CLL-1 (e.g., wild-type or mutant CLL-1).
  • proliferative diseases such as a cancer or malignancy or a precancerous condition such as a myelodysplasia, a myelodysplastic syndrome or a preleukemia
  • a noncancer related indication associated with a cell which expresses CLL-1 (e.g., wild-type or mutant CLL-1).
  • a disease associated with expression of CLL-1 may include a condition associated with a cell which do not presently express CLL-1, e.g., because CLL-1 expression has been downregulated, e.g., due to treatment with a molecule targeting CLL-1, e.g., a CLL-1 inhibitor described herein, but which at one time expressed CLL-1.
  • a cancer associated with expression of CLL-1 is a hematological cancer.
  • a hematological cancer includes but is not limited to leukemia (such as acute myelogenous leukemia, chronic myelogenous leukemia, acute lymphoid leukemia, chronic lymphoid leukemia and myelodysplastic syndrome) and malignant lymphoproliferative conditions, including lymphoma (such as multiple myeloma, non- Hodgkin's lymphoma, Burkitt's lymphoma, and small cell- and large cell-follicular lymphoma).
  • leukemia such as acute myelogenous leukemia, chronic myelogenous leukemia, acute lymphoid leukemia, chronic lymphoid leukemia and myelodysplastic syndrome
  • lymphoma such as multiple myeloma, non- Hodgkin's lymphoma, Burkitt's lymphoma, and small cell- and large cell-follicular lymphoma.
  • cancers include, but not limited to, e.g., atypical and/or non-classical cancers, malignancies, precancerous conditions or proliferative diseases associated with expression of CLL-1.
  • Non-cancer related indications associated with expression of CLL-1 may also be included.
  • the tumor antigen-expressing cell expresses, or at any time expressed, mRNA encoding the tumor antigen.
  • the tumor antigen-expressing cell produces the tumor antigen protein (e.g., wild-type or mutant), and the tumor antigen protein may be present at normal levels or reduced levels.
  • the tumor antigen-expressing cell produced detectable levels of a tumor antigen protein at one point, and subsequently produced substantially no detectable tumor antigen protein.
  • disease associated with expression of EGFRvIII includes, but is not limited to, a disease associated with expression of EGFRvIII or condition associated with cells which express EGFRvIII including, tumor cells of various cancers such as, e.g., glioblastoma (including glioblastoma stem cells); breast, ovarian, and non-small cell lung carcinomas; head and neck squamous cell carcinoma; medulloblastoma, colorectal cancer, prostate cancer, and bladder carcinoma.
  • the CARs disclosed herein provide for one or more of the following: targeting and destroying EGFRv Ill-expressing tumor cells, reducing or eliminating tumors, facilitating infiltration of immune cells to the tumor site, and enhancing/extending anti-tumor responses. Because EGFRvIII is not expressed at detectable levels in normal (i.e., non-cancerous) tissue, it is contemplated that the inventive CARs advantageously substantially avoid targeting/destroying normal tissues and cells.
  • disease associated with expression of mesothelin includes, but is not limited to, a disease associated with expression of mesothelin or condition associated with cells which express mesothelin including, e.g., proliferative diseases such as a cancer or malignancy or a precancerous condition such as a mesothelial hyperplasia; or a noncancer related indication associated with cells which express mesothelin.
  • proliferative diseases such as a cancer or malignancy or a precancerous condition such as a mesothelial hyperplasia
  • a noncancer related indication associated with cells which express mesothelin include but are not limited to, mesothelioma, ovarian cancer, pancreatic cancer, and the like.
  • the tumor antigen (e.g., CD123- or CD19-)-expressing cell expresses, or at any time expressed, mRNA encoding the tumor antigen.
  • the tumor antigen (e.g., CD123- or CD19-)-expressing cell produces the tumor antigen protein (e.g., wild-type or mutant), and the tumor antigen protein may be present at normal levels or reduced levels.
  • the tumor antigen (e.g., CD123- or CD19-)-expressing cell produced detectable levels of a tumor antigen protein at one point, and subsequently produced substantially no detectable tumor antigen protein.
  • conservative sequence modifications refers to amino acid modifications that do not significantly affect or alter the binding characteristics of the antibody or antibody fragment containing the amino acid sequence. Such conservative modifications include amino acid substitutions, additions and deletions. Modifications can be introduced into an antibody or antibody fragment of the invention by standard techniques known in the art, such as site- directed mutagenesis and PCR-mediated mutagenesis. Conservative substitutions are ones in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art.
  • amino acids with basic side chains e.g., lysine, arginine, histidine
  • acidic side chains e.g., aspartic acid, glutamic acid
  • uncharged polar side chains e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan
  • nonpolar side chains e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine
  • beta-branched side chains e.g., threonine, valine, isoleucine
  • aromatic side chains e.g., tyrosine, phenylalanine, tryptophan, histidine.
  • one or more amino acid residues within a CAR of the invention can be replaced with other amino acid residues from the same side chain family and the altered CAR can be tested using the functional assays described herein.
  • stimulation refers to a primary response induced by binding of a stimulatory molecule (e.g., a TCR/CD3 complex) with its cognate ligand thereby mediating a signal transduction event, such as, but not limited to, signal transduction via the TCR/CD3 complex.
  • a stimulatory molecule e.g., a TCR/CD3 complex
  • signal transduction event such as, but not limited to, signal transduction via the TCR/CD3 complex.
  • Stimulation can mediate altered expression of certain molecules, such as
  • the term "stimulatory molecule,” refers to a molecule expressed by a T cell that provides the primary cytoplasmic signaling sequence(s) that regulate primary activation of the TCR complex in a stimulatory way for at least some aspect of the T cell signaling pathway.
  • the primary signal is initiated by, for instance, binding of a TCR/CD3 complex with an MHC molecule loaded with peptide, and which leads to mediation of a T cell response, including, but not limited to, proliferation, activation, differentiation, and the like.
  • a primary cytoplasmic signaling sequence (also referred to as a "primary signaling domain") that acts in a stimulatory manner may contain a signaling motif which is known as immunoreceptor tyrosine- based activation motif or IT AM.
  • IT AM immunoreceptor tyrosine- based activation motif
  • Examples of an IT AM containing primary cytoplasmic signaling sequence that is of particular use in the invention includes, but is not limited to, those derived from TCR zeta, FcR gamma, FcR beta, CD3 gamma, CD3 delta , CD3 epsilon, CD5, CD22, CD79a, CD79b, CD278 (also known as "ICOS”), FcsRI, CD66d, DAP10 and DAP12.
  • the intracellular signaling domain in any one or more CARS of the invention comprises an intracellular signaling sequence, e.g., a primary signaling sequence of CD3-zeta.
  • the primary signaling sequence of CD3-zeta is the sequence provided as SEQ ID NO:9, or the equivalent residues from a non- human species, e.g., mouse, rodent, monkey, ape and the like.
  • the primary signaling sequence of CD3-zeta is the sequence as provided in SEQ ID NO: 10, or the equivalent residues from a non-human species, e.g., mouse, rodent, monkey, ape and the like.
  • an immune system cell such as an accessory cell (e.g., a B-cell, a dendritic cell, and the like) that displays a foreign antigen complexed with major histocompatibility complexes (MHC's) on its surface.
  • MHC's major histocompatibility complexes
  • T-cells may recognize these complexes using their T-cell receptors (TCRs).
  • APCs process antigens and present them to T-cells.
  • intracellular signaling domain refers to an intracellular portion of a molecule.
  • the intracellular signaling domain can generate a signal that promotes an immune effector function of the CAR containing cell, e.g., a CART cell or CAR-expressing NK cell.
  • immune effector function e.g., in a CART cell or CAR-expressing NK cell
  • examples of immune effector function include cytolytic activity and helper activity, including the secretion of cytokines.
  • the intracellular signal domain transduces the effector function signal and directs the cell to perform a specialized function. While the entire intracellular signaling domain can be employed, in many cases it is not necessary to use the entire chain.
  • intracellular signaling domain is thus meant to include any truncated portion of the intracellular signaling domain sufficient to transduce the effector function signal.
  • the intracellular signaling domain can comprise a primary intracellular signaling domain.
  • Exemplary primary intracellular signaling domains include those derived from the molecules responsible for primary stimulation, or antigen dependent simulation.
  • the intracellular signaling domain can comprise a costimulatory intracellular domain.
  • Exemplary costimulatory intracellular signaling domains include those derived from molecules responsible for costimulatory signals, or antigen independent stimulation.
  • a primary intracellular signaling domain can comprise a cytoplasmic sequence of a T cell receptor
  • a costimulatory intracellular signaling domain can comprise cytoplasmic sequence from co-receptor or costimulatory molecule.
  • a primary intracellular signaling domain can comprise a signaling motif which is known as an immunoreceptor tyrosine-based activation motif or IT AM.
  • IT AM immunoreceptor tyrosine-based activation motif
  • ⁇ containing primary cytoplasmic signaling sequences include, but are not limited to, those derived from CD3 zeta, FcR gamma, FcR beta, CD3 gamma, CD3 delta, CD3 epsilon, CD5, CD22, CD79a, CD79b, CD278 ("ICOS”), FcsRI, CD66d, DAP10, and DAP12.
  • zeta or alternatively “zeta chain”, “CD3-zeta” or “TCR-zeta” is defined as the protein provided as GenBan Acc. No. BAG36664.1, or the equivalent residues from a non- human species, e.g., mouse, rodent, monkey, ape and the like, and a "zeta stimulatory domain” or alternatively a "CD3-zeta stimulatory domain” or a “TCR-zeta stimulatory domain” is defined as the amino acid residues from the cytoplasmic domain of the zeta chain that are sufficient to functionally transmit an initial signal necessary for T cell activation.
  • the cytoplasmic domain of zeta comprises residues 52 through 164 of GenBank Acc. No.
  • the "zeta stimulatory domain” or a "CD3-zeta stimulatory domain” is the sequence provided as SEQ ID NO:9. In one aspect, the "zeta stimulatory domain” or a “CD3-zeta stimulatory domain” is the sequence provided as SEQ ID NO: 10.
  • costimulatory molecule refers to the cognate binding partner on a T cell that specifically binds with a costimulatory ligand, thereby mediating a costimulatory response by the T cell, such as, but not limited to, proliferation.
  • Costimulatory molecules are cell surface molecules other than antigen receptors or their ligands that are required for an efficient immune response.
  • Costimulatory molecules include, but are not limited to an a MHC class I molecule, TNF receptor proteins, Immunoglobulin-like proteins, cytokine receptors, integrins, signaling lymphocytic activation molecules (SLAM proteins), activating NK cell receptors, BTLA, a Toll ligand receptor, OX40, CD2, CD7, CD27, CD28, CD30, CD40, CDS, ICAM-1, LFA-1
  • CDl la/CD18 4-1BB (CD137), B7-H3, CDS, ICAM-1, ICOS (CD278), GITR, BAFFR, LIGHT, HVEM (LIGHTR), KIRDS2, SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD 19, CD4, CD8alpha, CD8beta, IL2R beta, IL2R gamma, IL7R alpha, ITGA4, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CDl ld, ITGAE, CD103, ITGAL, CDl la, LFA-1, ITGAM, CDl lb, ITGAX, CDl lc, ITGB 1, CD29, ITGB2, CD18, LFA-1, ITGB7, NKG2D, NKG2C, TNFR2, TRANCE/RANKL, DNAM1 (CD226), SLA
  • a costimulatory intracellular signaling domain refers to the intracellular portion of a costimulatory molecule.
  • the intracellular signaling domain can comprise the entire
  • intracellular portion or the entire native intracellular signaling domain, of the molecule from which it is derived, or a functional fragment thereof.
  • 4- IBB refers to a member of the TNFR superfamily with an amino acid sequence provided as GenBank Acc. No. AAA62478.2, or the equivalent residues from a non- human species, e.g., mouse, rodent, monkey, ape and the like; and a "4-lBB costimulatory domain” is defined as amino acid residues 214-255 of GenBank accno. AAA62478.2, or the equivalent residues from a non-human species, e.g., mouse, rodent, monkey, ape and the like.
  • the "4-lBB costimulatory domain” is the sequence provided as SEQ ID NO:7 or the equivalent residues from a non-human species, e.g., mouse, rodent, monkey, ape and the like.
  • Immuno effector cell refers to a cell that is involved in an immune response, e.g., in the promotion of an immune effector response.
  • immune effector cells include T cells, e.g., alpha/beta T cells and gamma/delta T cells, B cells, natural killer (NK) cells, natural killer T (NKT) cells, mast cells, and myeloic-derived phagocytes.
  • Immuno effector function or immune effector response refers to function or response, e.g., of an immune effector cell, that enhances or promotes an immune attack of a target cell.
  • an immune effector function or response refers a property of a T or NK cell that promotes killing or the inhibition of growth or proliferation, of a target cell.
  • primary stimulation and co-stimulation are examples of immune effector function or response.
  • effector function refers to a specialized function of a cell. Effector function of a T cell, for example, may be cytolytic activity or helper activity including the secretion of cytokines.
  • encoding refers to the inherent property of specific sequences of nucleotides in a polynucleotide, such as a gene, a cDNA, or an mRNA, to serve as templates for synthesis of other polymers and macromolecules in biological processes having either a defined sequence of nucleotides (e.g., rRNA, tRNA and mRNA) or a defined sequence of amino acids and the biological properties resulting therefrom.
  • a gene, cDNA, or RNA encodes a protein if transcription and translation of mRNA corresponding to that gene produces the protein in a cell or other biological system.
  • Both the coding strand, the nucleotide sequence of which is identical to the mRNA sequence and is usually provided in sequence listings, and the non- coding strand, used as the template for transcription of a gene or cDNA, can be referred to as encoding the protein or other product of that gene or cDNA.
  • nucleotide sequence encoding an amino acid sequence includes all nucleotide sequences that are degenerate versions of each other and that encode the same amino acid sequence.
  • the phrase nucleotide sequence that encodes a protein or a RNA may also include introns to the extent that the nucleotide sequence encoding the protein may in some version contain an intron(s).
  • endogenous refers to any material from or produced inside an organism, cell, tissue or system.
  • exogenous refers to any material introduced from or produced outside an organism, cell, tissue or system.
  • expression refers to the transcription and/or translation of a particular nucleotide sequence driven by a promoter.
  • transfer vector refers to a composition of matter which comprises an isolated nucleic acid and which can be used to deliver the isolated nucleic acid to the interior of a cell.
  • Numerous vectors are known in the art including, but not limited to, linear
  • transfer vector includes an autonomously replicating plasmid or a virus.
  • the term should also be construed to further include non-plasmid and non-viral compounds which facilitate transfer of nucleic acid into cells, such as, for example, a polylysine compound, liposome, and the like.
  • viral transfer vectors include, but are not limited to, adenoviral vectors, adeno-associated virus vectors, retroviral vectors, lentiviral vectors, and the like.
  • expression vector refers to a vector comprising a recombinant polynucleotide comprising expression control sequences operatively linked to a nucleotide sequence to be expressed.
  • An expression vector comprises sufficient cis-acting elements for expression; other elements for expression can be supplied by the host cell or in an in vitro expression system.
  • Expression vectors include all those known in the art, including cosmids, plasmids (e.g., naked or contained in liposomes) and viruses (e.g., lentiviruses, retroviruses, adenoviruses, and adeno-associated viruses) that incorporate the recombinant polynucleotide.
  • vector refers to any vehicle that can be used to deliver and/or express a nucleic acid molecule. It can be a transfer vector or an expression vector as described herein.
  • lentivirus refers to a genus of the Retroviridae family. Lentiviruses are unique among the retroviruses in being able to infect non-dividing cells; they can deliver a significant amount of genetic information into the DNA of the host cell, so they are one of the most efficient methods of a gene delivery vector. HIV, SIV, and FIV are all examples of lentiviruses.
  • lentiviral vector refers to a vector derived from at least a portion of a lentivirus genome, including especially a self-inactivating lentiviral vector as provided in Milone et al., Mol. Ther. 17(8): 1453-1464 (2009).
  • Other examples of lentivirus vectors that may be used in the clinic include but are not limited to, e.g., the LENTIVECTOR® gene delivery technology from Oxford BioMedica, the LENTIMAXTM vector system from Lentigen and the like. Nonclinical types of lentiviral vectors are also available and would be known to one skilled in the art.
  • homologous refers to the subunit sequence identity between two polymeric molecules, e.g., between two nucleic acid molecules, such as, two DNA molecules or two RNA molecules, or between two polypeptide molecules.
  • two nucleic acid molecules such as, two DNA molecules or two RNA molecules
  • polypeptide molecules between two polypeptide molecules.
  • a subunit position in both of the two molecules is occupied by the same monomeric subunit; e.g., if a position in each of two DNA molecules is occupied by adenine, then they are homologous or identical at that position.
  • the homology between two sequences is a direct function of the number of matching or homologous positions; e.g., if half (e.g., five positions in a polymer ten subunits in length) of the positions in two sequences are homologous, the two sequences are 50% homologous; if 90% of the positions (e.g., 9 of 10), are matched or homologous, the two sequences are 90% homologous.
  • Humanized forms of non-human (e.g., murine) antibodies are chimeric
  • humanized antibodies and antibody fragments thereof are human immunoglobulins (recipient antibody or antibody fragment) in which residues from a complementary-determining region (CDR) of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat or rabbit having the desired specificity, affinity, and capacity.
  • CDR complementary-determining region
  • donor antibody such as mouse, rat or rabbit having the desired specificity, affinity, and capacity.
  • Fv framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues.
  • a humanized antibody/antibody fragment can comprise residues which are found neither in the recipient antibody nor in the imported CDR or framework sequences.
  • the humanized antibody or antibody fragment thereof will comprise substantially all of at least one, and typically two, variable domains, in which all or
  • substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or a significant portion of the FR regions are those of a human immunoglobulin sequence.
  • the humanized antibody or antibody fragment can also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
  • Fc immunoglobulin constant region
  • Fully human refers to an immunoglobulin, such as an antibody or antibody fragment, where the whole molecule is of human origin or consists of an amino acid sequence identical to a human form of the antibody or immunoglobulin.
  • isolated means altered or removed from the natural state.
  • a nucleic acid or a peptide naturally present in a living animal is not “isolated,” but the same nucleic acid or peptide partially or completely separated from the coexisting materials of its natural state is “isolated.”
  • An isolated nucleic acid or protein can exist in substantially purified form, or can exist in a non-native environment such as, for example, a host cell.
  • the following abbreviations for the commonly occurring nucleic acid bases are used.
  • A refers to adenosine
  • C refers to cytosine
  • G refers to guanosine
  • T refers to thymidine
  • U refers to uridine.
  • operably linked refers to functional linkage between a regulatory sequence and a heterologous nucleic acid sequence resulting in expression of the latter.
  • a first nucleic acid sequence is operably linked with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence.
  • a promoter is operably linked to a coding sequence if the promoter affects the transcription or expression of the coding sequence.
  • Operably linked DNA sequences can be contiguous with each other and, e.g., where necessary to join two protein coding regions, are in the same reading frame.
  • parenteral administration of an immunogenic composition includes, e.g., subcutaneous (s.c), intravenous (i.v.), intramuscular (i.m.), or intrasternal injection, intratumoral, or infusion techniques.
  • nucleic acid refers to deoxyribonucleic acid (DNA) or ribonucleic acid (RNA), or a combination of a DNA or RNA thereof, and polymers thereof in either single- or double- stranded form.
  • nucleic acid includes a gene, cDNA or an mRNA.
  • the nucleic acid molecule is synthetic (e.g., chemically synthesized) or recombinant.
  • nucleic acids containing analogues or derivatives of natural nucleotides that have similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides.
  • a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions), alleles, orthologs, SNPs, and complementary sequences as well as the sequence explicitly indicated.
  • degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et al., Nucleic Acid Res. 19:5081 (1991); Ohtsuka et al., J. Biol. Chem. 260:2605-2608 (1985); and Rossolini et al., Mol. Cell. Probes 8:91-98 (1994)).
  • peptide refers to a compound comprised of amino acid residues covalently linked by peptide bonds.
  • a protein or peptide must contain at least two amino acids, and no limitation is placed on the maximum number of amino acids that can comprise a protein's or peptide's sequence.
  • Polypeptides include any peptide or protein comprising two or more amino acids joined to each other by peptide bonds.
  • the term refers to both short chains, which also commonly are referred to in the art as peptides, oligopeptides and oligomers, for example, and to longer chains, which generally are referred to in the art as proteins, of which there are many types.
  • Polypeptides include, for example, biologically active fragments, substantially homologous polypeptides, oligopeptides, homodimers, heterodimers, variants of polypeptides, modified polypeptides, derivatives, analogs, fusion proteins, among others.
  • a polypeptide includes a natural peptide, a recombinant peptide, or a combination thereof.
  • promoter refers to a DNA sequence recognized by the synthetic machinery of the cell, or introduced synthetic machinery, required to initiate the specific transcription of a polynucleotide sequence.
  • promoter/regulatory sequence refers to a nucleic acid sequence which is required for expression of a gene product operably linked to the promoter/regulatory sequence. In some instances, this sequence may be the core promoter sequence and in other instances, this sequence may also include an enhancer sequence and other regulatory elements which are required for expression of the gene product.
  • the promoter/regulatory sequence may, for example, be one which expresses the gene product in a tissue specific manner.
  • constitutive promoter refers to a nucleotide sequence which, when operably linked with a polynucleotide which encodes or specifies a gene product, causes the gene product to be produced in a cell under most or all physiological conditions of the cell.
  • inducible promoter refers to a nucleotide sequence which, when operably linked with a polynucleotide which encodes or specifies a gene product, causes the gene product to be produced in a cell substantially only when an inducer which corresponds to the promoter is present in the cell.
  • tissue-specific promoter refers to a nucleotide sequence which, when operably linked with a polynucleotide encodes or specified by a gene, causes the gene product to be produced in a cell substantially only if the cell is a cell of the tissue type corresponding to the promoter.
  • cancer associated antigen or “tumor antigen” interchangeably refers to a molecule (typically a protein, carbohydrate or lipid) that is expressed on the surface of a cancer cell, either entirely or as a fragment (e.g., MHC/peptide), and which is useful for the preferential targeting of a pharmacological agent to the cancer cell.
  • a tumor antigen is a marker expressed by both normal cells and cancer cells, e.g., a lineage marker, e.g., CD19 or CD123 on B cells.
  • a tumor antigen is a cell surface molecule that is overexpressed in a cancer cell in comparison to a normal cell, for instance, 1-fold over expression, 2-fold overexpression, 3 -fold overexpression or more in comparison to a normal cell.
  • a tumor antigen is a cell surface molecule that is inappropriately synthesized in the cancer cell, for instance, a molecule that contains deletions, additions or mutations in comparison to the molecule expressed on a normal cell.
  • a tumor antigen will be expressed exclusively on the cell surface of a cancer cell, entirely or as a fragment (e.g., MHC/peptide), and not synthesized or expressed on the surface of a normal cell.
  • the CARs of the present invention includes CARs comprising an antigen binding domain (e.g., antibody or antibody fragment) that binds to a MHC presented peptide.
  • an antigen binding domain e.g., antibody or antibody fragment
  • peptides derived from endogenous proteins fill the pockets of Major histocompatibility complex (MHC) class I molecules, and are recognized by T cell receptors (TCRs) on CD8 + T lymphocytes.
  • MHC Major histocompatibility complex
  • TCRs T cell receptors
  • virus -specific and/or tumor- specific peptide/MHC complexes represent a unique class of cell surface targets for immunotherapy.
  • TCR-like antibodies targeting peptides derived from viral or tumor antigens in the context of human leukocyte antigen (HLA)-Al or HLA-A2 have been described (see, e.g., Sastry et al., J Virol.
  • TCR-like antibody can be identified from screening a library, such as a human scFv phage displayed library.
  • flexible polypeptide linker or "linker” as used in the context of a scFv refers to a peptide linker that consists of amino acids such as glycine and/or serine residues used alone or in combination, to link variable heavy and variable light chain regions together.
  • the flexible polypeptide linkers include, but are not limited to, (Gly4 Ser)4 (SEQ ID NO:27) or (Gly4 Ser)3 (SEQ ID NO:28).
  • the linkers include multiple repeats of (Gly2Ser), (GlySer) or (Gly3Ser) (SEQ ID NO:29). Also included within the scope of the invention are linkers described in WO2012/138475, incorporated herein by reference).
  • a 5' cap (also termed an RNA cap, an RNA 7-methylguanosine cap or an RNA m'G cap) is a modified guanine nucleotide that has been added to the "front" or 5' end of a eukaryotic messenger RNA shortly after the start of transcription.
  • the 5' cap consists of a terminal group which is linked to the first transcribed nucleotide. Its presence is critical for recognition by the ribosome and protection from RNases. Cap addition is coupled to transcription, and occurs co-transcriptionally, such that each influences the other.
  • RNA polymerase Shortly after the start of transcription, the 5' end of the mRNA being synthesized is bound by a cap- synthesizing complex associated with RNA polymerase. This enzymatic complex catalyzes the chemical reactions that are required for mRNA capping. Synthesis proceeds as a multi-step biochemical reaction.
  • the capping moiety can be modified to modulate functionality of mRNA such as its stability or efficiency of translation.
  • in vitro transcribed RNA refers to RNA, preferably mRNA,that has been synthesized in vitro.
  • the in vitro transcribed RNA is generated from an in vitro transcription vector.
  • the in vitro transcription vector comprises a template that is used to generate the in vitro transcribed RNA.
  • poly(A) is a series of adenosines attached by polyadenylation to the mRNA.
  • the polyA is between 50 and 5000 (SEQ ID NO: 30), preferably greater than 64, more preferably greater than 100, most preferably greater than 300 or 400.
  • poly(A) sequences can be modified chemically or enzymatically to modulate mRNA functionality such as localization, stability or efficiency of translation.
  • polyadenylation refers to the covalent linkage of a polyadenylyl moiety, or its modified variant, to a messenger RNA molecule.
  • mRNA messenger RNA
  • the 3' poly(A) tail is a long sequence of adenine nucleotides (often several hundred) added to the pre-mRNA through the action of an enzyme, polyadenylate polymerase.
  • poly(A) tail is added onto transcripts that contain a specific sequence, the polyadenylation signal.
  • Polyadenylation is also important for transcription termination, export of the mRNA from the nucleus, and translation. Polyadenylation occurs in the nucleus immediately after transcription of DNA into RNA, but additionally can also occur later in the cytoplasm.
  • the mRNA chain is cleaved through the action of an endonuclease complex associated with RNA polymerase.
  • the cleavage site is usually characterized by the presence of the base sequence AAUAAA near the cleavage site.
  • adenosine residues are added to the free 3' end at the cleavage site.
  • transient refers to expression of a non-integrated transgene for a period of hours, days or weeks, wherein the period of time of expression is less than the period of time for expression of the gene if integrated into the genome or contained within a stable plasmid replicon in the host cell.
  • the terms “treat”, “treatment” and “treating” refer to the reduction or amelioration of the progression, severity and/or duration of a proliferative disorder, or the amelioration of one or more symptoms (preferably, one or more discernible symptoms) of a proliferative disorder resulting from the administration of one or more therapies (e.g., one or more therapeutic agents such as a CAR of the invention).
  • the terms “treat”, “treatment” and “treating” refer to the amelioration of at least one measurable physical parameter of a proliferative disorder, such as growth of a tumor, not necessarily discernible by the patient.
  • the terms “treat”, “treatment” and “treating” -refer to the inhibition of the progression of a proliferative disorder, either physically by, e.g., stabilization of a discernible symptom, physiologically by, e.g., stabilization of a physical parameter, or both.
  • the terms “treat”, “treatment” and “treating” refer to the reduction or stabilization of tumor size or cancerous cell count.
  • a dosage regimen e.g., a therapeutic dosage regimen, can include one or more treatment intervals.
  • the dosage regimen can result in at least one beneficial or desired clinical result including, but are not limited to, alleviation of a symptom, diminishment of extent of disease, stabilized (i.e., not worsening) state of disease, delay or slowing of disease
  • a "treatment interval" refers to a treatment cycle, for example, a course of administration of a therapeutic agent that can be repeated, e.g., on a regular schedule.
  • a dosage regimen can have one or more periods of no administration of the therapeutic agent in between treatment intervals.
  • a treatment interval can include one dose of a CAR molecule administered in combination with (prior, concurrently or after) administration of a second therapeutic agent, e.g., an inhibitor (e.g., a kinase inhibitor as described herein).
  • signal transduction pathway refers to the biochemical relationship between a variety of signal transduction molecules that play a role in the transmission of a signal from one portion of a cell to another portion of a cell.
  • cell surface receptor includes molecules and complexes of molecules capable of receiving a signal and transmitting signal across the membrane of a cell.
