WO2018002564A1 - Biomarqueur pour le diagnostic de maladies inflammatoires - Google Patents

Biomarqueur pour le diagnostic de maladies inflammatoires Download PDF

Info

Publication number
WO2018002564A1
WO2018002564A1 PCT/FR2017/051811 FR2017051811W WO2018002564A1 WO 2018002564 A1 WO2018002564 A1 WO 2018002564A1 FR 2017051811 W FR2017051811 W FR 2017051811W WO 2018002564 A1 WO2018002564 A1 WO 2018002564A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
amino acid
protein kinase
natural
activity
Prior art date
Application number
PCT/FR2017/051811
Other languages
English (en)
Inventor
Iain K. PEMBERTON
Original Assignee
Ip Research Consulting
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Ip Research Consulting filed Critical Ip Research Consulting
Publication of WO2018002564A1 publication Critical patent/WO2018002564A1/fr

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/04—Linear peptides containing only normal peptide links
    • C07K7/06—Linear peptides containing only normal peptide links having 5 to 11 amino acids
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/48—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving transferase
    • C12Q1/485—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving transferase involving kinase
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/90—Enzymes; Proenzymes
    • G01N2333/91—Transferases (2.)
    • G01N2333/912—Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
    • G01N2333/91205—Phosphotransferases in general
    • G01N2333/9121—Phosphotransferases in general with an alcohol group as acceptor (2.7.1), e.g. general tyrosine, serine or threonine kinases
    • G01N2333/91215—Phosphotransferases in general with an alcohol group as acceptor (2.7.1), e.g. general tyrosine, serine or threonine kinases with a definite EC number (2.7.1.-)
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00—Detection or diagnosis of diseases
    • G01N2800/06—Gastro-intestinal diseases
    • G01N2800/065—Bowel diseases, e.g. Crohn, ulcerative colitis, IBS
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00—Detection or diagnosis of diseases
    • G01N2800/52—Predicting or monitoring the response to treatment, e.g. for selection of therapy based on assay results in personalised medicine; Prognosis

Definitions

  • the invention relates to the use of a biomarker for the diagnosis of inflammatory diseases, in particular chronic inflammatory diseases, in particular inflammatory bowel diseases, a diagnostic method, a method for evaluating the efficacy of a treatment, an assay method, as well as kits and enzymatic substrates.
  • IBD inflammatory bowel disease
  • CD Crohn's disease
  • UC ulcerative colitis
  • Protein kinases are a family of enzymes that play a key role in intracellular signal transduction.
  • the cAMP-dependent protein kinase (cyclic Adenosine monophosphate), or protein kinase A (PKA) is a dimer protein composed of two types of subunits, a catalytic subunit ensuring the transfer of a phosphate group substrate protein, and a cAMP-sensitive regulatory subunit controlling ON / OFF activation of protein kinase A.
  • protein kinase A activation of many proteins by phosphorylation and is involved in the regulation of many cellular mechanisms (including the regulation of sugar and lipid metabolism).
  • the present invention provides a method of diagnosing inflammatory diseases, including inflammatory diseases, particularly IBD, non-invasive, sensitive, fast, and inexpensive based on a protein kinase capable of phosphorylating a substrate of protein kinase A.
  • One aspect of the invention relates to the use of phosphorylation rate for the diagnosis of inflammatory diseases, especially chronic inflammatory diseases.
  • Another aspect of the invention thus relates to the use of a protein kinase for the diagnosis of inflammatory diseases, especially chronic inflammatory diseases.
  • Another aspect of the invention relates to a method of diagnosing inflammatory diseases, including chronic inflammatory diseases.
  • Another aspect of the invention relates to a method for evaluating and monitoring the efficacy of a treatment of inflammatory diseases, including chronic inflammatory diseases.
  • Another aspect of the invention relates to a method for assaying kinase A activity. Another aspect of the invention also relates to assay and diagnostic kits, as well as substrate peptides.
  • One aspect of the invention relates to the use of the phosphorylation level of a peptide substrate comprising or consisting of the consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1),
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, Q, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da, in a biological sample of a subject suspected of having an inflammatory disease, including a chronic inflammatory disease, as a marker for the in vitro diagnosis and / or prognosis of an inflammatory disease, particularly a chronic inflammatory disease, in said subject ,
  • Another aspect of the invention relates to the use of the phosphorylation level of a peptide substrate comprising or consisting of the consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1),
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, Q, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da, said phosphorylation resulting from the action of a protein kinase capable of phosphorylating said peptide substrate,
  • a biological sample of a subject suspected of having an inflammatory disease including a chronic inflammatory disease, as a marker for the in vitro diagnosis and / or prognosis of an inflammatory disease, particularly a chronic inflammatory disease, in said subject ,
  • Another aspect of the invention relates to the use of a protein kinase capable of phosphorylating a peptide substrate comprising or consisting of the consensus sequence RX X 2 -S / TX 3 (SEQ ID NO: 1),
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da, in a biological sample of a subject suspected of having inflammatory disease, including chronic inflammatory disease, as a marker for the diagnosis and / or prognosis in vitro of an inflammatory disease, particularly a chronic inflammatory disease, in said subject.
  • Another aspect of the invention is the use of the activity of a protein kinase capable of generating phosphorylation of a peptide substrate comprising or consisting of the consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1),
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, Q, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da, measured in a biological sample of a subject suspected of having an inflammatory disease, including a chronic inflammatory disease,
  • the inflammatory diseases are diseases that result directly or indirectly from the immune response. These diseases all have an inflammatory component that contributes significantly to the development of the disease, such as diabetes or cardiovascular disease.
  • an inflammatory disease is in particular chosen from the list below:
  • CVD cardiovascular diseases
  • COPD chronic obstructive pulmonary disease
  • the subject of the invention is the use as defined above, in which a protein kinase is capable of phosphorylating a peptide substrate comprising or consisting of the consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1),
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, Q, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da, in a biological sample of a subject suspected of having chronic inflammatory lumbalgia as a marker for in vitro diagnosis and / or prognosis of chronic inflammatory lower back pain in said subject.
  • use as defined above relates both to the use of a protein kinase and the use of protein kinase activity.
  • the subject of the invention is the use as defined above, in which a protein kinase is capable of phosphorylating a peptide substrate comprising or consisting of the consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1),
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, O, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da, in a biological sample of a subject suspected of having cardiovascular disease, as a marker for the in vitro diagnosis and / or prognosis of an autoimmune disease in said subject.
  • the subject of the invention is the use as defined above, in which a protein kinase is capable of phosphorylating a peptide substrate comprising or consisting of the consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1),
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, Q, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da, in a biological sample of a subject suspected of having chronic obstructive pulmonary disease as a marker for in vitro diagnosis and / or prognosis of chronic obstructive pulmonary disease in said subject.
  • the subject of the invention is the use as defined above, in which a protein kinase is capable of phosphorylating a peptide substrate comprising or consisting of the consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1),
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, O, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da, in a biological sample of a subject suspected of having diabetes, as a marker for the in vitro diagnosis and / or prognosis of diabetes in said subject.
  • the subject of the invention is the use as defined above, in which a protein kinase is capable of phosphorylating a peptide substrate comprising or consisting of the consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1),
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, Q, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da, in a biological sample of a subject suspected of having inflammatory bowel disease as a marker for in vitro diagnosis and / or prognosis of a chronic inflammatory bowel disease in said subject.
  • the invention relates to the use as defined above wherein said biological sample contains said protein kinase.
  • the invention relates to the use as defined above wherein said biological sample containing said protein kinase is an extracellular biological sample.
  • extracellular biological sample corresponds to the liquid medium of a biological sample obtained outside the cell, in particular the extracellular fluid of the blood, such as plasma or serum.
  • the invention relates to the use as defined above wherein said biological sample containing said protein kinase is obtained from the total blood cells of the peripheral blood or venous blood, and the activity of the protein kinase is measured after lysis of said cells.
  • the invention relates to the use as defined above wherein said biological sample contains said protein kinase.
  • the invention relates to the use as defined above wherein said protein kinase is an extracellular protein kinase or a protein kinase present in an extracellular biological sample.
  • This invention is based on the surprising double observation made by the inventors that the phosphorylation of substrates of PKA (kinase A or PKA-like activity) can be detected in the blood and is correlated with the presence of inflammatory diseases, especially chronic inflammatory diseases, whereas PKA is normally an intracellular enzyme.
  • Measurement of kinase activity in serum is thus used as a tool for the diagnosis of inflammatory diseases, including chronic inflammatory diseases.
  • protein kinase capable of phosphorylating an R-Xi-X 2 -S / TX 3 peptide substrate designates a group of enzymes having kinase activity type A, i.e., enzymes capable of phosphorylating the substrates of kinase A in the presence of ATP.
  • This group of enzymes includes protein kinase A and PKA-like proteins.
  • protein kinase A refers to cAMP-dependent kinases (ENZYME ENTRY: EC 2.7.11.11), members of the serine-threonine kinase family, as well as their different isoforms.
  • PKA protein kinase A
  • EKA cAMP-dependent kinases
  • human PKA is mainly illustrated by the catalytic alpha subunit of sequence SEQ ID NO: 60.
  • protein kinase A refers to a protein kinase of which at least one subunit has at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity, with SEQ ID NO: 60.
  • protein kinase A may also refer to a protein kinase of which at least one subunit has at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%. 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity, with SEQ ID NO: 61 or SEQ ID NO: 62.
  • SEQ ID NO: 60 MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQF
  • protein kinase A-like refers to any protein kinase capable of phosphorylating the same peptide substrate as protein kinase A, but whose sequence may be different from that of protein kinase A.
  • protein kinases present in serum having an activity comparable to protein kinase A and being sensitive to PKI, can therefore be characterized as being "PKA-like.”
  • the cAMP-dependent protein kinase (PKA) peptide inhibitor also known as PKI, TTYADFIASGRTGRRNAIHD, inhibits the phosphorylation of target proteins by binding to the protein-substrate site of the catalytic subunit of PKA.
  • Inhibitor PKI corresponds to region 5-24 of the natural inhibitor of protein kinase A. It has an optimal primary sequence and 3D structure to inhibit class A protein kinases, i.e. protein kinase A or protein kinase A-like, while having little effect or negligible effect on other classes of protein kinases such as class B or C protein kinases or map kinases or tyrosine kinases,.
  • the PKI inhibitor has become a tool commonly used to characterize the biological effects and functions of protein kinase A in vitro.
  • FIG. 13A the protein kinase activity observed in the serum is compared with that of the recombinant protein kinase A.
  • the phosphorylation of the substrates by the enzyme present in the serum is identical to that performed by the recombinant protein kinase A.
  • the activity of protein kinase in serum is ATP dependent.
  • Figure 14 shows that the protein kinase present in the serum binds to biotin-labeled PKI immobilized on a streptavidin-sepharose column, thus allowing its purification.
  • Protein kinase A and protein kinase A-like are capable of phosphorylating a peptide substrate comprising or consisting of the consensus sequence R-Xi-X 2 -S / T-X 3 (SEQ ID NO: 1), wherein:
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, Q, R, M, K, H and C or a non-naturally occurring amino acid of hydrophobic character and a molecular weight of 100 to 200 Da.
  • the term "natural amino acid” designates an amino acid chosen from alanine (A), valine (V), isoleucine (I), leucine (L) and methionine (M). , phenylalanine (F), tyrosine (Y), tryptophan (W), serine (S), threonine (T), asparagine (N), glutamine (Q.), cysteine (C) , glycine (G), proline (P), arginine (R), histidine (H), lysine (K), aspartic acid (D), glutamic acid (E), selenocysteine (U) and pyrrolysine (O). These amino acids can also be naturally modified by one or more post-translational modifications (e.g. methylation, nitrosylation, phosphorylation).
  • post-translational modifications e.g. methylation, nitrosylation, phosphorylation.
  • unnatural amino acid refers to an amino acid that does not naturally exist. These are natural amino acid analogues. These peptides have the same basic chemical structure as a natural amino acid but have modified peptide groups and / or backbone (e.g., norleucine, homoserine, norleucine, methionine sulfoxide, methyl methionine sulfonium).
  • modified peptide groups and / or backbone e.g., norleucine, homoserine, norleucine, methionine sulfoxide, methyl methionine sulfonium.
  • the subject of the invention is the use as defined above, in which a protein kinase is capable of phosphorylating a peptide substrate RX X 2 -S / TX 3 (SEQ ID NO: 1), where :
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da, in a biological sample of a subject suspected of having an inflammatory disease, including a chronic inflammatory disease, as a marker for the in vitro diagnosis and / or prognosis of an inflammatory disease, particularly a chronic inflammatory disease, in said subject ,
  • protein kinase being selected from protein kinase A and a PKA-like protein.
  • the subject of the invention is the use as defined above, in which a protein kinase is capable of phosphorylating an R-Xi-X 2 -S / TX 3 peptide substrate (SEQ ID NO: 1). , or :
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, Q, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da, in a biological sample of a subject suspected of having an inflammatory disease, including a chronic inflammatory disease, as a marker for the in vitro diagnosis and / or prognosis of an inflammatory disease, particularly a chronic inflammatory disease, in said subject,
  • the subject of the invention is the use as defined above, in which a protein kinase is capable of phosphorylating a peptide substrate comprising or consisting of the consensus sequence R- Xi-X 2 -S / TX 3 (SEQ ID NO: 1), where:
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, O, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da, in a biological sample of a subject suspected of having an inflammatory disease, including a chronic inflammatory disease, as a marker for the in vitro diagnosis and / or prognosis of an inflammatory disease, particularly a chronic inflammatory disease, in said subject, said protein kinase being a PKA-like protein.
  • the protein kinase is capable of phosphorylating a peptide substrate comprising or consisting of the consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO : 1), where:
  • Xi is an amino acid, preferably R
  • X 2 is an amino acid, preferably P
  • X 3 is an amino acid selected from L, F, V, I, Q, R, M, K, H and C, preferably from L, F, V and I.
  • the protein kinase is capable of phosphorylating a peptide substrate comprising or consisting of the consensus sequence RX a -X b -R-Xi-X 2 -S / TX 3 (SEQ ID NO: 2), where:
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, O, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da,
  • X a and X b are natural or non-natural amino acids, preferably selected from P and a D-isomer amino acid.
  • the peptide substrate comprises or consists of the consensus sequence RX X 2 -S / TX 3 (SEQ ID NO: 1) or RX a -X b -R-Xi-X 2 -S / TX 3 ( SEQ ID NO: 2), where:
  • Xi is a positively charged amino acid at physiological pH, in particular R or K, more particularly R.
  • the peptide substrate comprises or consists of the consensus sequence RX X 2 -S / TX 3 (SEQ ID NO: 1) or RX a -X b -R-Xi-X 2 -S / TX 3 ( SEQ ID NO: 2), where:
  • the peptide substrate comprises or consists of the consensus sequence RX X 2 -S / TX 3 (SEQ ID NO: 1) or RX a- X b -RX X 2 -S / TX 3 (SEQ ID NO: 2), where: X 3 is an amino acid selected from: L, F, V, I, Q, R, M, K, H and C.
  • the peptide substrate comprises or consists of the consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1) or RX a -X b -R-Xi-X 2 -S / T-X3 (SEQ ID NO: 2), wherein: X 3 5 is an amino acid selected from L, F, V and I.
  • the peptide substrate comprises or consists of the consensus sequence RX X 2 -S / TX 3 (SEQ ID NO: 1) or RX a -X b -R-Xi-X 2 -S / TX 3 ( SEQ ID NO: 2), where:
  • X 3 is an amino acid selected from: Q, R, M, K, H and C.
  • the protein kinase whose activity is measured in the present invention, is capable of phosphorylating a peptide substrate comprising or consisting of one of the following sequences:
  • LRRASLG (SEQ ID NO: 4), PRRPSLG (SEQ ID NO: 5), LPRRPSI (SEQ ID NO: 6), PRRASLG 15 (SEQ ID NO: 7), PRRWSLG (SEQ ID NO: 8), PRRKSLG (SEQ ID NO: 9), PRRLSLG (SEQ ID NO:
  • PRRRSLG SEQ ID NO: 11
  • PRRTSLG SEQ ID NO: 12
  • PRRGSLG SEQ ID NO: 13
  • PRRESLG SEQ ID NO: 14
  • PRRSSLG SEQ ID NO: 15
  • PRRYSLG SEQ ID NO: 16
  • PRRHSLG SEQ ID NO: 17
  • PRRVSLG SEQ ID NO: 18
  • PRRNSLG SEQ ID NO: 19
  • PRRCSLG SEQ ID NO: 20
  • PRRQSLG SEQ ID NO: 21
  • PRRDSLG SEQ ID NO: 22
  • PRRASFG SEQ ID NO: 23
  • PRRASVG SEQ ID NO: 24
  • PRRASIG SEQ ID NO: 25
  • PRRASMG SEQ ID NO: 26
  • PRRASQG SEQ ID NO: 27
  • PRRASNG SEQ ID NO: 28
  • PRRASCG SEQ ID NO: 29
  • RDLRRASLV SEQ ID NO: 30
  • RYLRRATLV SEQ ID NO: 25
  • the phosphorylation activity PKA (or PKA-like) can be tested by incubating a protein kinase or a biological sample capable of containing a protein kinase in the presence of a peptide substrate as defined above and in the presence of ATP.
  • inflammatory bowel diseases or "IBD” or "IBD”
  • IBD inflammatory bowel diseases
  • IBD includes two distinct pathologies, Crohn's disease and ulcerative colitis. These two pathologies are characterized by an inflammation of the wall of a part of the digestive tract and evolve by inflammatory flares of extremely variable duration and frequency depending on the patients.
  • the invention relates to the use as defined above, wherein said chronic inflammatory bowel disease belongs to the following group: Crohn's disease and ulcerative colitis.
  • Crohn's disease refers to a chronic inflammatory condition affecting any part of the digestive tract, but most often settling at the junction of the small intestine and the colon . Crohn's disease, unlike ulcerative colitis, can affect all parts of the intestine and is characterized mainly by an epithelioid granuloma observed in the submucosa of the intestine.
  • the term "ulcerative colitis” or “ulcerative colitis” refers to chronic inflammation of the colon and rectum characterized by the existence of superficial or deep ulcers, isolated or confluent.
  • the invention relates to the use as defined above, wherein said protein kinase as defined above is capable of phosphorylating a peptide substrate comprising or consisting of the consensus sequence R-Xi-X 2 - S / TX 3 (SEQ ID NO: 1), where:
  • X 3 is an amino acid selected from L, F, V and I.
  • the invention relates to the use as defined above, wherein said protein kinase as defined above is able to phosphorylate a substrate peptide comprising or consisting of the consensus sequence RX -X b -R-Xi-X2-S / TX 3 (SEQ ID NO: 2), wherein:
  • Xi is a natural or non-natural amino acid, preferably R,
  • X 2 is a natural or non-natural amino acid selected from P and A, preferably P, X 3 is an amino acid selected from L, F, V and I,
  • X a and X b are natural or non-natural amino acids, preferably selected from P and a D-isomer amino acid.
  • the invention relates to the use as defined above, wherein said protein kinase as defined above is capable of phosphorylating a peptide substrate comprising or consisting of the consensus sequence RX a -R-X- X 2 -S / TX 3 (SEQ ID NO: 3), where:
  • Xi is a natural or non-natural amino acid, preferably R,
  • X 2 is a natural or non-natural amino acid selected from P and A, preferably PX 3 is a naturally occurring amino acid selected from L, F, V, I, O, R, M, K, H and C or an acid non-natural amine, of hydrophobic character and with a molecular weight of 100 to 200 Da, X a is a natural or non-natural amino acid, preferably selected from P and a D-isomer amino acid.
  • the invention relates to the use as defined above, wherein said protein kinase as defined above is capable of phosphorylating a peptide substrate comprising or consisting of the sequence LRRASLG (SEQ ID NO: 4) .
  • the invention relates to the use as defined above, wherein said protein kinase as defined above is capable of phosphorylating a peptide substrate comprising or consisting of the sequence PRRPSLG (SEQ ID NO: 5) . In one embodiment, the invention relates to the use as defined above, wherein said protein kinase as defined above is capable of phosphorylating a peptide substrate comprising or consisting of the LPRRPSI sequence (SEQ ID NO: 6).
  • the invention relates to the use as defined above, wherein said biological sample is a blood sample.
  • the invention relates to the use as defined above, wherein said biological sample is a blood sample or a sample of a blood component such as serum or plasma.
  • the invention relates to the use as defined above, wherein the activity of said protein kinase is determined in said biological sample.
  • the measurement of the activity of said protein kinase involves the use of ATP, as a phosphate donor, and a peptide substrate, as a phosphate acceptor.
  • the phosphorylation of the peptide substrate can be measured using techniques known to those skilled in the art, in particular using radioactive markers (for example, 32 P-labeled ATP) or fluorescers (for example, a substrate). bound to a fluorescent molecule).
  • the invention relates to the use as defined above, wherein the activity of said protein kinase is determined in a blood sample or in a blood component such as the serum or plasma of said subject.
  • the invention relates to the use as defined above, wherein the activity of said protein kinase is determined using at least one peptide substrate comprising or consisting of the consensus sequence R-X1 -X2-S / T-X3 (SEQ ID NO: 1), where:
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, Q, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da.
  • the invention relates to the use as defined above, wherein the activity of said protein kinase is determined using at least one peptide substrate comprising or consisting of the consensus sequence R-X1 -X2-S / T-X3 (SEQ ID NO: 1), where:
  • Xi is an amino acid, preferably R
  • X 2 is an amino acid, preferably P, preferably P
  • X 3 is an amino acid selected from L, F, V, I, O, R, M, K, H and C, preferably from L, F, V and I.
  • the invention relates to the use as defined above, in which the activity of said protein kinase is determined using at least one peptide substrate comprising or consisting of the consensus sequence RX a - X b -R-Xi-X 2 -S / TX 3 (SEQ ID NO: 2),
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, O, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da,
  • X a and X b are natural or non-natural amino acids, preferably selected from P and a D-isomer amino acid.
  • the invention relates to the use as defined above, in which the activity of said protein kinase is determined using at least one peptide substrate comprising or consisting of a sequence chosen from:
  • LRRASLG (SEQ ID NO: 4), PRRPSLG (SEQ ID NO: 5), LPRRPSI (SEQ ID NO: 6), PRRASLG (SEQ ID NO: 7), PRRWSLG (SEQ ID NO: 8), PRRKSLG (SEQ ID NO. : 9), PRRLSLG (SEQ ID NO: 10), PRRRSLG (SEQ ID NO: 11), PRRTSLG (SEQ ID NO: 12), PRRGSLG (SEQ ID NO: 13), PRRESLG (SEQ ID NO: 14), PRRSSLG (SEQ ID NO: 15), PRRYSLG (SEQ ID NO: 16), PRRHSLG (SEQ ID NO: 17), PRRVSLG (SEQ ID NO: 18), PRRNSLG (SEQ ID NO.
  • PRRCSLG SEQ ID NO: 20
  • PRRQSLG SEQ ID NO: 21
  • PRRDSLG SEQ ID NO: 22
  • PRRASFG SEQ ID NO: 23
  • PRRASVG SEQ ID NO: 24
  • PRRASIG SEQ ID NO: 25
  • PRRASMG SEQ ID NO: 26
  • PRRASQG SEQ ID NO: 27
  • PRRASNG SEQ ID NO: 28
  • PRRASCG SEQ ID NO: 29
  • RDLRRASLV SEQ ID NO: 30
  • RYLRRATLV SEQ ID NO: 31
  • RYLRRPSLG SEQ ID NO: 32
  • RPPRRASLG SEQ ID NO: 33
  • Said protein kinase of the invention is capable of phosphorylating various peptide substrates.
  • These different peptide substrates all have a sequence covered by the consensus sequence SEQ ID NO: 1 and can have one or more amino acids in N-ter or C-ter of SEQ ID NO: 1.
  • These peptides can be used alone or in combination (i.e., a mixture of several peptide substrates) to measure the activity of said protein kinase.
  • the peptide substrates that can be used in the invention have a size of from 5 to 20 amino acids, in particular from 5 to 15 amino acids, more particularly 9 amino acids.
  • the peptide substrates usable in the invention have a size of 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 acids. amines.
  • the peptide substrates that may be used in the invention may contain one or more non-natural acids.
  • the peptide substrates can incorporate additional chemical modifications, such as, for example, labeling with a radioactive isotope or modification of the peptide bond. As observed by the inventors, the measurement of the phosphorylation of these substrates makes it possible to determine the activity of said protein kinase in a biological sample such as blood or such as a blood component such as serum or plasma.
  • the activity of said protein kinase in the serum is low and very difficult to measure, which requires prolonged incubations with substrates having almost optimal kinetic properties vis-à-vis the PKA for effectively detect phosphorylation activity.
  • PKA protein kinase
  • other non-optimal substrates may be phosphorylated at higher concentrations of PKA with activation by cAMP, a low activity of extracellular PKA will not be detectable with these peptides under similar conditions. This has been observed in particular by limiting the concentration of a recombinant PKA (although still present at a concentration 10 times greater than that in the serum), in order to determine the optimum substrate for detecting a low level of extracellular kinase activity.
  • the invention relates to the use as defined above, wherein the concentration of said protein kinase is determined in said biological sample.
  • the concentration of said protein kinase in the blood is detected in a biological sample using an antibody, or an antibody fragment, specific for said protein kinase.
  • the invention relates to the use as defined above, wherein said subject has at least one symptom belonging to the group comprising: blood in the stool, mucus in the stool, nausea and vomiting, painful abdominal cramps, especially in the lower abdomen, blood in the stool (even hemorrhage in the event of a serious outbreak), chronic diarrhea, frequent bowel movements, an urgent need to defecate even if there is little or no stool to evacuate (tenesmus rectal), weight loss due to reduced appetite and poor absorption of nutrients in the intestine, fatigue, often caused anemia, fever, joint pain, retarded growth and / or puberty in the case of a child.
  • symptom belonging to the group comprising: blood in the stool, mucus in the stool, nausea and vomiting, painful abdominal cramps, especially in the lower abdomen, blood in the stool (even hemorrhage in the event of a serious outbreak), chronic diarrhea, frequent bowel movements, an urgent need to defecate even if there is little or no stool to evacuate (tenesmus rectal), weight loss
  • the present invention is preferably used to diagnose IBD in a patient having one or more symptoms (abdominal distension, bowel pain, diarrhea, ...) likely to be wrongly attributed to other pathologies (as per example, irritable bowel syndrome).
  • the invention relates to the use as defined above, wherein said subject is suspected of suffering from irritable bowel syndrome.
  • the present invention can thus be used to establish a diagnosis differentiating inflammatory bowel diseases from bowel disease of irritable bowel syndrome.
  • a second aspect of the invention relates to a method for diagnosing and / or in vitro prognosis of an inflammatory disease, particularly a chronic inflammatory disease, in a subject suspected of having an inflammatory disease, in particular a chronic inflammatory disease , comprising:
  • a step i) of determining the activity of a protein kinase capable of phosphorylating a peptide substrate comprising or consisting of the consensus sequence R-X1-X2-S / T-X3 (SEQ ID NO: 1), wherein :
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, Q, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da, in a biological sample of said subject,
  • the subject of the invention is a method for diagnosing and / or in vitro prognosis of an inflammatory disease, in particular a chronic inflammatory disease, said inflammatory disease, in particular said chronic inflammatory disease, being chosen from inflammatory bowel diseases including Crohn's disease and ulcerative colitis or ulcerative colitis, chronic inflammatory lower back pain, cardiovascular disease, chronic obstructive pulmonary disease (COPD), and diabetes.
  • an inflammatory disease in particular a chronic inflammatory disease
  • said inflammatory disease in particular said chronic inflammatory disease, being chosen from inflammatory bowel diseases including Crohn's disease and ulcerative colitis or ulcerative colitis, chronic inflammatory lower back pain, cardiovascular disease, chronic obstructive pulmonary disease (COPD), and diabetes.
  • COPD chronic obstructive pulmonary disease
  • the subject of the invention is a method for diagnosing and / or prognosing in vitro chronic inflammatory lumbalgia in a subject suspected of having chronic inflammatory lower back pain, comprising:
  • a step i) of determining the activity of a protein kinase capable of phosphorylating a peptide substrate comprising or consisting of the consensus sequence R-X1-X2-S / T-X3 (SEQ ID NO: 1), in which:
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, Q, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da, in a biological sample of said subject,
  • a subject of the invention is a method for diagnosing and / or prognosing in vitro a cardiovascular disease in a subject suspected of having an autoimmune disease, comprising:
  • a step i) of determining the activity of a protein kinase capable of phosphorylating a peptide substrate comprising or consisting of the consensus sequence R-X1-X2-S / T-X3 (SEQ ID NO: 1), in which:
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, Q, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da, in a biological sample of said subject,
  • the subject of the invention is a method for diagnosing and / or prognosing in vitro chronic obstructive pulmonary disease in a subject suspected of having chronic obstructive pulmonary disease, comprising:
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, Q, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da, in a biological sample of said subject,
  • the subject of the invention is a method for diagnosing and / or prognosing in vitro a diabetes in a subject suspected of having diabetes, comprising:
  • a step i) of determining the activity of a protein kinase capable of phosphorylating a peptide substrate comprising or consisting of the consensus sequence R-X1-X2-S / T-X3 (SEQ ID NO: 1), in which:
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, O, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da, in a biological sample of said subject, a step (ii) of comparing the activity of said protein kinase determined in step (i) with respect to a reference value.
  • the invention provides a method for in vitro diagnosis and / or prognosis of a chronic inflammatory bowel disease in a subject suspected of having a chronic inflammatory bowel disease, comprising:
  • a step i) of determining the activity of a protein kinase capable of phosphorylating a peptide substrate comprising or consisting of the consensus sequence R-X1-X2-S / T-X3 (SEQ ID NO: 1), wherein :
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, Q, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da, in a biological sample of said subject,
  • the invention relates to a diagnostic and / or prognostic method as defined above, wherein said protein kinase is protein kinase A or a PKA-like protein.
  • the method of diagnosis and / or prognosis as defined above is carried out from a biological sample.
  • the invention relates to a method of diagnosis and / or prognosis as defined above wherein said biological sample is an extracellular biological sample.
  • the invention relates to a method of diagnosis and / or prognosis as defined above wherein said biological sample contains said protein kinase. In one embodiment, the invention relates to a method of diagnosis and / or prognosis as defined above in which said protein kinase is an extracellular protein kinase or a protein kinase present in an extracellular biological sample.
  • the invention relates to a method of diagnosis and / or prognosis as defined above, wherein said inflammatory bowel disease belongs to the following group: Crohn's disease and / or ulcerative colitis.
  • the invention relates to a method of diagnosis and / or prognosis as defined above, wherein said biological sample is a blood sample or a sample of a blood component such as serum or plasma.
  • the invention relates to a method of diagnosis and / or prognosis as defined above, in which, in step i), the activity of said protein kinase is determined in a blood sample or in a sample of a blood component such as serum or plasma of said subject.
  • step i) the activity of said protein kinase is determined by incubating the biological sample in the presence of ATP and a peptide substrate capable of being phosphorylated by said protein kinase during at least 10 hours.
  • the invention relates to a method of diagnosis and / or prognosis as defined above, in which, in step i), the activity of said protein kinase is determined using a peptide substrate comprising or consisting of the consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1), wherein: Xi is a natural or unnatural amino acid,
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, Q, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da.
  • the invention relates to a method of diagnosis and / or prognosis as defined above, in which, in step i), the activity of said protein kinase is determined using a peptide substrate comprising or consisting of the consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1), wherein:
  • Xi is an amino acid selected from R and K, preferably R,
  • X 2 is an amino acid, preferably P,
  • X 3 is an amino acid selected from L, F, V, I, Q, R, M, K, H and C, preferably from L, F, V and I.
  • the invention relates to a method of diagnosis and / or prognosis as defined above, in which, in step i), the activity of said protein kinase is determined using a peptide substrate comprising or consisting of the consensus sequence consensus sequence RX -X b -R-Xi-X 2 -S / TX 3 (SEQ ID NO: 2.),
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, Q, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da
  • X a and X b are natural or non-natural amino acids, preferably selected from P and a D-isomer amino acid.
  • the invention relates to a method of diagnosis and / or prognosis as defined above, in which, in step i), the activity of said protein kinase is determined using a peptide substrate comprising or consisting of the sequence: RX X 2 -S / TX 3 (SEQ ID NO: 1) or RX a -X b -R-Xi-X 2 -S / TX 3 (SEQ ID NO: 2), or : Xi is a positively charged amino acid at physiological pH, preferably R or
  • the invention relates to a method of diagnosis and / or prognosis as defined above, in which, in step i), the activity of said protein kinase is determined using a peptide substrate comprising or consisting of the sequence: R-Xi-X 2 -S / TX 3 (SEO ID NO: 1) or RX a -X b -R-Xi-X 2 -S / T-X 3 (SEO ID NO : 2), where:
  • X 2 is P.
  • the invention relates to a method of diagnosis and / or prognosis as defined above, in which, in step i), the activity of said protein kinase is determined using a peptide substrate comprising or consisting of the sequence: RX X 2 -S / TX 3 (SEO ID NO: 1) or RX a -X b -R-Xi-X 2 -S / TX 3 (SEO ID NO: 2), or :
  • X 3 is an amino acid selected from: L, F, V, I, O, R, M, K, H and C.
  • the invention relates to a method of diagnosis and / or prognosis as defined above, in which, in step i), the activity of said protein kinase is determined using a peptide substrate comprising or consisting of the sequence: RX X 2 -S / TX 3 (SEO ID NO: 1) or RX a -X b -R-Xi-X 2 -S / TX 3 (SEO ID NO: 2), or :
  • X 3 is an amino acid chosen from: L, F, V and I.
  • the invention relates to a method of diagnosis and / or prognosis as defined above, in which, in step i) the activity of said protein kinase is determined using a peptide substrate comprising or consisting of the sequence: RX X 2 -S / TX 3 (SEO ID NO: 1) or RX a -X b -R- Xi-X 2 -S / TX 3 (SEO ID NO: 2), where:
  • X 3 is an amino acid selected from: O, R, M, K, H and C.
  • the invention relates to a method of diagnosis and / or prognosis as defined above, in which, in step i), the activity of said protein kinase is determined using a peptide substrate comprising or consisting of a sequence selected from:
  • LRRASLG SEO ID NO: 4
  • PRRPSLG SEO ID NO: 5
  • LPRRPSI SEO ID NO: 6
  • PRRASLG SEO ID NO: 7
  • PRRWSLG SEO ID NO: 8
  • PRRKSLG SEO ID NO: 9
  • PRRLSLG SEO ID NO: 10
  • PRRRSLG SEO ID NO: 11
  • PRRTSLG SEO ID NO: 12
  • PRRGSLG SEO ID NO: 13
  • PRRESLG SEO ID NO: 14
  • PRRSSLG SEO ID NO: 15
  • PRRYSLG SEO ID NO: 16
  • PRRHSLG SEO ID NO: 17
  • PRRVSLG SEO ID NO: 18
  • PRRNSLG SEO ID NO: 19
  • PRRCSLG SEO ID NO: 20
  • PRROSLG SEO ID NO: 21
  • PRRDSLG SEO ID NO: 22
  • PRRASFG SEO ID NO: 23
  • PRRASVG SEO ID NO: 24
  • the invention relates to a method of diagnosis and / or prognosis as defined above, wherein said reference value is the average of the activity of said protein kinase determined in a sample of the same nature as said biological sample, for a group of healthy subjects.
  • the invention relates to a method of diagnosis and / or prognosis as defined above, wherein said reference value is the average of the activity of said protein kinase determined in a sample of the same nature as said biological sample, for a group of subjects with inflammatory disease.
  • the invention relates to a method of diagnosis and / or prognosis as defined above, further comprising: a step iii) of deducing the state of the subject.
  • the invention relates to a method of diagnosis and / or prognosis as defined above, comprising:
  • the invention relates to a method for diagnosis and / or prognosis as defined above, in which, in step iii), said subject is capable of presenting an inflammatory disease, in particular a chronic inflammatory disease, if the activity of said protein kinase in the biological sample of said subject is less than the activity of said protein kinase measured in a healthy individual under the same conditions.
  • the invention relates to a method for diagnosis and / or prognosis as defined above, in which, in step iii), said subject is capable of presenting an inflammatory disease, in particular a chronic inflammatory disease, if the activity of said protein kinase in the biological sample of said subject is less than 0.04 pmol / min / ⁇ , in particular less than 0.02 pmol / min / ⁇ .
  • the invention relates to a method for diagnosis and / or prognosis as defined above, in which, in step iii), said subject is capable of presenting an inflammatory disease, in particular a chronic inflammatory disease, if the activity of said protein kinase in the biological sample of said subject is less than 0.04, 0.03, 0.02 or 0.01 pmol / min / ⁇ .
  • the invention relates to a method for diagnosis and / or prognosis as defined above, in which, in step iii), said subject is capable of presenting an inflammatory disease, in particular a chronic inflammatory disease, if the activity of said protein kinase in the biological sample of said subject is at least 2 times lower, in particular at least 3 times lower, more particularly at least 3.5 times lower, with respect to the activity of said protein kinase measured in a healthy individual under the same conditions.