  • subject is intended to include living organisms in which an immune response can be elicited (e.g., mammals, human).
  • substantially purified cell refers to a cell that is essentially free of other cell types.
  • a substantially purified cell also refers to a cell which has been separated from other cell types with which it is normally associated in its naturally occurring state.
  • a population of substantially purified cells refers to a homogenous population of cells. In other instances, this term refers simply to cell that have been separated from the cells with which they are naturally associated in their natural state.
  • the cells are cultured in vitro. In other aspects, the cells are not cultured in vitro.
  • terapéutica as used herein means a treatment.
  • a therapeutic effect is obtained by reduction, suppression, remission, or eradication of a disease state.
  • a disease state treated includes CRS.
  • treatment of CRS includes administration of a composition or combination described herein after the onset, e.g., after detection of, one or more CRS symptoms.
  • treatment of CRS results in a reduction in the severity of CRS, e.g., relative to a subject not administered the composition or combination described herein.
  • the subject may reduce CRS to an undetectable level.
  • the treatment results in a less severe form of CRS, e.g., grade 1, 2, or 3 CRS.
  • prophylaxis means the prevention of or protective treatment for a disease or disease state. Prevention of a disease or disease state can include reduction (e.g., mitigation) of one or more symptoms of the disease or disease state, e.g., relative to a reference level (e.g., the symptom(s) in a similar subject not administered the treatment).
  • Prevention can also include delaying onset of one or more symptoms of the disease or disease state, e.g., relative to a reference level (e.g., the onset of the symptom(s) in a similar subject not administered the treatment).
  • a disease is a disease described herein.
  • a disease state prevented includes CRS.
  • prevention of CRS includes administration of a composition or combination described herein prior to, e.g., prior to detection or onset of, one or more CRS symptoms.
  • administration of the JAK-STAT inhibitor or the BTK inhibitor occurs prior to the CAR therapy.
  • prevention of CRS results in a reduction in the likelihood or severity of CRS, e.g., relative to a subject not administered the composition or combination described herein.
  • the subject may not develop CRS.
  • the subject develops a less severe form of CRS, e.g., grade 1, 2, or 3 CRS, e.g., relative to a subject not administered the composition or combination described herein.
  • tumor antigen or “hyperproliferative disorder antigen” or “antigen associated with a hyperproliferative disorder” refers to antigens that are common to specific hyperproliferative disorders.
  • the hyperproliferative disorder antigens of the present invention are derived from, cancers including but not limited to primary or metastatic melanoma, thymoma, lymphoma, sarcoma, lung cancer, liver cancer, non-Hodgkin lymphoma, non-Hodgkin lymphoma, leukemias, uterine cancer, cervical cancer, bladder cancer, kidney cancer and adenocarcinomas such as breast cancer, prostate cancer, ovarian cancer, pancreatic cancer, and the like.
  • transfected or “transformed” or “transduced” refers to a process by which exogenous nucleic acid is transferred or introduced into the host cell.
  • a “transfected” or “transformed” or “transduced” cell is one which has been transfected, transformed or transduced with exogenous nucleic acid.
  • the cell includes the primary subject cell and its progeny.
  • the term “specifically binds,” refers to an antibody, or a ligand, which recognizes and binds with a cognate binding partner (e.g., a stimulatory and/or costimulatory molecule present on a T cell) protein present in a sample, but which antibody or ligand does not substantially recognize or bind other molecules in the sample.
  • a cognate binding partner e.g., a stimulatory and/or costimulatory molecule present on a T cell
  • RCAR Regular chimeric antigen receptor
  • an RCAR comprises at least an extracellular antigen binding domain, a transmembrane and a cytoplasmic signaling domain (also referred to herein as "an intracellular signaling domain") comprising a functional signaling domain derived from a stimulatory molecule and/or costimulatory molecule as defined herein in the context of a CAR molecule.
  • the RCAR includes a dimerization switch that, upon the presence of a dimerization molecule, can couple the polypeptides to one another, e.g., can couple an antigen binding domain to an intracellular signaling domain.
  • the RCAR is expressed in a cell (e.g., an immune effector cell) as described herein, e.g., an RCAR-expressing cell (also referred to herein as "RCARX cell").
  • the RCARX cell is a T cell, and is referred to as a RCART cell.
  • the RCARX cell is an NK cell, and is referred to as a RCARN cell.
  • the RCAR can provide the RCAR- expressing cell with specificity for a target cell, typically a cancer cell, and with regulatable intracellular signal generation or proliferation, which can optimize an immune effector property of the RCAR-expressing cell.
  • an RCAR cell relies at least in part, on an antigen binding domain to provide specificity to a target cell that comprises the antigen bound by the antigen binding domain.
  • Membrane anchor or “membrane tethering domain”, as that term is used herein, refers to a polypeptide or moiety, e.g., a myristoyl group, sufficient to anchor an extracellular or intracellular domain to the plasma membrane.
  • Switch domain refers to an entity, typically a polypeptide-based entity, that, in the presence of a dimerization molecule, associates with another switch domain. The association results in a functional coupling of a first entity linked to, e.g., fused to, a first switch domain, and a second entity linked to, e.g., fused to, a second switch domain.
  • a first and second switch domain are collectively referred to as a dimerization switch.
  • the first and second switch domains are the same as one another, e.g., they are polypeptides having the same primary amino acid sequence, and are referred to collectively as a homodimerization switch. In embodiments, the first and second switch domains are different from one another, e.g., they are polypeptides having different primary amino acid sequences, and are referred to collectively as a heterodimerization switch. In embodiments, the switch is intracellular. In embodiments, the switch is extracellular. In embodiments, the switch domain is a polypeptide-based entity, e.g., FKBP or FRB-based, and the dimerization molecule is small molecule, e.g., a rapalogue. In embodiments, the switch domain is a polypeptide-based entity, e.g., an scFv that binds a myc peptide, and the
  • dimerization molecule is a polypeptide, a fragment thereof, or a multimer of a polypeptide, e.g., a myc ligand or multimers of a myc ligand that bind to one or more myc scFvs.
  • the switch domain is a polypeptide-based entity, e.g., myc receptor, and the dimerization molecule is an antibody or fragments thereof, e.g., myc antibody.
  • dimerization molecule refers to a molecule that promotes the association of a first switch domain with a second switch domain.
  • the dimerization molecule does not naturally occur in the subject, or does not occur in concentrations that would result in significant dimerization.
  • the dimerization molecule is a small molecule, e.g., rapamycin or a rapalogue, e.g, RAD001.
  • bioequivalent refers to an amount of an agent other than the reference compound (e.g., RAD001), required to produce an effect equivalent to the effect produced by the reference dose or reference amount of the reference compound (e.g., RAD001).
  • the effect is the level of mTOR inhibition, e.g., as measured by P70 S6 kinase inhibition, e.g., as evaluated in an in vivo or in vitro assay, e.g., as measured by an assay described herein, e.g., the Boulay assay, or measurement of phosphorylated S6 levels by western blot.
  • the effect is alteration of the ratio of PD-1 positive/PD-1 negative immune effector cells, e.g., T cells or NK cells, as measured by cell sorting.
  • a bioequivalent amount or dose of an mTOR inhibitor is the amount or dose that achieves the same level of P70 S6 kinase inhibition as does the reference dose or reference amount of a reference compound.
  • a bioequivalent amount or dose of an mTOR inhibitor is the amount or dose that achieves the same level of alteration in the ratio of PD-1 positive/PD-1 negative immune effector cells, e.g., T cells or NK cells as does the reference dose or reference amount of a reference compound.
  • low, immune enhancing, dose when used in conjuction with an mTOR inhibitor, e.g., an allosteric mTOR inhibitor, e.g., RAD001 or rapamycin, or a catalytic mTOR inhibitor, refers to a dose of mTOR inhibitor that partially, but not fully, inhibits mTOR activity, e.g., as measured by the inhibition of P70 S6 kinase activity. Methods for evaluating mTOR activity, e.g., by inhibition of P70 S6 kinase, are discussed herein. The dose is insufficient to result in complete immune suppression but is sufficient to enhance the immune response.
  • an mTOR inhibitor e.g., an allosteric mTOR inhibitor, e.g., RAD001 or rapamycin, or a catalytic mTOR inhibitor
  • the low, immune enhancing, dose of mTOR inhibitor results in a decrease in the number of PD-1 positive immune effector cells, e.g., T cells or NK cells, and/or an increase in the number of PD-1 negative immune effector cells, e.g., T cells or NK cells, or an increase in the ratio of PD-1 negative T cells/PD-1 positive immune effector cells, e.g., T cells or NK cells.
  • the low, immune enhancing, dose of mTOR inhibitor results in an increase in the number of naive immune effector cells, e.g., T cells or NK cells. In an embodiment, the low, immune enhancing, dose of mTOR inhibitor results in one or more of the following:
  • KLRG1 a decrease in the expression of KLRG1, e.g., on memory T cells, e.g., memory T cell precursors;
  • an increase in the number of memory T cell precursors e.g., cells with any one or combination of the following characteristics: increased CD62L hlgh , increased CD127 hlgh , increased CD27 + , decreased KLRG1, and increased BCL2;
  • any of the changes described above occurs, e.g., at least transiently, e.g., as compared to a non-treated subject.
  • Refractory refers to a disease, e.g., cancer, that does not respond to a treatment.
  • a refractory cancer can be resistant to a treatment before or at the beginning of the treatment. In other embodiments, the refractory cancer can become resistant during a treatment.
  • a refractory cancer is also called a resistant cancer.
  • Relapsed refers to the return or reappearance of a disease (e.g., cancer) or the signs and symptoms of a disease such as cancer after a period of improvement or responsiveness, e.g., after prior treatment of a therapy, e.g., cancer therapy.
  • the initial period of responsiveness may involve the level of cancer cells falling below a certain threshold, e.g., below 20%, 1%, 10%, 5%, 4%, 3%, 2%, or 1%.
  • the reappearance may involve the level of cancer cells rising above a certain threshold, e.g., above 20%, 1%, 10%, 5%, 4%, 3%, 2%, or 1%.
  • the reappearance may involve, e.g., a reappearance of blasts in the blood, bone marrow (> 5%), or any extramedullary site, after a complete response.
  • a complete response in this context, may involve ⁇ 5% BM blast.
  • a response e.g., complete response or partial response
  • the initial period of responsiveness lasts at least 1, 2, 3, 4, 5, or 6 days; at least 1, 2, 3, or 4 weeks; at least 1, 2, 3, 4, 6, 8, 10, or 12 months; or at least 1, 2, 3, 4, or 5 years.
  • a therapy that includes a CD 19 inhibitor may relapse or be refractory to treatment.
  • the relapse or resistance can be caused by CD19 loss (e.g., an antigen loss mutation) or other CD19 alteration that reduces the level of CD19 (e.g., caused by clonal selection of CD19-negative clones).
  • CD19 loss e.g., an antigen loss mutation
  • CD19 alteration that reduces the level of CD19 (e.g., caused by clonal selection of CD19-negative clones).
  • a cancer that harbors such CD 19 loss or alteration is referred to herein as a "CD19-negative cancer” or a "CD19-negative relapsed cancer”).
  • a CD19-negative cancer need not have 100% loss of CD19, but a sufficient reduction to reduce the effectiveness of a CD19 therapy such that the cancer relapses or becomes refractory.
  • a CD19-negative cancer results from a CD 19 CAR therapy.
  • JAK-STAT refers to the JAK-STAT signaling pathway and/or one or more kinase in the JAK-STAT pathway. The JAK-STAT signaling pathway and its components are described in greater detail herein.
  • ranges throughout this disclosure, various aspects of the invention can be presented in a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the invention. Accordingly, the description of a range should be considered to have specifically disclosed all the possible subranges as well as individual numerical values within that range. For example, description of a range such as from 1 to 6 should be considered to have specifically disclosed subranges such as from 1 to 3, from 1 to 4, from 1 to 5, from 2 to 4, from 2 to 6, from 3 to 6 etc., as well as individual numbers within that range, for example, 1, 2, 2.7, 3, 4, 5, 5.3, and 6.
  • a range such as 95-99% identity includes something with 95%, 96%, 97%, 98% or 99% identity, and includes subranges such as 96-99%, 96-98%, 96-97%, 97-99%, 97-98% and 98-99% identity. This applies regardless of the breadth of the range.
  • the method can include administration of a CAR described herein in combination with a kinase inhibitor, e.g., inhibitor of JAK-STAT or BTK.
  • a kinase inhibitor e.g., inhibitor of JAK-STAT or BTK.
  • CAR chimeric antigen receptor
  • Example 3 herein describes that in CAR T cell-associated CRS, IL-6 is produced by antigen presenting cells (myeloid cells) and that IL-6 presence or absence (e.g., as measured by degranulation in the presence or absence of APCs) did not affect CART function. Accordingly, in some embodiments, a CAR described herein is administered in combination with an IL-6 inhibitor, e.g., tocilizumab. In embodiments, methods described herein provide for early administration of an IL-6 inhibitor, e.g., tocilizumab, to prevent CRS associated with CAR therapy.
  • an IL-6 inhibitor e.g., tocilizumab
  • early administration include administration prior to a CAR therapy, at the same time as a CAR therapy dose, or up until a first sign of a fever (e.g., after a CAR therapy dose).
  • the combination of CAR and IL-6 inhibitor described herein can further comprise a kinase inhibitor, e.g., a kinase inhibitor as described herein.
  • a chimeric antigen receptor comprising an antibody or antibody fragment engineered for specific binding to an antigen (e.g., CD123 protein or CD19 protein or fragments thereof) can be used in accordance with any method or composition described herein.
  • the invention provides a cell (e.g., an immune effector cell, e.g., a T cell or a NK cell) engineered to express a CAR, wherein the CAR-expressing cell (e.g., "CART" or CAR-expressing NK cell) exhibits an antitumor property.
  • a cell is transformed with the CAR and the at least part of the CAR is expressed on the cell surface.
  • the cell e.g., immune effector cell, e.g., T cell or NK cell
  • a viral vector encoding a CAR.
  • the viral vector is a retroviral vector.
  • the viral vector is a lentiviral vector.
  • the cell may stably express the CAR.
  • the cell e.g., immune effector cell, e.g., T cell or NK cell
  • a nucleic acid e.g., mRNA, cDNA, DNA, encoding a CAR.
  • the cell may transiently express the CAR.
  • the antigen binding domain e.g., CD123 binding domain or CD19 binding domain
  • the human or humanized CD 123 binding domain or CD 19 binding domain of the CAR is a scFv antibody fragment.
  • such antibody fragments are functional in that they retain the equivalent binding affinity, e.g., they bind the same antigen with comparable efficacy, as the IgG antibody having the same heavy and light chain variable regions.
  • such antibody fragments are functional in that they provide a biological response that can include, but is not limited to, activation of an immune response, inhibition of signal-transduction origination from its target antigen, inhibition of kinase activity, and the like, as will be understood by a skilled artisan.
  • the antibodies of the invention are incorporated into a chimeric antigen receptor (CAR).
  • CAR chimeric antigen receptor
  • the CAR is a CD 123 CAR and comprises the polypeptide sequence provided herein as SEQ ID NOS: 98-101, and 125-156.
  • the antigen binding domain (CD123 or CD19 binding domain, e.g., humanized or human CD 123 or CD 19 binding domain) portion of a CAR of the invention is encoded by a transgene whose sequence has been codon optimized for expression in a mammalian cell.
  • entire CAR construct of the invention is encoded by a transgene whose entire sequence has been codon optimized for expression in a mammalian cell. Codon optimization refers to the discovery that the frequency of occurrence of synonymous codons (i.e., codons that code for the same amino acid) in coding DNA is biased in different species. Such codon degeneracy allows an identical polypeptide to be encoded by a variety of nucleotide sequences.
  • the antigen binding domain of the CAR comprises a human CD 123 antibody or antibody fragment or a human CD 19 antibody or antibody fragment. In one aspect, the antigen binding domain of the CAR comprises a humanized CD 123 or CD 19 antibody or antibody fragment. In one aspect, the antigen binding domain of the CAR comprises human CD 123 or CD 19 antibody fragment comprising an scFv. In one aspect, the antigen binding domain of the CAR is a human CD 123 scFv or a human CD 19 scFv.
  • the antigen binding domain of the CAR comprises a humanized CD 123 or CD 19 antibody fragment comprising an scFv. In one aspect, the antigen binding domain of the CAR is a humanized CD123 scFv or CD19 scFv.
  • the CAR123 binding domain comprises the scFv portion provided in SEQ ID NO: 1
  • the scFv portion is human.
  • the human CAR123 binding domain comprises the scFv portion provided in SEQ ID NO: 157- 160.
  • the human CD 123 binding domain comprises the scFv portion provided in SEQ ID NO: 478, 480, 483, or 485.
  • the scFv portion is humanized.
  • the humanized CAR123 binding domain comprises the scFv portion provided in SEQ ID NO: 184-215.
  • the humanized CD123 binding domain comprises the scFv portion provided in SEQ ID NOs: 556-587.
  • the present invention provides CD 123 CAR compositions and their use in medicaments or methods for treating, among other diseases, cancer or any malignancy or autoimmune diseases involving cells or tissues which express CD 123.
  • the CAR of the invention can be used to eradicate CD123-expressing normal cells, thereby applicable for use as a cellular conditioning therapy prior to cell transplantation.
  • the CD123-expressing normal cell is a CD123-expressing expressing myeloid progenitor cell and the cell transplantation is a stem cell transplantation.
  • the invention provides a cell (e.g., an immune effector cell, e.g., a T cell or NK cell) engineered to express a chimeric antigen receptor (e.g., CAR-expressing immune effector cell, e.g., CART or CAR-expressing NK cell) of the present invention, wherein the cell (e.g., "CART") exhibits an antitumor property.
  • a cell e.g., an immune effector cell, e.g., a T cell or NK cell
  • a chimeric antigen receptor e.g., CAR-expressing immune effector cell, e.g., CART or CAR-expressing NK cell
  • the invention provides a CD 123- CAR that comprises a CD 123 binding domain and is engineered into an immune effector cell, e.g., a T cell or a NK cell, and methods of their use for adoptive therapy.
  • the CD123-CAR comprises at least one intracellular domain, e.g., described herein, e.g., selected from the group of a CD137 (4-1BB) signaling domain, a CD28 signaling domain, a CD3zeta signal domain, and any combination thereof.
  • the CD 123 -CAR comprises at least one intracellular signaling domain is from one or more co- stimulatory molecule(s) other than a CD137 (4-1BB) or CD28.
  • a CAR molecule comprises a CD123 CAR described herein, e.g., a CD123 CAR described in US2014/0322212A1 or US2016/0068601A1, both incorporated herein by reference.
  • the CD 123 CAR comprises an amino acid, or has a nucleotide sequence shown in US2014/0322212A1 or US2016/0068601A1, both incorporated herein by reference.
  • a CAR molecule comprises a CD19 CAR molecule described herein, e.g., a CD19 CAR molecule described in US-2015-0283178-A1, e.g., CTL019.
  • the CD19 CAR comprises an amino acid, or has a nucleotide sequence shown in US-2015-
  • CAR molecule comprises a BCMA CAR molecule described herein, e.g., a BCMA CAR described in US-2016-0046724- Al.
  • the BCMA CAR comprises an amino acid, or has a nucleotide sequence shown in US-2016-0046724-A1, incorporated herein by reference.
  • the CAR molecule comprises a CLL1 CAR described herein, e.g., a CLL1 CAR described in US2016/0051651A1, incorporated herein by reference.
  • the CLL1 CAR comprises an amino acid, or has a nucleotide sequence shown in US2016/0051651A1, incorporated herein by reference.
  • the CAR molecule comprises a CD33 CAR described herein, e.ga CD33 CAR described in US2016/0096892A1, incorporated herein by reference.
  • the CD33 CAR comprises an amino acid, or has a nucleotide sequence shown in US2016/0096892A1, incorporated herein by reference.
  • the CAR molecule comprises an EGFRvIII CAR molecule described herein, e.g., an EGFRvIII CAR described US2014/0322275A1, incorporated herein by reference.
  • the EGFRvIII CAR comprises an amino acid, or has a nucleotide sequence shown in
  • the CAR molecule comprises a mesothelin CAR described herein, e.g., a mesothelin CAR described in WO 2015/090230, incorporated herein by reference.
  • the mesothelin CAR comprises an amino acid, or has a nucleotide sequence shown in WO 2015/090230, incorporated herein by reference.
  • the present invention encompasses a recombinant DNA construct comprising sequences encoding a CAR, wherein the CAR comprises an antigen binding domain (e.g., antibody, antibody fragment) that binds specifically to CD123 or a fragment thereof, e.g., human CD123, wherein the sequence of the CD123 binding domain (e.g., antibody or antibody fragment) is, e.g., contiguous with and in the same reading frame as a nucleic acid sequence encoding an intracellular signaling domain.
  • the intracellular signaling domain can comprise a costimulatory signaling domain and/or a primary signaling domain, e.g., a zeta chain.
  • the costimulatory signaling domain refers to a portion of the CAR comprising at least a portion of the intracellular domain of a costimulatory molecule.
  • a CAR construct of the invention comprises a scFv domain selected from the group consisting of SEQ ID NOS: 157-160,184-215, 478, 480, 483, 485, and 556-587 wherein the scFv may be preceded by an optional leader sequence such as provided in SEQ ID NO: 1, and followed by an optional hinge sequence such as provided in SEQ ID NO:2 or SEQ ID NO:3 or SEQ ID NO:4 or SEQ ID NO:5, a transmembrane region such as provided in SEQ ID NO:6, an intracellular signalling domain that includes SEQ ID NO:7 or SEQ ID NO:8 and a CD3 zeta sequence that includes SEQ ID NO:9 or SEQ ID NO: 10, e.g., wherein the domains are contiguous with and in the same reading frame to form a single fusion protein.
  • the scFv domain is a human scFv domain selected from the group consisting of SEQ ID NOS: 157-160, 478, 480, 483, and 485. In some embodiments, the scFv domain is a humanized scFv domain selected from the group consisting of SEQ ID NOS: 184-215 and 556- 587. Also included in the invention is a nucleotide sequence that encodes the polypeptide of each of the scFv fragments selected from the group consisting of SEQ ID NO: 157-160, 184- 215, 478, 480, 483, 485, and 556-587.
  • nucleotide sequence that encodes the polypeptide of each of the scFv fragments selected from the group consisting of SEQ ID NO: 157-160, 184-215, 478, 480, 483, 485, and 556-587, and each of the domains of SEQ ID NOS: 1,2, and 6-9, plus the encoded CD 123 CAR of the invention.
  • an exemplary CD123CAR constructs comprise an optional leader sequence, an extracellular antigen binding domain, a hinge, a transmembrane domain, and an intracellular stimulatory domain.
  • an exemplary CD123CAR construct comprises an optional leader sequence, an extracellular antigen binding domain, a hinge, a transmembrane domain, an intracellular costimulatory domain and an intracellular stimulatory domain.
  • full-length CD 123 CAR sequences are also provided herein as SEQ ID NOS: 98-101 and 125-156, as shown in Table 11A or 12A.
  • An exemplary leader sequence is provided as SEQ ID NO: 1.
  • An exemplary leader sequence is provided as SEQ ID NO: 1.
  • SEQ ID NO:2 SEQ ID NO:3 or SEQ ID NO:4 or SEQ ID NO:5.
  • An exemplary transmembrane domain sequence is provided as SEQ ID NO:6.
  • An exemplary sequence of the intracellular signaling domain of the 4- IBB protein is provided as SEQ ID NO: 7.
  • An exemplary sequence of the intracellular signaling domain of CD27 is provided as SEQ ID NO:8.
  • An exemplary CD3zeta domain sequence is provided as SEQ ID NO: 9 or SEQ ID NO: 10.
  • An exemplary sequence of the intracellular signaling domain of CD28 is provided as SEQ ID NO:43.
  • An exemplary sequence of the intracellular signaling domain of ICOS is provided as SEQ ID NO:45.
  • the present invention encompasses a recombinant nucleic acid construct comprising a nucleic acid molecule encoding a CAR, wherein the nucleic acid molecule comprises the nucleic acid sequence encoding a CD 123 binding domain, e.g., described herein, e.g., that is contiguous with and in the same reading frame as a nucleic acid sequence encoding an intracellular signaling domain.
  • a CD 123 binding domain is selected from one or more of SEQ ID NOS: 157-160, 184-215, 478, 480, 483, 485, and 556-587.
  • the CD 123 binding domain is a human CD 123 binding domain selected from the group consisting of SEQ ID NOS: 157-160, 478, 480, 483, and 485. In some embodiments, the CD 123 binding domain is a humanized CD 123 binding domain selected from the group consisting of SEQ ID NOS: 184-215 and 556-587.
  • the present invention encompasses a recombinant nucleic acid construct comprising a nucleic acid molecule encoding a CAR, wherein the nucleic acid molecule comprises a nucleic acid sequence encoding a CD 123 binding domain, e.g., wherein the sequence is contiguous with and in the same reading frame as the nucleic acid sequence encoding an intracellular signaling domain.
  • An exemplary intracellular signaling domain that can be used in the CAR includes, but is not limited to, one or more intracellular signaling domains of, e.g., CD3-zeta, CD28, 4-lBB, ICOS, and the like.
  • the CAR can comprise any combination of CD3-zeta, CD28, 4- IBB, ICOS, and the like.
  • the nucleic acid sequence of a CAR construct of the invention is selected from one or more of SEQ ID NOS:39-42 and 66-97.
  • the nucleic acid sequences coding for the desired molecules can be obtained using recombinant methods known in the art, such as, for example by screening libraries from cells expressing the gene, by deriving the gene from a vector known to include the same, or by isolating directly from cells and tissues containing the same, using standard techniques.
  • the nucleic acid of interest can be produced synthetically, rather than cloned.
  • the present disclosure encompasses immune effector cells (e.g., T cells or NK cells) comprising a CAR molecule that targets, e.g., specifically binds, to CD19 (CD19 CAR).
  • the immune effector cells are engineered to express the CD 19 CAR.
  • the immune effector cells comprise a recombinant nucleic acid construct comprising nucleic acid sequences encoding the CD 19 CAR.
  • the CD 19 CAR comprises an antigen binding domain that specifically binds to CD19, e.g., CD19 binding domain, a transmembrane domain, and an intracellular signaling domain.
  • the sequence of the antigen binding domain is contiguous with and in the same reading frame as a nucleic acid sequence encoding an intracellular signaling domain.
  • the intracellular signaling domain can comprise a
  • costimulatory signaling domain and/or a primary signaling domain, e.g., a zeta chain.
  • the costimulatory signaling domain refers to a portion of the CAR comprising at least a portion of the intracellular domain of a costimulatory molecule.
  • exemplary CAR constructs comprise an optional leader sequence (e.g., a leader sequence described herein), an extracellular antigen binding domain (e.g., an antigen binding domain described herein), a hinge (e.g., a hinge region described herein), a
  • an exemplary CAR construct comprises an optional leader sequence (e.g., a leader sequence described herein), an extracellular antigen binding domain (e.g., an antigen binding domain described herein), a hinge (e.g., a hinge region described herein), a transmembrane domain (e.g., a transmembrane domain described herein), an intracellular costimulatory signaling domain (e.g., a costimulatory signaling domain described herein) and/or an intracellular primary signaling domain (e.g., a primary signaling domain described herein).
  • leader sequence e.g., a leader sequence described herein
  • an extracellular antigen binding domain e.g., an antigen binding domain described herein
  • a hinge e.g., a hinge region described herein
  • a transmembrane domain e.g., a transmembrane domain described herein
  • an intracellular costimulatory signaling domain e.g., a costimulatory
  • the CD 19 CARs of the invention comprise at least one intracellular signaling domain selected from the group of a CD137 (4-1BB) signaling domain, a CD28 signaling domain, a CD27 signaling domain, an ICOS signaling domain, a CD3zeta signal domain, and any combination thereof.
  • the CARs of the invention comprise at least one intracellular signaling domain is from one or more costimulatory molecule(s) selected from CD137 (4-1BB), CD28, CD27, or ICOS.
  • the present invention includes retroviral and lentiviral vector constructs expressing a CAR that can be directly transduced into a cell.
  • the present invention also includes an RNA construct that can be directly transfected into a cell.
  • a method for generating mRNA for use in transfection involves in vitro
  • RNA so produced can efficiently transfect different kinds of cells.
  • the template includes sequences for the CAR.
  • an RNA CAR vector is transduced into a T cell by electroporation.
  • the CAR of the invention comprises a target- specific binding element otherwise referred to as an antigen binding domain.
  • the choice of moiety depends upon the type and number of ligands that define the surface of a target cell.
  • the antigen binding domain may be chosen to recognize a ligand that acts as a cell surface marker on target cells associated with a particular disease state.
  • examples of cell surface markers that may act as ligands for the antigen binding domain in a CAR of the invention include those associated with viral, bacterial and parasitic infections, autoimmune disease and cancer cells.
  • the CAR-mediated T-cell response can be directed to an antigen of interest by way of engineering an antigen binding domain that specifically binds a desired antigen into the CAR.
  • the portion of the CAR comprising the antigen binding domain comprises an antigen binding domain that targets a tumor antigen, e.g., a tumor antigen described herein.
  • the portion of the CAR comprising the antigen binding domain comprises an antigen binding domain that targets CD 123 or a fragment thereof.
  • the antigen binding domain targets human CD 123 or a fragment thereof.
  • the antigen binding domain targets a B cell antigen (e.g., B cell surface antigen), e.g., CD10, CD19, CD20, CD22, CD34, CD123, FLT-3, ROR1, CD79b, CD179b, or CD79a.
  • the antigen binding domain can be any domain that binds to the antigen including but not limited to a monoclonal antibody, a polyclonal antibody, a recombinant antibody, a human antibody, a humanized antibody, and a functional fragment thereof, including but not limited to a single-domain antibody such as a heavy chain variable domain (VH), a light chain variable domain (VL) and a variable domain (VHH) of camelid derived nanobody, and to an alternative scaffold known in the art to function as antigen binding domain, such as a recombinant fibronectin domain, and the like.
  • VH heavy chain variable domain
  • VL light chain variable domain
  • VHH variable domain
  • it is beneficial for the antigen binding domain to be derived from the same species in which the CAR will ultimately be used in.