  • an inflammatory disease in particular a chronic inflammatory disease
  • the invention relates to a diagnostic and / or prognostic method as defined above, in which:
  • step i) the activity of said protein kinase is determined using a peptide substrate comprising or consisting of the consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1) , or :
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, Q, R, M, K, H and C or a non-naturally occurring amino acid of hydrophobic character and a molecular weight of 100 to 200 Da, at step iii) said subject is likely to present an inflammatory disease, especially a chronic inflammatory disease, if the activity of said protein kinase in the biological sample of said subject is at least 2-fold lower, in particular at least 3-fold lower, more particularly at least 3.5 times lower, relative to the activity of said protein kinase measured in a healthy individual under the same conditions.
  • the invention relates to a diagnostic and / or prognostic method as defined above, in which:
  • step i) the activity of said protein kinase is determined using a peptide substrate comprising or consisting of the consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1 ), or :
  • Xi is an amino acid, preferably R,
  • X 2 is an amino acid, preferably P
  • X 3 is an amino acid selected from L, F, V, I, Q, R, M, K, H and C, preferably selected from L, F, V and I,
  • said subject in step iii), is likely to present an inflammatory disease, in particular a chronic inflammatory disease, if the activity of said protein kinase in the biological sample of said subject is at least 2 times lower, in particular at least 3 lower, more particularly at least 3.5 times lower, relative to the activity of said protein kinase measured in a healthy individual under the same conditions.
  • the invention relates to a diagnostic and / or prognostic method as defined above, in which:
  • step i) the activity of said protein kinase is determined using a peptide substrate comprising or consisting of the consensus sequence RX a -X b -R-Xi-X2-S / TX 3 (SEQ ID NO: 2),
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, Q, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da
  • X a and X b are natural or non-natural amino acids, preferably selected from P and a D-isomer amino acid.
  • said subject is likely to present an inflammatory disease, in particular a chronic inflammatory disease, if the activity of said protein kinase in the biological sample of said subject is at least 2 times lower, in particular at least 3 lower, more particularly at least 3.5 times lower, relative to the activity of said protein kinase measured in a healthy individual under the same conditions.
  • an inflammatory disease in particular a chronic inflammatory disease
  • the invention relates to a diagnostic and / or prognostic method as defined above, in which the activity of said protein kinase is determined in a sample of blood of said subject using a substrate.
  • peptide comprising or consisting of: the sequence LRRASLG (SEQ ID NO: 4),
  • said subject is capable of presenting an inflammatory disease, especially a chronic inflammatory disease, if the activity of said protein kinase in the blood sample of said subject is at least 2-fold lower, in particular at least 3 times lower, more particularly at least 3.5 times lower, with respect to the activity of said protein kinase measured in a healthy individual under the same conditions.
  • the invention relates to a diagnostic and / or prognostic method as defined above, in which the activity of said protein kinase is determined in a sample of blood of said subject using a substrate.
  • peptide comprising or consisting of:
  • said subject is capable of presenting an inflammatory disease, including a chronic inflammatory disease, if the activity of said protein kinase in the blood sample of said subject at least 2 times lower, in at least 3 times lower, more particularly at least 3.5 times lower, relative to the activity of said protein kinase measured in a healthy individual under the same conditions.
  • an inflammatory disease including a chronic inflammatory disease
  • the invention relates to a diagnostic and / or prognostic method as defined above, in which the activity of said protein kinase is determined in a sample of blood of said subject using a substrate.
  • peptide comprising or consisting of:
  • step iii) said subject is capable of presenting an inflammatory disease, including a chronic inflammatory disease, if the activity of said protein kinase in the blood sample of said subject at least 2 times lower, in at least 3 times lower, more particularly at least 3.5 times lower, relative to the activity of said protein kinase measured in a healthy individual under the same conditions.
  • the invention relates to a diagnostic and / or prognostic method as defined above, in which the activity of said protein kinase is determined in a sample of blood of said subject using a substrate.
  • said subject is capable of exhibiting an inflammatory disease, especially a chronic inflammatory disease, if the activity of said protein kinase in the biological sample of said subject is less than 0.04 pmol / min / ⁇ , in particular less than 0.02 pmol / min / ⁇ .
  • the invention relates to a diagnostic and / or prognostic method as defined above, in which the activity of said protein kinase is determined in a sample of blood of said subject using a substrate.
  • peptide comprising or consisting of:
  • said subject is capable of exhibiting an inflammatory disease, especially a chronic inflammatory disease, if the activity of said protein kinase in the biological sample of said subject is less than 0.04 pmol / min / ⁇ , in particular less than 0.02 pmol / min / ⁇ .
  • the invention relates to a diagnostic and / or prognostic method as defined above, in which the activity of said protein kinase is determined in a sample of blood of said subject using a substrate.
  • peptide comprising or consisting of:
  • the invention relates to a method of diagnosis and / or prognosis as defined above, further comprising:
  • the invention relates to a method of diagnosis and / or prognosis as defined above, comprising:
  • the invention relates to a method for diagnosis and / or prognosis as defined above, in which, in step iii), said subject is capable of presenting an inflammatory disease, in particular a chronic inflammatory disease, if the activity of said protein kinase in the biological sample of said subject is less than the activity of said protein kinase measured in a healthy individual under the same conditions, said step iii) can be followed by a treatment with use of an anti-inflammatory agent adapted to said diagnosed inflammatory disease, particularly to said diagnosed chronic inflammatory disease.
  • an inflammatory disease in particular a chronic inflammatory disease
  • the invention relates to a method for diagnosis and / or prognosis as defined above, in which, in step iii), said subject is capable of presenting an inflammatory disease, in particular a chronic inflammatory disease, if the activity of said protein kinase in the biological sample of said subject is less than 0.04 pmol / min / ⁇ , in particular less than 0.02 pmol / min / ⁇ , said step iii) being able to be followed by treatment with an anti-inflammatory agent adapted to said diagnosed inflammatory disease, notably to said diagnosed chronic inflammatory disease.
  • an inflammatory disease in particular a chronic inflammatory disease
  • the invention relates to a method for diagnosis and / or prognosis as defined above, in which, in step iii), said subject is capable of presenting an inflammatory disease, in particular a chronic inflammatory disease, if the activity of said protein kinase in the biological sample of said subject is less than 0.04, 0.03, 0.02 or 0.01 pmol / min / ⁇ , said step iii) being able to be followed by a treatment with using an anti-inflammatory agent adapted to said diagnosed inflammatory disease, particularly to said diagnosed chronic inflammatory disease.
  • an inflammatory disease in particular a chronic inflammatory disease
  • the invention relates to a method for diagnosis and / or prognosis as defined above, in which, in step iii), said subject is capable of presenting an inflammatory disease, in particular a chronic inflammatory disease, if the activity of said protein kinase in the biological sample of said subject is at least 2 times lower, in particular at least 3 times lower, more particularly at least 3.5 times lower, with respect to the activity of said protein kinase measured in a healthy individual under the same conditions, said step iii) may be followed by treatment with an anti-inflammatory agent adapted to said diagnosed inflammatory disease, particularly to said diagnosed chronic inflammatory disease.
  • the activity of said protein kinase can be measured through the amount of phosphorylated susbtrate.
  • An increase in the amount of phosphorylated substrate indicates an increase in the activity of said protein kinase in the sample.
  • a decrease in the amount of phosphorylated substrate indicates a decrease in the activity of said protein kinase in the sample.
  • a third aspect of the invention relates to a method for evaluating and / or monitoring the efficacy of a treatment of an inflammatory disease, in particular a chronic inflammatory disease, in a subject comprising:
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, Q, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da, in a biological sample of said subject,
  • the subject of the invention is a method for evaluating and / or monitoring the efficacy of a treatment of an inflammatory disease, in particular a chronic inflammatory disease, said inflammatory disease, in particular said chronic inflammatory disease being selected from inflammatory bowel diseases including Crohn's disease and ulcerative colitis or ulcerative colitis, chronic inflammatory lower back pain, cardiovascular disease, chronic obstructive pulmonary disease (COPD), and diabetes .
  • an inflammatory disease in particular a chronic inflammatory disease
  • said inflammatory disease in particular said chronic inflammatory disease being selected from inflammatory bowel diseases including Crohn's disease and ulcerative colitis or ulcerative colitis, chronic inflammatory lower back pain, cardiovascular disease, chronic obstructive pulmonary disease (COPD), and diabetes .
  • COPD chronic obstructive pulmonary disease
  • the subject of the invention is a method for evaluating and / or monitoring the efficacy of a treatment of chronic inflammatory lumbalgia in a subject comprising:
  • a step i) of determining the activity of a protein kinase capable of phosphorylating a peptide substrate comprising or consisting of the consensus sequence R-X1-X2-S / T-X3 (SEQ ID NO: 1), wherein
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, Q, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da, in a biological sample of said subject,
  • the subject of the invention is a method for evaluating and / or monitoring the efficacy of a treatment of cardiovascular disease in a subject comprising:
  • a step i) of determining the activity of a protein kinase capable of phosphorylating a peptide substrate comprising or consisting of the consensus sequence R-X1-X2-S / T-X3 (SEQ ID NO: 1), wherein
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, Q, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da, in a biological sample of said subject,
  • the subject of the invention is a method for evaluating and / or monitoring the efficacy of a treatment of chronic obstructive pulmonary disease in a subject comprising:
  • a step i) of determining the activity of a protein kinase capable of phosphorylating a peptide substrate comprising or consisting of the consensus sequence R-X1-X2-S / T-X3 (SEQ ID NO: 1), wherein
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, O, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da, in a biological sample of said subject, a step ii) of comparing the activity of said determined protein kinase in said biological sample taken at different dates.
  • the subject of the invention is a method for evaluating and / or monitoring the efficacy of a treatment of diabetes in a subject comprising:
  • a step i) of determining the activity of a protein kinase capable of phosphorylating a peptide substrate comprising or consisting of the consensus sequence R-X1-X2-S / T-X3 (SEQ ID NO: 1), wherein
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, Q, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da, in a biological sample of said subject,
  • the subject of the invention is a method for evaluating and / or monitoring the efficacy of treating a chronic inflammatory bowel disease in a subject comprising:
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, O, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da, in a biological sample of said subject,
  • the invention relates to a method for evaluating and / or monitoring the efficacy of a treatment of a chronic inflammatory bowel disease as defined above, wherein said chronic inflammatory disease of the intestine is selected from: Crohn's disease and ulcerative colitis.
  • the method for evaluating and / or monitoring the efficacy of a treatment of an inflammatory disease, in particular a chronic inflammatory disease, as defined above is carried out from a sample organic.
  • the invention relates to a method for evaluating and / or monitoring the efficacy of a treatment of an inflammatory disease, in particular a chronic inflammatory disease, as defined previously in which said sample Biological is an extracellular biological sample.
  • the invention relates to a method of evaluating and / or monitoring the efficacy of a treatment of an inflammatory disease, particularly a chronic inflammatory disease, as defined above in which said biological sample contains said protein kinase.
  • the invention relates to a method of evaluating and / or monitoring the efficacy of a treatment of an inflammatory disease, particularly a chronic inflammatory disease, as defined above in which said protein kinase is an extracellular protein kinase or a protein kinase present in an extracellular biological sample.
  • the invention relates to a method for evaluating and / or monitoring the efficacy of a treatment of an inflammatory disease, in particular a chronic inflammatory disease, as defined above, in which the said biological sample is a sample of blood, plasma or serum.
  • the invention relates to a method for evaluating and / or monitoring the efficacy of a treatment of an inflammatory disease, particularly a chronic inflammatory disease, as defined above, in which step i), the activity of said protein kinase is determined in a blood sample of said subject.
  • the invention relates to a method for evaluating and / or monitoring the efficacy of a treatment of an inflammatory disease, particularly a chronic inflammatory disease, as defined above, in which, in step i), the activity of said protein kinase is determined using a peptide substrate comprising or consisting of the consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1) , or :
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, Q, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da.
  • the invention relates to a method for evaluating and / or monitoring the efficacy of a treatment of an inflammatory disease, particularly a chronic inflammatory disease, as defined above, in which, in step i), the activity of said protein kinase is determined using a peptide substrate comprising or consisting of the consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1 ), or :
  • Xi is an amino acid, preferably R,
  • X 2 is an amino acid, preferably P,
  • X 3 is an amino acid selected from L, F, V, I, O, R, M, K, H and C, preferably selected from L, F, V and I.
  • the invention relates to a method for evaluating and / or monitoring the efficacy of a treatment of an inflammatory disease, particularly a chronic inflammatory disease, as defined above, in which, at step i), the activity of said protein kinase is determined using a peptide substrate comprising or consisting of the consensus sequence RX -X b - -X-X2-S / TX 3 (SEQ ID NO : 2),
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, O, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da
  • X a and X b are natural or non-natural amino acids, preferably selected from P and a D-isomer amino acid.
  • the invention relates to a method for evaluating and / or monitoring the efficacy of a treatment of an inflammatory disease, particularly a chronic inflammatory disease, as defined above, in which, in step i), the activity of said protein kinase is determined using a peptide substrate comprising or consisting of a sequence chosen from:
  • LRRASLG SEO ID NO: 4
  • PRRPSLG SEO ID NO: 5
  • LPRRPSI SEO ID NO: 6
  • PRRASLG SEO ID NO: 7
  • PRRWSLG SEO ID NO: 8
  • PRRKSLG SEO ID NO: 9
  • PRRLSLG SEO ID NO: 10
  • PRRRSLG SEO ID NO: 11
  • PRRTSLG SEO ID NO: 12
  • PRRGSLG SEO ID NO: 13
  • PRRESLG SEO ID NO: 14
  • PRRSSLG SEO ID NO: 15
  • PRRYSLG SEO ID NO: 16
  • PRRHSLG SEO ID NO: 17
  • PRRVSLG SEO ID NO: 18
  • PRRNSLG SEO ID NO: 19
  • PRRCSLG SEO ID NO: 20
  • PRROSLG SEO ID NO: 21
  • PRRDSLG SEO ID NO: 22
  • PRRASFG SEO ID NO: 23
  • PRRASVG SEO ID NO: 24
  • the invention relates to a method for evaluating and / or monitoring the efficacy of a treatment of an inflammatory disease, particularly a chronic inflammatory disease, as defined above, wherein, in step ii), said biological sample is taken before and after administration of said treatment to said subject.
  • the invention relates to a method for evaluating and / or monitoring the efficacy of a treatment of an inflammatory disease, in particular a chronic inflammatory disease, as defined above, further comprising
  • the treatment is effective, if the activity of said protein kinase increases over time, and
  • the treatment is not effective, if the activity of said protein kinase stagnates or decreases over time.
  • the invention relates to a method for evaluating and / or monitoring the efficacy of a treatment of an inflammatory disease, in particular a chronic inflammatory disease, as defined above, comprising:
  • the invention relates to a method for evaluating and / or monitoring the efficacy of a treatment of an inflammatory disease, particularly a chronic inflammatory disease, as defined above, in which, at step iii), said treatment has a therapeutic effect against said inflammatory disease, in particular against said chronic inflammatory disease, if the activity of said protein kinase has increased after the administration of said treatment to said subject.
  • the invention relates to a method for evaluating and / or monitoring the efficacy of a treatment of an inflammatory disease, particularly a chronic inflammatory disease, as defined above, in which, in step iii), said treatment has a therapeutic effect against said inflammatory disease, in particular against said chronic inflammatory disease, if the activity of said protein kinase has increased at least 2 times, in particular at least 3 times more particularly at least 3.5 times after administration of said treatment to said subject with respect to protein kinase A activity in said subject prior to administration of said treatment.
  • the invention relates to a method for evaluating and / or monitoring the efficacy of a treatment of an inflammatory disease, in particular a chronic inflammatory disease, as defined above, in which the concentration of said protein kinase is determined in said biological sample.
  • a fourth aspect of the invention relates to a method for assaying the activity of a protein kinase capable of phosphorylating a peptide substrate comprising or consisting of the consensus sequence R-Xi-X 2 -S / TX 3 (SEQ. ID NO: 1), where:
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, Q, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da, in a biological sample, comprising:
  • This invention is based on the surprising observation made by the inventors that it is possible to measure a PKA or PKA-like activity in a biological sample such as blood whereas this type of kinase is normally an intracellular enzyme.
  • the assay method as defined above is carried out from a biological sample, preferably from the blood.
  • the invention relates to an assay method as defined above wherein said biological sample is an extracellular biological sample.
  • the invention relates to an assay method as hereinbefore defined wherein said biological sample contains said protein kinase.
  • the invention relates to an assay method as defined above wherein said protein kinase is an extracellular protein kinase or a protein kinase present in an extracellular biological sample.
  • the invention relates to an assay method as defined above, wherein said protein kinase is selected from protein kinase A and a PKA-like protein.
  • the invention relates to an assay method as defined above, comprising:
  • Detection of PKA activity in a blood sample is difficult.
  • the inventors have observed that prolonged incubation of the sample with the substrate makes it possible to reveal even low enzyme activity.
  • the sample or protein kinase is incubated in the presence of ATP and a substrate for at least 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 , 21, 22, 23 or 24 hours.
  • the invention relates to an assay method as defined above, wherein said biological sample is a sample of blood, plasma or serum.
  • the invention relates to an assay method as defined above, wherein said peptide substrate comprises or consists of the consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1), or :
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, Q, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da.
  • the invention relates to an assay method as defined above, wherein said peptide substrate comprises or consists of the consensus sequence RX X 2 -S / TX 3 (SEQ ID NO: 1), wherein:
  • Xi is an amino acid, preferably R,
  • X 2 is an amino acid, preferably P,
  • X 3 is an amino acid selected from L, F, V, I, O, R, M, K, H and C, preferably selected from L, F, V and I.
  • the invention relates to an assay method as defined above, wherein said peptide substrate comprises or consists of the consensus sequence RX a -X b -R-Xi-X 2 -S / TX 3 (SEQ ID NO: 2),
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, Q, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da,
  • X a and X b are natural or non-natural amino acids, preferably selected from P and a D-isomer amino acid.
  • the invention relates to an assay method as defined above, wherein said peptide substrate comprises or consists of a sequence selected from:
  • LRRASLG (SEQ ID NO: 4), PRRPSLG (SEQ ID NO: 5), LPRRPSI (SEQ ID NO: 6), PRRASLG 15 (SEQ ID NO: 7), PRRWSLG (SEQ ID NO: 8), PRRKSLG (SEQ ID NO: 9), PRRLSLG (SEQ ID NO:
  • PRRRSLG SEQ ID NO: 11
  • PRRTSLG SEQ ID NO: 12
  • PRRGSLG SEQ ID NO: 13
  • PRRESLG SEQ ID NO: 14
  • PRRSSLG SEQ ID NO: 15
  • PRRYSLG SEQ ID NO: 16
  • PRRHSLG SEQ ID NO: 17
  • PRRVSLG SEQ ID NO: 18
  • PRRNSLG SEQ ID NO: 19
  • PRRCSLG SEQ ID NO: 20
  • PRRQSLG SEQ ID NO: 21
  • PRRDSLG SEQ ID NO: 22
  • PRRASFG SEQ ID NO: 23
  • PRRASVG SEQ ID NO: 24
  • PRRASIG SEQ ID NO: 25
  • PRRASMG SEQ ID NO: 26
  • PRRASQG SEQ ID NO: 27
  • PRRASNG SEQ ID NO: 28
  • PRRASCG SEQ ID NO: 29
  • RDLRRASLV SEQ ID NO: 30
  • RYLRRATLV SEQ ID NO: 25
  • the invention relates to an assay method as defined above, wherein, in step i), said sample, or protein kinase A from said sample, is incubated in the presence of a substrate.