  • the antigen binding domain comprises one, two three (e.g., all three) heavy chain CDRs, HC CDR1, HC CDR2 and HC CDR3, from an antibody described herein (e.g., an antibody described in WO2015/142675, US-2015-0283178-A1, US-2016- 0046724-A1, US2014/0322212A1, US2016/0068601A1, US2016/0051651A1,
  • the antigen binding domain comprises a heavy chain variable region and/or a variable light chain region of an antibody listed above.
  • the antigen binding domain is an antigen binding domain described in WO2015/142675, US-2015-0283178-A1, US-2016-0046724-A1, US2014/0322212A1, US2016/0068601A1, US2016/0051651A1, US2016/0096892A1, US2014/0322275A1, or WO2015/090230, incorporated herein by reference.
  • the antigen binding domain targets BCMA and is described in US- 2016-0046724-A1.
  • the antigen binding domain targets CD19 and is described in US- 2015-0283178-A1.
  • the antigen binding domain targets CD 123 and is described in
  • the antigen binding domain targets CLL and is described in
  • the antigen binding domain targets CD33 and is described in
  • target antigens that can be targeted using the CAR-expressing cells, include, but are not limited to, CD19, CD123, EGFRvIII, CD33, mesothelin, BCMA, and GFR
  • ALPHA-4 among others, as described in, for example, WO2014/153270, WO 2014/130635, WO2016/028896, WO 2014/130657, WO2016/014576, WO 2015/090230, WO2016/014565, WO2016/014535, and WO2016/025880, each of which is herein incorporated by reference in its entirety.
  • the CAR-expressing cells can specifically bind to humanized CD19, e.g., can include a CAR molecule, or an antigen binding domain (e.g., a humanized antigen binding domain) according to Table 3 of WO2014/153270, incorporated herein by reference.
  • the amino acid and nucleotide sequences encoding the CD 19 CAR molecules and antigen binding domains are specified in WO2014/153270.
  • the CAR-expressing cells can specifically bind to CD123, e.g., can include a CAR molecule (e.g., any of the CAR1 to CAR8), or an antigen binding domain according to Tables 1-2 of WO 2014/130635, incorporated herein by reference.
  • the amino acid and nucleotide sequences encoding the CD 123 CAR molecules and antigen binding domains are specified in WO 2014/130635.
  • the CAR-expressing cells can specifically bind to CD123, e.g., can include a CAR molecule (e.g., any of the CAR123- 1 ro CAR123-4 and hzCAR123-l to hzCAR123-32), or an antigen binding domain according to Tables 2, 6, and 9 of
  • WO2016/028896 incorporated herein by reference.
  • the amino acid and nucleotide sequences encoding the CD123 CAR molecules and antigen binding domains are specified in WO2016/028896.
  • the CAR-expressing cells can specifically bind to EGFRvIII, e.g., can include a CAR molecule, or an antigen binding domain according to Table 2 or SEQ ID NO: 11 of WO 2014/130657, incorporated herein by reference.
  • the amino acid and nucleotide sequences encoding the EGFRvIII CAR molecules and antigen binding domains are specified in WO 2014/130657.
  • the CAR-expressing cells can specifically bind to CD33, e.g., can include a CAR molecule (e.g., any of CAR33-1 to CAR-33-9), or an antigen binding domain according to Table 2 or 9 of WO2016/014576, incorporated herein by reference.
  • the amino acid and nucleotide sequences encoding the CD33 CAR molecules and antigen binding domains are specified in WO2016/014576.
  • the CAR-expressing cells can specifically bind to mesothelin, e.g., can include a CAR molecule, or an antigen binding domain according to Tables 2-3 of WO 2015/090230, incorporated herein by reference.
  • the amino acid and nucleotide sequences encoding the mesothelin CAR molecules and antigen binding domains are specified in WO 2015/090230.
  • the CAR-expressing cells can specifically bind to BCMA, e.g., can include a CAR molecule, or an antigen binding domain according to Table 1 or 16, SEQ ID NO: 271 or SEQ ID NO: 273 of WO2016/014565, incorporated herein by reference.
  • the amino acid and nucleotide sequences encoding the BCMA CAR molecules and antigen binding domains are specified in WO2016/014565.
  • the CAR-expressing cells can specifically bind to CLL-1, e.g., can include a CAR molecule, or an antigen binding domain according to Table 2 of
  • WO2016/014535 incorporated herein by reference.
  • the amino acid and nucleotide sequences encoding the CLL- 1 CAR molecules and antigen binding domains are specified in WO2016/014535.
  • the CAR-expressing cells can specifically bind to GFR ALPHA-
  • WO2016/025880 can include a CAR molecule, or an antigen binding domain according to Table 2 of WO2016/025880, incorporated herein by reference.
  • the amino acid and nucleotide sequences encoding the GFR ALPHA-4 CAR molecules and antigen binding domains are specified in WO2016/025880.
  • the antigen binding domain of any of the CAR molecules described herein comprises one, two three (e.g., all three) heavy chain CDRs, HC CDR1, HC CDR2 and HC CDR3, from an antibody listed above, and/or one, two, three (e.g., all three) light chain CDRs, LC CDR1, LC CDR2 and LC CDR3, from an antigen binding domain listed above.
  • the antigen binding domain comprises a heavy chain variable region and/or a variable light chain region of an antibody listed or described above.
  • the antigen binding domain comprises a humanized antibody or an antibody fragment.
  • a non-human antibody is humanized, where specific sequences or regions of the antibody are modified to increase similarity to an antibody naturally produced in a human or fragment thereof.
  • the antigen binding domain is humanized.
  • the antigen binding domain it is beneficial for the antigen binding domain to be derived from the same species in which the CAR will ultimately be used in.
  • the antigen binding domain of the CAR may be beneficial for the antigen binding domain of the CAR to comprise human or humanized residues for the antigen binding domain of an antibody or antibody fragment.
  • the antigen binding domain comprises a human antibody or an antibody fragment.
  • the human CD 123 binding domain comprises one or more (e.g., all three) light chain complementary determining region 1 (LC CDRl), light chain complementary determining region 2 (LC CDR2), and light chain complementary determining region 3 (LC CDR3) of a human CD123 binding domain described herein, and/or one or more (e.g., all three) heavy chain complementary determining region 1 (HC CDRl), heavy chain
  • HC CDR2 complementary determining region 2
  • determining region 3 of a human CD123 binding domain described herein, e.g., a human CD 123 binding domain comprising one or more, e.g., all three, LC CDRs and one or more, e.g., all three, HC CDRs.
  • the human CD123 binding domain comprises one or more (e.g., all three) heavy chain complementary determining region 1 (HC CDRl), heavy chain complementary determining region 2 (HC CDR2), and heavy chain complementary determining region 3 (HC CDR3) of a human CD 123 binding domain described herein, e.g., the human CD 123 binding domain has two variable heavy chain regions, each comprising a HC CDRl, a HC CDR2 and a HC CDR3 described herein.
  • the human CD 123 binding domain comprises a human light chain variable region described herein (e.g., in Table 11A or 12B) and/or a human heavy chain variable region described herein (e.g., in 11A or 12B).
  • the human CD123 binding domain comprises a human heavy chain variable region described herein (e.g., in Table 11A or 12B 9), e.g., at least two human heavy chain variable regions described herein (e.g., in Table 11 A or 12B).
  • the CD 123 binding domain is a scFv comprising a light chain and a heavy chain of an amino acid sequence of Table 11A or 12B.
  • the CD 123 binding domain (e.g., an scFv) comprises: a light chain variable region comprising an amino acid sequence having at least one, two or three modifications (e.g., substitutions) but not more than 30, 20 or 10 modifications (e.g., substitutions) of an amino acid sequence of a light chain variable region provided in Table 11A or 12B, or a sequence with at least 95% identity, e.g., 95-99% identity, with an amino acid sequence of Tablel 1A; and/or a heavy chain variable region comprising an amino acid sequence having at least one, two or three modifications (e.g., substitutions) but not more than 30, 20 or 10 modifications (e.g., substitutions) of an amino acid sequence of a heavy chain variable region provided in Table 11A or 12B, or a sequence with at least 95% identity, e.g., 95-99% identity, to an amino acid sequence of Table 11A or 12B.
  • a light chain variable region comprising an amino acid sequence having at least one, two or three modifications (
  • the human CD 123 binding domain comprises a sequence selected from a group consisting of SEQ ID NO: 157-160, 478, 480, 483, and 485, or a sequence with at least 95% identity, e.g., 95-99% identity, thereof.
  • the human CD123 binding domain is a scFv, and a light chain variable region comprising an amino acid sequence described herein, e.g., in Table 11A or 12B, is attached to a heavy chain variable region comprising an amino acid sequence described herein, e.g., in Table 11A, via a linker, e.g., a linker described herein.
  • the human CD123 binding domain includes a
  • the light chain variable region and heavy chain variable region of a scFv can be, e.g., in any of the following orientations: light chain variable region-linker-heavy chain variable region or heavy chain variable region-linker-light chain variable region.
  • a non-human antibody is humanized, where specific sequences or regions of the antibody are modified to increase similarity to an antibody naturally produced in a human or fragment thereof.
  • the antigen binding domain comprises a humanized antibody or an antibody fragment.
  • the humanized CD 123 binding domain comprises one or more (e.g., all three) light chain complementary determining region 1 (LC CDR1), light chain complementary determining region 2 (LC CDR2), and light chain complementary determining region 3 (LC CDR3) of a humanized CD 123 binding domain described herein, and/or one or more (e.g., all three) heavy chain complementary determining region 1 (HC CDR1), heavy chain complementary determining region 2 (HC CDR2), and heavy chain complementary determining region 3 (HC CDR3) of a humanized CD 123 binding domain described herein, e.g., a humanized CD123 binding domain comprising one or more, e.g., all three, LC CDRs and one or more, e.g., all three, HC CDRs.
  • LC CDR1 light chain complementary determining region 1
  • HC CDR2 light chain complementary determining region 2
  • HC CDR3 light chain complementary determining region 3
  • the humanized CD123 binding domain comprises one or more (e.g., all three) heavy chain complementary determining region 1 (HC CDR1), heavy chain complementary determining region 2 (HC CDR2), and heavy chain complementary determining region 3 (HC CDR3) of a humanized CD 123 binding domain described herein, e.g., the humanized CD 123 binding domain has two variable heavy chain regions, each comprising a HC CDR1, a HC CDR2 and a HC CDR3 described herein.
  • the humanized CD 123 binding domain comprises a humanized light chain variable region described herein (e.g., in Table 12A) and/or a humanized heavy chain variable region described herein (e.g., in Table 12A).
  • the humanized CD 123 binding domain comprises a humanized heavy chain variable region described herein (e.g., in Table 12A), e.g., at least two humanized heavy chain variable regions described herein (e.g., in Table 12A).
  • the CD123 binding domain is a scFv comprising a light chain and a heavy chain of an amino acid sequence of Table 12A.
  • the CD 123 binding domain (e.g., an scFv) comprises: a light chain variable region comprising an amino acid sequence having at least one, two or three modifications (e.g., substitutions) but not more than 30, 20 or 10 modifications (e.g., substitutions) of an amino acid sequence of a light chain variable region provided in Table 4, or a sequence with at least 95% identity, e.g., 95-99% identity, with an amino acid sequence of Table 12A; and/or a heavy chain variable region comprising an amino acid sequence having at least one, two or three modifications (e.g., substitutions) but not more than 30, 20 or 10 modifications (e.g., substitutions) of an amino acid sequence of a heavy chain variable region provided in Table 12A, or a sequence with at least 95% identity, e.g., 95-99% identity, to an amino acid sequence of Table 12A.
  • a light chain variable region comprising an amino acid sequence having at least one, two or three modifications (e.g., substitutions) but not more than
  • the humanized CD 123 binding domain comprises a sequence selected from a group consisting of SEQ ID NO: 184-215 and 302-333, or a sequence with at least 95% identity, e.g., 95-99% identity, thereof.
  • the humanized CD 123 binding domain is a scFv, and a light chain variable region comprising an amino acid sequence described herein, e.g., in Table 12A, is attached to a heavy chain variable region comprising an amino acid sequence described herein, e.g., in Table 12A, via a linker, e.g., a linker described herein.
  • the humanized CD 123 binding domain includes a (Gly4-Ser)n linker, wherein n is 1, 2, 3, 4, 5, or 6, preferably 3 or 4 (SEQ ID NO:26).
  • the light chain variable region and heavy chain variable region of a scFv can be, e.g., in any of the following orientations: light chain variable region-linker-heavy chain variable region or heavy chain variable region-linker-light chain variable region.
  • Humanized antibody A humanized antibody can be produced using a variety of techniques known in the art, including but not limited to, CDR-grafting (see, e.g., European Patent No. EP 239,400;
  • framework substitutions are identified by methods well-known in the art, e.g., by modeling of the interactions of the CDR and framework residues to identify framework residues important for antigen binding and sequence comparison to identify unusual framework residues at particular positions. (See, e.g., Queen et al., U.S. Pat. No. 5,585,089; and Riechmann et al., 1988, Nature, 332:323, which are incorporated herein by reference in their entireties.)
  • a humanized antibody or antibody fragment has one or more amino acid residues remaining in it from a source which is nonhuman. These nonhuman amino acid residues are often referred to as "import” residues, which are typically taken from an “import” variable domain.
  • humanized antibodies or antibody fragments comprise one or more CDRs from nonhuman immunoglobulin molecules and framework regions wherein the amino acid residues comprising the framework are derived completely or mostly from human germline.
  • Humanized antibodies are often human antibodies in which some CDR residues and possibly some framework (FR) residues are substituted by residues from analogous sites in rodent antibodies.
  • Humanization of antibodies and antibody fragments can also be achieved by veneering or resurfacing (EP 592,106; EP 519,596; Padlan, 1991, Molecular Immunology, 28(4/5):489-498; Studnicka et al., Protein Engineering, 7(6):805-814 (1994); and Roguska et al., PNAS, 91:969-973 (1994)) or chain shuffling (U.S. Pat. No. 5,565,332), the contents of which are incorporated herein by reference herein in their entirety.
  • variable domains both light and heavy
  • the choice of human variable domains, both light and heavy, to be used in making the humanized antibodies is to reduce antigenicity.
  • sequence of the variable domain of a rodent antibody is screened against the entire library of known human variable-domain sequences.
  • the human sequence which is closest to that of the rodent is then accepted as the human framework (FR) for the humanized antibody (Sims et al., J. Immunol., 151:2296 (1993); Chothia et al., J. Mol. Biol., 196:901 (1987), the contents of which are incorporated herein by reference herein in their entirety).
  • Another method uses a particular framework derived from the consensus sequence of all human antibodies of a particular subgroup of light or heavy chains.
  • the same framework may be used for several different humanized antibodies (see, e.g., Nicholson et al. Mol. Immun. 34 (16-17): 1157-1165 (1997); Carter et al., Proc. Natl. Acad. Sci. USA, 89:4285 (1992); Presta et al., J. Immunol., 151:2623 (1993), the contents of which are incorporated herein by reference herein in their entirety).
  • the framework region e.g., all four framework regions, of the heavy chain variable region are derived from a VH4_4-59 germline sequence.
  • the framework region can comprise, one, two, three, four or five modifications, e.g., substitutions, e.g., from the amino acid at the corresponding murine sequence.
  • the framework region e.g., all four framework regions of the light chain variable region are derived from a VK3_1.25 germline sequence.
  • the framework region can comprise, one, two, three, four or five modifications, e.g., substitutions, e.g., from the amino acid at the corresponding murine sequence.
  • the portion of a CAR composition of the invention that comprises an antibody fragment is humanized with retention of high affinity for the target antigen and other favorable biological properties.
  • humanized antibodies and antibody fragments are prepared by a process of analysis of the parental sequences and various conceptual humanized products using three-dimensional models of the parental and humanized sequences. Three-dimensional immunoglobulin models are commonly available and are familiar to those skilled in the art. Computer programs are available which illustrate and display probable three-dimensional conformational structures of selected candidate
  • immunoglobulin sequences Inspection of these displays permits analysis of the likely role of the residues in the functioning of the candidate immunoglobulin sequence, e.g., the analysis of residues that influence the ability of the candidate immunoglobulin to bind the target antigen.
  • FR residues can be selected and combined from the recipient and import sequences so that the desired antibody or antibody fragment characteristic, such as increased affinity for the target antigen, is achieved.
  • the CDR residues are directly and most substantially involved in influencing antigen binding.
  • a humanized antibody or antibody fragment may retain a similar antigenic specificity as the original antibody, e.g., in the present invention, the ability to bind an antigen described herein, e.g., tumor antigen, e.g., B cell antigen, e.g., human CD123, CD19, or a fragment thereof.
  • an antigen described herein e.g., tumor antigen, e.g., B cell antigen, e.g., human CD123, CD19, or a fragment thereof.
  • a humanized antibody or antibody fragment may have improved affinity and/or specificity of binding to the antigen, e.g., tumor antigen, e.g., B cell antigen, e.g., human CD123, CD19, or a fragment thereof.
  • the antigen binding domain portion comprises one or more sequence selected from SEQ ID NOS: 157-160,184-215, 478, 480, 483, 485, and 556-587.
  • the CD 123 CAR that includes a human CD 123 binding domain is selected from one or more sequence selected from SEQ ID NOS: 157-160, 478, 480, 483, and 485.
  • the CD 123 CAR that includes a humanized CD 123 binding domain is selected from one or more sequence selected from SEQ ID NOS: 184-215 and 556-587.
  • the antigen binding domain e.g., tumor antigen binding domain, e.g., B cell antigen binding domain, e.g., CD123 binding domain or CD19 binding domain
  • the portion of a CAR composition of the invention that comprises an antigen binding domain specifically binds the antigen (e.g., tumor antigen, e.g., B cell antigen, e.g., human CD123, CD19, or a fragment thereof).
  • the invention relates to an antigen binding domain comprising an antibody or antibody fragment, wherein the antibody binding domain specifically binds to a CD 123 protein or fragment thereof, wherein the antibody or antibody fragment comprises a variable light chain and/or a variable heavy chain that includes an amino acid sequence of SEQ ID NO: 157-160, 184-215, 478, 480, 483, 485, and 556-587.
  • the antigen binding domain comprises an amino acid sequence of an scFv selected from SEQ ID NO: 157-160, 184-215, 478, 480, 483, 485, and 556-587.
  • the scFv is contiguous with and in the same reading frame as a leader sequence.
  • the leader sequence is the polypeptide sequence provided as SEQ ID NO: l.
  • the antigen binding domain (e.g., tumor antigen binding domain, e.g., B cell antigen binding domain, e.g., CD123 binding domain or CD19 binding domain) is a fragment, e.g., a single chain variable fragment (scFv).
  • the antigen binding domain e.g., tumor antigen binding domain, e.g., B cell antigen binding domain, e.g., CD123 binding domain or CD 19 binding domain
  • the antibodies and fragments thereof of the invention binds an antigen (e.g., tumor antigen, e.g., B cell antigen, e.g., CD123 or CD19 protein) or fragment thereof with wild-type or enhanced affinity.
  • an antigen e.g., tumor antigen, e.g., B cell antigen, e.g., CD123 or CD19 protein
  • a human scFv can be derived from a display library.
  • a display library is a collection of entities; each entity includes an accessible polypeptide component and a recoverable component that encodes or identifies the polypeptide component.
  • the polypeptide component is varied so that different amino acid sequences are represented.
  • the polypeptide component can be of any length, e.g. from three amino acids to over 300 amino acids.
  • a display library entity can include more than one polypeptide component, for example, the two polypeptide chains of a Fab.
  • a display library can be used to identify a human CD 123 binding domain. In a selection, the polypeptide component of each member of the library is probed with CD 123, or a fragment thereof, and if the polypeptide component binds to CD 123, the display library member is identified, typically by retention on a support.
  • Retained display library members are recovered from the support and analyzed.
  • the analysis can include amplification and a subsequent selection under similar or dissimilar conditions. For example, positive and negative selections can be alternated.
  • the analysis can also include determining the amino acid sequence of the polypeptide component, i.e., the anti- CD 123 binding domain, and purification of the polypeptide component for detailed
  • a variety of formats can be used for display libraries. Examples include the phaage display. In phage display, the protein component is typically covalently linked to a
  • the linkage results from translation of a nucleic acid encoding the protein component fused to the coat protein.
  • the linkage can include a flexible peptide linker, a protease site, or an amino acid incorporated as a result of suppression of a stop codon.
  • Phage display is described, for example, in U.S. 5,223,409; Smith (1985) Science 228: 1315-1317; WO 92/18619; WO 91/17271; WO 92/20791; WO 92/15679; WO 93/01288; WO 92/01047; WO 92/09690; WO 90/02809; de Haard et al. (1999) J. Biol. Chem 274: 18218-30;
  • Bacteriophage displaying the protein component can be grown and harvested using standard phage preparatory methods, e.g. PEG precipitation from growth media. After selection of individual display phages, the nucleic acid encoding the selected protein components can be isolated from cells infected with the selected phages or from the phage themselves, after amplification. Individual colonies or plaques can be picked, the nucleic acid isolated and sequenced.
  • display formats include cell based display (see, e.g., WO 03/029456), protein- nucleic acid fusions (see, e.g., US 6,207,446), ribosome display (See, e.g., Mattheakis et al. (1994) Proc. Natl. Acad. Sci. USA 91 :9022 and Hanes et al. (2000) Nat Biotechnol. 18: 1287- 92; Hanes et al. (2000) Methods Enzymol. 328:404-30; and Schaffitzel et al. (1999) Immunol Methods. 231(1-2): 119-35), and E. coli periplasmic display (2005 Nov 22;PMID: 16337958).
  • scFvs can be prepared according to method known in the art (see, for example, Bird et al., (1988) Science 242:423-426 and Huston et al., (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883).
  • ScFv molecules can be produced by linking VH and VL regions together using flexible polypeptide linkers.
  • the scFv molecules comprise a linker (e.g., a Ser- Gly linker) with an optimized length and/or amino acid composition. The linker length can greatly affect how the variable regions of a scFv fold and interact.
  • WO2007/024715 is incorporated herein by reference.
  • An scFv can comprise a linker of at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15,
  • the linker sequence may comprise any naturally occurring amino acid.
  • the linker sequence comprises amino acids glycine and serine.
  • the linker sequence comprises sets of glycine and serine repeats such as
  • the linker can be (Gly 4 Ser) 4 (SEQ ID NO:27) or (Gly 4 Ser) 3 (SEQ ID NO:28). Variation in the linker length may retain or enhance activity, giving rise to superior efficacy in activity studies.
  • Exemplary CD123 CAR Constructs and Antigen Binding Domains Exemplary CD 123 CAR constructs disclose herein comprise an scFv (e.g., a human scFv as disclosed in Tables 11 A, 12A and 12B herein, optionally preceded with an optional leader sequence (e.g., SEQ ID NO: l and SEQ ID NO: 12 for exemplary leader amino acid and nucleotide sequences, respectively).
  • the sequences of the human scFv fragments (amino acid sequences of SEQ ID NOs: 157-160) are provided herein in Table 11A.
  • sequences of human scFv fragments, without the leader sequence are provided herein in Table 12B (SEQ ID NOs: 479, 481, 482, and 484 for the nucleotide sequences, and SEQ ID NOs: 478, 480, 483, and 485 for the amino acid sequences).
  • the CD 123 CAR construct can further include an optional hinge domain, e.g., a CD8 hinge domain (e.g., including the amino acid sequence of SEQ ID NO: 2 or encoded by a nucleic acid sequence of SEQ ID NO: 13); a transmembrane domain, e.g., a CD8 transmembrane domain (e.g., including the amino acid sequence of SEQ ID NO: 6 or encoded by the nucleotide sequence of SEQ ID NO: 17); an intracellular domain, e.g., a 4- IBB intracellular domain (e.g., including the amino acid sequence of SEQ ID NO: 7 or encoded by the nucleotide sequence of SEQ ID NO: 18; and a functional signaling domain, e.g., a CD3 zeta domain (e.g., including amino acid sequence of SEQ ID NO: 9 or 10, or encoded by the nucleotide sequence of SEQ ID NO: 20 or 21).
  • an optional hinge domain e.
  • the domains are contiguous with and in the same reading frame to form a single fusion protein.
  • the domain are in separate polypeptides, e.g., as in an RCAR molecule as described herein.
  • the full length CD 123 CAR molecule includes the amino acid sequence of, or is encoded by the nucleotide sequence of, CD 123-1, CD 123 -2, CD 123 -3, CD123-4, hzCD123-l, hzCD123-2, hzCD123-3, hzCD123-4, hzCD123-5, hzCD123-6, hzCD123-7, hzCD123-8, hzCD123-9, hzCD123-10, hzCD123-l l, hzCD123-12, hzCD123-13, hzCD123-14, hzCD123-15, hzCD123-16, hzCD123-17, hzCD123-18, hzCD123-19
  • the CD 123 CAR molecule includes the scFv amino acid sequence of CD123-1, CD123-2, CD123-3, CD123-4, hzCD123-l, hzCD123-2, hzCD123-3, hzCD123-4, hzCD123-5, hzCD123-6, hzCD123-7, hzCD123-8, hzCD123-9, hzCD123-10, hzCD123-l l, hzCD123-12, hzCD123-13, hzCD123- 14, hzCD123-15, hzCD123-16, hzCD123-17, hzCD123-18, hzCD123-19, hzCD123-20, hzCD123-21, hzCD123-22, hzCD123-23, hzCD123-24, hzCD123-25, hzCD123-26, hzCD123- 27, hzCD 123-28,
  • hzCD123-31 30, hzCD123-31, or hzCD123-32, or a sequence substantially identical (e.g., with at least 95% identity, e.g., 95-99% identity, or up to 20, 15, 10, 8, 6, 5, 4, 3, 2, or 1 amino acid changes) to any of the aforesaid sequences.
  • the CD 123 CAR molecule or the CD 123 antigen binding domain, includes the heavy chain variable region and/or the light chain variable region of
  • hzCD123-32 provided in Table 11A or 12A, or a sequence substantially identical (e.g., with at least 95% identity, e.g., 95-99% identity, or up to 20, 15, 10, 8, 6, 5, 4, 3, 2, or 1 amino acid changes) to any of the aforesaid sequences.
  • the CD 123 CAR molecule, or the CD 123 antigen binding domain includes one, two or three CDRs from the heavy chain variable region (e.g., HCDR1, HCDR2 and/or HCDR3), provided in Table 1A or 3A; and/or one, two or three CDRs from the light chain variable region (e.g., LCDR1, LCDR2 and/or LCDR3) of CD123-1, CD123-2, CD123-3, CD123-4, hzCD123-l, hzCD123-2, hzCD123-3, hzCD123-4, hzCD123-5, hzCD123-6, hzCD123-7, hzCD123-8, hzCD123-9, hzCD123-10, hzCD123-l l, hzCD123-12, hzCD123-13, hzCD123-14, hzCD123-15, hzCD123-16, hzCD123-17, hzCD123-18, hzzCD123-15,
  • the CD 123 CAR molecule, or the CD 123 antigen binding domain includes one, two or three CDRs from the heavy chain variable region (e.g., HCDR1, HCDR2 and/or HCDR3), provided in Table 5A; and/or one, two or three CDRs from the light chain variable region (e.g., LCDRl, LCDR2 and/or LCDR3) of CD123-1, CD123-2, CD123-3, CD123-4, hzCD123-l, hzCD123-2, hzCD123-3, hzCD123-4, hzCD123-5, hzCD123-6, hzCD123-7, hzCD123-8, hzCD123-9, hzCD123-10, hzCD123-l l, hzCD123-12, hzCD123-13, hzCD123-14, hzCD123-15, hzCD123-16, hzCD123-17, hzCD123-18, hzCD123
  • the CD 123 molecule, or the CD 123 antigen binding domain includes one, two or three CDRs from the heavy chain variable region (e.g., HCDR1, HCDR2 and/or HCDR3), provided in Table 7A; and/or one, two or three CDRs from the light chain variable region (e.g., LCDRl, LCDR2 and/or LCDR3) of CD123-1, CD123-2, CD123-3, CD123-4, hzCD123-l, hzCD123-2, hzCD123-3, hzCD123-4, hzCD123-5, hzCD123-6, hzCD123-7, hzCD123-8, hzCD123-9, hzCD123-10, hzCD123-l l, hzCD123-12, hzCD123-13, hzCD123-14, hzCD123-15, hzCD123-16, hzCD123-17, hzCD123-18, hzCD123-19,
  • CDR sequences of the scFv domains are shown in Tables , 3A, 5A, and 7A for the heavy chain variable domains and in Tables 2A, 4A, 6A, and 8A for the light chain variable domains.
  • ID stands for the respective SEQ ID NO for each CDR.
  • the CDRs provided in Tables 1A, 2A, 3A, and 4A are according to a combination of the Kabat and Chothia numbering scheme.
  • CD 123 single chain variable fragments are generated and cloned into lentiviral CAR expression vectors with the intracellular CD3zeta domain and the intracellular co-stimulatory domain of 4- IBB.
  • Names of exemplary fully human CD 123 scFvs are depicted in Table 9A.
  • Names of exemplary humanized CD 123 scFvs are depicted in Table 10A.
  • the order in which the VL and VH domains appear in the scFv is varied (i.e., VL-VH, or VH-VL orientation), and where either three or four copies of the "G4S" (SEQ ID NO:25) subunit, in which each subunit comprises the sequence GGGGS (SEQ ID NO:25) (e.g., (G4S) 3 (SEQ ID NO:28) or (G4S) 4 (SEQ ID NO:27)), connect the variable domains to create the entirety of the scFv domain, as shown in Table 11 A, Table 12A, and Table 12B.
  • the amino acid and nucleic acid sequences of the CD 123 scFv domains and CD 123 CAR molecules are provided in Table 11A, Table 12A, and Table 12B.
  • the amino acid sequences for the variable heavy chain and variable light chain for each scFv is also provided in Table 11A and Table 12A.
  • the scFv fragments (SEQ ID NOs: 157-160, and 184-215) with a leader sequence (e.g., the amino acid sequence of SEQ ID NO: 1 or the nucleotide sequence of SEQ ID NO: 12) and without a leader sequence (SEQ ID NOs: 478, 480, 483, 485, and 556-587) are also encompassed by the present invention.
  • these clones in Table 11A and 12A all contained a Q/K residue change in the signal domain of the co-stimulatory domain derived from CD3zeta chain.
  • QKFQGRVTLTRDTS IS TV YMELS RLRS DDT A VYYC ARDMNILA TVPFDIWGQGTMVTVSSGGGGSGGGGSGGGGSDIQMTQSPSS LS AS VGDRVTITCRAS QS IS S YLNW YQQKPGKAPKLLIY A AS S L QS G VPS RFS GS GS GTDFTLT VNS LQPEDFAT YYC QQGDS VPLTF GGGTRLEIK CAR123-2 217 QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAP VH GQGLEWMGWINPNSGGTNYAQKFQGRVTLTRDTSISTVYMEL SRLRSDDTAVYYCARDMNILATVPFDIWGQGTMVTVSS
  • KFQGR VTMTRDTS IS T A YMELS GLRS DDP A V Y YC ARDMNILA TVPFDIWGQGTLVTVSSGGGGSGGGGSGGGGSDIQLTQSPSSL S AS VGDRVTITCR AS QS IS S YLNW YQQKPGKAPKLLIY A AS S LQ S G VPS RFS GS GS GTDFTLT VNS LQPEDF AT Y YC QQGDS VPLTFG GGTKVEIK
  • hzCAR12 302 DVQLTQSPS FLS AS VGDRVTITCR AS KS IS KDLA W YQQKPGKAPKLL 3-1 VL IYS GS TLQS G VPS RFS GS GS GTEFTLTIS S LQPEDF AT Y YCQQHNKYP
  • hzCAR12 67 ATGGCCCTCCCTGTCACCGCCCTGCTGCTTCCGCTGGCTCTTCTG 3-2 NT CTCCACGCCGCTCGGCCCCAAGTGCAGCTGGTCCAGTCGGGAGC CGAAGTCAAGAAGCCCGGCGCTAGCGTGAAAGTGTCCTGCAAAG
  • hzCAR12 303 EV VLTQS P ATLS LS PGERATLS CR AS KS IS KDLA W YQQKPGQ APRLL 3-2 VL IYS GS TLQS GIPARFS GS GS GTDFTLTIS S LEPEDF A VYYC QQHNKYP
  • hzCAR12 68 ATGGCCCTCCCTGTCACCGCCCTGCTGCTTCCGCTGGCTCTTCTG 3-3 NT CTCCACGCCGCTCGGCCCCAAGTGCAGCTGGTCCAGTCGGGAGC
  • hzCAR12 304 DVVMTQSPAFLSVTPGEKVTITCRASKSISKDLAWYQQKPDQAPKL 3-3 VL LIYS GS TLQS G VPS RFS GS GS GTDFTFTIS S LE AED A AT Y YC QQHNKY
  • PYTFGGGTKVEIK hzCAR12 69 ATGGCCCTCCCTGTCACCGCCCTGCTGCTTCCGCTGGCTCTTCTG 3-4 NT CTCCACGCCGCTCGGCCCCAAGTGCAGCTGGTCCAGTCGGGAGC
  • hzCAR12 70 ATGGCCCTCCCTGTCACCGCCCTGCTGCTTCCGCTGGCTCTTCTG 3-5 NT CTCCACGCCGCTCGGCCCGACGTGCAGCTCACCCAGTCGCCCTCA