  • peptide capable of being phosphorylated by said protein kinase and in the presence of at least one inhibitor of protease, said at least one protease inhibitor being preferably selected from the group consisting of: 1,10-Phenanthroline, AEBSF (4- (2-Aminoethyl) benzenesulfonyl fluoride hydrochloride), aprotinin, bestatin, ⁇ - 64, leupeptin, pepstatin a, EDTA, antipain dihydrochloride, chymostatin, phosphoramidon, the Pefabloc ® SC, ⁇ -aminocaproic acid, N-ethylmaleimide, a trypsin inhibitor and alpha-antitrypsin .
  • said at least one protease inhibitor is 1,10-Phenanthroline and / or AEBSF (4- (2-Aminoethyl) benzenesulfonyl fluoride hydrochloride).
  • the inventors have found that certain peptides are sufficiently stable and can be used to assay protein kinase activity in serum without addition or with a reduced amount of protease inhibitor.
  • the following peptides can be used to assay PKA or PKA-like activity in a serum sample, without addition or with little protease inhibitor: LPRRPSI (SEQ ID NO: 6), R ⁇ dY ⁇ ⁇ dL ⁇ RRASLG (SEQ ID NO: 34) and R ⁇ dY ⁇ ⁇ dL ⁇ RRPSLG (SEO ID NO: 35).
  • the invention relates to an assay method as defined above, comprising, prior to step i):
  • the invention relates to an assay method as defined above, further comprising:
  • kits for assaying the activity of a protein kinase comprising at least one substrate capable of being phosphorylated by said protein kinase, said substrate comprising or consisting of the consensus sequence RX X2 -S / T-X3 (SEQ ID NO: 1), where:
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, Q, R, M, K, H and C or a non-naturally occurring amino acid of hydrophobic character and a molecular weight of 100 to 200 Da.
  • the invention relates to a kit for assaying the activity of a protein kinase, comprising at least one substrate capable of being phosphorylated by said protein kinase, said substrate comprising or consisting of the consensus sequence R- X1-X2-S / T-X3 (SEQ ID NO: 1), where:
  • Xi is an amino acid, preferably R,
  • X 2 is an amino acid, preferably P,
  • X 3 is an amino acid selected from L, F, V, I, R, M, K, H and C, preferably selected from L, F, V and I.
  • the invention relates to a kit for assaying the activity of a protein kinase, comprising at least one substrate capable of being phosphorylated by said protein kinase, said substrate comprising or consisting of the consensus sequence RX a -X b -R-Xi-X 2 -S / TX 3 (SEO ID NO: 2),
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da,
  • X a and X b are natural or non-natural amino acids, preferably selected from P and a D-isomer amino acid.
  • the invention relates to a kit for assaying the activity of a protein kinase, comprising at least one substrate capable of being phosphorylated by said protein kinase, said substrate comprising or consisting of the consensus sequence R-X1-X2-S / T-X3 (SEQ ID NO: 1), wherein:
  • Xi is a positively charged amino acid at physiological pH, preferably R or
  • the invention relates to a kit for assaying the activity of a protein kinase, comprising at least one substrate capable of being phosphorylated by said protein kinase, said substrate comprising or consisting of the consensus sequence R- X1-X2-S / T-X3 (SEQ ID NO: 1), where:
  • X 2 is P.
  • the invention relates to a kit for assaying the activity of a protein kinase, comprising at least one substrate capable of being phosphorylated by said protein kinase, said substrate comprising or consisting of the consensus sequence R- X1-X2-S / T-X3 (SEQ ID NO: 1), where:
  • X 3 is an amino acid selected from: L, F, V, I, O, R, M, K, H and C.
  • the invention relates to a kit for assaying the activity of a protein kinase, comprising at least one substrate capable of being phosphorylated by said protein kinase, said substrate comprising or consisting of the consensus sequence R- X1-X2-S / T-X3 (SEQ ID NO: 1), where:
  • X 3 is an amino acid selected from: L, F, V and I.
  • the invention relates to a kit for assaying the activity of a protein kinase, comprising at least one substrate capable of being phosphorylated by said protein kinase, said substrate comprising or consisting of the consensus sequence R- X1-X2-S / T-X3 (SEQ ID NO: 1), where:
  • X 3 is an amino acid selected from: O, R, M, K, H and C.
  • the invention relates to an assay kit as defined above, wherein said peptide substrate comprises or consists of a sequence selected from:
  • LRRASLG (SEQ ID NO: 4), PRRPSLG (SEQ ID NO: 5), LPRRPSI (SEQ ID NO: 6), PRRASLG 5 (SEQ ID NO: 7), PRRWSLG (SEQ ID NO: 8), PRRKSLG (SEQ ID NO: 9), PRRLSLG (SEQ ID NO:
  • PRRRSLG SEQ ID NO: 11
  • PRRTSLG SEQ ID NO: 12
  • PRRGSLG SEQ ID NO: 13
  • PRRESLG SEQ ID NO: 14
  • PRRSSLG SEQ ID NO: 15
  • PRRYSLG SEQ ID NO: 16
  • PRRHSLG SEQ ID NO: 17
  • PRRVSLG SEQ ID NO: 18
  • PRRNSLG SEQ ID NO: 19
  • PRRCSLG SEQ ID NO: 20
  • PRRQSLG SEQ ID NO: 21
  • PRRDSLG SEQ ID NO: 22
  • PRRASFG SEQ ID NO:
  • PRRASVG SEQ ID NO: 24
  • PRRASIG SEQ ID NO: 25
  • PRRASMG SEQ ID NO: 26
  • PRRASQG SEQ ID NO: 27
  • PRRASNG SEQ ID NO: 28
  • PRRASCG SEQ ID NO: 29
  • RDLRRASLV SEQ ID NO: 30
  • RYLRRATLV SEQ ID NO: 31
  • RYLRRPSLG SEQ ID NO: 32
  • RPPRRASLG SEQ ID NO: 33
  • R ⁇ dY ⁇ ⁇ dL ⁇ RRASLG where d denotes the D-isomer form of an amino acid
  • R ⁇ dY ⁇ ⁇ dL ⁇ RRPSLG where d indicates the D-isomeric form of a
  • Amino acid (SEQ ID NO: 35), RPPRKASLG (SEQ ID NO: 36), RPPRRPSLG (SEQ ID NO: 37), RPPRRPSI (SEQ ID NO: 38), PRRPTI (SEQ ID NO: 39), and RYLRRASLG ( SEQ ID NO: 40).
  • the invention relates to an assay kit as defined above, wherein said peptide substrate is different from SEQ ID NO: 4.
  • the invention relates to an assay kit as defined above, said protein kinase being chosen from:
  • PKA protein kinase A
  • PKA-like protein kinases capable of phosphorylating a peptide substrate comprising or consisting of the consensus sequence R-X1-X2-S / T-X3 (SEQ ID NO: 1), wherein: Xi is a natural amino acid or unnatural,
  • X 2 is a natural or unnatural amino acid
  • X 3 is a natural or non-natural amino acid of hydrophobic character.
  • the invention relates to an assay kit as defined above, said kit also comprising ATP.
  • the invention relates to an assay kit as defined above, said kit also comprising at least one protease inhibitor, preferably selected from the group consisting of: 1,10-Phenanthroline, AEBSF (4 - (2-Aminoethyl) benzenesulfonyl fluoride hydrochloride), aprotinin, bestatin, ⁇ -64, leupeptin, pepstatin A, EDTA, antipain dihydrochloride, chymostatin, phosphoramidon, Pefabloc ® SC, l ⁇ -aminocaproic acid, N-ethylmaleimide, a trypsin inhibitor and alpha antitrypsin.
  • protease inhibitor preferably selected from the group consisting of: 1,10-Phenanthroline, AEBSF (4 - (2-Aminoethyl) benzenesulfonyl fluor
  • Another aspect of the invention relates to a diagnostic kit for an inflammatory disease, in particular a chronic inflammatory disease, comprising at least one substrate capable of being phosphorylated by a protein kinase, said substrate comprising or consisting of: consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1), wherein: Xi is a natural or unnatural amino acid,
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from: L, F, V, I, Q, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da.
  • the subject of the invention is a diagnostic kit for an inflammatory disease, in particular a chronic inflammatory disease, as defined above, in which the said inflammatory disease, in particular the said chronic inflammatory disease, is chosen from inflammatory bowel diseases including Crohn's disease and ulcerative colitis or ulcerative colitis, chronic inflammatory lower back pain, cardiovascular disease, chronic obstructive pulmonary disease (COPD), and diabetes.
  • inflammatory bowel diseases including Crohn's disease and ulcerative colitis or ulcerative colitis
  • COPD chronic obstructive pulmonary disease
  • the subject of the invention is a kit for the diagnosis of chronic inflammatory lumbalgia, comprising at least one substrate capable of being phosphorylated by a protein kinase, said substrate comprising or consisting of the consensus sequence RX X 2 -S / TX 3 (SEQ ID NO: 1), where: Xi is a natural or unnatural amino acid,
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from: L, F, V, I, Q, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da.
  • the subject of the invention is a kit for diagnosing a cardiovascular disease, comprising at least one substrate capable of being phosphorylated by a protein kinase, said substrate comprising or consisting of the consensus sequence R-X1- X2-S / T-X3 (SEQ ID NO: 1), where:
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from: L, F, V, I, Q, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da .
  • the subject of the invention is a kit for diagnosing chronic obstructive pulmonary disease, comprising at least one substrate capable of being phosphorylated by a protein kinase, said substrate comprising or consisting of the consensus sequence R- Xi-X 2 -S / TX 3 (SEQ ID NO: 1), where:
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from: L, F, V, I, O, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da.
  • the subject of the invention is a kit for diagnosing diabetes, comprising at least one substrate capable of being phosphorylated by a protein kinase, said substrate comprising or consisting of the consensus sequence R-Xi-X 2 - S / TX 3 (SEQ ID NO: 1), where:
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from: L, F, V, I, O, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da.
  • the subject of the invention is a kit for diagnosing a chronic inflammatory bowel disease, comprising at least one substrate capable of being phosphorylated by a protein kinase, said substrate comprising or consisting of the sequence consensus R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1), where:
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from: L, F, V, I, Q, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da.
  • the invention provides a kit for diagnosing an inflammatory disease, including a chronic inflammatory disease, comprising at least one substrate capable of being phosphorylated by a protein kinase, said substrate comprising or consisting of consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1), where:
  • Xi is an amino acid, preferably R,
  • X 2 is an amino acid, preferably P,
  • X 3 is an amino acid selected from L, F, V, I, O, R, M, K, H and C, preferably chosen from L, F, V and I.
  • the invention relates to a kit for diagnosing an inflammatory disease, in particular a chronic inflammatory disease, comprising at least one substrate capable of being phosphorylated by a protein kinase, said substrate comprising or consisting of the consensus sequence RX a -X b -R- Xi-X 2 -S / TX 3 (SEQ ID NO: 2),
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, O, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da
  • X a and X b are natural or non-natural amino acids, preferably selected from P and a D-isomer amino acid.
  • the invention provides a kit for diagnosing an inflammatory disease, including a chronic inflammatory disease, comprising at least one substrate capable of being phosphorylated by a protein kinase, said substrate comprising or consisting of consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1), where:
  • Xi is a positively charged amino acid at physiological pH, preferably R or
  • the invention provides a kit for diagnosing an inflammatory disease, including a chronic inflammatory disease, comprising at least one substrate capable of being phosphorylated by a protein kinase, said substrate comprising or consisting of consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1), where:
  • X 2 is P.
  • the invention provides a kit for diagnosing an inflammatory disease, including a chronic inflammatory disease, comprising at least one substrate capable of being phosphorylated by a protein kinase, said substrate comprising or consisting of consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1), where:
  • X 3 is an amino acid selected from: L, F, V, I, O, R, M, K, H and C.
  • the invention relates to a kit for diagnosing an inflammatory disease, in particular chronic inflammatory disease comprising at least one substrate capable of being phosphorylated by a protein kinase, said substrate comprising or consisting of the consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1), or :
  • X 3 is an amino acid selected from: L, F, V and I.
  • the invention provides a kit for diagnosing an inflammatory disease, including a chronic inflammatory disease, comprising at least one substrate capable of being phosphorylated by a protein kinase, said substrate comprising or consisting of consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1), where:
  • X 3 is an amino acid selected from: O, R, M, K, H and C.
  • the invention relates to a diagnostic kit as defined above, wherein said peptide substrate comprises or consists of a sequence selected from:
  • LRRASLG (SEQ ID NO: 4), PRRPSLG (SEQ ID NO: 5), LPRRPSI (SEQ ID NO: 6), PRRASLG 5 (SEQ ID NO: 7), PRRWSLG (SEQ ID NO: 8), PRRKSLG (SEQ ID NO: 9), PRRLSLG (SEQ ID NO:
  • PRRRSLG SEQ ID NO: 11
  • PRRTSLG SEQ ID NO: 12
  • PRRGSLG SEQ ID NO: 13
  • PRRESLG SEQ ID NO: 14
  • PRRSSLG SEQ ID NO: 15
  • PRRYSLG SEQ ID NO: 16
  • PRRHSLG SEQ ID NO: 17
  • PRRVSLG SEQ ID NO: 18
  • PRRNSLG SEQ ID NO: 19
  • PRRCSLG SEQ ID NO: 20
  • PRRQSLG SEQ ID NO: 21
  • PRRDSLG SEQ ID NO: 22
  • PRRASFG SEQ ID NO:
  • PRRASVG SEQ ID NO: 24
  • PRRASIG SEQ ID NO: 25
  • PRRASMG SEQ ID NO: 26
  • PRRASQG SEQ ID NO: 27
  • PRRASNG SEQ ID NO: 28
  • PRRASCG SEQ ID NO: 29
  • RDLRRASLV SEQ ID NO: 30
  • RYLRRATLV SEQ ID NO: 31
  • RYLRRPSLG SEQ ID NO: 32
  • RPPRRASLG SEQ ID NO: 33
  • R ⁇ dY ⁇ ⁇ dL ⁇ RRASLG where d denotes the D-isomer form of an amino acid
  • R ⁇ dY ⁇ ⁇ dL ⁇ RRPSLG where d indicates the D-isomeric form of a
  • Amino acid (SEQ ID NO: 35), RPPRKASLG (SEQ ID NO: 36), RPPRRPSLG (SEQ ID NO: 37), RPPRRPSI (SEQ ID NO: 38), PRRPTI (SEQ ID NO: 39), and RYLRRASLG ( SEQ ID NO: 40).
  • the invention relates to a diagnostic kit as defined above, said protein kinase being chosen from:
  • PKA Protein kinase A
  • PKA-like protein kinases capable of phosphorylating a peptide substrate comprising or consisting of the consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1), in which:
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, Q, R, M, K, H and C or a non-naturally occurring amino acid of hydrophobic character and a molecular weight of 100 to 200 Da.
  • the invention relates to a diagnostic kit as defined above, wherein said peptide substrate is different from SEQ ID NO: 4.
  • the invention relates to a diagnostic kit as defined above, said kit also comprising ⁇ .
  • the invention relates to a diagnostic kit as defined above, said kit also comprising at least one protease inhibitor, preferably selected from the group comprising: 1,10-Phenanthroline, AEBSF (4) - (2-Aminoethyl) benzenesulfonyl fluoride hydrochloride), aprotinin, bestatin, E-64, leupeptin, pepstatin A, EDTA, antipain dihydrochloride, chymostatin, phosphoramidon, Pefabloc ® SC , ⁇ -aminocaproic acid, N-ethylmaleimide, a trypsin inhibitor and alpha antitrypsin.
  • protease inhibitor preferably selected from the group comprising: 1,10-Phenanthroline, AEBSF (4) - (2-Aminoethyl) benzenesulfonyl fluoride hydrochloride), aprotinin, bestatin, E-64, leupeptin
  • Another aspect of the invention is the use of a peptide comprising or consisting of the consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1), wherein:
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, Q, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da, for the in vitro diagnosis of an inflammatory disease, particularly a chronic inflammatory disease, from a biological sample of a patient.
  • the subject of the invention is the use of a peptide as defined above, in which said inflammatory disease, in particular said chronic inflammatory disease, is chosen from inflammatory bowel diseases, including Crohn's disease and ulcerative colitis or ulcerative colitis, chronic inflammatory lower back pain, cardiovascular disease, chronic obstructive pulmonary disease (COPD), and diabetes.
  • said inflammatory disease in particular said chronic inflammatory disease, is chosen from inflammatory bowel diseases, including Crohn's disease and ulcerative colitis or ulcerative colitis, chronic inflammatory lower back pain, cardiovascular disease, chronic obstructive pulmonary disease (COPD), and diabetes.
  • COPD chronic obstructive pulmonary disease
  • the subject of the invention is the use of a peptide comprising or consisting of the consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1), wherein:
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, Q, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da, for in vitro diagnosis of chronic inflammatory lumbalgia from a biological sample of a patient.
  • the subject of the invention is the use of a peptide comprising or consisting of the consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1), wherein:
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, O, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da, for the in vitro diagnosis of cardiovascular disease from a biological sample of a patient.
  • the subject of the invention is the use of a peptide comprising or consisting of the consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1), wherein:
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, O, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da, for in vitro diagnosis of chronic obstructive pulmonary disease from a biological sample of a patient.
  • the subject of the invention is the use of a peptide comprising or consisting of the consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1), wherein:
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, O, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da, for the in vitro diagnosis of diabetes from a biological sample of a patient.
  • the subject of the invention is the use of a peptide comprising or consisting of the consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1), wherein:
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, Q, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da, for the in vitro diagnosis of a chronic inflammatory bowel disease (IBD) from a biological sample of a patient.
  • IBD chronic inflammatory bowel disease
  • the invention relates to the use of a peptide comprising or consisting of the consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1), wherein:
  • Xi is an amino acid, preferably R,
  • X 2 is an amino acid, preferably P,
  • X 3 is an amino acid selected from L, F, V, I, O, R, M, K, H and C, preferably selected from L, F, V and I,
  • an inflammatory disease particularly a chronic inflammatory disease
  • a biological sample of a patient for the in vitro diagnosis of an inflammatory disease, particularly a chronic inflammatory disease, from a biological sample of a patient.