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • General Health & Medical Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Epidemiology (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Immunology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Organic Chemistry (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Oncology (AREA)
  • Biomedical Technology (AREA)
  • Hematology (AREA)
  • Mycology (AREA)
  • Microbiology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Cell Biology (AREA)
  • Biotechnology (AREA)
  • Developmental Biology & Embryology (AREA)
  • Virology (AREA)
  • Zoology (AREA)
PCT/US2017/042129 2016-07-15 2017-07-14 Treatment and prevention of cytokine release syndrome using a chimeric antigen receptor in combination with a kinase inhibitor Ceased WO2018013918A2 (en)

Priority Applications (11)

Application Number Priority Date Filing Date Title
EP17746563.0A EP3484455A2 (en) 2016-07-15 2017-07-14 Treatment and prevention of cytokine release syndrome using a chimeric antigen receptor in combination with a kinase inhibitor
US16/317,943 US20190336504A1 (en) 2016-07-15 2017-07-14 Treatment and prevention of cytokine release syndrome using a chimeric antigen receptor in combination with a kinase inhibitor
SG11201900344YA SG11201900344YA (en) 2016-07-15 2017-07-14 Treatment and prevention of cytokine release syndrome using a chimeric antigen receptor in combination with a kinase inhibitor
CN202510483434.XA CN120285179A (zh) 2016-07-15 2017-07-14 使用与激酶抑制剂组合的嵌合抗原受体治疗和预防细胞因子释放综合征
CN201780054186.0A CN110461315B (zh) 2016-07-15 2017-07-14 使用与激酶抑制剂组合的嵌合抗原受体治疗和预防细胞因子释放综合征
JP2019522625A JP7219376B2 (ja) 2016-07-15 2017-07-14 キメラ抗原受容体をキナーゼ阻害薬と併用して使用したサイトカイン放出症候群の治療及び予防
CA3030837A CA3030837A1 (en) 2016-07-15 2017-07-14 Treatment and prevention of cytokine release syndrome using a chimeric antigen receptor in combination with a kinase inhibitor
AU2017295886A AU2017295886C1 (en) 2016-07-15 2017-07-14 Treatment and prevention of cytokine release syndrome using a chimeric antigen receptor in combination with a kinase inhibitor
JP2022122044A JP7584475B2 (ja) 2016-07-15 2022-07-29 キメラ抗原受容体をキナーゼ阻害薬と併用して使用したサイトカイン放出症候群の治療及び予防
AU2023263469A AU2023263469A1 (en) 2016-07-15 2023-11-08 Treatment and prevention of cytokine release syndrome using a chimeric antigen receptor in combination with a kinase inhibitor
JP2024193777A JP2025032091A (ja) 2016-07-15 2024-11-05 キメラ抗原受容体をキナーゼ阻害薬と併用して使用したサイトカイン放出症候群の治療及び予防

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
US201662362659P 2016-07-15 2016-07-15
US62/362,659 2016-07-15
US201662366997P 2016-07-26 2016-07-26
US62/366,997 2016-07-26
US201662381230P 2016-08-30 2016-08-30
US62/381,230 2016-08-30

Publications (2)

Publication Number Publication Date
WO2018013918A2 true WO2018013918A2 (en) 2018-01-18
WO2018013918A3 WO2018013918A3 (en) 2018-02-22

Family

ID=59506336

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2017/042129 Ceased WO2018013918A2 (en) 2016-07-15 2017-07-14 Treatment and prevention of cytokine release syndrome using a chimeric antigen receptor in combination with a kinase inhibitor

Country Status (8)

Country Link
US (1) US20190336504A1 (https=)
EP (1) EP3484455A2 (https=)
JP (3) JP7219376B2 (https=)
CN (2) CN110461315B (https=)
AU (2) AU2017295886C1 (https=)
CA (1) CA3030837A1 (https=)
SG (1) SG11201900344YA (https=)
WO (1) WO2018013918A2 (https=)