  • the invention relates to the use of a peptide comprising or consisting of the consensus sequence RX -X b -R-Xi-X 2 -S / TX 3 (SEQ ID NO: 2),
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, O, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da
  • X a and X b are natural or non-natural amino acids, preferably chosen from P and a D-isomer amino acid
  • the invention relates to the use of a peptide comprising or consisting of the consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1), wherein: Xi is a positively charged amino acid at physiological pH, preferably R or
  • an inflammatory disease particularly a chronic inflammatory disease
  • a biological sample of a patient for the in vitro diagnosis of an inflammatory disease, particularly a chronic inflammatory disease, from a biological sample of a patient.
  • the invention relates to the use of a peptide comprising or consisting of the consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1), wherein:
  • an inflammatory disease particularly a chronic inflammatory disease
  • a biological sample of a patient for the in vitro diagnosis of an inflammatory disease, particularly a chronic inflammatory disease, from a biological sample of a patient.
  • the invention relates to the use of a peptide comprising or consisting of the consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1), wherein:
  • X 3 is an amino acid selected from: L, F, V, I, O, R, M, K, H and C,
  • an inflammatory disease particularly a chronic inflammatory disease
  • a biological sample of a patient for the in vitro diagnosis of an inflammatory disease, particularly a chronic inflammatory disease, from a biological sample of a patient.
  • the invention relates to the use of a peptide comprising or consisting of the consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1), wherein:
  • X 3 is an amino acid selected from: L, F, V and I,
  • an inflammatory disease particularly a chronic inflammatory disease
  • a biological sample of a patient for the in vitro diagnosis of an inflammatory disease, particularly a chronic inflammatory disease, from a biological sample of a patient.
  • the invention relates to the use of a peptide comprising or consisting of the consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1), wherein:
  • X 3 is an amino acid selected from: O, R, M, K, H and C,
  • the invention relates to the use of a peptide comprising or consisting of a peptide sequence selected from: LRRASLG (SEQ ID NO: 4), PRRPSLG (SEQ ID NO: 5), LPRRPSI (SEQ ID NO: 6), PRRASLG (SEQ ID NO: 7), PRRWSLG (SEQ ID NO: 8), PRRKSLG (SEQ ID NO.
  • PRRLSLG SEQ ID NO: 10
  • PRRRSLG SEQ ID NO: 11
  • PRRTSLG SEQ ID NO: 12
  • PRRGSLG SEQ ID NO: 13
  • PRRESLG SEQ ID NO: 14
  • PRRSSLG SEQ ID NO: 15
  • PRRYSLG SEQ ID NO: 16
  • PRRHSLG SEQ ID NO: 17
  • PRRVSLG SEQ ID NO: 18
  • PRRNSLG SEQ ID NO: 19
  • PRRCSLG SEQ ID NO: 20
  • PRRQSLG SEQ ID NO: 21
  • PRRDSLG SEQ ID NO: 22
  • PRRASFG SEQ ID NO: 23
  • PRRASVG SEQ ID NO: 24
  • PRRASIG SEQ ID NO: 25
  • PRRASMG SEQ ID NO: 26
  • PRRASQG SEQ ID NO: 27
  • PRRASNG SEQ ID NO: 28
  • PRRASCG SEQ ID NO: 29
  • RDLRRASLV SEQ ID NO: 25
  • the use of a peptide as defined above is carried out from a biological sample preferably from the blood.
  • the invention relates to the use of a peptide as defined above wherein said biological sample is an extracellular biological sample.
  • the invention relates to the use of a peptide as defined above wherein said biological sample contains said protein kinase.
  • the invention relates to the use of a peptide as defined above wherein said protein kinase is an extracellular protein kinase or a protein kinase present in an extracellular biological sample.
  • a peptide comprising or consisting of the consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1), wherein:
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, Q, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da .
  • the invention provides a peptide comprising or consisting of the consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1), wherein:
  • Xi is an amino acid, preferably R,
  • X 2 is an amino acid, preferably P,
  • X 3 is selected from L, F, V, I, O, R, M, K, H and C.
  • the invention relates to a peptide comprising or consisting of the consensus sequence RX -X b -R-Xi-X 2 -S / TX 3 (SEQ ID NO: 2), wherein:
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, O, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da
  • X a and X b are natural or non-natural amino acids, preferably selected from P and a D-isomer amino acid.
  • the invention relates to a peptide comprising or consisting of a peptide sequence selected from:
  • PRRPSLG (SEQ ID NO: 5), LPRRPSI (SEQ ID NO: 6), PRRASLG (SEQ ID NO: 7), PRRWSLG (SEQ ID NO: 8), PRRKSLG (SEQ ID NO: 9), PRRLSLG (SEQ ID NO.
  • PRRRSLG SEQ ID NO: 11
  • PRRTSLG SEQ ID NO: 12
  • PRRGSLG SEQ ID NO: 13
  • PRRESLG SEQ ID NO: 14
  • PRRSSLG SEQ ID NO: 15
  • PRRYSLG SEQ ID NO: 16
  • PRRHSLG SEQ ID NO: 17
  • PRRVSLG SEQ ID NO: 18
  • PRRNSLG SEQ ID NO: 19
  • PRRCSLG SEQ ID NO: 20
  • PRRQSLG SEQ ID NO: 21
  • PRRDSLG SEQ ID NO: 22
  • PRRASFG SEQ ID NO: 23
  • PRRASVG SEQ ID NO: 24
  • PRRASIG SEQ ID NO: 25
  • PRRASMG SEQ ID NO: 26
  • PRRASQG SEQ ID NO: 27
  • PRRASNG SEQ ID NO: 28
  • PRRASCG SEQ ID NO: 29
  • RDLRRASLV SEQ ID NO: 30
  • RYLRRATLV SEQ ID NO: 25
  • the invention relates to a peptide as defined above, said peptide being different from SEQ ID NO: 4.
  • the peptides of the invention may be produced according to the various techniques known to those skilled in the art, for example by expression in a eukaryotic or prokaryotic cell, or by chemical synthesis.
  • Another aspect of the invention is the use of a peptide comprising or consisting of the consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1), wherein:
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, O, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da, in as a substrate for a protein kinase, particularly as a substrate for protein kinase A and / or protein kinase A-like.
  • the invention relates to the use of a peptide comprising or consisting of the consensus sequence R-Xi-X 2 -S / TX 3 (SEQ ID NO: 1), wherein:
  • Xi is an amino acid, preferably R,
  • X 2 is an amino acid, preferably P,
  • X 3 is chosen from L, F, V, I, O, R, M, K, H and C, preferably chosen from L, F, V and I, as a substrate for a protein kinase, in particular in as substrate for protein kinase A and / or protein kinase A-like.
  • the invention relates to the use of a peptide comprising or consisting of the consensus sequence RX -X b -R-Xi-X2-S / TX 3 (SEQ ID NO. 2), where :
  • Xi is a natural or unnatural amino acid
  • X 2 is a natural or unnatural amino acid
  • X 3 is a naturally occurring amino acid selected from L, F, V, I, O, R, M, K, H and C or a non-natural amino acid of hydrophobic character and a molecular weight of 100 to 200 Da,
  • X a and X b are natural or non-natural amino acids, preferably chosen from P and a D-isomer amino acid,
  • a substrate for a protein kinase particularly as a substrate for protein kinase A and / or protein kinase A-like.
  • the invention relates to the use of a peptide comprising or consisting of a peptide sequence selected from:
  • PRRPSLG (SEQ ID NO: 5), LPRRPSI (SEQ ID NO: 6), PRRASLG (SEQ ID NO: 7), PRRWSLG (SEQ ID NO: 8), PRRKSLG (SEQ ID NO: 9), PRRLSLG (SEQ ID NO.
  • PRRRSLG SEQ ID NO: 11
  • PRRTSLG SEQ ID NO: 12
  • PRRGSLG SEQ ID NO: 13
  • PRRESLG SEQ ID NO: 14
  • PRRSSLG SEQ ID NO: 15
  • PRRYSLG SEQ ID NO: 16
  • PRRHSLG SEQ ID NO: 17
  • PRRVSLG SEQ ID NO: 18
  • PRRNSLG SEQ ID NO: 19
  • PRRCSLG SEQ ID NO: 20
  • PRRQSLG SEQ ID NO: 21
  • PRRDSLG SEQ ID NO: 22
  • PRRASFG SEQ ID NO: 23
  • PRRASVG SEQ ID NO: 24
  • PRRASIG SEQ ID NO: 25
  • PRRASMG SEQ ID NO: 26
  • PRRASQG SEQ ID NO: 27
  • PRRASNG SEQ ID NO: 28
  • PRRASCG SEQ ID NO: 29
  • RDLRRASLV SEQ ID NO: 30
  • RYLRRATLV SEQ ID NO: 25
  • Fifiure Standard curve of kinase activity measurement test.
  • the x-axis indicates the amount of recombinant kinase (in ng) and the y-axis indicates the amount of fluorescent substrate peptide (SEQ ID NO: 5) phosphorylated (in pmol / min).
  • the results of the activity test for each population are presented in the form of a scatter plot (median and interquartile range).
  • the fluorescent substrate peptide is SEQ ID NO: 5. (See details in Example II)
  • the curve was obtained from the results presented in FIG. 2.
  • the abscissa axis indicates the specificity (in%) and the ordinate axis indicates the sensitivity (in%).
  • FIG. 1 ROC analysis of the American cohort: patients with chronic inflammatory bowel disease (IBD) versus healthy individuals.
  • IBD chronic inflammatory bowel disease
  • the x-axis indicates the specificity (in%) and the y-axis indicates the sensitivity (in%).
  • the fluorescent substrate peptide is SEQ ID NO: 5.
  • CMl Individuals from the Italian cohort are named CMl and those from the US CM2 cohort. The witnesses correspond to the healthy individuals of each center.
  • the axis of ordinates indicates the concentration of active enzyme (ng.mr 1 ).
  • the specific activity is measured with the fluorescent substrate peptide (SEQ ID NO: 5)
  • the abscisess axis indicates the amount of phosphorylated product (in%) and the ordinate axis indicates the relative frequency (in% of the total value of phosphorylated product).
  • the gray curve (Gaussian inverse) corresponds to patients with IBD (MC or CU).
  • the black curve corresponds to healthy individuals (Gaussian).
  • the fluorescent substrate peptide is SEQ ID NO: 5.
  • the y-axis indicates the relative amount of protein measured with each of the serological tests.
  • Hs CRP High-sensitivity C-reactive protein
  • PSA Prostate Specifies Antigen
  • CK Cell Kinase
  • PKA activity measured with the fluorescent peptide SEQ ID NO: 5).
  • Fifiure 8 Relative activity of a recombinant PKA as a function of peptide substrates VDPRRASXgG (SEQ ID NO: 41) carrying a different amino acid in position X3 ⁇ 4.
  • the activity (in% of phosphorylated substrate) is indicated as a function of the molecular mass (in Da) of the amino acid in position X 3 .
  • the circles represent hydrophobic or non-polar amino acids and the squares represent polar or positively charged amino acids.
  • Figure 9 N / B carboxypeptidase activity in the sera of patients suffering from a chronic inflammatory bowel disease (IBD) versus the sera of healthy individuals.
  • the sera were incubated with the fluorescent substrate peptide SEQ. ID NO: 62 to detect N / B carboxypeptidase activity resulting in C-terminal arginine suppression. (AT).
  • Fifiure 10 Analysis of a cohort of patients with chronic inflammatory lumbalfias (with cLBP, chromium Low back Pain) versus healthy individuals (without cLBP).
  • the sera were incubated with the SEO ID NO: 62 fluorescent substrate peptide to detect the N / B carboxypeptidase activity resulting in C-terminal arginine removal.
  • the unpaired Mann Whitney statistical test indicates that the two populations are not significantly different (P ⁇ 0.12).
  • the analysis of the frequency distribution shows similar distributions for both types of populations regarding carboxypeptidase activity values.
  • Figure 12 Cohort analyzes of patients with chronic obstructive pulmonary disease (COPD), cardiovascular disease (CVD) or diabetes versus healthy individuals.
  • COPD chronic obstructive pulmonary disease
  • CVD cardiovascular disease
  • diabetes versus healthy individuals.
  • the modification is reversible when the incubation is in the presence of phosphatase (well 9).
  • B. Microfluidic Analysis In this case, the separation is carried out in microcapillaries, and the peaks of the substrate (S) and the phosphorylated product (P) are detected and quantified by laser-induced fluorescence. In this example, the reactions are carried out in the presence or absence of sera and inhibitors of PKI and PKC protein kinase.
  • the fluorescent substrate peptide is SEQ ID NO: 5. The results are as follows:
  • Peak S with serum plus PKI
  • Peak P with serum plus PKC.
  • a change in electrophoretic mobility is observed in the presence of the PKC inhibitor but not in the presence of the PKI inhibitor. This shows that protein kinase activity in serum is sensitive to PKI inhibition.
  • Fifiure 14 Purification of protein kinase A or A-like serum
  • the protein was purified with the immobilized PKI inhibitor on a streptavidin-biotin column.
  • A Sequence of biotin-aminohexanoic-protein kinase A inhibitory peptide.
  • B Schematic summary of the three steps of purification. L: loading; F: washing; E: elution. The column was preincubated with 300 nmol biotin-PKI / ml streptavadine sepharose.
  • the serum was diluted with kinase reaction buffer (final concentration: 50 mM Tris.HCl, pH 7.5, 5 mM MgCl 2 supplemented with protease inhibitors, 2.5 mM phenanthroline, 0.5 mM AEBSF) loaded onto the column and washed in the same buffer in the presence of 250 ⁇ l of ATP. Elution was performed in the kinase reaction buffer in the absence of ATP, without protease inhibitors, and in the presence of 500 nM NaCl + 10 mM imadazole.
  • D Detection of PKA activity in elution fractions. The yield is 46% of the total proteins charged
  • the results of the activity test for two independent control cohorts are presented in the form of a scatter plot (median and interquartile range).
  • the fluorescent substrate peptide is SEQ. ID NO: 5.
  • Individuals are also analyzed by their gender (men, women). The details of the results are shown in Table 5, see Example X.
  • Peptides The peptides used to measure the activity of protein kinase A and / or protein kinases A-like were determined from the consensus sequence R ⁇ 3 -Xi ⁇ 2 -X 2 _1 - S ° / T ° -X3 +1 (SEQ ID NO: 1), where Xi is a natural or non-natural amino acid, preferably R, and X 2 is a natural or non-naturally occurring amino acid, preferably P (the numbering indicating the position relative to to the phosphorylated amino acid (S 0 or T °) by PKA or PKA-like).
  • P the numbering indicating the position relative to to the phosphorylated amino acid (S 0 or T °) by PKA or PKA-like).
  • P the numbering indicating the position relative to to the phosphorylated amino acid (S 0 or T °) by PKA or PKA-like).
  • P the numbering indicating the position relative to to the phosphorylated amino acid (S
  • Peptides can be extended from SEQ ID NO: 1 by adding additional C-ter and / or N-ter amino acids without altering the properties of these peptides as substrates of PKA or PKA-like kinases.
  • SEQ ID NO: 1 the sequence SEQ ID NO: 1 is preceded by 3 amino acids VDP and extended by a G amino acid.
  • the substrates PRRPSLG (SEQ ID NO: 5) and R ⁇ dY ⁇ ⁇ dL ⁇ RRPSLG (SEQ ID NO: 35) are preferred in our activity assays because they have better resistance to serum proteases during prolonged incubations and, by therefore, their use requires fewer protease inhibitors, which are likely to reduce PKA or PKA-like activity.
  • Samples Serum samples were received from different clinical centers for cohorts of patients clinically diagnosed as having Crohn's disease or Crohn's disease, chronic inflammatory lower back pain, chronic obstructive pulmonary disease (POC), caravascular diseases (CVD) or diabetes. Samples from healthy individuals were also obtained from two independent Italian centers (Cl and C2) and an American center (used only to compare the American ICI cohort), demographically in correspondence with the age and sex with patients. The values obtained with the two cohorts Controls, C1 and C2, are virtually identical, allowing their use to control other inflammatory diseases after demographic matching (see Figure 15).
  • PKA protein kinase A
  • PRKACA SEQ ID: 60 - obtained from UniProtKB - P17612 (KAPCA_HUMAN)
  • the recombinant enzyme was eluted with 200 mM imidazole before being desalted in buffer (50 mM Tris.HCl, pH 7.5, 10 mM MgCl 2 , 40% glycerol) then stored at -20 ° C before use.
  • buffer 50 mM Tris.HCl, pH 7.5, 10 mM MgCl 2 , 40% glycerol
  • the fluorescent peptides were synthesized by addition of a carboxyfluorescein (FAM) group at the N-terminal via an aminohexanoic acid spacer (ahx) and by formation of a C-terminal amide (eg FAM-ahx peptide-CONH 2 ).
  • FAM carboxyfluorescein
  • ahx aminohexanoic acid spacer
  • the freeze-dried peptides were dissolved at a concentration of 2mM in sterile, doubly distilled water.
  • peptide fluorescent substrates were incubated with 3 ⁇ l of serum in a kinase reaction buffer (final concentration: 50 mM Tris.HCl, pH 7.5, 5 mM MgCl 2 ) supplemented with protease inhibitors ( 2.5 mM Phenoltrolin 0.5 mM AEBSF) and 0.25 mM cofactor adenosine triphosphate (ATP).
  • protease inhibitors 2.5 mM Phenoltrolin 0.5 mM AEBSF
  • cofactor adenosine triphosphate ATP
  • reaction mixtures were prepared using a 96-well benchtop pipettor system (Sorenson Bioscience, Inc.) in 384-well black microtitre plates and incubated at 37 ° C for 18 hours before stopping the reaction by adding EDTA at a final concentration of 50 mM.
  • the reaction mixtures were then anlysés by electrophoresis in non-denaturing conditions to ha ut voltage (2000V at a pressure of 1.5 psi) in microfluidic channels using a LabChip EZReader ® (Perkin Elmer).
  • Phosphorylated and non-phosphorylated peptides were separated by modification of charge-mediated electrophoretic mobility prior to detection and quantification of laser-induced fluorescence (excitation at 470 nm, 530 nm emission) (see Figure 13B, microfluidic analysis). ).
  • PKI for inhibition of kinase activity PKI, PKC or staurosporine (ST) inhibitors were added at a final concentration of 1 ⁇ .
  • the detection of a potential phosphorylation (or its inhibition) is carried out by observing a mobility shift of the phosphorylated proteins after electrophoresis on a native agarose gel (2%) and visualization by UV fluorescence.
  • the statistical parameters of the controls / patient disease comparisons were calculated using the Graphpad Software Prism 6 (Graphpad Software I nc.): The frequency of distribution was performed to define a Gaussian distribution in log as opposed to a normal Gaussian distribution, and therefore distinct. A t-test was performed using the Mann-Whitney method to analyze the statistically significant differences of the respective medians ⁇ 95% Cl.
  • ROC Receiver Operator Characteristic
  • the PKA activity values of the sera were compared, and the active enzyme concentrations (ng / ml) were extrapolated from standard curves made by diluting a recombinant active PKA in heat-inactivated serum and activity being measured as described above.
  • Carboxypeptidase Activity Control Assay Carboxypeptidase activity in serum was measured using a fluorescent peptide (FAM-ahx-RHRSDSSR " C00H SEO ID NO: 62) Under standard reaction conditions, 2 ⁇ of serum are incubated with 10 ⁇ l of this fluorescent peptide in a 50 mM carboxypeptidase reaction buffer Tris-HCl (pH 8), 5 mM MgCl 2 , for 2 hours at 25 ° C. The carboxypeptidase activity remains stable at this temperature. (> 12 hours) but is less stable at 37 ° C.
  • FAM-ahx-RHRSDSSR " C00H SEO ID NO: 62
  • the total activity requires a predilution of the serum in the carboxypeptidase reaction buffer before the addition of the substrate, the reactions are carried out in 384-well plates and Completed by addition of 10 mM phenanthroline, the reaction mixtures were then electrophoresed under high voltage non-denaturing conditions (2500V at 1.8 psi) in microfluidic channels using a LabChip. ® EZReader (Perkin Elmer).
  • the decarboxylated peptides were separated from the unreacted substrate peptides on the basis of their charge difference.
  • the decarboxylation reaction removes a basic C-terminal amino acid, here arginine, modifying the charge of +1 to 0.
  • the peptides were separated by modification of the charge-related electrophoretic mobility before detection and quantification of laser-induced fluorescence (excitation at 470 nm, 530 nm emission) (see Figure 13B).
  • Purification of Protein Kinase A or PKA-like Serum Enzyme The protein responsible for kinase activity measured in the sera was purified following the use of immobilized PKI inhibitor on a streptavidin-biotin column.
  • the column was preincubated with 300 nmol biotin-PKI / ml streptavadin-sepharose (the biotin-aminohexanoic-protein kinase sequence is shown in Figure 14A) and then loaded with 50 ml of serum from the healthy individuals (after dilution in kinase buffer in the presence of a final concentration of ATP of 250 mM and protease inhibitors).
  • the column was washed once with 50 ml of kinase buffer (50 mM Tris.HCl, pH 7.5, 5 mM MgCl 2 ) in the presence of 250 mM ATP.
  • Protein kinase was eluted in kinase buffer without ATP but with 500 nM NaCl + 10 mM imadazole and collected in 1 ml fractions. The activity of the protein kinase harvested in the different fractions was tested with the fluorescent substrate SEQ. ID NO: 5 in the presence of 0.5mM ATP at 37 ° C for 60 minutes. The protein concentration was calculated using the calibration curve for the recombinant protein shown in Figure 1.
  • a standard curve was obtained by measuring the phosphorylation activity of a recombinant PKA enzyme with the fluorescent substrate peptide: SEQ ID NO: 5, under the same conditions as those of the serum samples (FIG. 1).
  • the standard curve obtained makes it possible to obtain an estimate of the amount of active enzyme in a serum sample.
  • Serum samples from the Italian cohort were analyzed using the PKA activity assay with fluorescein substrate peptide: SEQ ID NO: 5 (named A2 in Figure 2).
  • the amount of phosphorylated product is 0.06 ⁇ 0.02 pmol / min / ⁇
  • the amount of phosphorylated product is 0.017 ⁇ 0.012 pmol / min / ⁇ .
  • the amount of active enzyme was determined in the serum samples. In healthy individuals, the amount of active enzyme in the serum is 17.1 ⁇ 5.7 ng / ml, whereas in patients with ICI the amount of active enzyme in the serum is 4, 8 ⁇ 4.2 ng / ml.
  • the amount of enzyme active against the peptide substrate is reduced by 3.4 times compared to that of healthy individuals.
  • Receiver Operator Characteristic Receiveiver Efficiency Functional Curve
  • AUC or AUC Area Under the Curve
  • Figure 7 compares the sensitivity of this test compared to other serological tests commonly used to diagnose inflammation (hs CRP), cardiovascular diseases (D-dimer and creatine kinase) or cancer (PSA, prostate specifies antigen). .
  • These tests like that of the invention, are based on the proteome but relate to very different protein concentrations in the serum (variation of about 9 log).
  • Each of these different techniques, as well as the test of the invention has a variation of less than one log between the amount of relative protein in healthy individuals and that in sick patients.
  • the phosphorylation activity of a recombinant human PKA enzyme was determined using different fluorescent substrate peptides and this was compared to the activity measured with the fluorescent control peptide LRRASLG (SEQ ID NO: 4). (Tables 3 and 4)
  • PRRASLG (SEQID NO: 7)> 90%
  • PRRWSLG (SEQIDNO: 8)> 90%
  • PRRPSLG (SEQIDNO: 5)> 90%
  • PRRTSLG (SEQ ID NO: 12)> 80%
  • PRRSSLG (SEQ ID NO: 15)> 80%
  • PRRDSLG (SEQID NO: 22)> 50%
  • Serum samples from a center in Italy were analyzed using the test for measuring protein kinase activity with the fluorescent substrate peptide SEQ. ID NO: 5 ( Figure 10).
  • the amount of active enzyme was determined in the serum samples.
  • the amount of active enzyme in the serum is 17.7 ⁇ 6.3 ng / ml
  • the amount of active enzyme in the serum is 13.9 ⁇ 5.1 ng / ml. ml (p ⁇ 0.0001).
  • the amount of active enzyme towards the peptide substrate is reduced compared to that of healthy individuals.
  • ROC Receiveiver Operator Characteristic
  • an amount of active enzyme less than 14.8 ng / ml is significantly correlated with chronic inflammatory lower back pain.
  • COPD Chronic Obstructive Pulmonary Disease
  • Serum samples from a center in Italy were analyzed using the test for measuring protein kinase activity with the fluorescent substrate peptide SEQ. I D NO: 5.
  • the amount of active enzyme was determined in the serum samples. In healthy individuals, the amount of active enzyme in the serum is 17.7 ⁇ 6.3 ng / ml, while in patients with M POC, the amount of active enzyme in the serum is 14.5 ⁇ 3.9 ng / ml (p ⁇ 0.01).
  • Serum samples from a center in Italy were analyzed using the protein kinase activity assay with the SEO ID NO: 5 fluorescent substrate peptide.
  • the amount of phosphorylated product is 0.062 ⁇ 0.022 pmol / min / ⁇
  • the amount of phosphorylated product is 0.049 ⁇ 0.017 pmol / min / ⁇ (p ⁇ 0.001).
  • the amount of active enzyme was determined in the serum samples.
  • Serum samples from a center in Italy were analyzed using the test for measuring protein kinase activity with the fluorescent substrate peptide SEQ ID NO: 5.
  • the amount of active enzyme was determined in the serum samples. In healthy individuals, the amount of active enzyme in the serum is 17.7 ⁇ 6.3 ng / ml, while in patients with diabetes, the amount of active enzyme in the serum is 14.8 ⁇ 5.4 ng / ml ( p ⁇ 0.0001).
  • XI - Serum protein kinase activity against the fluorescent peptide substrate shows the substrate specificity of protein kinase A and the sensitivity to inhibition by the specific inhibitor of the PKA, the PKI.
  • the enzymatic activity of the invention is defined as a protein kinase with similar specificity to PKA (PKA-like) on the following basis: (i) The activity is that of a protein kinase, which requires ⁇ for perform phosphorylation, as shown by the electrophoretic charge dependent on ⁇ . The shift of A2 peptide (SEQ ID NO: 5) on 2% agarose gels is similar to that obtained by phosphorylation of the same peptide by recombinant PKA ( Figure 13). The phosphorylation achieved by serum protein kinase and recombinant PKA is reversed (dephosphorylated) by phosphorus-thr / ser specific protein phosphatase (lambda phosphatase).
  • Phosphorylation is inhibited by the use of a broad-spectrum kinase inhibitor, the staurosporine and by the use of PKI, a specific inhibitor of PKA, but not by an inhibitory peptide specific for the protein kinase C protein class (PKC inhibitor, FIG. 13).
  • PKI inhibitor an inhibitory peptide specific for the protein kinase C protein class
  • FIG. 14 The affinity for PKI, and hence the PKA specificity, is further shown by the purification of serum protein kinase activity on immobilized PKI columns. This indicates that the extracellular protein kinase activity of the serum described above, which is significantly decreased in patients with chronic inflammatory diseases (IBD, MOPD, CVD, diabetes and cLBP), is of PKA or PKA-like origin.

Abstract

L'invention concerne l'utilisation d'un biomarqueur pour le diagnostic d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, en particulier des maladies inflammatoires chronique de l'intestin, une méthode de diagnostic, une méthode d'évaluation de l'efficacité d'un traitement, une méthode de dosage, ainsi que des kits et des substrats enzymatiques.

Description

BIOMARQUEUR POUR LE DIAGNOSTIC DE MALADIES INFLAMMATOIRES
L'invention concerne l'utilisation d'un biomarqueur pour le diagnostic de maladies inflammatoires, notamment de maladies inflammatoires chroniques, en particulier des maladies inflammatoires chroniques de l'intestin, une méthode de diagnostic, une méthode d'évaluation de l'efficacité d'un traitement, une méthode de dosage, ainsi que des kits et des substrats enzymatiques.
Les maladies inflammatoires représentent un vaste groupe de pathologies diverses. Parmi elles, les maladies inflammatoires chroniques de l'intestin (MICI, ou IBD pour Inflammatory Bowel Disease) représentent un groupe de pathologies caractérisées par une inflammation chronique du tractus digestif. Ce groupe correspond à deux pathologies principales : la maladie de Crohn (MC) et la colite ulcéreuse (CU, ou RCH pour Rectocolite Hémorragique). Ces deux pathologies présentent de nombreux symptômes communs mais correspondent à des affections distinctes.
Il s'agit de pathologies dont les causes demeurent inconnues. Leur diagnostic, généralement complexe, requiert de procéder à de nombreux examens tels que des analyses de sang, des examens de selles, des endoscopies ou encore des biopsies. En particulier, il est bien souvent difficile de distinguer les MICI d'autres pathologies de l'intestin, telles que le syndrome du côlon irritable, présentant des symptômes similaires (distension abdominale, douleur, diarrhées, ...).
Il existe donc actuellement un réel besoin d'outils efficaces permettant de diagnostiquer les maladies inflammatoires, en particulier les maladies inflammatoires chroniques de l'intestin.
Les protéines kinases correspondent à une famille d'enzymes jouant un rôle clé dans la transduction des signaux intracellulaires.
En particulier, la protéine kinase dépendante de l'AMPc (Adenosine monophosphate cyclique), ou protéine kinase A (PKA) est une protéine dimère composée de deux types de sous-unités, une sous-unité catalytique assurant le transfert d'un groupement phosphate à la protéine substrat, et une sous-unité régulatrice, sensible au niveau d'AMPc, contrôlant l'activation ON/OFF de la protéine kinase A. En fonction des niveaux d'AMPc présents dans la cellule, la protéine kinase A permet l'activation de nombreuses protéines par phosphorylation et intervient ainsi dans la régulation de nombreux mécanismes cellulaires (notamment la régulation du métabolisme des sucres et des lipides).
La présente invention propose une méthode de diagnostic des maladies inflammatoires, notamment des maladies inflammatoires chroniques, en particulier des MICI, non- invasive, sensible, rapide, et bon marché reposant sur une protéine kinase capable de phosphoryler un substrat de la protéine kinase A.
L'un des aspects de l'invention concerne l'utilisation du taux de phosphorylation pour le diagnostic des maladies inflammatoires, notamment des maladies inflammatoires chroniques.
Un autre aspect de l'invention concerne ainsi l'utilisation d'une protéine kinase pour le diagnostic des maladies inflammatoires, notamment des maladies inflammatoires chroniques.
Un autre aspect de l'invention concerne une méthode de diagnostic des maladies inflammatoires, notamment des maladies inflammatoires chroniques.
Un autre aspect de l'invention concerne une méthode d'évaluation et de suivi de l'efficacité d'un traitement des maladies inflammatoires, notamment des maladies inflammatoires chroniques.
Un autre aspect de l'invention concerne une méthode de dosage de l'activité kinase A. Un autre aspect de l'invention concerne également des kits de dosage et de diagnostic, ainsi que des peptides substrats.
Un des aspects de l'invention concerne l'utilisation du taux de phosphorylation d'un substrat peptidique comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ ID NO : l),
où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, Q., R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, dans un échantillon biologique d'un sujet suspecté de présenter une maladie inflammatoire, notamment une maladie inflammatoire chronique, comme marqueur pour le diagnostic et/ou le pronostic in vitro d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, chez ledit sujet,
Un autre aspect de l'invention concerne l'utilisation du taux de phosphorylation d'un substrat peptidique comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ ID NO : 1),
où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, Q., R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, ladite phosphorylation résultant de l'action d'une protéine kinase capable de phosphoryler ledit substrat peptidique,
dans un échantillon biologique d'un sujet suspecté de présenter une maladie inflammatoire, notamment une maladie inflammatoire chronique, comme marqueur pour le diagnostic et/ou le pronostic in vitro d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, chez ledit sujet,
Un autre aspect de l'invention a pour objet l'utilisation d'une protéine kinase capable de phosphoryler un substrat peptidique comprenant ou consistant en la séquence consensus R-X X2-S/T-X3 (SEQ ID NO : 1),
où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, , R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, dans un échantillon biologique d'un sujet suspecté de présenter une maladie inflammatoire, notamment une maladie inflammatoire chronique, comme marqueur pour le diagnostic et/ou le pronostic in vitro d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, chez ledit sujet.
Un autre aspect de l'invention a pour objet l'utilisation de l'activité d'une protéine kinase capable de générer la phosphorylation d'un substrat peptidique comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ. ID NO : 1),
où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, Q., R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, mesurée dans un échantillon biologique d'un sujet suspecté de présenter une maladie inflammatoire, notamment une maladie inflammatoire chronique,
dans lequel l'activité de ladite protéine kinase est déterminée par le taux de phosphorylation dudit substrat,
ladite utilisation de l'activité d'une protéine kinase servant comme marqueur pour le diagnostic et/ou le pronostic in vitro d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, chez ledit sujet, Selon l'invention, les maladies inflammatoires, notamment les maladies inflammatoires chroniques, désignent des maladies résultant directement ou indirectement de la réponse immunitaire. Ces maladies présentent toutes une composante inflammatoire qui contribue de manière importante au développement de la maladie, comme par exemple le diabète ou les maladies cardiovasculaires.
De manière non limitative, une maladie inflammatoire est notamment choisie parmi la liste ci-dessous :
- les maladies inflammatoires chroniques de l'intestin,
- les lombalgies inflammatoires chroniques,
- les maladies cardiovasculaires (MCV)
- la maladie pulmonaire obstructive chronique (MPOC), - les diabètes
Dans un mode de réalisation, l'invention a pour objet l'utilisation telle que définie précédemment, dans laquelle une protéine kinase est capable de phosphoryler un substrat peptidique comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ ID NO : 1),
où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, Q, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, dans un échantillon biologique d'un sujet suspecté de présenter des lombalgies inflammatoires chroniques, comme marqueur pour le diagnostic et/ou le pronostic in vitro des lombalgies inflammatoires chroniques chez ledit sujet.
Dans la présente invention, « l'utilisation telle que définie précédemment » concerne à la fois l'utilisation d'une protéine kinase et l'utilisation de l'activité d'une protéine kinase.
Dans un mode de réalisation, l'invention a pour objet l'utilisation telle que définie précédemment, dans laquelle une protéine kinase est capable de phosphoryler un substrat peptidique comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ ID NO : 1),
où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, O, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, dans un échantillon biologique d'un sujet suspecté de présenter une maladie cardiovasculaire, comme marqueur pour le diagnostic et/ou le pronostic in vitro d'une maladie autoimmune chez ledit sujet. Dans un mode de réalisation, l'invention a pour objet l'utilisation telle que définie précédemment, dans laquelle une protéine kinase est capable de phosphoryler un substrat peptidique comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ ID NO : 1),
où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, Q, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, dans un échantillon biologique d'un sujet suspecté de présenter une maladie pulmonaire obstructive chronique, comme marqueur pour le diagnostic et/ou le pronostic in vitro d'une maladie pulmonaire obstructive chronique chez ledit sujet.
Dans un mode de réalisation, l'invention a pour objet l'utilisation telle que définie précédemment, dans laquelle une protéine kinase est capable de phosphoryler un substrat peptidique comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ ID NO : 1),
où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, O, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, dans un échantillon biologique d'un sujet suspecté de présenter un diabète, comme marqueur pour le diagnostic et/ou le pronostic in vitro du diabète chez ledit sujet.
Dans un mode de réalisation, l'invention a pour objet l'utilisation telle que définie précédemment, dans laquelle une protéine kinase est capable de phosphoryler un substrat peptidique comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ ID NO : 1),
où :
Xi est un acide aminé naturel ou non naturel, X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, Q., R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, dans un échantillon biologique d'un sujet suspecté de présenter une maladie inflammatoire chronique de l'intestin, comme marqueur pour le diagnostic et/ou le pronostic in vitro d'une maladie inflammatoire chronique de l'intestin chez ledit sujet.
Dans un mode de réalisation, l'invention concerne l'utilisation telle que définie précédemment dans laquelle ledit échantillon biologique contient ladite protéine kinase.
Dans un mode de réalisation, l'invention concerne l'utilisation telle que définie précédemment dans laquelle ledit échantillon biologique contenant ladite protéine kinase est un échantillon biologique extracellulaire. Selon l'invention, « échantillon biologique extracellulaire » correspond au milieu liquide d'un échantillon biologique, obtenu à l'extérieur de la cellule, en particulier le liquide extracellulaire du sang, tel que le plasma ou le sérum.
Dans un mode de réalisation, l'invention concerne l'utilisation telle que définie précédemment dans laquelle ledit échantillon biologique contenant ladite protéine kinase est obtenu à partir des cellules sanguines totales du sang périphérique ou du sang veineux, et l'activité de la protéine kinase est mesurée après lyse desdites cellules.
Dans un mode de réalisation, l'invention concerne l'utilisation telle que définie précédemment dans laquelle ledit échantillon biologique contient ladite protéine kinase.
Dans un mode de réalisation, l'invention concerne l'utilisation telle que définie précédemment dans laquelle ladite protéine kinase est une protéine kinase extracellulaire ou une protéine kinase présente dans un échantillon biologique extracellulaire. Cette invention repose sur la double observation surprenante faite par les inventeurs que la phosphorylation des substrats de la PKA (activité de la kinase A ou d'une PKA-like) peut être détectée dans le sang et est corrélée avec la présence des maladies inflammatoires, notamment des maladies inflammatoires chroniques, alors que la PKA est normalement 5 une enzyme intracellulaire.
La mesure de l'activité kinase dans le sérum est ainsi utilisée comme outil pour le diagnostic des maladies inflammatoires, notamment des maladies inflammatoires chroniques.