Cited By (41)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2019148150A1 (en) * 2018-01-29 2019-08-01 Dana-Farber Cancer Institute, Inc. Degradation of bruton's tyrosine kinase (btk) by conjugation of btk inhibitors with e3 ligase ligand and methods of use
WO2020077300A1 (en) * 2018-10-12 2020-04-16 Tolero Pharmaceuticals, Inc. Methods for monitoring tumor lysis syndrome
WO2020118216A1 (en) * 2018-12-08 2020-06-11 Board Of Regents, The University Of Texas System Identification and targeting of tumor promoting carcinoma associated fibroblasts for diagnosis and treatment of cancer and other diseases
WO2020198080A1 (en) * 2019-03-22 2020-10-01 Augmenta Bioworks, Inc. Isolation of single cells and uses thereof
US10835537B2 (en) 2015-08-03 2020-11-17 Sumitomo Dainippon Pharma Oncology, Inc. Combination therapies for treatment of cancer
US10858649B2 (en) 2016-09-15 2020-12-08 Augmenta Bioworks, Inc. Immune repertoire sequence amplification methods and applications
US10869888B2 (en) 2018-04-17 2020-12-22 Innovative Cellular Therapeutics CO., LTD. Modified cell expansion and uses thereof
EP3752146A1 (en) * 2018-02-16 2020-12-23 Incyte Corporation Jak1 pathway inhibitors for the treatment of cytokine-related disorders
US20210002374A1 (en) * 2018-03-08 2021-01-07 Novartis Ag USE OF an anti-P-selectin antibody
WO2021026451A1 (en) * 2019-08-08 2021-02-11 Rigel Pharmaceuticals, Inc. Compounds and method for treating cytokine release syndrome
US10918667B2 (en) 2018-11-20 2021-02-16 Innovative Cellular Therapeutics CO., LTD. Modified cell expressing therapeutic agent and uses thereof
WO2021030526A1 (en) * 2019-08-14 2021-02-18 Rigel Pharmaceuticals, Inc. Method of blocking or ameliorating cytokine release syndrome
EP3801769A1 (en) * 2018-05-25 2021-04-14 Novartis AG Combination therapy with chimeric antigen receptor (car) therapies
US20210106618A1 (en) * 2017-09-06 2021-04-15 Fred Hutchinson Cancer Research Center Methods for improving adoptive cell therapy
US20210113690A1 (en) * 2018-06-14 2021-04-22 Berlin-Chemie Ag Pharmaceutical combinations
US11034710B2 (en) 2018-12-04 2021-06-15 Sumitomo Dainippon Pharma Oncology, Inc. CDK9 inhibitors and polymorphs thereof for use as agents for treatment of cancer
WO2021168375A1 (en) * 2020-02-20 2021-08-26 Kite Pharma, Inc. Chimeric antigen receptor t cell therapy
US20210268028A1 (en) * 2018-07-02 2021-09-02 Cellectis Chimeric antigen receptors (car)-expressing cells and combination treatment for immunotherapy of patients with relapse refractory adverse genetic risk aml
US11141436B2 (en) 2019-03-05 2021-10-12 Nkarta, Inc. Immune cells engineered to express CD19-directed chimeric antigen receptors and uses thereof in immunotherapy
US11161913B2 (en) 2018-08-30 2021-11-02 Innovative Cellular Therapeutics Holdings, Ltd. Chimeric antigen receptor cells for treating solid tumor
EP3433276B1 (en) 2016-03-22 2021-12-22 Seattle Children's Hospital (DBA Seattle Children's Research Institute) Early intervention methods to prevent or ameliorate toxicity
US11279694B2 (en) 2016-11-18 2022-03-22 Sumitomo Dainippon Pharma Oncology, Inc. Alvocidib prodrugs and their use as protein kinase inhibitors
JP2022531911A (ja) * 2019-05-07 2022-07-12 グレイセル・バイオテクノロジーズ(シャンハイ)カンパニー・リミテッド Bcmaを標的とする操作された免疫細胞及びその使用
US11497756B2 (en) 2017-09-12 2022-11-15 Sumitomo Pharma Oncology, Inc. Treatment regimen for cancers that are insensitive to BCL-2 inhibitors using the MCL-1 inhibitor alvocidib
EP3962490A4 (en) * 2019-05-03 2023-01-25 Kite Pharma, Inc. METHOD OF ADMINISTRATION OF CHIMERIC ANTIGEN RECEPTOR IMMUNOTHERAPY
US11617767B2 (en) 2020-11-20 2023-04-04 Simcere Innovation, Inc. Armed dual CAR-T compositions and methods for cancer immunotherapy
US11662341B2 (en) 2018-10-10 2023-05-30 Augmenta Bioworks, Inc. Methods for isolating immune binding proteins
EP3947450A4 (en) * 2019-04-05 2023-05-31 The Regents Of The University Of California METHODS AND COMPOSITIONS USING CHIMERIC BINDING POLYPEPTIDES
US11747346B2 (en) 2015-09-03 2023-09-05 Novartis Ag Biomarkers predictive of cytokine release syndrome
US11793802B2 (en) 2019-03-20 2023-10-24 Sumitomo Pharma Oncology, Inc. Treatment of acute myeloid leukemia (AML) with venetoclax failure
US11957661B2 (en) 2020-12-08 2024-04-16 Incyte Corporation JAK1 pathway inhibitors for the treatment of vitiligo
WO2024097852A1 (en) * 2022-11-02 2024-05-10 Mayo Foundation For Medical Education And Research Engineered mesenchymal stromal cells
US12043654B2 (en) 2020-06-02 2024-07-23 Innovative Cellular Therapeutics Holdings, Ltd. Anti-GCC antibody and CAR thereof for treating digestive system cancer
US12076343B2 (en) 2020-02-19 2024-09-03 Innovative Cellular Therapeutics Holdings, Ltd. Engineered safety in cell therapy
US12240899B2 (en) 2020-06-22 2025-03-04 Ngm Biopharmaceuticals, Inc. LAIR-1-binding agents and methods of use thereof
EP4319793A4 (en) * 2021-04-08 2025-03-19 Biosceptre (Aust) Pty Ltd Methods for controlling immune cell activity
US12268667B2 (en) 2021-05-03 2025-04-08 Incyte Corporation JAK1 pathway inhibitors for the treatment of prurigo nodularis
US12338261B2 (en) 2015-05-18 2025-06-24 Sumitomo Pharma Oncology, Inc. Alvocidib prodrugs having increased bioavailability
US12441707B2 (en) 2019-12-30 2025-10-14 Tyra Biosciences, Inc. Indazole compounds
US12473598B2 (en) 2018-03-28 2025-11-18 Board Of Regents, The University Of Texas System Identification of epigenetic alterations in DNA isolated from exosomes
US12590148B2 (en) 2018-11-26 2026-03-31 Nkarta, Inc. Methods for the simultaneous expansion of multiple immune cell types, related compositions and uses of same in cancer immunotherapy

Families Citing this family (50)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DK2958943T3 (da) 2013-02-20 2019-12-09 Univ Pennsylvania Behandling af cancer ved anvendelse af humaniseret anti-EGFRvIII kimær antigenreceptor
TW201446794A (zh) 2013-02-20 2014-12-16 Novartis Ag 利用抗-cd123嵌合抗原受體工程化t細胞之初級人類白血病有效靶向
EP2970426B1 (en) 2013-03-15 2019-08-28 Michael C. Milone Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy
UY35468A (es) 2013-03-16 2014-10-31 Novartis Ag Tratamiento de cáncer utilizando un receptor quimérico de antígeno anti-cd19
US10287354B2 (en) 2013-12-20 2019-05-14 Novartis Ag Regulatable chimeric antigen receptor
US11028143B2 (en) 2014-01-21 2021-06-08 Novartis Ag Enhanced antigen presenting ability of RNA CAR T cells by co-introduction of costimulatory molecules
TWI750110B (zh) 2014-07-21 2021-12-21 瑞士商諾華公司 使用人類化抗-bcma嵌合抗原受體治療癌症
SG10201913765YA (en) 2014-07-21 2020-03-30 Novartis Ag Treatment of cancer using a cd33 chimeric antigen receptor
US11542488B2 (en) 2014-07-21 2023-01-03 Novartis Ag Sortase synthesized chimeric antigen receptors
ES2791248T3 (es) 2014-08-19 2020-11-03 Novartis Ag Receptor antigénico quimérico (CAR) anti-CD123 para su uso en el tratamiento del cáncer
KR20170068504A (ko) 2014-10-08 2017-06-19 노파르티스 아게 키메라 항원 수용체 요법에 대한 치료 반응성을 예측하는 바이오마커 및 그의 용도
WO2016115482A1 (en) 2015-01-16 2016-07-21 Novartis Pharma Ag Phosphoglycerate kinase 1 (pgk) promoters and methods of use for expressing chimeric antigen receptor
US11161907B2 (en) 2015-02-02 2021-11-02 Novartis Ag Car-expressing cells against multiple tumor antigens and uses thereof
MX2017012939A (es) 2015-04-08 2018-05-22 Novartis Ag Terapias cd20, terapias cd22 y terapias de combinacion con una celula que expresa un receptor quimerico de antigeno (car) de cd19.
SG11201708516YA (en) 2015-04-17 2017-11-29 David Maxwell Barrett Methods for improving the efficacy and expansion of chimeric antigen receptor-expressing cells
EP3286211A1 (en) 2015-04-23 2018-02-28 Novartis AG Treatment of cancer using chimeric antigen receptor and protein kinase a blocker
AU2016297014B2 (en) 2015-07-21 2021-06-17 Novartis Ag Methods for improving the efficacy and expansion of immune cells
EP3331913A1 (en) 2015-08-07 2018-06-13 Novartis AG Treatment of cancer using chimeric cd3 receptor proteins
EA201891338A1 (ru) 2015-12-04 2018-12-28 Новартис Аг Композиции и способы для иммуноонкологии
US11549099B2 (en) 2016-03-23 2023-01-10 Novartis Ag Cell secreted minibodies and uses thereof
US20190336504A1 (en) * 2016-07-15 2019-11-07 Novartis Ag Treatment and prevention of cytokine release syndrome using a chimeric antigen receptor in combination with a kinase inhibitor
EP3523331A1 (en) 2016-10-07 2019-08-14 Novartis AG Chimeric antigen receptors for the treatment of cancer
EP4043485A1 (en) 2017-01-26 2022-08-17 Novartis AG Cd28 compositions and methods for chimeric antigen receptor therapy
WO2018156448A1 (en) 2017-02-21 2018-08-30 The Board Of Regents Of The Uiversity Of Texas System Prediction and treatment of immunotherapeutic toxicity
US12163952B2 (en) 2017-02-27 2024-12-10 Juno Therapeutics, Inc. Determining toxicity risk in CAR T-cell therapy
WO2018175636A2 (en) 2017-03-22 2018-09-27 Novartis Ag Compositions and methods for immunooncology
WO2019046832A1 (en) * 2017-09-01 2019-03-07 Juno Therapeutics, Inc. GENE EXPRESSION AND EVALUATION OF RISK OF DEVELOPMENT OF TOXICITY FOLLOWING CELL THERAPY
WO2019051047A1 (en) * 2017-09-07 2019-03-14 University Of Florida Research Foundation, Inc. CHIMERIC ANTIGEN RECEPTOR T-LYMPHOCYTES EXPRESSING THE INTERLEUKIN-8 RECEPTOR
JP7585034B2 (ja) 2017-10-18 2024-11-18 ノバルティス アーゲー 選択的タンパク質分解のための組成物及び方法
TW201930591A (zh) 2018-01-08 2019-08-01 瑞士商諾華公司 用於與嵌合抗原受體療法併用之免疫增強rna
WO2019195823A1 (en) * 2018-04-06 2019-10-10 The Board Of Regents Of The University Of Texas System Prediction and treatment of immunotherapeutic toxicity
CA3100724A1 (en) 2018-06-13 2019-12-19 Novartis Ag B-cell maturation antigen protein (bcma) chimeric antigen receptors and uses thereof
SG11202104524YA (en) 2018-11-01 2021-05-28 Gracell Biotechnologies Shanghai Co Ltd Compositions and methods for t cell engineering
EP4058054A1 (en) * 2019-11-13 2022-09-21 CRISPR Therapeutics AG Cd70+ solid tumor therapy using genetically engineered t cells targeting cd70
PH12022551291A1 (en) 2019-11-26 2023-11-20 Novartis Ag Chimeric antigen receptors binding bcma and cd19 and uses thereof
IL292924A (en) 2019-11-26 2022-07-01 Novartis Ag Chimeric antigen receptors cd19 and cd22 and their uses
US20230039520A1 (en) * 2020-01-15 2023-02-09 The Board Of Trustees Of The Leland Stanford Junior University Pericyte-sparing therapy
AU2021235899A1 (en) * 2020-03-08 2022-10-13 Humanigen, Inc. Methods for treating coronavirus infection and resulting inflammation-induced lung injury
WO2021207230A1 (en) * 2020-04-06 2021-10-14 Verastem, Inc. Methods of treating cytokine release syndrome using a pi3k inhibitor
US11324750B2 (en) * 2020-04-09 2022-05-10 Children's Hospital Medical Center Compositions and methods for the treatment of severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) infection
WO2021206766A1 (en) 2020-04-09 2021-10-14 Children's Hospital Medical Center Sars-cov-2 infection biomarkers and uses thereof
WO2022101120A1 (en) * 2020-11-10 2022-05-19 F. Hoffmann-La Roche Ag Prevention or mitigation of t-cell engaging agent-related adverse effects
CA3199840A1 (en) * 2020-11-30 2022-06-02 Cytoagents, Inc. Car t-cell adjuvant therapies
FI4284512T3 (fi) 2021-01-28 2025-05-22 Regeneron Pharma Koostumuksia ja menetelmiä sytokiinien vapautumisoireyhtymän hoitamiseksi
WO2022192093A1 (en) * 2021-03-08 2022-09-15 Humanigen, Inc. Methods for treating coronavirus infection and resulting inflammation-induced lung injury
WO2022223651A1 (en) * 2021-04-23 2022-10-27 F. Hoffmann-La Roche Ag Prevention or mitigation of nk cell engaging agent-related adverse effects
CN115820697B (zh) * 2022-09-23 2024-07-30 中国海洋大学 一种免疫细胞及其制备方法和应用
WO2024107891A2 (en) * 2022-11-16 2024-05-23 Nkarta, Inc. Dosing regimens for combination therapies
WO2024118079A1 (en) * 2022-12-01 2024-06-06 Vaxxinity, Inc. Method for the prevention and treatment of coronavirus disease
WO2024144896A1 (en) * 2022-12-30 2024-07-04 Mprobe Inc. Methods and compositions for a plasma metabolite-based test to detect minimal residual disease in post-surgery colorectal cancer patients

Citations (187)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4433059A (en) 1981-09-08 1984-02-21 Ortho Diagnostic Systems Inc. Double antibody conjugate
US4444878A (en) 1981-12-21 1984-04-24 Boston Biomedical Research Institute, Inc. Bispecific antibody determinants
EP0239400A2 (en) 1986-03-27 1987-09-30 Medical Research Council Recombinant antibodies and methods for their production
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
EP0346087A2 (en) 1988-06-09 1989-12-13 Snow Brand Milk Products Co., Ltd. Hybrid antibody and process for the production thereof
WO1990002809A1 (en) 1988-09-02 1990-03-22 Protein Engineering Corporation Generation and selection of recombinant varied binding proteins
WO1991003493A1 (en) 1989-08-29 1991-03-21 The University Of Southampton Bi-or trispecific (fab)3 or (fab)4 conjugates
WO1991009967A1 (en) 1989-12-21 1991-07-11 Celltech Limited Humanised antibodies
WO1991017271A1 (en) 1990-05-01 1991-11-14 Affymax Technologies N.V. Recombinant library screening methods
WO1992001047A1 (en) 1990-07-10 1992-01-23 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
WO1992009690A2 (en) 1990-12-03 1992-06-11 Genentech, Inc. Enrichment method for variant proteins with altered binding properties
WO1992015679A1 (en) 1991-03-01 1992-09-17 Protein Engineering Corporation Improved epitode displaying phage
WO1992018619A1 (en) 1991-04-10 1992-10-29 The Scripps Research Institute Heterodimeric receptor libraries using phagemids
WO1992020791A1 (en) 1990-07-10 1992-11-26 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
EP0519596A1 (en) 1991-05-17 1992-12-23 Merck & Co. Inc. A method for reducing the immunogenicity of antibody variable domains
WO1993001288A1 (de) 1991-07-08 1993-01-21 Deutsches Krebsforschungszentrum Stiftung des öffentlichen Rechts Phagemid zum screenen von antikörpern
US5212290A (en) 1989-09-08 1993-05-18 The Johns Hopkins University Antibodies specific for type II mutant EGTR
US5223409A (en) 1988-09-02 1993-06-29 Protein Engineering Corp. Directed evolution of novel binding proteins
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
WO1993017105A1 (en) 1992-02-19 1993-09-02 Scotgen Limited Altered antibodies, products and processes relating thereto
WO1993023537A1 (en) 1992-05-08 1993-11-25 Creative Biomolecules Chimeric multivalent protein analogues and methods of use thereof
US5273743A (en) 1990-03-09 1993-12-28 Hybritech Incorporated Trifunctional antibody-like compounds as a combined diagnostic and therapeutic agent
WO1994004678A1 (en) 1992-08-21 1994-03-03 Casterman Cecile Immunoglobulins devoid of light chains
EP0592106A1 (en) 1992-09-09 1994-04-13 Immunogen Inc Resurfacing of rodent antibodies
WO1994009131A1 (en) 1992-10-15 1994-04-28 Scotgen Limited Recombinant specific binding protein
WO1994012625A2 (en) 1992-11-23 1994-06-09 Zeneca Limited LIGAND BINDING VARIABLE DOMAIN (V-MIN) COMPRISING A FRAMEWORK REGION WITH A CYCLICALLY PERMUTED CENTRAL β-BARREL
US5350674A (en) 1992-09-04 1994-09-27 Becton, Dickinson And Company Intrinsic factor - horse peroxidase conjugates and a method for increasing the stability thereof
US5399346A (en) 1989-06-14 1995-03-21 The United States Of America As Represented By The Department Of Health And Human Services Gene therapy
WO1995009917A1 (en) 1993-10-07 1995-04-13 The Regents Of The University Of California Genetically engineered bispecific tetravalent antibodies
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5534254A (en) 1992-02-06 1996-07-09 Chiron Corporation Biosynthetic binding proteins for immuno-targeting
US5565332A (en) 1991-09-23 1996-10-15 Medical Research Council Production of chimeric antibodies - a combinatorial approach
WO1996037621A2 (en) 1995-05-23 1996-11-28 Morphosys Gesellschaft Für Proteinoptimierung Mbh Multimeric proteins
US5580859A (en) 1989-03-21 1996-12-03 Vical Incorporated Delivery of exogenous DNA sequences in a mammal
US5582996A (en) 1990-12-04 1996-12-10 The Wistar Institute Of Anatomy & Biology Bifunctional antibodies and method of preparing same
US5585362A (en) 1989-08-22 1996-12-17 The Regents Of The University Of Michigan Adenovirus vectors for gene therapy
US5591828A (en) 1989-06-22 1997-01-07 Behringwerke Aktiengesellschaft Bispecific and oligospecific mono-and oligovalent receptors, the preparation and use thereof
US5635602A (en) 1993-08-13 1997-06-03 The Regents Of The University Of California Design and synthesis of bispecific DNA-antibody conjugates
US5637481A (en) 1993-02-01 1997-06-10 Bristol-Myers Squibb Company Expression vectors encoding bispecific fusion proteins and methods of producing biologically active bispecific fusion proteins in a mammalian cell
US5731168A (en) 1995-03-01 1998-03-24 Genentech, Inc. Method for making heteromultimeric polypeptides
US5766886A (en) 1991-12-13 1998-06-16 Xoma Corporation Modified antibody variable domains
US5786464A (en) 1994-09-19 1998-07-28 The General Hospital Corporation Overexpression of mammalian and viral proteins
US5837821A (en) 1992-11-04 1998-11-17 City Of Hope Antibody construct
US5837242A (en) 1992-12-04 1998-11-17 Medical Research Council Multivalent and multispecific binding proteins, their manufacture and use
US5844094A (en) 1992-09-25 1998-12-01 Commonwealth Scientific And Industrial Research Organization Target binding polypeptide
US5858358A (en) 1992-04-07 1999-01-12 The United States Of America As Represented By The Secretary Of The Navy Methods for selectively stimulating proliferation of T cells
US5864019A (en) 1990-06-11 1999-01-26 Celltech Limited Multivalent antigen-binding proteins
US5869620A (en) 1986-09-02 1999-02-09 Enzon, Inc. Multivalent antigen-binding proteins
US5910573A (en) 1992-01-23 1999-06-08 Merck Patent Gesellschaft Mit Beschrankter Haftung Monomeric and dimeric antibody-fragment fusion proteins
US5932448A (en) 1991-11-29 1999-08-03 Protein Design Labs., Inc. Bispecific antibody heterodimers
US5959083A (en) 1991-06-03 1999-09-28 Behringwerke Aktiengellschaft Tetravalent bispecific receptors, the preparation and use thereof
US5981725A (en) 1989-09-08 1999-11-09 The Johns Hopkins Univiersity Structural alterations of the EGF receptor gene in human tumors
US5989830A (en) 1995-10-16 1999-11-23 Unilever Patent Holdings Bv Bifunctional or bivalent antibody fragment analogue
WO1999064460A1 (en) 1998-06-10 1999-12-16 Celltech Therapeutics Limited Divalent antibody fragments
US6005079A (en) 1992-08-21 1999-12-21 Vrije Universiteit Brussels Immunoglobulins devoid of light chains
WO2000006605A2 (en) 1998-07-28 2000-02-10 Micromet Ag Heterominibodies
US6114148A (en) 1996-09-20 2000-09-05 The General Hospital Corporation High level expression of proteins
US6207446B1 (en) 1997-01-21 2001-03-27 The General Hospital Corporation Selection of proteins using RNA-protein fusions
WO2001029058A1 (en) 1999-10-15 2001-04-26 University Of Massachusetts Rna interference pathway genes as tools for targeted genetic interference
US6239259B1 (en) 1996-04-04 2001-05-29 Unilever Patent Holdings B.V. Multivalent and multispecific antigen-binding protein
US6294353B1 (en) 1994-10-20 2001-09-25 Morphosys Ag Targeted hetero-association of recombinant proteins to multi-functional complexes
US6326193B1 (en) 1999-11-05 2001-12-04 Cambria Biosciences, Llc Insect control agent
WO2001096584A2 (en) 2000-06-12 2001-12-20 Akkadix Corporation Materials and methods for the control of nematodes
US6333396B1 (en) 1998-10-20 2001-12-25 Enzon, Inc. Method for targeted delivery of nucleic acids
US20020004587A1 (en) 2000-04-11 2002-01-10 Genentech, Inc. Multivalent antibodies and uses therefor
US6352694B1 (en) 1994-06-03 2002-03-05 Genetics Institute, Inc. Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells
US6407213B1 (en) 1991-06-14 2002-06-18 Genentech, Inc. Method for making humanized antibodies
US20020076406A1 (en) 2000-07-25 2002-06-20 Leung Shui-On Multivalent target binding protein
US20020103345A1 (en) 2000-05-24 2002-08-01 Zhenping Zhu Bispecific immunoglobulin-like antigen binding proteins and method of production
WO2002072635A2 (en) 2001-03-13 2002-09-19 University College London Specific binding members
US6476198B1 (en) 1993-07-13 2002-11-05 The Scripps Research Institute Multispecific and multivalent antigen-binding polypeptide molecules
US6511663B1 (en) 1991-06-11 2003-01-28 Celltech R&D Limited Tri- and tetra-valent monospecific antigen-binding proteins
WO2003014161A2 (en) 2001-08-10 2003-02-20 Aberdeen University Antigen binding domains from fish
US6534055B1 (en) 1988-11-23 2003-03-18 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
WO2003029456A1 (en) 2001-10-01 2003-04-10 Dyax Corp. Multi-chain eukaryotic display vectors and uses thereof
US6548640B1 (en) 1986-03-27 2003-04-15 Btg International Limited Altered antibodies
US20030207346A1 (en) 1997-05-02 2003-11-06 William R. Arathoon Method for making multispecific antibodies having heteromultimeric and common components
US20030211078A1 (en) 2001-12-07 2003-11-13 Heavner George A. Pseudo-antibody constructs
US6670453B2 (en) 1997-10-27 2003-12-30 Unilever Patent Holdings B.V. Multivalent antigen-binding proteins
US6692964B1 (en) 1995-05-04 2004-02-17 The United States Of America As Represented By The Secretary Of The Navy Methods for transfecting T cells
US6703199B1 (en) 1997-06-12 2004-03-09 Research Corporation Technologies, Inc. Artificial antibody polypeptides
US20040101519A1 (en) 2002-01-03 2004-05-27 The Trustees Of The University Of Pennsylvania Activation and expansion of T-cells using an engineered multivalent signaling platform as a research tool
US6743896B2 (en) 1997-04-30 2004-06-01 Enzon, Inc. Single-chain antigen-binding proteins capable of glycosylation, production and uses thereof
WO2004081051A1 (en) 2003-03-12 2004-09-23 The University Of Birmingham Bispecific antibodies
US6797514B2 (en) 2000-02-24 2004-09-28 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US6809185B1 (en) 1998-01-23 2004-10-26 Vlaams Interuniversitair Instituut Voor Biotechnologie Multipurpose antibody derivatives
US20040220388A1 (en) 2000-06-30 2004-11-04 Nico Mertens Novel heterodimeric fusion proteins
US20040219643A1 (en) 2001-06-28 2004-11-04 Greg Winter Dual-specific ligand
US20040242847A1 (en) 2000-10-20 2004-12-02 Naoshi Fukushima Degraded agonist antibody
US6833441B2 (en) 2001-08-01 2004-12-21 Abmaxis, Inc. Compositions and methods for generating chimeric heteromultimers
US20050003403A1 (en) 2003-04-22 2005-01-06 Rossi Edmund A. Polyvalent protein complex
US20050004352A1 (en) 1998-04-09 2005-01-06 Roland Kontermann Single-chain multiple antigen-binding molecule, its preparation and use
US20050042664A1 (en) 2003-08-22 2005-02-24 Medimmune, Inc. Humanization of antibodies
US20050048617A1 (en) 2003-08-18 2005-03-03 Medimmune, Inc. Humanization of antibodies
US6867041B2 (en) 2000-02-24 2005-03-15 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US20050069552A1 (en) 2003-07-28 2005-03-31 Bleck Gregory T. Fusion antibodies
US20050079170A1 (en) 2001-09-14 2005-04-14 Fabrice Le Gall Dimeric and multimeric antigen binding structure
US20050100543A1 (en) 2003-07-01 2005-05-12 Immunomedics, Inc. Multivalent carriers of bi-specific antibodies
US6905680B2 (en) 1988-11-23 2005-06-14 Genetics Institute, Inc. Methods of treating HIV infected subjects
US6905874B2 (en) 2000-02-24 2005-06-14 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US20050136049A1 (en) 2001-01-17 2005-06-23 Ledbetter Jeffrey A. Binding constructs and methods for use thereof
US20050136051A1 (en) 2003-12-22 2005-06-23 Bernard Scallon Methods for generating multimeric molecules
US20050163782A1 (en) 2003-06-27 2005-07-28 Biogen Idec Ma Inc. Modified binding molecules comprising connecting peptides
US20050175606A1 (en) 2001-04-11 2005-08-11 Hua-Liang Huang Cyclic single-chain trispecific antibody
US20050266425A1 (en) 2003-12-31 2005-12-01 Vaccinex, Inc. Methods for producing and identifying multispecific antibodies
US20060034810A1 (en) 2004-05-27 2006-02-16 The Trustees Of The University Of Pennsylvania Novel artificial antigen presenting cells and uses therefor
WO2006020258A2 (en) 2004-07-17 2006-02-23 Imclone Systems Incorporated Novel tetravalent bispecific antibody
US20060083747A1 (en) 2002-12-27 2006-04-20 Domantis Limited Fc fusion
US20060121005A1 (en) 2000-02-24 2006-06-08 Xcyte Therapies, Inc. Activation and expansion of cells
US20060120960A1 (en) 2004-01-30 2006-06-08 Sergey Deyev Multivalent complexes, their production and method of use
US7067318B2 (en) 1995-06-07 2006-06-27 The Regents Of The University Of Michigan Methods for transfecting T cells
US20060204493A1 (en) 2004-09-02 2006-09-14 Genentech, Inc. Heteromultimeric molecules
WO2006106905A1 (ja) 2005-03-31 2006-10-12 Chugai Seiyaku Kabushiki Kaisha 会合制御によるポリペプチド製造方法
US7129330B1 (en) 1998-05-05 2006-10-31 Deutsches Krebsforschungszentrum Stiftung Des Offentlichen Rechts Multivalent antibody constructs
US20060263367A1 (en) 2005-05-23 2006-11-23 Fey Georg H Bispecific antibody devoid of Fc region and method of treatment using same
US20070004909A1 (en) 2005-04-15 2007-01-04 Macrogenics, Inc. Covalent diabodies and uses thereof
US7175843B2 (en) 1994-06-03 2007-02-13 Genetics Institute, Llc Methods for selectively stimulating proliferation of T cells
US20070036773A1 (en) 2005-08-09 2007-02-15 City Of Hope Generation and application of universal T cells for B-ALL
US7183076B2 (en) 1997-05-02 2007-02-27 Genentech, Inc. Method for making multispecific antibodies having heteromultimeric and common components
WO2007024715A2 (en) 2005-08-19 2007-03-01 Abbott Laboratories Dual variable domain immunoglobin and uses thereof
WO2007044887A2 (en) 2005-10-11 2007-04-19 Transtarget, Inc. Method for producing a population of homogenous tetravalent bispecific antibodies
US20070087381A1 (en) 2002-04-15 2007-04-19 Tetsuo Kojima Methods for constructing scdb libraries
US20070128150A1 (en) 2003-12-23 2007-06-07 Norman Timothy J Branched molecular scaffolds for linking polymer residues to biologically active moieties
US20070141049A1 (en) 2005-08-26 2007-06-21 Reinhard Bredehorst Bivalent IgY antibody constructs for diagnostic and therapeutic applications
US20070154901A1 (en) 1997-06-11 2007-07-05 Protein Engineering Technology Aps Trimerising module
WO2007095338A2 (en) 2006-02-15 2007-08-23 Imclone Systems Incorporated Functional antibodies
WO2007110205A2 (en) 2006-03-24 2007-10-04 Merck Patent Gmbh Engineered heterodimeric protein domains
US20070274985A1 (en) 2006-05-26 2007-11-29 Stefan Dubel Antibody
WO2007137760A2 (en) 2006-05-25 2007-12-06 Bayer Schering Pharma Aktiengesellschaft Dimeric molecular complexes
US20080050370A1 (en) 2006-03-17 2008-02-28 Scott Glaser Stabilized polypeptide compositions
US20080069820A1 (en) 2006-08-30 2008-03-20 Genentech, Inc. Multispecific antibodies
US20080152645A1 (en) 2006-08-18 2008-06-26 Armagen Technologies, Inc. Genetically Encoded Multifunctional Compositions Bidrectionally Transported Between Peripheral Blood and the CNS
US20080241884A1 (en) 2003-10-08 2008-10-02 Kenya Shitara Fused Protein Composition
WO2008119353A1 (en) 2007-03-29 2008-10-09 Genmab A/S Bispecific antibodies and methods for production thereof
US20080254512A1 (en) 2006-11-02 2008-10-16 Capon Daniel J Hybrid immunoglobulins with moving parts
US20080260738A1 (en) 2007-04-18 2008-10-23 Moore Margaret D Single chain fc, methods of making and methods of treatment
WO2009021754A2 (en) 2007-08-15 2009-02-19 Bayer Schering Pharma Aktiengesellschaft Monospecific and multispecific antibodies and method of use
US7521056B2 (en) 2005-04-06 2009-04-21 Ibc Pharmaceuticals, Inc. Stably tethered structures of defined compositions with multiple functions or binding specificities
US7527787B2 (en) 2005-10-19 2009-05-05 Ibc Pharmaceuticals, Inc. Multivalent immunoglobulin-based bioactive assemblies
US7534866B2 (en) 2005-10-19 2009-05-19 Ibc Pharmaceuticals, Inc. Methods and compositions for generating bioactive assemblies of increased complexity and uses
US20090130106A1 (en) 2005-11-29 2009-05-21 The University Of Sydney Demibodies: dimerization-activated therapeutic agents
WO2009068630A1 (en) 2007-11-27 2009-06-04 Ablynx N.V. Immunoglobulin constructs
US20090148905A1 (en) 2007-11-30 2009-06-11 Claire Ashman Antigen-binding constructs
US20090155275A1 (en) 2007-07-31 2009-06-18 Medimmune, Llc Multispecific epitope binding proteins and uses thereof
US20090162359A1 (en) 2007-12-21 2009-06-25 Christian Klein Bivalent, bispecific antibodies
US20090162360A1 (en) 2007-12-21 2009-06-25 Christian Klein Bivalent, bispecific antibodies
US20090175851A1 (en) 2007-12-21 2009-07-09 Christian Klein Bivalent, bispecific antibodies
US20090175867A1 (en) 2006-06-12 2009-07-09 Trubion Pharmaceuticals, Inc. Single-Chain Multivalent Binding Proteins with Effector Function
WO2009089004A1 (en) 2008-01-07 2009-07-16 Amgen Inc. Method for making antibody fc-heterodimeric molecules using electrostatic steering effects
US20090234105A1 (en) 2006-03-24 2009-09-17 The Regents Of The University Of California Construction of a Multivalent SCFV Through Alkyne-Azide 1,3-Dipolar Cycloaddition
US20090232811A1 (en) 2007-12-21 2009-09-17 Christian Klein Bivalent, bispecific antibodies
US20090263392A1 (en) 2006-03-31 2009-10-22 Chugai Seiyaku Kabushiki Kaisha Methods of modifying antibodies for purification of bispecific antibodies
US7612181B2 (en) 2005-08-19 2009-11-03 Abbott Laboratories Dual variable domain immunoglobulin and uses thereof
US20090274649A1 (en) 2002-03-01 2009-11-05 Immunomedics, Inc. Bispecific Antibody Point Mutations for Enhancing Rate of Clearance
WO2010129304A2 (en) 2009-04-27 2010-11-11 Oncomed Pharmaceuticals, Inc. Method for making heteromultimeric molecules
WO2011056894A2 (en) 2009-11-03 2011-05-12 Jensen Michael C TRUNCATED EPIDERIMAL GROWTH FACTOR RECEPTOR (EGFRt) FOR TRANSDUCED T CELL SELECTION
US20110158957A1 (en) 2009-11-10 2011-06-30 Sangamo Biosciences, Inc. Targeted disruption of T cell receptor genes using engineered zinc finger protein nucleases
WO2011131746A2 (en) 2010-04-20 2011-10-27 Genmab A/S Heterodimeric antibody fc-containing proteins and methods for production thereof
US20120060230A1 (en) 2010-07-21 2012-03-08 Trevor Collingwood Methods and compositions for modification of a hla locus
WO2012079000A1 (en) 2010-12-09 2012-06-14 The Trustees Of The University Of Pennsylvania Use of chimeric antigen receptor-modified t cells to treat cancer
WO2012138475A1 (en) 2011-04-08 2012-10-11 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Anti-epidermal growth factor receptor variant iii chimeric antigen receptors and use of same for the treatment of cancer
US20120321667A1 (en) 2009-10-29 2012-12-20 Sentman Charles L T cell receptor-deficient t cell compositions
WO2013019615A2 (en) 2011-07-29 2013-02-07 The Trustees Of The University Of Pennsylvania Switch costimulatory receptors
WO2013060867A2 (en) 2011-10-27 2013-05-02 Genmab A/S Production of heterodimeric proteins
WO2013126712A1 (en) 2012-02-22 2013-08-29 The Trustees Of The University Of Pennsylvania Compositions and methods for generating a persisting population of t cells useful for the treatment of cancer
WO2014011984A1 (en) 2012-07-13 2014-01-16 The Trustees Of The University Of Pennsylvania Toxicity management for anti-tumor activity of cars
US20140068797A1 (en) 2012-05-25 2014-03-06 University Of Vienna Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription
WO2014055442A2 (en) 2012-10-01 2014-04-10 The Trustees Of The University Of Pennsylvania Compositions and methods for targeting stromal cells for the treatment of cancer
WO2014055657A1 (en) 2012-10-05 2014-04-10 The Trustees Of The University Of Pennsylvania Use of a trans-signaling approach in chimeric antigen receptors
US8697359B1 (en) 2012-12-12 2014-04-15 The Broad Institute, Inc. CRISPR-Cas systems and methods for altering expression of gene products
US8795965B2 (en) 2012-12-12 2014-08-05 The Broad Institute, Inc. CRISPR-Cas component systems, methods and compositions for sequence manipulation
WO2014130635A1 (en) 2013-02-20 2014-08-28 Novartis Ag Effective targeting of primary human leukemia using anti-cd123 chimeric antigen receptor engineered t cells
WO2014130657A1 (en) 2013-02-20 2014-08-28 The Trustees Of The University Of Pennsylvania Treatment of cancer using humanized anti-egfrviii chimeric antigen receptor
WO2014145252A2 (en) 2013-03-15 2014-09-18 Milone Michael C Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy
WO2014153270A1 (en) 2013-03-16 2014-09-25 Novartis Ag Treatment of cancer using humanized anti-cd19 chimeric antigen receptor
WO2014165707A2 (en) 2013-04-03 2014-10-09 Memorial Sloan-Kettering Cancer Center Effective generation of tumor-targeted t-cells derived from pluripotent stem cells
US8865406B2 (en) 2012-12-12 2014-10-21 The Broad Institute Inc. Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation
WO2015090229A1 (en) 2013-12-20 2015-06-25 Novartis Ag Regulatable chimeric antigen receptor
WO2015090230A1 (en) 2013-12-19 2015-06-25 Novartis Ag Human mesothelin chimeric antigen receptors and uses thereof
WO2015142675A2 (en) 2014-03-15 2015-09-24 Novartis Ag Treatment of cancer using chimeric antigen receptor
US20150283178A1 (en) 2014-04-07 2015-10-08 Carl H. June Treatment of cancer using anti-cd19 chimeric antigen receptor
WO2016014535A1 (en) 2014-07-21 2016-01-28 Novartis Ag Treatment of cancer using a cll-1 chimeric antigen receptor
WO2016014565A2 (en) 2014-07-21 2016-01-28 Novartis Ag Treatment of cancer using humanized anti-bcma chimeric antigen receptor
WO2016014576A1 (en) 2014-07-21 2016-01-28 Novartis Ag Treatment of cancer using a cd33 chimeric antigen receptor
WO2016025880A1 (en) 2014-08-14 2016-02-18 Novartis Ag Treatment of cancer using gfr alpha-4 chimeric antigen receptor
WO2016028896A1 (en) 2014-08-19 2016-02-25 Novartis Ag Anti-cd123 chimeric antigen receptor (car) for use in cancer treatment
WO2016164731A2 (en) 2015-04-08 2016-10-13 Novartis Ag Cd20 therapies, cd22 therapies, and combination therapies with a cd19 chimeric antigen receptor (car) - expressing cell

Family Cites Families (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9949971B2 (en) * 2014-06-17 2018-04-24 Acerta Pharma B.V. Therapeutic combinations of a BTK inhibitor, a PI3K inhibitor and/or a JAK-2 inhibitor
WO2016014530A1 (en) * 2014-07-21 2016-01-28 Novartis Ag Combinations of low, immune enhancing. doses of mtor inhibitors and cars
US20180334490A1 (en) * 2014-12-03 2018-11-22 Qilong H. Wu Methods for b cell preconditioning in car therapy
EP4012415A3 (en) * 2015-12-04 2022-12-07 Juno Therapeutics, Inc. Methods and compositions related to toxicity associated with cell therapy
US20190336504A1 (en) * 2016-07-15 2019-11-07 Novartis Ag Treatment and prevention of cytokine release syndrome using a chimeric antigen receptor in combination with a kinase inhibitor