10
Dans l'invention, l'expression "protéine kinase capable de phosphoryler un substrat peptidique R-Xi-X2-S/T-X3 (SEQ. ID NO : 1)" désigne un groupe d' enzymes possédant une activité kinase type A, c'est-à-dire des enzymes capables de phosphoryler les substrats de la kinase A en présence d'ATP. Ce groupe d'enzymes inclut la protéine kinase A et les 15 protéines PKA-like.
Dans l'invention, le terme "protéine kinase A" (ou "PKA") désigne les kinases dépendantes de l'AMPc (ENZYME ENTRY : EC 2.7.11.11), membres de la famille des kinases à sérine-thréonine, ainsi que leurs différentes isoformes. De manière non- 20 limitative, la PKA humaine est principalement illustrée par la sous-unité catalytique alpha de séquence SEQ ID NO : 60.
En particulier, le terme "protéine kinase A" désigne une protéine kinase dont au moins une sous unité présente au moins 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89% , 25 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% ou 100% d'identité, avec SEQ ID NO : 60.
Le terme "protéine kinase A" peut également désigner une protéine kinase dont au moins une sous unité présente au moins 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 30 89% , 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% ou 100% d'identité, avec SEQ ID NO : 61 ou SEQ ID NO : 62. SEQ ID NO : 60 MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQF
ERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEH
sous-unité α TLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSH
LRRIGRFSEPHARFYAAQIVL FEYLHSLDLIYRDLKPENLLID QQGYIQVTDFGFAKRVKGRTWTLCG PEYLAPEI ILSKGYNKAV DWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSS DLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQ RKVEAPFI PKFKGPGD SNFDDYEEEEIRVS INEKCGKEFSEF
SEQ ID NO : 61 MGNAA AKKGSEVESVKEFLAKAKEDFLKKWENPTQNNAGLEDF
ERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEH
sous-unité β TLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSH
LRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLID HQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEI ILSKGYNKAV DWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSS DLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQ RKVEAPFI PKFRGSGDTSNFDDYEEEDIRVS ITEKCAKEFGEF
MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQF ERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEH
SE ID NO : 62 ILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSR sous-unité γ LQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLID
QQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEI ILSKGYNKAV DWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSS DLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYE KKVEAPFI PKYTGPGDASNFDDYEEEELRI S INEKCAKEFSEF
Tableau 1. Séquences de référence des sous-unités de la PKA humaine.
Dans l'invention, le terme "protéine kinase A-like" (ou "PKA-like") désigne toute protéine 5 kinase capable de phosphoryler le même substrat peptidique que la protéine kinase A, mais dont la séquence peut être différente de celle de la protéine kinase A.
Afin de caractériser l'activité d'une protéine kinase observée dans le sérum, les inventeurs ont utilisé un inhibiteur PKI défini ci après (les résultats sont présentés figures 10 13A, 13B et 14).
Ainsi, les protéines kinases présentes dans le sérum, ayant une activité comparable à la protéine kinase A et étant sensibles au PKI, peuvent donc être caractérisées comme étant des "PKA-like."
L'inhibiteur peptidique des protéines kinases dépendantes de l'AMPc (PKA) (également appelé PKI), TTYADFIASGRTGRRNAIHD, inhibe la phosphorylation des protéines cibles en se liant au site protéine-substrat de la sous-unité catalytique de la PKA. L'inhibiteur PKI correspond à la région 5-24 de l'inhibiteur naturel de la protéine kinase A. Il possède une séquence primaire et une structure 3D optimales pour inhiber les protéines kinases de la classe A, c'est-à-dire la protéine kinase A ou la protéine kinase A-like, tout en ayant un faible effet ou un effet négligeable sur d'autres classes de protéines kinases telles que les protéines kinases de classe B ou C ou les Map kinases ou encore les tyrosines kinases, ... Par conséquent, l'inhibiteur PKI est devenu un outil couramment utilisé pour caractériser les effets biologiques et les fonctions de la protéine kinase A in vitro. Dans la figure 13A, l'activité protéine kinase observée dans le sérum est comparée à celle de la protéine kinase A recombinante. La phosphorylation des substrats par l'enzyme présente dans le sérum est identique à celle effectuée par la protéine kinase A recombinante. Tout comme pour la protéine kinase A recombinante, l'activité de la protéine kinase présente dans le sérum est dépendante de l'ATP. La phosphorylation réalisée par la protéine kinase sérique et la PKA recombinante est inversée (déphosphorylée) par une protéine phosphatase spécifique au phosphore-thr / ser (lambda phosphatase). La phosphorylation est inhibée par l'utilisation d'un inhibiteur de kinase à large spectre, la staurosporine et par l'utilisation du PKI, inhibiteur spécifique de PKA, mais pas par un peptide inhibiteur spécifique de la classe de protéines C de la protéine kinase (inhibiteur PKC), figure 13B). La figure 13B montre également que l'activité protéine kinase observée dans le sérum est sensible à l'inhibition par PKI.
La figure 14 montre que la protéine kinase présente dans le sérum se lie au PKI étiqueté par la biotine immobilisée sur une colonne de streptavidine-sepharose, permettant ainsi sa purification.
Cela indique que l'activité protéine kinase extracellulaire du sérum selon la présente invention est d'origine PKA ou PKA-like. La protéine kinase A et les protéines kinase A-like sont capables de phosphoryler un susbstrat peptidique comprenant ou consistant en la séquence consensus R-Xi-X2-S/T- X3(SEQ I D NO : 1), où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, Q., R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da.
Selon l'invention, le terme "acide aminé naturel" désigne un acide aminé choisi pa rmi l'alanine (A), la valine (V), l'isoleucine (I), la leucine (L), la méthionine (M), la phénylalanine (F), la tyrosine (Y), le tryptophane (W), la sérine (S), la thréonine (T), l'asparagine (N), la glutamine (Q.), la cystéine (C), la glycine (G), la proline (P), l'arginine (R), l'histidine (H), la lysine (K), l'acide aspartique (D), l'acide glutamique (E), la sélénocystéine (U) et la pyrrolysine (O). Ces acides aminés peuvent également être modifiés naturellement par une ou plusieurs modifications post-traductionnelles (e.g. méthylation, nitrosylation, phosphorylation).
Selon l'invention, le terme "acide aminé non naturel" désigne un acide aminé qui n'existe pas naturellement. I l s'agit d'analogues d'acides aminés naturels. Ces peptides ont la même structure chimique de base qu'un acide aminé naturel mais possèdent des groupements et/ou un squelette peptidique modifiés (e.g. la norleucine, l'homosérine, la norleucine, la méthionine sulfoxyde, de sulfonium de méthionine de méthyle).
Dans un mode de réalisation, l'invention a pour objet l'utilisation telle que définie précédemment, dans laquelle une protéine kinase est capable de phosphoryler un substrat peptidique R-X X2-S/T-X3 (SEQ. I D NO : 1), où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, , R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, dans un échantillon biologique d'un sujet suspecté de présenter une maladie inflammatoire, notamment une maladie inflammatoire chronique, comme marqueur pour le diagnostic et/ou le pronostic in vitro d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, chez ledit sujet,
ladite protéine kinase étant choisie parmi la protéine kinase A et une protéine PKA-like.
Dans un mode de réalisation, l'invention a pour objet l'utilisation telle que définie précédemment, dans laquelle une protéine kinase est capable de phosphoryler un substrat peptidique R-Xi-X2-S/T-X3 (SEQ ID NO : 1), où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, Q, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, dans un échantillon biologique d'un sujet suspecté de présenter une maladie inflammatoire, notamment une maladie inflammatoire chronique, comme marqueur pour le diagnostic et/ou le pronostic in vitro d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, chez ledit sujet,
ladite protéine kinase étant la protéine kinase A. Dans un mode de réalisation, l'invention a pour objet l'utilisation telle que définie précédemment, dans laquelle une protéine kinase est capable de phosphoryler un substrat peptidique comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ. ID NO : 1), où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, O, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, dans un échantillon biologique d'un sujet suspecté de présenter une maladie inflammatoire, notamment une maladie inflammatoire chronique, comme marqueur pour le diagnostic et/ou le pronostic in vitro d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, chez ledit sujet, ladite protéine kinase étant une protéine PKA-like.
Dans un mode de réalisation, la protéine kinase, dont l'activité est mesurée dans la présente invention, est capable de phosphoryler un substrat peptidique comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ ID NO : 1), où :
Xi est un acide aminé de préférence R
X2 est un acide aminé de préférence P
X3 est un acide aminé choisi parmi L, F, V, I, Q, R, M, K, H et C, de préférence parmi L, F, V et I .
Dans un mode de réalisation, la protéine kinase, dont l'activité est mesurée dans la présente invention, est capable de phosphoryler un substrat peptidique comprenant ou consistant en la séquence consensus R-Xa-Xb-R-Xi-X2-S/T-X3 (SEQ. ID NO : 2), où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, 0, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da,
Xa et Xb sont des acides aminés naturels ou non naturels, de préférence choisis parmi P et un acide aminé en D-isomère.
Dans un mode de réalisation, le substrat peptidique comprend ou consiste en la séquence consensus R-X X2-S/T-X3 (SEQ ID NO : 1) ou R-Xa-Xb-R-Xi-X2-S/T-X3 (SEQ ID NO : 2), où :
Xi est un acide aminé chargé positivement au pH physiologique, en particulier R ou K, plus particulièrement R.
Dans un mode de réalisation, le substrat peptidique comprend ou consiste en la séquence consensus R-X X2-S/T-X3 (SEQ ID NO : 1) ou R-Xa-Xb-R-Xi-X2-S/T-X3 (SEQ ID NO : 2), où :
X2 est P. Dans un mode de réalisation, le substrat peptidique comprend ou consiste en la séquence consensus R-X X2-S/T-X3 (SEQ ID NO : 1) ou R-Xa-Xb-R-X X2-S/T-X3 (SEQ ID NO : 2), où : X3 est un acide aminé choisi parmi : L, F, V, I, Q, R, M, K, H et C.
Dans un mode de réalisation, le substrat peptidique comprend ou consiste en la séquence consensus R-Xi-X2-S/T-X3 (SEQ I D NO : 1) ou R-Xa-Xb-R-Xi-X2-S/T-X3 (SEQ I D NO : 2), où : 5 X3 est un acide aminé choisi parmi : L, F, V et I .
Dans un mode de réalisation, le substrat peptidique comprend ou consiste en la séquence consensus R-X X2-S/T-X3 (SEQ I D NO : 1) ou R-Xa-Xb-R-Xi-X2-S/T-X3 (SEQ I D NO : 2), où :
X3 est un acide aminé choisi parmi : Q, R, M, K, H et C.
10
Dans un mode de réalisation, la protéine kinase, dont l'activité est mesurée dans la présente invention, est capable de phosphoryler un substrat peptidique comprenant ou consistant en une des séquences suivantes :
LRRASLG (SEQ I D NO : 4), PRRPSLG (SEQ I D NO : 5), LPRRPSI (SEQ I D NO : 6), PRRASLG 15 (SEQ I D NO : 7), PRRWSLG (SEQ ID NO : 8), PRRKSLG (SEQ ID NO : 9), PRRLSLG (SEQ I D NO :
10), PRRRSLG (SEQ I D NO : 11), PRRTSLG (SEQ I D NO : 12), PRRGSLG (SEQ I D NO : 13), PRRESLG (SEQ ID NO : 14), PRRSSLG (SEQ I D NO : 15), PRRYSLG (SEQ I D NO : 16), PRRHSLG (SEQ I D NO : 17), PRRVSLG (SEQ I D NO : 18), PRRNSLG (SEQ I D NO : 19), PRRCSLG (SEQ I D NO : 20), PRRQSLG (SEQ I D NO : 21), PRRDSLG (SEQ I D NO : 22), PRRASFG (SEQ I D NO : 20 23), PRRASVG (SEQ I D NO : 24), PRRASIG (SEQ I D NO : 25), PRRASMG (SEQ I D NO : 26), PRRASQG (SEQ I D NO : 27), PRRASNG (SEQ I D NO : 28), PRRASCG (SEQ I D NO : 29), RDLRRASLV (SEQ I D NO : 30), RYLRRATLV(SEQ ID NO : 31), RYLRRPSLG (SEQ ID NO : 32), RPPRRASLG (SEQ I D NO : 33), R{dY}{dL}RRASLG (où d indique la forme D-isomère d'une acide aminé) (SEQ I D NO : 34), R{dY}{dL}RRPSLG (où d indique la forme D-isomère d'une 25 acide aminé) (SEQ I D NO : 35), RPPRKASLG (SEQ ID NO : 36), RPPRRPSLG (SEQ I D NO : 37), RPPRRPSI (SEQ I D NO : 38), PRRPTI (SEQ ID NO : 39) et RYLRRASLG (SEQ I D NO : 40).
L'activité de phosphorylation PKA (ou PKA-like) peut être testée en incubant une protéine kinase ou un échantillon biologique susceptible de contenir une protéine kinase en présence d'un substrat peptidique tel que défini ci-dessus et en présence d'ATP. Dans l'invention, le terme "maladies inflammatoires chroniques de l'intestin" (ou "MICI" ou "IBD") regroupe deux pathologies distinctes, la maladie de Crohn et la colite ulcéreuse. Ces deux pathologies se caractérisent par une inflammation de la paroi d'une partie du tube digestif et évoluent par poussées inflammatoires de durée et de fréquence extrêmement variables en fonction des patients.
Dans un mode de réalisation, l'invention concerne l'utilisation telle que définie précédemment, dans laquelle ladite maladie inflammatoire chronique de l'intestin appartient au groupe suivant : la maladie de Crohn et la colite ulcéreuse.
Dans l'invention, le terme "maladie de Crohn" (MC) fait référence à une affection inflammatoire chronique touchant n'importe quelle partie du tube digestif, mais s'installant le plus souvent à la jonction de l'intestin grêle et du côlon. La maladie de Crohn, contrairement à la colite ulcéreuse, peut toucher toutes les parties de l'intestin et se caractérise principalement par un granulome épithélioïde observé dans la sous- muqueuse de l'intestin.
Dans l'invention, le terme "rectocolite hémorragique" ou "colite ulcéreuse" (CU) fait référence à une inflammation chronique du colon et du rectum caractérisée par l'existence d'ulcérations superficielles ou profondes, isolées ou confluentes.
Dans un mode de réalisation, l'invention concerne l'utilisation telle que définie précédemment, dans laquelle ladite protéine kinase telle que définie ci-dessus est capable de phosphoryler un substrat peptidique comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ. ID NO : 1), où :
Xi est R,
X2 est P,
X3 est un acide aminé choisi parmi L, F, V et I. Dans un mode de réalisation, l'invention concerne l'utilisation telle que définie précédemment, dans laquelle ladite protéine kinase telle que définie ci-dessus est capable de phosphoryler un substrat peptidique comprenant ou consistant en la séquence consensus R-Xa-Xb-R-Xi-X2-S/T-X3 (SEQ ID NO : 2), où :
Xi est un acide aminé naturel ou non naturel, de préférence R,
X2 est un acide aminé naturel ou non naturel, choisi parmi P et A, de préférence P, X3 est un acide aminé choisi parmi L, F, V et I,
Xa et Xb sont des acides aminés naturels ou non naturels, de préférence choisis parmi P et un acide aminé en D-isomère.
Dans un mode de réalisation, l'invention concerne l'utilisation telle que définie précédemment, dans laquelle ladite protéine kinase telle que définie ci-dessus est capable de phosphoryler un substrat peptidique comprenant ou consistant en la séquence consensus R-Xa-R-Xi-X2-S/T-X3 (SEQ. ID NO : 3), où :
Xi est un acide aminé naturel ou non naturel, de préférence R,
X2 est un acide aminé naturel ou non naturel, choisi parmi P et A, de préférence P X3 est un acide aminé naturel choisi parmi L, F, V, I, 0, R, M, K, H et C ou un acide aminé non naturel, de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, Xa est un acide aminé naturel ou non naturel, de préférence choisi parmi P et un acide aminé en D-isomère. Dans un mode de réalisation, l'invention concerne l'utilisation telle que définie précédemment, dans laquelle ladite protéine kinase telle que définie ci-dessus est capable de phosphoryler un substrat peptidique comprenant ou consistant en la séquence LRRASLG (SEQ ID NO : 4). Dans un mode de réalisation, l'invention concerne l'utilisation telle que définie précédemment, dans laquelle ladite protéine kinase telle que définie ci-dessus est capable de phosphoryler un substrat peptidique comprenant ou consistant en la séquence PRRPSLG (SEQ ID NO : 5). Dans un mode de réalisation, l'invention concerne l'utilisation telle que définie précédemment, dans laquelle ladite protéine kinase telle que définie ci-dessus est capable de phosphoryler un substrat peptidique comprenant ou consistant en la séquence LPRRPSI (SEQ ID NO : 6).
Dans un mode de réalisation, l'invention concerne l'utilisation telle que définie précédemment, dans laquelle ledit échantillon biologique est un échantillon de sang.
Dans un mode de réalisation, l'invention concerne l'utilisation telle que définie précédemment, dans laquelle ledit échantillon biologique est un échantillon de sang ou un échantillon d'un composant du sang tel que le sérum ou plasma.
Dans un mode de réalisation, l'invention concerne l'utilisation telle que définie précédemment, dans laquelle l'activité de ladite protéine kinase est déterminée dans ledit échantillon biologique.
La mesure de l'activité de ladite protéine kinase implique l'utilisation d'ATP, en tant que donneur de phosphate, et d'un substrat peptidique, en tant qu'accepteur de phosphate. La phosphorylation du substrat peptidique peut être mesurée à l'aide de techniques connues de l'homme du métier, notamment à l'aide de marqueurs radioactifs (par exemple, l'ATP marqué au 32P) ou fluorescents (par exemple, un substrat lié à une molécule fluorescente).
Dans un mode de réalisation, l'invention concerne l'utilisation telle que définie précédemment, dans laquelle l'activité de ladite protéine kinase est déterminée dans un échantillon de sang ou dans un composant du sang tel que le sérum ou plasma dudit sujet.
Dans un mode de réalisation, l'invention concerne l'utilisation telle que définie précédemment, dans laquelle l'activité de ladite protéine kinase est déterminée à l'aide d'au moins un substrat peptidique comprenant ou consistant en la séquence consensus R-X1-X2-S/T-X3 (SEQ ID NO : 1), où :
Xi est un acide aminé naturel ou non naturel, X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, Q, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da. Dans un mode de réalisation, l'invention concerne l'utilisation telle que définie précédemment, dans laquelle l'activité de ladite protéine kinase est déterminée à l'aide d'au moins un substrat peptidique comprenant ou consistant en la séquence consensus R-X1-X2-S/T-X3 (SEQ ID NO : 1), où :
Xi est un acide aminé de préférence R
X2 est un acide aminé de préférence P,de préférence P
X3 est un acide aminé choisi parmi L, F, V, I, O, R, M, K, H et C, de préférence parmi L, F, V et I.