Patent Citations (213)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4433059A (en) 1981-09-08 1984-02-21 Ortho Diagnostic Systems Inc. Double antibody conjugate
US4444878A (en) 1981-12-21 1984-04-24 Boston Biomedical Research Institute, Inc. Bispecific antibody determinants
US6331415B1 (en) 1983-04-08 2001-12-18 Genentech, Inc. Methods of producing immunoglobulins, vectors and transformed host cells for use therein
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US6548640B1 (en) 1986-03-27 2003-04-15 Btg International Limited Altered antibodies
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
EP0239400A2 (en) 1986-03-27 1987-09-30 Medical Research Council Recombinant antibodies and methods for their production
US5869620A (en) 1986-09-02 1999-02-09 Enzon, Inc. Multivalent antigen-binding proteins
EP0346087A2 (en) 1988-06-09 1989-12-13 Snow Brand Milk Products Co., Ltd. Hybrid antibody and process for the production thereof
US5223409A (en) 1988-09-02 1993-06-29 Protein Engineering Corp. Directed evolution of novel binding proteins
WO1990002809A1 (en) 1988-09-02 1990-03-22 Protein Engineering Corporation Generation and selection of recombinant varied binding proteins
US6534055B1 (en) 1988-11-23 2003-03-18 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
US5883223A (en) 1988-11-23 1999-03-16 Gray; Gary S. CD9 antigen peptides and antibodies thereto
US7232566B2 (en) 1988-11-23 2007-06-19 The United States As Represented By The Secretary Of The Navy Methods for treating HIV infected subjects
US6887466B2 (en) 1988-11-23 2005-05-03 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
US7144575B2 (en) 1988-11-23 2006-12-05 The Regents Of The University Of Michigan Methods for selectively stimulating proliferation of T cells
US6905680B2 (en) 1988-11-23 2005-06-14 Genetics Institute, Inc. Methods of treating HIV infected subjects
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5585089A (en) 1988-12-28 1996-12-17 Protein Design Labs, Inc. Humanized immunoglobulins
US5589466A (en) 1989-03-21 1996-12-31 Vical Incorporated Induction of a protective immune response in a mammal by injecting a DNA sequence
US5580859A (en) 1989-03-21 1996-12-03 Vical Incorporated Delivery of exogenous DNA sequences in a mammal
US5399346A (en) 1989-06-14 1995-03-21 The United States Of America As Represented By The Department Of Health And Human Services Gene therapy
US5591828A (en) 1989-06-22 1997-01-07 Behringwerke Aktiengesellschaft Bispecific and oligospecific mono-and oligovalent receptors, the preparation and use thereof
US5585362A (en) 1989-08-22 1996-12-17 The Regents Of The University Of Michigan Adenovirus vectors for gene therapy
WO1991003493A1 (en) 1989-08-29 1991-03-21 The University Of Southampton Bi-or trispecific (fab)3 or (fab)4 conjugates
US5814317A (en) 1989-09-08 1998-09-29 The John Hopkins University Structural alterations of the EGF receptor gene in human gliomas
US5710010A (en) 1989-09-08 1998-01-20 The Johns Hopkins University Assays for the presence of a mutant EGF receptor
US5401828A (en) 1989-09-08 1995-03-28 The Johns Hopkins University Structural alterations of the EGF receptor gene in human gliomas
US6455498B1 (en) 1989-09-08 2002-09-24 The Johns Hopkins University Structural alterations of the EGF receptor genes in human tumors
US5212290A (en) 1989-09-08 1993-05-18 The Johns Hopkins University Antibodies specific for type II mutant EGTR
US6127126A (en) 1989-09-08 2000-10-03 The Johns Hopkins University Method for diagnosing glioma associated with structural alterations of the EGF receptor gene in human tumors
US5981725A (en) 1989-09-08 1999-11-09 The Johns Hopkins Univiersity Structural alterations of the EGF receptor gene in human tumors
WO1991009967A1 (en) 1989-12-21 1991-07-11 Celltech Limited Humanised antibodies
US5273743A (en) 1990-03-09 1993-12-28 Hybritech Incorporated Trifunctional antibody-like compounds as a combined diagnostic and therapeutic agent
WO1991017271A1 (en) 1990-05-01 1991-11-14 Affymax Technologies N.V. Recombinant library screening methods
US5864019A (en) 1990-06-11 1999-01-26 Celltech Limited Multivalent antigen-binding proteins
WO1992020791A1 (en) 1990-07-10 1992-11-26 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
WO1992001047A1 (en) 1990-07-10 1992-01-23 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
WO1992009690A2 (en) 1990-12-03 1992-06-11 Genentech, Inc. Enrichment method for variant proteins with altered binding properties
US5582996A (en) 1990-12-04 1996-12-10 The Wistar Institute Of Anatomy & Biology Bifunctional antibodies and method of preparing same
WO1992015679A1 (en) 1991-03-01 1992-09-17 Protein Engineering Corporation Improved epitode displaying phage
WO1992018619A1 (en) 1991-04-10 1992-10-29 The Scripps Research Institute Heterodimeric receptor libraries using phagemids
EP0519596A1 (en) 1991-05-17 1992-12-23 Merck & Co. Inc. A method for reducing the immunogenicity of antibody variable domains
US5959083A (en) 1991-06-03 1999-09-28 Behringwerke Aktiengellschaft Tetravalent bispecific receptors, the preparation and use thereof
US6511663B1 (en) 1991-06-11 2003-01-28 Celltech R&D Limited Tri- and tetra-valent monospecific antigen-binding proteins
US6407213B1 (en) 1991-06-14 2002-06-18 Genentech, Inc. Method for making humanized antibodies
WO1993001288A1 (de) 1991-07-08 1993-01-21 Deutsches Krebsforschungszentrum Stiftung des öffentlichen Rechts Phagemid zum screenen von antikörpern
US5565332A (en) 1991-09-23 1996-10-15 Medical Research Council Production of chimeric antibodies - a combinatorial approach
US5932448A (en) 1991-11-29 1999-08-03 Protein Design Labs., Inc. Bispecific antibody heterodimers
US5766886A (en) 1991-12-13 1998-06-16 Xoma Corporation Modified antibody variable domains
US5910573A (en) 1992-01-23 1999-06-08 Merck Patent Gesellschaft Mit Beschrankter Haftung Monomeric and dimeric antibody-fragment fusion proteins
US5534254A (en) 1992-02-06 1996-07-09 Chiron Corporation Biosynthetic binding proteins for immuno-targeting
WO1993017105A1 (en) 1992-02-19 1993-09-02 Scotgen Limited Altered antibodies, products and processes relating thereto
US5858358A (en) 1992-04-07 1999-01-12 The United States Of America As Represented By The Secretary Of The Navy Methods for selectively stimulating proliferation of T cells
WO1993023537A1 (en) 1992-05-08 1993-11-25 Creative Biomolecules Chimeric multivalent protein analogues and methods of use thereof
WO1994004678A1 (en) 1992-08-21 1994-03-03 Casterman Cecile Immunoglobulins devoid of light chains
US6005079A (en) 1992-08-21 1999-12-21 Vrije Universiteit Brussels Immunoglobulins devoid of light chains
US5350674A (en) 1992-09-04 1994-09-27 Becton, Dickinson And Company Intrinsic factor - horse peroxidase conjugates and a method for increasing the stability thereof
EP0592106A1 (en) 1992-09-09 1994-04-13 Immunogen Inc Resurfacing of rodent antibodies
US5844094A (en) 1992-09-25 1998-12-01 Commonwealth Scientific And Industrial Research Organization Target binding polypeptide
WO1994009131A1 (en) 1992-10-15 1994-04-28 Scotgen Limited Recombinant specific binding protein
US5837821A (en) 1992-11-04 1998-11-17 City Of Hope Antibody construct
WO1994012625A2 (en) 1992-11-23 1994-06-09 Zeneca Limited LIGAND BINDING VARIABLE DOMAIN (V-MIN) COMPRISING A FRAMEWORK REGION WITH A CYCLICALLY PERMUTED CENTRAL β-BARREL
US5837242A (en) 1992-12-04 1998-11-17 Medical Research Council Multivalent and multispecific binding proteins, their manufacture and use
US5637481A (en) 1993-02-01 1997-06-10 Bristol-Myers Squibb Company Expression vectors encoding bispecific fusion proteins and methods of producing biologically active bispecific fusion proteins in a mammalian cell
US6476198B1 (en) 1993-07-13 2002-11-05 The Scripps Research Institute Multispecific and multivalent antigen-binding polypeptide molecules
US5635602A (en) 1993-08-13 1997-06-03 The Regents Of The University Of California Design and synthesis of bispecific DNA-antibody conjugates
WO1995009917A1 (en) 1993-10-07 1995-04-13 The Regents Of The University Of California Genetically engineered bispecific tetravalent antibodies
US7175843B2 (en) 1994-06-03 2007-02-13 Genetics Institute, Llc Methods for selectively stimulating proliferation of T cells
US6352694B1 (en) 1994-06-03 2002-03-05 Genetics Institute, Inc. Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells
US6905681B1 (en) 1994-06-03 2005-06-14 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
US5786464C1 (en) 1994-09-19 2012-04-24 Gen Hospital Corp Overexpression of mammalian and viral proteins
US5786464A (en) 1994-09-19 1998-07-28 The General Hospital Corporation Overexpression of mammalian and viral proteins
US6294353B1 (en) 1994-10-20 2001-09-25 Morphosys Ag Targeted hetero-association of recombinant proteins to multi-functional complexes
US20070014794A1 (en) 1995-03-01 2007-01-18 Genentech, Inc. Method for making heteromultimeric polypeptides
US5731168A (en) 1995-03-01 1998-03-24 Genentech, Inc. Method for making heteromultimeric polypeptides
US7172869B2 (en) 1995-05-04 2007-02-06 The United States Of America As Represented By The Secretary Of The Navy Methods for transfecting T cells
US6692964B1 (en) 1995-05-04 2004-02-17 The United States Of America As Represented By The Secretary Of The Navy Methods for transfecting T cells
WO1996037621A2 (en) 1995-05-23 1996-11-28 Morphosys Gesellschaft Für Proteinoptimierung Mbh Multimeric proteins
US7067318B2 (en) 1995-06-07 2006-06-27 The Regents Of The University Of Michigan Methods for transfecting T cells
US5989830A (en) 1995-10-16 1999-11-23 Unilever Patent Holdings Bv Bifunctional or bivalent antibody fragment analogue
US6239259B1 (en) 1996-04-04 2001-05-29 Unilever Patent Holdings B.V. Multivalent and multispecific antigen-binding protein
US6114148A (en) 1996-09-20 2000-09-05 The General Hospital Corporation High level expression of proteins
US6114148C1 (en) 1996-09-20 2012-05-01 Gen Hospital Corp High level expression of proteins
US6207446B1 (en) 1997-01-21 2001-03-27 The General Hospital Corporation Selection of proteins using RNA-protein fusions
US6743896B2 (en) 1997-04-30 2004-06-01 Enzon, Inc. Single-chain antigen-binding proteins capable of glycosylation, production and uses thereof
US20030207346A1 (en) 1997-05-02 2003-11-06 William R. Arathoon Method for making multispecific antibodies having heteromultimeric and common components
US7183076B2 (en) 1997-05-02 2007-02-27 Genentech, Inc. Method for making multispecific antibodies having heteromultimeric and common components
US20070154901A1 (en) 1997-06-11 2007-07-05 Protein Engineering Technology Aps Trimerising module
US6703199B1 (en) 1997-06-12 2004-03-09 Research Corporation Technologies, Inc. Artificial antibody polypeptides
US6670453B2 (en) 1997-10-27 2003-12-30 Unilever Patent Holdings B.V. Multivalent antigen-binding proteins
US6809185B1 (en) 1998-01-23 2004-10-26 Vlaams Interuniversitair Instituut Voor Biotechnologie Multipurpose antibody derivatives
US20050004352A1 (en) 1998-04-09 2005-01-06 Roland Kontermann Single-chain multiple antigen-binding molecule, its preparation and use
US7129330B1 (en) 1998-05-05 2006-10-31 Deutsches Krebsforschungszentrum Stiftung Des Offentlichen Rechts Multivalent antibody constructs
WO1999064460A1 (en) 1998-06-10 1999-12-16 Celltech Therapeutics Limited Divalent antibody fragments
WO2000006605A2 (en) 1998-07-28 2000-02-10 Micromet Ag Heterominibodies
US6333396B1 (en) 1998-10-20 2001-12-25 Enzon, Inc. Method for targeted delivery of nucleic acids
WO2001029058A1 (en) 1999-10-15 2001-04-26 University Of Massachusetts Rna interference pathway genes as tools for targeted genetic interference
US6326193B1 (en) 1999-11-05 2001-12-04 Cambria Biosciences, Llc Insect control agent
US6797514B2 (en) 2000-02-24 2004-09-28 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US20060121005A1 (en) 2000-02-24 2006-06-08 Xcyte Therapies, Inc. Activation and expansion of cells
US6867041B2 (en) 2000-02-24 2005-03-15 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US6905874B2 (en) 2000-02-24 2005-06-14 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US20020004587A1 (en) 2000-04-11 2002-01-10 Genentech, Inc. Multivalent antibodies and uses therefor
US20020103345A1 (en) 2000-05-24 2002-08-01 Zhenping Zhu Bispecific immunoglobulin-like antigen binding proteins and method of production
WO2001096584A2 (en) 2000-06-12 2001-12-20 Akkadix Corporation Materials and methods for the control of nematodes
US20040220388A1 (en) 2000-06-30 2004-11-04 Nico Mertens Novel heterodimeric fusion proteins
US20020076406A1 (en) 2000-07-25 2002-06-20 Leung Shui-On Multivalent target binding protein
US20040242847A1 (en) 2000-10-20 2004-12-02 Naoshi Fukushima Degraded agonist antibody
US20050136049A1 (en) 2001-01-17 2005-06-23 Ledbetter Jeffrey A. Binding constructs and methods for use thereof
WO2002072635A2 (en) 2001-03-13 2002-09-19 University College London Specific binding members
US20050175606A1 (en) 2001-04-11 2005-08-11 Hua-Liang Huang Cyclic single-chain trispecific antibody
US20040219643A1 (en) 2001-06-28 2004-11-04 Greg Winter Dual-specific ligand
US6833441B2 (en) 2001-08-01 2004-12-21 Abmaxis, Inc. Compositions and methods for generating chimeric heteromultimers
WO2003014161A2 (en) 2001-08-10 2003-02-20 Aberdeen University Antigen binding domains from fish
US20050079170A1 (en) 2001-09-14 2005-04-14 Fabrice Le Gall Dimeric and multimeric antigen binding structure
WO2003029456A1 (en) 2001-10-01 2003-04-10 Dyax Corp. Multi-chain eukaryotic display vectors and uses thereof
US20030211078A1 (en) 2001-12-07 2003-11-13 Heavner George A. Pseudo-antibody constructs
US20040101519A1 (en) 2002-01-03 2004-05-27 The Trustees Of The University Of Pennsylvania Activation and expansion of T-cells using an engineered multivalent signaling platform as a research tool
US20090274649A1 (en) 2002-03-01 2009-11-05 Immunomedics, Inc. Bispecific Antibody Point Mutations for Enhancing Rate of Clearance
US20070087381A1 (en) 2002-04-15 2007-04-19 Tetsuo Kojima Methods for constructing scdb libraries
US20060083747A1 (en) 2002-12-27 2006-04-20 Domantis Limited Fc fusion
WO2004081051A1 (en) 2003-03-12 2004-09-23 The University Of Birmingham Bispecific antibodies
US20050003403A1 (en) 2003-04-22 2005-01-06 Rossi Edmund A. Polyvalent protein complex
US20080171855A1 (en) 2003-04-22 2008-07-17 Ibc Pharmaceuticals, Inc. Polyvalent protein complex
US20050163782A1 (en) 2003-06-27 2005-07-28 Biogen Idec Ma Inc. Modified binding molecules comprising connecting peptides
US20050100543A1 (en) 2003-07-01 2005-05-12 Immunomedics, Inc. Multivalent carriers of bi-specific antibodies
US20050069552A1 (en) 2003-07-28 2005-03-31 Bleck Gregory T. Fusion antibodies
US20050048617A1 (en) 2003-08-18 2005-03-03 Medimmune, Inc. Humanization of antibodies
US20050042664A1 (en) 2003-08-22 2005-02-24 Medimmune, Inc. Humanization of antibodies
US20080241884A1 (en) 2003-10-08 2008-10-02 Kenya Shitara Fused Protein Composition
US20050136051A1 (en) 2003-12-22 2005-06-23 Bernard Scallon Methods for generating multimeric molecules
US20070128150A1 (en) 2003-12-23 2007-06-07 Norman Timothy J Branched molecular scaffolds for linking polymer residues to biologically active moieties
US20050266425A1 (en) 2003-12-31 2005-12-01 Vaccinex, Inc. Methods for producing and identifying multispecific antibodies
US20060120960A1 (en) 2004-01-30 2006-06-08 Sergey Deyev Multivalent complexes, their production and method of use
US20060034810A1 (en) 2004-05-27 2006-02-16 The Trustees Of The University Of Pennsylvania Novel artificial antigen presenting cells and uses therefor
WO2006020258A2 (en) 2004-07-17 2006-02-23 Imclone Systems Incorporated Novel tetravalent bispecific antibody
US20060204493A1 (en) 2004-09-02 2006-09-14 Genentech, Inc. Heteromultimeric molecules
WO2006106905A1 (ja) 2005-03-31 2006-10-12 Chugai Seiyaku Kabushiki Kaisha 会合制御によるポリペプチド製造方法
US7521056B2 (en) 2005-04-06 2009-04-21 Ibc Pharmaceuticals, Inc. Stably tethered structures of defined compositions with multiple functions or binding specificities
US20070004909A1 (en) 2005-04-15 2007-01-04 Macrogenics, Inc. Covalent diabodies and uses thereof
US20060263367A1 (en) 2005-05-23 2006-11-23 Fey Georg H Bispecific antibody devoid of Fc region and method of treatment using same
US20070036773A1 (en) 2005-08-09 2007-02-15 City Of Hope Generation and application of universal T cells for B-ALL
US7612181B2 (en) 2005-08-19 2009-11-03 Abbott Laboratories Dual variable domain immunoglobulin and uses thereof
WO2007024715A2 (en) 2005-08-19 2007-03-01 Abbott Laboratories Dual variable domain immunoglobin and uses thereof
US20070141049A1 (en) 2005-08-26 2007-06-21 Reinhard Bredehorst Bivalent IgY antibody constructs for diagnostic and therapeutic applications
WO2007044887A2 (en) 2005-10-11 2007-04-19 Transtarget, Inc. Method for producing a population of homogenous tetravalent bispecific antibodies
US7527787B2 (en) 2005-10-19 2009-05-05 Ibc Pharmaceuticals, Inc. Multivalent immunoglobulin-based bioactive assemblies
US7534866B2 (en) 2005-10-19 2009-05-19 Ibc Pharmaceuticals, Inc. Methods and compositions for generating bioactive assemblies of increased complexity and uses
US20090130106A1 (en) 2005-11-29 2009-05-21 The University Of Sydney Demibodies: dimerization-activated therapeutic agents
WO2007095338A2 (en) 2006-02-15 2007-08-23 Imclone Systems Incorporated Functional antibodies
US20080050370A1 (en) 2006-03-17 2008-02-28 Scott Glaser Stabilized polypeptide compositions
WO2007110205A2 (en) 2006-03-24 2007-10-04 Merck Patent Gmbh Engineered heterodimeric protein domains
US20090234105A1 (en) 2006-03-24 2009-09-17 The Regents Of The University Of California Construction of a Multivalent SCFV Through Alkyne-Azide 1,3-Dipolar Cycloaddition
US20090263392A1 (en) 2006-03-31 2009-10-22 Chugai Seiyaku Kabushiki Kaisha Methods of modifying antibodies for purification of bispecific antibodies
WO2007137760A2 (en) 2006-05-25 2007-12-06 Bayer Schering Pharma Aktiengesellschaft Dimeric molecular complexes
US20070274985A1 (en) 2006-05-26 2007-11-29 Stefan Dubel Antibody
US20090175867A1 (en) 2006-06-12 2009-07-09 Trubion Pharmaceuticals, Inc. Single-Chain Multivalent Binding Proteins with Effector Function
US20080152645A1 (en) 2006-08-18 2008-06-26 Armagen Technologies, Inc. Genetically Encoded Multifunctional Compositions Bidrectionally Transported Between Peripheral Blood and the CNS
US20080069820A1 (en) 2006-08-30 2008-03-20 Genentech, Inc. Multispecific antibodies
US20080254512A1 (en) 2006-11-02 2008-10-16 Capon Daniel J Hybrid immunoglobulins with moving parts
WO2008119353A1 (en) 2007-03-29 2008-10-09 Genmab A/S Bispecific antibodies and methods for production thereof
US20080260738A1 (en) 2007-04-18 2008-10-23 Moore Margaret D Single chain fc, methods of making and methods of treatment
US20090155275A1 (en) 2007-07-31 2009-06-18 Medimmune, Llc Multispecific epitope binding proteins and uses thereof
WO2009021754A2 (en) 2007-08-15 2009-02-19 Bayer Schering Pharma Aktiengesellschaft Monospecific and multispecific antibodies and method of use
WO2009068630A1 (en) 2007-11-27 2009-06-04 Ablynx N.V. Immunoglobulin constructs
US20090148905A1 (en) 2007-11-30 2009-06-11 Claire Ashman Antigen-binding constructs
US20090232811A1 (en) 2007-12-21 2009-09-17 Christian Klein Bivalent, bispecific antibodies
US20090175851A1 (en) 2007-12-21 2009-07-09 Christian Klein Bivalent, bispecific antibodies
US20090162360A1 (en) 2007-12-21 2009-06-25 Christian Klein Bivalent, bispecific antibodies
US20090162359A1 (en) 2007-12-21 2009-06-25 Christian Klein Bivalent, bispecific antibodies
WO2009089004A1 (en) 2008-01-07 2009-07-16 Amgen Inc. Method for making antibody fc-heterodimeric molecules using electrostatic steering effects
WO2010129304A2 (en) 2009-04-27 2010-11-11 Oncomed Pharmaceuticals, Inc. Method for making heteromultimeric molecules
US20120321667A1 (en) 2009-10-29 2012-12-20 Sentman Charles L T cell receptor-deficient t cell compositions
WO2011056894A2 (en) 2009-11-03 2011-05-12 Jensen Michael C TRUNCATED EPIDERIMAL GROWTH FACTOR RECEPTOR (EGFRt) FOR TRANSDUCED T CELL SELECTION
US20110158957A1 (en) 2009-11-10 2011-06-30 Sangamo Biosciences, Inc. Targeted disruption of T cell receptor genes using engineered zinc finger protein nucleases
WO2011131746A2 (en) 2010-04-20 2011-10-27 Genmab A/S Heterodimeric antibody fc-containing proteins and methods for production thereof
US20120060230A1 (en) 2010-07-21 2012-03-08 Trevor Collingwood Methods and compositions for modification of a hla locus
WO2012079000A1 (en) 2010-12-09 2012-06-14 The Trustees Of The University Of Pennsylvania Use of chimeric antigen receptor-modified t cells to treat cancer
WO2012138475A1 (en) 2011-04-08 2012-10-11 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Anti-epidermal growth factor receptor variant iii chimeric antigen receptors and use of same for the treatment of cancer
WO2013019615A2 (en) 2011-07-29 2013-02-07 The Trustees Of The University Of Pennsylvania Switch costimulatory receptors
WO2013060867A2 (en) 2011-10-27 2013-05-02 Genmab A/S Production of heterodimeric proteins
WO2013126712A1 (en) 2012-02-22 2013-08-29 The Trustees Of The University Of Pennsylvania Compositions and methods for generating a persisting population of t cells useful for the treatment of cancer
US20140068797A1 (en) 2012-05-25 2014-03-06 University Of Vienna Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription
WO2014011984A1 (en) 2012-07-13 2014-01-16 The Trustees Of The University Of Pennsylvania Toxicity management for anti-tumor activity of cars
WO2014055442A2 (en) 2012-10-01 2014-04-10 The Trustees Of The University Of Pennsylvania Compositions and methods for targeting stromal cells for the treatment of cancer
WO2014055657A1 (en) 2012-10-05 2014-04-10 The Trustees Of The University Of Pennsylvania Use of a trans-signaling approach in chimeric antigen receptors
US8865406B2 (en) 2012-12-12 2014-10-21 The Broad Institute Inc. Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation
US8697359B1 (en) 2012-12-12 2014-04-15 The Broad Institute, Inc. CRISPR-Cas systems and methods for altering expression of gene products
US8771945B1 (en) 2012-12-12 2014-07-08 The Broad Institute, Inc. CRISPR-Cas systems and methods for altering expression of gene products
US8795965B2 (en) 2012-12-12 2014-08-05 The Broad Institute, Inc. CRISPR-Cas component systems, methods and compositions for sequence manipulation
US8871445B2 (en) 2012-12-12 2014-10-28 The Broad Institute Inc. CRISPR-Cas component systems, methods and compositions for sequence manipulation
WO2014130657A1 (en) 2013-02-20 2014-08-28 The Trustees Of The University Of Pennsylvania Treatment of cancer using humanized anti-egfrviii chimeric antigen receptor
US20140322275A1 (en) 2013-02-20 2014-10-30 Jennifer Brogdon TREATMENT OF CANCER USING HUMANIZED ANTI-EGFRvIII CHIMERIC ANTIGEN RECEPTOR
US20140322212A1 (en) 2013-02-20 2014-10-30 Jennifer Brogdon Effective targeting of primary human leukemia using anti-cd123 chimeric antigen receptor engineered t cells
WO2014130635A1 (en) 2013-02-20 2014-08-28 Novartis Ag Effective targeting of primary human leukemia using anti-cd123 chimeric antigen receptor engineered t cells
WO2014145252A2 (en) 2013-03-15 2014-09-18 Milone Michael C Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy
WO2014153270A1 (en) 2013-03-16 2014-09-25 Novartis Ag Treatment of cancer using humanized anti-cd19 chimeric antigen receptor
WO2014165707A2 (en) 2013-04-03 2014-10-09 Memorial Sloan-Kettering Cancer Center Effective generation of tumor-targeted t-cells derived from pluripotent stem cells
WO2015090230A1 (en) 2013-12-19 2015-06-25 Novartis Ag Human mesothelin chimeric antigen receptors and uses thereof
WO2015090229A1 (en) 2013-12-20 2015-06-25 Novartis Ag Regulatable chimeric antigen receptor
WO2015142675A2 (en) 2014-03-15 2015-09-24 Novartis Ag Treatment of cancer using chimeric antigen receptor
US20150283178A1 (en) 2014-04-07 2015-10-08 Carl H. June Treatment of cancer using anti-cd19 chimeric antigen receptor
WO2016014535A1 (en) 2014-07-21 2016-01-28 Novartis Ag Treatment of cancer using a cll-1 chimeric antigen receptor
WO2016014565A2 (en) 2014-07-21 2016-01-28 Novartis Ag Treatment of cancer using humanized anti-bcma chimeric antigen receptor
WO2016014576A1 (en) 2014-07-21 2016-01-28 Novartis Ag Treatment of cancer using a cd33 chimeric antigen receptor
US20160046724A1 (en) 2014-07-21 2016-02-18 The Trustees Of The University Of Pennsylvania Treatment of cancer using humanized anti-bcma chimeric antigen receptor
US20160051651A1 (en) 2014-07-21 2016-02-25 The Trustees Of The University Of Pennsylvania Treatment of cancer using a cll-1 chimeric antigen receptor
US20160096892A1 (en) 2014-07-21 2016-04-07 The Trustees Of The University Of Pennsylvania Treatment of cancer using a cd33 chimeric antigen receptor
WO2016025880A1 (en) 2014-08-14 2016-02-18 Novartis Ag Treatment of cancer using gfr alpha-4 chimeric antigen receptor
WO2016028896A1 (en) 2014-08-19 2016-02-25 Novartis Ag Anti-cd123 chimeric antigen receptor (car) for use in cancer treatment
US20160068601A1 (en) 2014-08-19 2016-03-10 The Trustees Of The University Of Pennsylvania Treatment of cancer using a cd123 chimeric antigen receptor
WO2016164731A2 (en) 2015-04-08 2016-10-13 Novartis Ag Cd20 therapies, cd22 therapies, and combination therapies with a cd19 chimeric antigen receptor (car) - expressing cell

Non-Patent Citations (138)

* Cited by examiner, † Cited by third party
Title
AGATA ET AL., INT. IMMUNOL, vol. 8, 1996, pages 765 - 75
AGGEN ET AL., GENE THER., vol. 19, no. 4, April 2012 (2012-04-01), pages 365 - 74
AL-LAZIKANI ET AL., JMB, vol. 273, 1997, pages 927 - 948
ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410
ALTSCHUL ET AL., NUC. ACIDS RES., vol. 25, 1977, pages 3389 - 3402
BACA ET AL., J. BIOL. CHEM., vol. 272, no. 16, 1997, pages 10678 - 84
BARRANGOU ET AL., SCIENCE, vol. 315, 2007, pages 1709 - 1712
BATZER ET AL., NUCLEIC ACID RES., vol. 19, 1991, pages 5081
BERG ET AL., TRANSPLANT PROC., vol. 30, no. 8, 1998, pages 3975 - 3977
BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426
BITINAITE ET AL., PROC. NATL. ACAD. SCI. USA, vol. 95, 1998, pages 10570 - 5
BLANK ET AL., CANCER IMMUNOL. IMMUNOTHER, vol. 54, 2005, pages 307 - 314
BOCH ET AL., SCIENCE, vol. 326, 2009, pages 1509 - 12
BOCH, NATURE BIOTECH., vol. 29, 2011, pages 135 - 6
BOLOTIN ET AL., MICROBIOL., vol. 151, 2005, pages 2551 - 2561
BRENT ET AL., CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, 2003
BROUNS ET AL., SCIENCE, vol. 321, 2008, pages 960 - 964
CALDAS ET AL., PROTEIN ENG., vol. 13, no. 5, 2000, pages 353 - 60
CARL JUNE: "Adoptive T cell therapy for cancer in the clinic", JOURNAL OF CLINICAL INVESTIGATION, vol. 117, 2007, pages 1466 - 1476, XP055287551, DOI: doi:10.1172/JCI32446
CARROLL ET AL., GENETICS SOCIETY OF AMERICA, vol. 188, 2011, pages 773 - 782
CARTER ET AL., EUR J IMMUNOL, vol. 32, 2002, pages 634 - 43
CARTER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 4285
CATHOMEN ET AL., MOL. THER., vol. 16, 2008, pages 1200 - 7
CERMAK ET AL., NUCL. ACIDS RES., vol. 39, 2011, pages e82
CHEN, J.; ZHENG, X. F.; BROWN, E. J.; SCHREIBER, S. L.: "Identification of an 11-kDa FKBP 12-rapamycin-binding domain within the 289-kDa FKBP 12-rapamycin-associated protein and characterization of a critical serine residue", PROC NATL ACAD SCI USA, vol. 92, 1995, pages 4947 - 51
CHOTHIA ET AL., J. MOL. BIOL., vol. 196, 1987, pages 901
CONG, SCIENCE, vol. 339, 2013, pages 819 - 823
COUTO ET AL., CANCER RES., vol. 55, no. 23, 1995, pages 5973s - 5977s
COUTO ET AL., CANCER RES., vol. 55, no. 8, 1995, pages 1717 - 22
CRADDOCK ET AL., J IMMUNOTHER., vol. 33, no. 8, October 2010 (2010-10-01), pages 780 - 8
DAO ET AL., SCI TRANSL MED, vol. 5, no. 176, 2013, pages 176ra33
DATABASE Nucleotide [O] 15 July 2006 (2006-07-15), "Mesothelin [Homo sapiens]", retrieved from NCBI Database accession no. AAH03512.1
DATABASE Nucleotide [O] 26 January 2001 (2001-01-26), "Homo sapiens truncated epidermal growth factor receptor precursor (EGFR) mRNA, complete cds", retrieved from NCBI Database accession no. AF125253
DE HAARD ET AL., J. BIOL. CHEM, vol. 274, 1999, pages 18218 - 30
DI ET AL., N ENGL. J. MED., vol. 365, no. 18, 3 November 2011 (2011-11-03), pages 1673 - 1683
DI STASI ET AL., N. ENGL. J. MED., vol. 365, 2011, pages 1673 - 83
DONG ET AL., J MOL MED, vol. 81, 2003, pages 281 - 7
DOYON ET AL., NATURE METHODS, vol. 8, 2010, pages 74 - 79
E. MEYERS; W. MILLER, COMPUT. APPL. BIOSCI., vol. 4, 1988, pages 11 - 17
FREEMAN, J EXP MED, vol. 192, 2000, pages 1027 - 34
GARLAND ET AL., J. IMMUNOL METH., vol. 227, no. 1-2, 1999, pages 53 - 63
GEIBLER ET AL., PLOS ONE, vol. 6, 2011, pages e19509
GHOSH ET AL., GLYCOBIOLOGY, vol. 5, 1991, pages 505 - 10
GRISSA ET AL., BMC BIOINFORMATICS, vol. 8, 2007, pages 172
GRUPP ET AL., NEJM, vol. 368, 2013, pages 1509 - 1518
GUO ET AL., J. MOL. BIOL., vol. 200, 2010, pages 96
GUO ET AL., J. MOL. BIOL., vol. 400, 2010, pages 96
HAANEN ET AL., J. EXP. MED., vol. 190, no. 9, 1999, pages 13191328
HAFT ET AL., PLOS COMPUT. BIOL., vol. 1, 2005, pages e60
HAMERS-CASTERMAN, C. ET AL., NATURE, vol. 363, 1993, pages 446 - 448
HANES ET AL., METHODS ENZYMOL., vol. 328, 2000, pages 404 - 30
HANES ET AL., NAT BIOTECHNOL., vol. 18, 2000, pages 1287 - 92
HARLOW ET AL.: "Antibodies: A Laboratory Manual", 1989, COLD SPRING HARBOR
HARLOW ET AL.: "Using Antibodies: A Laboratory Manual", 1999, COLD SPRING HARBOR LABORATORY PRESS
HOCKEMEYER ET AL., NATURE BIOTECH., vol. 29, 2011, pages 731 - 734
HOET ET AL., NAT BIOTECHNOL., vol. 23, no. 3, 2005, pages 344 - 8
HOLLINGER ET AL., PROC NATL ACAD. SCI. U.S.A., vol. 90, 1993, pages 6444 - 6448
HOLLINGER; HUDSON, NATURE BIOTECHNOLOGY, vol. 23, 2005, pages 1126 - 1136
HOOGENBOOM ET AL., IMMUNOL TODAY, vol. 2, 2000, pages 371 - 8
HOOGENBOOM ET AL., IMMUNOTECHNOLOGY, vol. 4, 1998, pages 1 - 20
HORVATH ET AL., SCIENCE, vol. 327, 2010, pages 167 - 170
HOUSTON ET AL.,, PROC. NATL. ACAD. SCI., vol. 85, 1988, pages 5879 - 5883
HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883
JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 525
JONNALAGADDA ET AL., GENE THER., vol. 20, no. 8, 2013, pages 853 - 860
JUNE ET AL., NATURE REVIEWS IMMUNOLOGY, vol. 9.10, 2009, pages 704 - 716
KABAT ET AL.: "Sequences of Proteins of Immunological Interest, 5th Ed.", 1991, PUBLIC HEALTH SERVICE, NATIONAL INSTITUTES OF HEALTH
KALOS ET AL., SCI TRANSL MED, vol. 3, 2011, pages 95ra73
KERSHAW ET AL., HUM GENE THER., vol. 13, no. 16, 1 November 2002 (2002-11-01), pages 1971 - 80
KIM ET AL., PROC. NATL. ACAD. SCI. USA, vol. 93, 1996, pages 1156 - 1160
KONISHI ET AL., CLIN CANCER RES, vol. 10, 2004, pages 5094
KUNIN ET AL., GENOME BIOL., vol. 8, 2007, pages R61
LAABI Y. ET AL., NUCLEIC ACIDS RES., vol. 22, 1994, pages 1147 - 1154
LANZAVECCHIA ET AL., EUR. J. IMMUNOL., vol. 17, 1987, pages 105
LATCHMAN ET AL., NAT IMMUNOL, vol. 2, 2001, pages 261 - 8
LEE, D. ET AL., BLOOD, vol. 124, no. 2, 2014, pages 188 - 195
MAKAROVA ET AL., BIOLOGY DIRECT, vol. 1, 2006, pages 7
MARRAGINI ET AL., SCIENCE, vol. 322, 2008, pages 1843 - 1845
MATTHEAKIS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 91, 1994, pages 9022
MEYERSON ET AL.: "hEST2, the Putative Human Telomerase Catalytic Subunit Gene, Is Up-Regulated in Tumor Cells and during Immortalization", CELL, vol. 90, no. 4, 22 August 1997 (1997-08-22), pages 785 - 795, XP002056804, DOI: doi:10.1016/S0092-8674(00)80538-3
MILLER ET AL., NATURE BIOTECH., vol. 29, 2011, pages 143 - 8
MILONE ET AL., MOL. THER., vol. 17, no. 8, 2009, pages 1453 - 1464
MOJICA ET AL., J. MOL. EVOL., vol. 60, 2005, pages 174 - 182
MOREA ET AL., METHODS, vol. 20, no. 3, 2000, pages 267 - 79
MOSCOU ET AL., SCIENCE, vol. 326, 2009, pages 3501
NEEDLEMAN; WUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 443
NEEDLEMAN; WUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 444 - 453
NICHOLSON ET AL., MOL. IMMUN., vol. 34, no. 16-17, 1997, pages 1157 - 1165
OHTSUKA ET AL., J. BIOL. CHEM., vol. 260, 1985, pages 2605 - 2608
PADLAN, MOLECULAR IMMUNOLOGY, vol. 28, no. 4/5, 1991, pages 489 - 498
PEARSON; LIPMAN, PROC. NAT'L. ACAD. SCI. USA, vol. 85, 1988, pages 2444
PEDERSEN ET AL., J. MOL. BIOL., vol. 235, no. 3, 1994, pages 959 - 73
PENNISI, SCIENCE, vol. 341, 2013, pages 833 - 836
PHILIP ET AL., BLOOD, vol. 124, no. 8, 2014, pages 1277 - 1287
PORTER ET AL., NEJM, vol. 365, 2011, pages 725 - 733
POURCEL ET AL., MICROBIOL., vol. 151, 2005, pages 653 - 663
PRESTA ET AL., J. IMMUNOL., vol. 151, 1993, pages 2623
PRESTA, CURR. OP. STRUCT. BIOL., vol. 2, 1992, pages 593 - 596
REICHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 329
RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323
RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 327
ROGUSKA ET AL., PNAS, vol. 91, 1994, pages 969 - 973
ROGUSKA ET AL., PROTEIN ENG., vol. 9, no. 10, 1996, pages 895 - 904
ROSSOLINI ET AL., MOL. CELL. PROBES, vol. 8, 1994, pages 91 - 98
SADELAIN ET AL., CANCER DISCOVERY, vol. 3, 2013, pages 388 - 398
SAMBROOK ET AL.: "MOLECULAR CLONING: A LABORATORY MANUAL", vol. 1 -4, 2012, COLD SPRING HARBOR PRESS
SANDHU J S, GENE, vol. 150, no. 2, 1994, pages 409 - 10
SASTRY ET AL., J VIROL., vol. 85, no. 5, 2011, pages 1935 - 1942
SCHAFFITZEL ET AL., J IMMUNOL METHODS, vol. 231, no. 1-2, 1999, pages 119 - 35
See also references of EP3484455A2
SERGEEVA ET AL., BLOOD, vol. 117, no. 16, 2011, pages 4262 - 4272
SIMS ET AL., J. IMMUNOL., vol. 151, 1993, pages 2296
SMIRNOVA AS ET AL., MOL IMMUNOL., vol. 45, no. 4, 2008, pages 1179 - 1183
SMITH ET AL.: "Ex vivo expansion of human T cells for adoptive immunotherapy using the novel Xeno-free CTS Immune Cell Serum Replacement", CLINICAL & TRANSLATIONAL IMMUNOLOGY, vol. 4, 2015, pages e31
SMITH, SCIENCE, vol. 228, 1985, pages 1315 - 1317
SMITH; WATERMAN, ADV. APPL. MATH., vol. 2, 1970, pages 482c
SONG ET AL., BLOOD, vol. 119, no. 3, 2012, pages 696 - 706
SONG ET AL., CANCER GENE THER., vol. 15, no. 10, 2008, pages 667 - 75
STERN ET AL., TRENDS. GENET., vol. 28, 2010, pages 335 - 340
STRELTSOV, PROTEIN SCI., vol. 14, 2005, pages 2901 - 2909
STUDNICKA ET AL., PROTEIN ENGINEERING, vol. 7, no. 6, 1994, pages 805 - 814
SUGAWA ET AL., PROC. NATL. ACAD. SCI., vol. 87, 1990, pages 8602 - 8606
SZCZEPEK ET AL., NATURE BIOTECH., vol. 25, 2007, pages 786 - 793
TAN ET AL., J. IMMUNOL., vol. 169, 2002, pages 1119 - 25
TASSEV ET AL., CANCER GENE THER, vol. 19, no. 2, 2012, pages 84 - 100
THEMELI ET AL., NAT. BIOTECHNOL., vol. 31.10, 2013, pages 928 - 35
TOBIAS MAETZIG ET AL.: "Gammaretroviral Vectors: Biology, Technology and Application", VIRUSES, vol. 3, no. 6, June 2011 (2011-06-01), pages 677 - 713
TSAI, NATURE BIOTECHNOL., vol. 32, no. 6, 2014, pages 569 - 576
UI-TEI ET AL., FEBS LETTERS, vol. 479, 2000, pages 79 - 82
ULLRICH ET AL., NATURE, vol. 309, 1984, pages 418 - 425
VERHOEYEN ET AL., SCIENCE, vol. 239, 1988, pages 1534 - 1536
VERMA ET AL., J IMMUNOL, vol. 184, no. 4, 2010, pages 2156 - 2165
WIEDENHEFT ET AL., NATURE, vol. 482, 2012, pages 331 - 8
WILLEMSEN ET AL., GENE THER, vol. 8, no. 21, 2001, pages 1601 - 1608
WILLEMSEN RA ET AL., GENE THERAPY, vol. 7, 2000, pages 1369 - 1377
WOOD ET AL., SCIENCE, vol. 333, 2011, pages 307
ZHANG ET AL., NATURE BIOTECH., vol. 29, 2011, pages 149 - 53
ZHANG T ET AL., CANCER GENE THER, vol. 11, 2004, pages 487 - 496

Cited By (67)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12338261B2 (en) 2015-05-18 2025-06-24 Sumitomo Pharma Oncology, Inc. Alvocidib prodrugs having increased bioavailability
US10835537B2 (en) 2015-08-03 2020-11-17 Sumitomo Dainippon Pharma Oncology, Inc. Combination therapies for treatment of cancer
US11747346B2 (en) 2015-09-03 2023-09-05 Novartis Ag Biomarkers predictive of cytokine release syndrome
US12098208B2 (en) 2016-03-22 2024-09-24 Seattle Children's Hospital Early intervention methods to prevent or ameliorate toxicity
EP3433276B1 (en) 2016-03-22 2021-12-22 Seattle Children's Hospital (DBA Seattle Children's Research Institute) Early intervention methods to prevent or ameliorate toxicity
US11760804B2 (en) 2016-03-22 2023-09-19 Seattle Children's Hospital Early intervention methods to prevent or ameliorate toxicity
US10858649B2 (en) 2016-09-15 2020-12-08 Augmenta Bioworks, Inc. Immune repertoire sequence amplification methods and applications
US11279694B2 (en) 2016-11-18 2022-03-22 Sumitomo Dainippon Pharma Oncology, Inc. Alvocidib prodrugs and their use as protein kinase inhibitors
US20210106618A1 (en) * 2017-09-06 2021-04-15 Fred Hutchinson Cancer Research Center Methods for improving adoptive cell therapy
US12350312B2 (en) * 2017-09-06 2025-07-08 Fred Hutchinson Cancer Center Methods for improving adoptive cell therapy
US11497756B2 (en) 2017-09-12 2022-11-15 Sumitomo Pharma Oncology, Inc. Treatment regimen for cancers that are insensitive to BCL-2 inhibitors using the MCL-1 inhibitor alvocidib
US11712458B2 (en) 2018-01-29 2023-08-01 Dana-Farber Cancer Institute, Inc. Degradation of Bruton's tyrosine kinase (BTK) by conjugation of BTK inhibitors with E3 ligase ligand and methods of use
WO2019148150A1 (en) * 2018-01-29 2019-08-01 Dana-Farber Cancer Institute, Inc. Degradation of bruton's tyrosine kinase (btk) by conjugation of btk inhibitors with e3 ligase ligand and methods of use
US11103510B2 (en) 2018-02-16 2021-08-31 Incyte Corporation JAK1 pathway inhibitors for the treatment of cytokine-related disorders
EP3752146A1 (en) * 2018-02-16 2020-12-23 Incyte Corporation Jak1 pathway inhibitors for the treatment of cytokine-related disorders
JP2021513981A (ja) * 2018-02-16 2021-06-03 インサイト・コーポレイションIncyte Corporation サイトカイン関連障害を治療するためのjak1経路阻害薬
US11833152B2 (en) 2018-02-16 2023-12-05 Incyte Corporation JAK1 pathway inhibitors for the treatment of cytokine-related disorders
JP2024023213A (ja) * 2018-02-16 2024-02-21 インサイト・コーポレイション サイトカイン関連障害を治療するためのjak1経路阻害薬
KR102925957B1 (ko) * 2018-02-16 2026-02-11 인사이트 코포레이션 사이토카인-관련 장애의 치료를 위한 jak1 경로 억제제
KR20240157777A (ko) * 2018-02-16 2024-11-01 인사이트 코포레이션 사이토카인-관련 장애의 치료를 위한 jak1 경로 억제제
US12336998B2 (en) 2018-02-16 2025-06-24 Incyte Corporation JAK1 pathway inhibitors for the treatment of cytokine-related disorders
IL311485B1 (en) * 2018-02-16 2026-01-01 Incyte Corp JAK1 pathway inhibitors for the treatment of cytokine-related disorders
US20210002374A1 (en) * 2018-03-08 2021-01-07 Novartis Ag USE OF an anti-P-selectin antibody
US12473598B2 (en) 2018-03-28 2025-11-18 Board Of Regents, The University Of Texas System Identification of epigenetic alterations in DNA isolated from exosomes
US12150960B2 (en) 2018-04-17 2024-11-26 Innovative Cellular Therapeutics Holdings, Ltd. Modified cell expansion and uses thereof
US10869888B2 (en) 2018-04-17 2020-12-22 Innovative Cellular Therapeutics CO., LTD. Modified cell expansion and uses thereof
EP3801769A1 (en) * 2018-05-25 2021-04-14 Novartis AG Combination therapy with chimeric antigen receptor (car) therapies
US20210113690A1 (en) * 2018-06-14 2021-04-22 Berlin-Chemie Ag Pharmaceutical combinations
US12194092B2 (en) * 2018-06-14 2025-01-14 Berlin-Chemie Ag Pharmaceutical combinations
US20210268028A1 (en) * 2018-07-02 2021-09-02 Cellectis Chimeric antigen receptors (car)-expressing cells and combination treatment for immunotherapy of patients with relapse refractory adverse genetic risk aml
US12240915B2 (en) 2018-08-30 2025-03-04 Innovative Cellular Therapeutics Holdings, Ltd. Chimeric antigen receptor cells for treating solid tumor
US11161913B2 (en) 2018-08-30 2021-11-02 Innovative Cellular Therapeutics Holdings, Ltd. Chimeric antigen receptor cells for treating solid tumor
US11662341B2 (en) 2018-10-10 2023-05-30 Augmenta Bioworks, Inc. Methods for isolating immune binding proteins
WO2020077300A1 (en) * 2018-10-12 2020-04-16 Tolero Pharmaceuticals, Inc. Methods for monitoring tumor lysis syndrome
US10918667B2 (en) 2018-11-20 2021-02-16 Innovative Cellular Therapeutics CO., LTD. Modified cell expressing therapeutic agent and uses thereof
US12590148B2 (en) 2018-11-26 2026-03-31 Nkarta, Inc. Methods for the simultaneous expansion of multiple immune cell types, related compositions and uses of same in cancer immunotherapy
US11034710B2 (en) 2018-12-04 2021-06-15 Sumitomo Dainippon Pharma Oncology, Inc. CDK9 inhibitors and polymorphs thereof for use as agents for treatment of cancer
US11530231B2 (en) 2018-12-04 2022-12-20 Sumitomo Pharma Oncology, Inc. CDK9 inhibitors and polymorphs thereof for use as agents for treatment of cancer
US12077554B2 (en) 2018-12-04 2024-09-03 Sumitomo Pharma Oncology, Inc. CDK9 inhibitors and polymorphs thereof for use as agents for treatment of cancer
CN113412130A (zh) * 2018-12-08 2021-09-17 得克萨斯州大学系统董事会 用于诊断和治疗癌症及其他疾病的对促肿瘤癌症相关成纤维细胞的识别和靶向
AU2019392915B2 (en) * 2018-12-08 2025-05-29 Board Of Regents, The University Of Texas System Identification and targeting of tumor promoting carcinoma associated fibroblasts for diagnosis and treatment of cancer and other diseases
WO2020118216A1 (en) * 2018-12-08 2020-06-11 Board Of Regents, The University Of Texas System Identification and targeting of tumor promoting carcinoma associated fibroblasts for diagnosis and treatment of cancer and other diseases
US11141436B2 (en) 2019-03-05 2021-10-12 Nkarta, Inc. Immune cells engineered to express CD19-directed chimeric antigen receptors and uses thereof in immunotherapy
US11154575B2 (en) 2019-03-05 2021-10-26 Nkarta, Inc. Cancer immunotherapy using CD19-directed chimeric antigen receptors
US11253547B2 (en) 2019-03-05 2022-02-22 Nkarta, Inc. CD19-directed chimeric antigen receptors and uses thereof in immunotherapy
US12398187B2 (en) 2019-03-05 2025-08-26 Nkarta, Inc. CD19-directed chimeric antigen receptors and uses thereof in immunotherapy
US11793802B2 (en) 2019-03-20 2023-10-24 Sumitomo Pharma Oncology, Inc. Treatment of acute myeloid leukemia (AML) with venetoclax failure
WO2020198080A1 (en) * 2019-03-22 2020-10-01 Augmenta Bioworks, Inc. Isolation of single cells and uses thereof
EP3947450A4 (en) * 2019-04-05 2023-05-31 The Regents Of The University Of California METHODS AND COMPOSITIONS USING CHIMERIC BINDING POLYPEPTIDES
EP3962490A4 (en) * 2019-05-03 2023-01-25 Kite Pharma, Inc. METHOD OF ADMINISTRATION OF CHIMERIC ANTIGEN RECEPTOR IMMUNOTHERAPY
EP4249075A3 (en) * 2019-05-03 2023-11-08 Kite Pharma, Inc. Methods of administering chimeric antigen receptor immunotherapy
US12540191B2 (en) 2019-05-07 2026-02-03 Gracell Biotechnologies (Shanghai) Co., Ltd. Engineered immune cells targeting BCMA and their uses thereof
JP7741732B2 (ja) 2019-05-07 2025-09-18 グレイセル・バイオテクノロジーズ(シャンハイ)カンパニー・リミテッド Bcmaを標的とする操作された免疫細胞及びその使用
JP2022531911A (ja) * 2019-05-07 2022-07-12 グレイセル・バイオテクノロジーズ(シャンハイ)カンパニー・リミテッド Bcmaを標的とする操作された免疫細胞及びその使用
WO2021026451A1 (en) * 2019-08-08 2021-02-11 Rigel Pharmaceuticals, Inc. Compounds and method for treating cytokine release syndrome
WO2021030526A1 (en) * 2019-08-14 2021-02-18 Rigel Pharmaceuticals, Inc. Method of blocking or ameliorating cytokine release syndrome
US12441707B2 (en) 2019-12-30 2025-10-14 Tyra Biosciences, Inc. Indazole compounds
US12076343B2 (en) 2020-02-19 2024-09-03 Innovative Cellular Therapeutics Holdings, Ltd. Engineered safety in cell therapy
WO2021168375A1 (en) * 2020-02-20 2021-08-26 Kite Pharma, Inc. Chimeric antigen receptor t cell therapy
US12252701B2 (en) 2020-02-20 2025-03-18 Kite Pharma, Inc. Chimeric antigen receptor T cell therapy
US12043654B2 (en) 2020-06-02 2024-07-23 Innovative Cellular Therapeutics Holdings, Ltd. Anti-GCC antibody and CAR thereof for treating digestive system cancer
US12240899B2 (en) 2020-06-22 2025-03-04 Ngm Biopharmaceuticals, Inc. LAIR-1-binding agents and methods of use thereof
US11617767B2 (en) 2020-11-20 2023-04-04 Simcere Innovation, Inc. Armed dual CAR-T compositions and methods for cancer immunotherapy
US11957661B2 (en) 2020-12-08 2024-04-16 Incyte Corporation JAK1 pathway inhibitors for the treatment of vitiligo
EP4319793A4 (en) * 2021-04-08 2025-03-19 Biosceptre (Aust) Pty Ltd Methods for controlling immune cell activity
US12268667B2 (en) 2021-05-03 2025-04-08 Incyte Corporation JAK1 pathway inhibitors for the treatment of prurigo nodularis
WO2024097852A1 (en) * 2022-11-02 2024-05-10 Mayo Foundation For Medical Education And Research Engineered mesenchymal stromal cells

Also Published As

Publication number Publication date
CA3030837A1 (en) 2018-01-18
JP2025032091A (ja) 2025-03-11
JP7219376B2 (ja) 2023-02-08
SG11201900344YA (en) 2019-02-27
EP3484455A2 (en) 2019-05-22
AU2017295886B2 (en) 2023-08-10
US20190336504A1 (en) 2019-11-07
JP2022166049A (ja) 2022-11-01
AU2017295886A1 (en) 2019-01-31
WO2018013918A3 (en) 2018-02-22
CN110461315A (zh) 2019-11-15
JP2019525956A (ja) 2019-09-12
AU2017295886C1 (en) 2024-05-16
JP7584475B2 (ja) 2024-11-15
AU2023263469A1 (en) 2023-11-30
CN110461315B (zh) 2025-05-02
CN120285179A (zh) 2025-07-11

Similar Documents

Publication Publication Date Title
JP7584475B2 (ja) キメラ抗原受容体をキナーゼ阻害薬と併用して使用したサイトカイン放出症候群の治療及び予防
US20250163123A1 (en) Therapeutic regimens for chimeric antigen receptor (car)-expressing cells
US20250353916A1 (en) Treatment of cancer using a cd33 chimeric antigen receptor
US11591404B2 (en) Treatment of cancer using a CD123 chimeric antigen receptor
US20200339651A1 (en) Methods for b cell preconditioning in car therapy
EP4056588B1 (en) Cd20 therapies, cd22 therapies, and combination therapies with a cd19 chimeric antigen receptor (car)- expressing cell
US20190151365A1 (en) Combination therapies of chimeric antigen receptors and pd-1 inhibitors
EP3801769A1 (en) Combination therapy with chimeric antigen receptor (car) therapies
WO2016126608A1 (en) Car-expressing cells against multiple tumor antigens and uses thereof
WO2016014535A1 (en) Treatment of cancer using a cll-1 chimeric antigen receptor
AU2015317608A1 (en) Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy
HK40077699A (en) Cd20 therapies, cd22 therapies, and combination therapies with a cd19 chimeric antigen receptor (car)- expressing cell

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17746563

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 2019522625

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 3030837

Country of ref document: CA

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2017295886

Country of ref document: AU

Date of ref document: 20170714

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2017746563

Country of ref document: EP

Effective date: 20190215

WWG Wipo information: grant in national office

Ref document number: 201780054186.0

Country of ref document: CN