Dans un mode de réalisation, l'invention concerne l'utilisation telle que définie précédemment, dans laquelle l'activité de ladite protéine kinase est déterminée à l'aide d'au moins un substrat peptidique comprenant ou consistant en la séquence consensus R-Xa-Xb-R-Xi-X2-S/T-X3 (SEQ ID NO : 2),
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, O, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da,
Xa et Xb sont des acides aminés naturels ou non naturels, de préférence choisis parmi P et un acide aminé en D-isomère. Dans un mode de réalisation, l'invention concerne l'utilisation telle que définie précédemment, dans laquelle l'activité de ladite protéine kinase est déterminée à l'aide d'au moins un substrat peptidique comprenant ou consistant en une séquence choisie parmi :
LRRASLG (SEQ ID NO : 4), PRRPSLG (SEQ ID NO : 5), LPRRPSI (SEQ ID NO : 6), PRRASLG (SEQ ID NO : 7), PRRWSLG (SEQ ID NO : 8), PRRKSLG (SEQ ID NO : 9), PRRLSLG (SEQ ID NO : 10), PRRRSLG (SEQ ID NO : 11), PRRTSLG (SEQ ID NO : 12), PRRGSLG (SEQ ID NO : 13), PRRESLG (SEQ ID NO : 14), PRRSSLG (SEQ ID NO : 15), PRRYSLG (SEQ ID NO : 16), PRRHSLG (SEQ ID NO : 17), PRRVSLG (SEQ ID NO : 18), PRRNSLG (SEQ ID NO : 19), PRRCSLG (SEQ ID NO : 20), PRRQSLG (SEQ ID NO : 21), PRRDSLG (SEQ ID NO : 22), PRRASFG (SEQ ID NO : 23), PRRASVG (SEQ ID NO : 24), PRRASIG (SEQ ID NO : 25), PRRASMG (SEQ ID NO : 26), PRRASQG (SEQ ID NO : 27), PRRASNG (SEQ ID NO : 28), PRRASCG (SEQ ID NO : 29), RDLRRASLV (SEQ ID NO : 30), RYLRRATLV(SEQ ID NO : 31), RYLRRPSLG (SEQ ID NO : 32), RPPRRASLG (SEQ ID NO : 33), R{dY}{dL}RRASLG (où d indique la forme D-isomère d'une acide aminé) (SEQ. ID NO : 34), R{dY}{dL}RRPSLG (où d indique la forme D-isomère d'une acide aminé) (SEQ ID NO : 35), RPPRKASLG (SEQ ID NO : 36), RPPRRPSLG (SEQ ID NO : 37), RPPRRPSI (SEQ ID NO : 38), PRRPTI (SEQ ID NO : 39) et RYLRRASLG (SEQ ID NO : 40).
Ladite protéine kinase de l'invention est capable de phosphoryler différents substrats peptidiques. Ces différents substrats peptidiques possèdent tous une séquence couverte par la séquence consensus SEQ ID NO : 1 et peuvent posséder un ou plusieurs acides aminés en N-ter ou C-ter de SEQ ID NO : 1. Ces peptides peuvent être utilisés seuls ou en combinaison (c-à-d. un mélange de plusieurs susbstrats peptidiques) pour mesurer l'activité de ladite protéine kinase.
Dans un mode de réalisation, les substrats peptides utilisables dans l'invention ont une taille de 5 à 20 acides aminés, en particulier de 5 à 15 acides aminés, plus particulièrement de 9 acides aminés.
Dans un mode de réalisation, les substrats peptides utilisables dans l'invention ont une taille de 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 ou 20 acides aminés. Les substrats peptidiques susceptibles d'être utilisés dans l'invention peuvent contenir un ou plusieurs acides non-naturels. De plus, les substrats peptidiques peuvent intégrer des modifications chimiques supplémentaires, comme par exemple un marquage avec un isotope radioactif ou une modification de la liaison peptidique. Comme observé par les Inventeurs, la mesure de la phosphorylation de ces substrats permet de déterminer l'activité de ladite protéine kinase dans un échantillon biologique tel que du sang ou tel qu'un composant du sang comme le sérum ou plasma. L'activité de ladite protéine kinase dans le sérum (activité PKA ou PKA-like) est faible et très difficile à mesurer, ce qui nécessite des incubations prolongées avec des substrats ayant des propriétés cinétiques presque optimales vis-à-vis de la PKA pour détecter efficacement l'activité de phosphorylation. Bien que d'autres substrats non optimaux puissent être phosphorylés à des concentrations plus importantes de PKA avec une activation par l'AMPc, une activité faible de la PKA extracellulaire ne sera pas détectable à l'aide de ces peptides dans des conditions similaires. Ceci a notamment été observé en limitant la concentration d'une PKA recombinante (bien que toujours présente à une concentration 10 fois supérieure à celle dans le sérum), afin de déterminer le substrat optimal permettant de détecter un faible niveau d'activité kinase extracellulaire.
Dans un mode de réalisation, l'invention concerne l'utilisation telle que définie précédemment, dans laquelle la concentration de ladite protéine kinase est déterminée dans ledit échantillon biologique. En particulier, la concentration de ladite protéine kinase dans le sang est détectée dans un échantillon biologique à l'aide d'un anticorps, ou d'un fragment d'anticorps, spécifique de ladite protéine kinase.
Dans un mode de réalisation, l'invention concerne l'utilisation telle que définie précédemment, dans laquelle ledit sujet présente au moins un symptôme appartenant au groupe comprenant : du sang dans les selles, des glaires dans les selles, des nausées et des vomissements, des crampes abdominales douloureuses, surtout dans le bas ventre, du sang dans les selles (voire une hémorragie en cas de poussée grave), une diarrhée chronique, des selles fréquentes, un besoin urgent de déféquer même s'il y a peu ou pas de selles à évacuer (ténesme rectal), une perte de poids en raison d'un appétit réduit et d'une mauvaise absorption des nutriments dans l'intestin, de la fatigue, souvent causée par l'anémie, de la fièvre, des douleurs aux articulations, un retard de croissance et/ou de puberté dans le cas d'un enfant.
La présente invention est de préférence utilisée pour diagnostiquer des MICI chez un patient présentant un ou plusieurs symptômes (distension abdominale, douleurs de l'intestin, diarrhées, ...) susceptibles d'être attribués à tort à d'autres pathologies (comme par exemple, le syndrome du côlon irritable).
Dans un mode de réalisation, l'invention concerne l'utilisation telle que définie précédemment, dans laquelle ledit sujet est suspecté de souffrir du syndrome du côlon irritable.
La présente invention peut ainsi être utilisée pour établir un diagnostic différenciant les maladies inflammatoires chroniques de l'intestin de la maladie du syndrome du côlon irritable.
Un second aspect de l'invention a pour objet une méthode de diagnostic et/ou de pronostic in vitro d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, chez un sujet suspecté de présenter une maladie inflammatoire, notamment une maladie inflammatoire chronique, comprenant :
- une étape i) de détermination de l'activité d'une protéine kinase capable de phosphoryler un substrat peptidique comprenant ou consistant en la séquence consensus R-X1-X2-S/T-X3 (SEQ. ID NO : 1), où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, Q., R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, dans un échantillon biologique dudit sujet,
- une étape (ii) de comparaison de l'activité de ladite protéine kinase déterminée à l'étape (i) par rapport à une valeur de référence. Dans un mode de réalisation, l'invention a pour objet une méthode de diagnostic et/ou de pronostic in vitro d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, ladite maladie inflammatoire, notamment ladite maladie inflammatoire chronique, étant choisie parmi les maladies inflammatoires chroniques de l'intestin y compris la maladie de Crohn et la colite ulcéreuse ou rectocolite hémorragique, les lombalgies inflammatoires chroniques, les maladies cardiovasculaires, la maladie pulmonaire obstructive chronique (MPOC), et les diabètes.
Dans un mode de réalisation, l'invention a pour objet une méthode de diagnostic et/ou de pronostic in vitro des lombalgies inflammatoires chroniques chez un sujet suspecté de présenter des lombalgies inflammatoires chroniques, comprenant :
- une étape i) de détermination de l'activité d'une protéine kinase capable de phosphoryler un substrat peptidique comprenant ou consistant en la séquence consensus R-X1-X2-S/T-X3 (SEQ ID NO : 1), où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, Q, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, dans un échantillon biologique dudit sujet,
- une étape (ii) de comparaison de l'activité de ladite protéine kinase déterminée à l'étape (i) par rapport à une valeur de référence.
Dans un mode de réalisation, l'invention a pour objet une méthode de diagnostic et/ou de pronostic in vitro d'une maladie cardiovasculaire chez un sujet suspecté de présenter une maladie autoimmune, comprenant :
- une étape i) de détermination de l'activité d'une protéine kinase capable de phosphoryler un substrat peptidique comprenant ou consistant en la séquence consensus R-X1-X2-S/T-X3 (SEQ ID NO : 1), où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel, X3 est un acide aminé naturel choisi parmi L, F, V, I, Q, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, dans un échantillon biologique dudit sujet,
- une étape (ii) de comparaison de l'activité de ladite protéine kinase déterminée à l'étape (i) par rapport à une valeur de référence.
Dans un mode de réalisation, l'invention a pour objet une méthode de diagnostic et/ou de pronostic in vitro d'une maladie pulmonaire obstructive chronique chez un sujet suspecté de présenter une maladie pulmonaire obstructive chronique, comprenant :
- une étape i) de détermination de l'activité d'une protéine kinase capable de phosphoryler un substrat peptidique comprenant ou consistant en la séquence consensus
R-X1-X2-S/T-X3 (SEQ ID NO : 1), où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, Q., R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, dans un échantillon biologique dudit sujet,
- une étape (ii) de comparaison de l'activité de ladite protéine kinase déterminée à l'étape (i) par rapport à une valeur de référence.
Dans un mode de réalisation, l'invention a pour objet une méthode de diagnostic et/ou de pronostic in vitro d'un diabète chez un sujet suspecté de présenter un diabète, comprenant :
- une étape i) de détermination de l'activité d'une protéine kinase capable de phosphoryler un substrat peptidique comprenant ou consistant en la séquence consensus R-X1-X2-S/T-X3 (SEQ ID NO : 1), où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, O, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, dans un échantillon biologique dudit sujet, - une étape (ii) de comparaison de l'activité de ladite protéine kinase déterminée à l'étape (i) par rapport à une valeur de référence.
Dans un mode de réalisation, l'invention a pour objet une méthode de diagnostic et/ou de pronostic in vitro d'une maladie inflammatoire chronique de l'intestin chez un sujet suspecté de présenter une maladie inflammatoire chronique de l'intestin, comprenant :
- une étape i) de détermination de l'activité d'une protéine kinase capable de phosphoryler un substrat peptidique comprenant ou consistant en la séquence consensus R-X1-X2-S/T-X3 (SEQ. ID NO : 1), où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, Q., R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, dans un échantillon biologique dudit sujet,
- une étape (ii) de comparaison de l'activité de ladite protéine kinase déterminée à l'étape (i) par rapport à une valeur de référence.
Dans un mode de réalisation, l'invention concerne une méthode de diagnostic et/ou de pronostic telle que définie précédemment, dans laquelle ladite protéine kinase est la protéine kinase A ou une protéine PKA-like.
Dans un mode de réalisation, la méthode de diagnostic et/ou de pronostic telle que définie précédemment est effectuée à partir d'un échantillon biologique. Dans un mode de réalisation, l'invention concerne une méthode de diagnostic et/ou de pronostic telle que définie précédemment dans laquelle ledit échantillon biologique est un échantillon biologique extracellulaire.
Dans un mode de réalisation, l'invention concerne une méthode de diagnostic et/ou de pronostic telle que définie précédemment dans laquelle ledit échantillon biologique contient ladite protéine kinase. Dans un mode de réalisation, l'invention concerne une méthode de diagnostic et/ou de pronostic telle que définie précédemment dans laquelle ladite protéine kinase est une protéine kinase extracellulaire ou une protéine kinase présente dans un échantillon biologique extracellulaire.
Dans un mode de réalisation, l'invention concerne une méthode de diagnostic et/ou de pronostic telle que définie précédemment, dans laquelle ladite maladie inflammatoire chronique de l'intestin appartient au groupe suivant : la maladie de Crohn et/ou la colite ulcéreuse.
Dans un mode de réalisation, l'invention concerne une méthode de diagnostic et/ou de pronostic telle que définie précédemment, dans laquelle ledit échantillon biologique est un échantillon de sang ou un échantillon d'un composant du sang tel que le sérum ou plasma.
Dans un mode de réalisation, l'invention concerne une méthode de diagnostic et/ou de pronostic telle que définie précédemment, dans laquelle, à l'étape i), l'activité de ladite protéine kinase est déterminée dans un échantillon de sang ou dans un échantillon d'un composant du sang tel que le sérum ou plasma dudit sujet.
Dans un mode de réalisation, à l'étape i), l'activité de ladite protéine kinase est déterminée en incubant l'échantillon biologique en présence d'ATP et d'un substrat peptidique susceptible d'être phosphorylé par ladite protéine kinase pendant au moins 10 heures.
Dans un mode de réalisation, l'invention concerne une méthode de diagnostic et/ou de pronostic telle que définie précédemment, dans laquelle, à l'étape i), l'activité de ladite protéine kinase est déterminée à l'aide d'un substrat peptidique comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ. ID NO : 1), où : Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, Q, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da.
Dans un mode de réalisation, l'invention concerne une méthode de diagnostic et/ou de pronostic telle que définie précédemment, dans laquelle, à l'étape i), l'activité de ladite protéine kinase est déterminée à l'aide d'un substrat peptidique comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ. ID NO : 1), où :
Xi est un acide aminé choisi parmi R et K, de préférence R,
X2 est un acide aminé de préférence P,
X3 est un acide aminé choisi parmi L, F, V, I, Q, R, M, K, H et C, de préférence parmi L, F, V et I . Dans un mode de réalisation, l'invention concerne une méthode de diagnostic et/ou de pronostic telle que définie précédemment, dans laquelle, à l'étape i), l'activité de ladite protéine kinase est déterminée à l'aide d'un substrat peptidique comprenant ou consistant en la séquence consensus la séquence consensus R-Xa-Xb-R-Xi-X2-S/T-X3 (SEQ. ID NO : 2),
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, Q, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, Xa et Xb sont des acides aminés naturels ou non naturels, de préférence choisis parmi P et un acide aminé en D-isomère.
Dans un mode de réalisation, l'invention concerne une méthode de diagnostic et/ou de pronostic telle que définie précédemment, dans laquelle, à l'étape i), l'activité de ladite protéine kinase est déterminée à l'aide d'un substrat peptidique comprenant ou consistant en la séquence : R-X X2-S/T-X3 (SEQ ID NO : 1) ou R-Xa-Xb-R-Xi-X2-S/T-X3 (SEQ ID NO : 2), où : Xi est un acide aminé chargé positivement au pH physiologique, de préférence R ou
K.
Dans un mode de réalisation, l'invention concerne une méthode de diagnostic et/ou de pronostic telle que définie précédemment, dans laquelle, à l'étape i), l'activité de ladite protéine kinase est déterminée à l'aide d'un substrat peptidique comprenant ou consistant en la séquence : R-Xi-X2-S/T-X3 (SEO ID NO : 1) ou R-Xa-Xb-R-Xi-X2-S/T-X3 (SEO ID NO : 2), où :
X2 est P.
Dans un mode de réalisation, l'invention concerne une méthode de diagnostic et/ou de pronostic telle que définie précédemment, dans laquelle, à l'étape i), l'activité de ladite protéine kinase est déterminée à l'aide d'un substrat peptidique comprenant ou consistant en la séquence : R-X X2-S/T-X3 (SEO ID NO : 1) ou R-Xa-Xb-R-Xi-X2-S/T-X3 (SEO ID NO : 2), où :
X3 est un acide aminé choisi parmi : L, F, V, I, 0, R, M, K, H et C.
Dans un mode de réalisation, l'invention concerne une méthode de diagnostic et/ou de pronostic telle que définie précédemment, dans laquelle, à l'étape i), l'activité de ladite protéine kinase est déterminée à l'aide d'un substrat peptidique comprenant ou consistant en la séquence : R-X X2-S/T-X3 (SEO ID NO : 1) ou R-Xa-Xb-R-Xi-X2-S/T-X3 (SEO ID NO : 2), où :
X3 est un acide aminé choisi parmi : L, F, V et I. Dans un mode de réalisation, l'invention concerne une méthode de diagnostic et/ou de pronostic telle que définie précédemment, dans laquelle, à l'étape i), l'activité de ladite protéine kinase est déterminée à l'aide d'un substrat peptidique comprenant ou consistant en la séquence : R-X X2-S/T-X3 (SEO ID NO : 1) ou R-Xa-Xb-R-Xi-X2-S/T-X3 (SEO ID NO : 2), où :
X3 est un acide aminé choisi parmi : O, R, M, K, H et C. Dans un mode de réalisation, l'invention concerne une méthode de diagnostic et/ou de pronostic telle que définie précédemment, dans laquelle, à l'étape i), l'activité de ladite protéine kinase est déterminée à l'aide d'un substrat peptidique comprenant ou consistant en une séquence choisie parmi :
LRRASLG (SEO ID NO : 4), PRRPSLG (SEO ID NO : 5), LPRRPSI (SEO ID NO : 6), PRRASLG (SEO ID NO : 7), PRRWSLG (SEO ID NO : 8), PRRKSLG (SEO ID NO : 9), PRRLSLG (SEO ID NO : 10), PRRRSLG (SEO ID NO : 11), PRRTSLG (SEO ID NO : 12), PRRGSLG (SEO ID NO : 13), PRRESLG (SEO ID NO : 14), PRRSSLG (SEO ID NO : 15), PRRYSLG (SEO ID NO : 16), PRRHSLG (SEO ID NO : 17), PRRVSLG (SEO ID NO : 18), PRRNSLG (SEO ID NO : 19), PRRCSLG (SEO ID NO : 20), PRROSLG (SEO ID NO : 21), PRRDSLG (SEO ID NO : 22), PRRASFG (SEO ID NO : 23), PRRASVG (SEO ID NO : 24), PRRASIG (SEO ID NO : 25), PRRASMG (SEO ID NO : 26), PRRASOG (SEO ID NO : 27), PRRASNG (SEO ID NO : 28), PRRASCG (SEO ID NO : 29), RDLRRASLV (SEO ID NO : 30), RYLRRATLV(SEO ID NO : 31), RYLRRPSLG (SEO ID NO : 32), RPPRRASLG (SEO ID NO : 33), R{dY}{dL}RRASLG (où d indique la forme D-isomère d'une acide aminé) (SEO ID NO : 34), R{dY}{dL}RRPSLG (où d indique la forme D-isomère d'une acide aminé) (SEO ID NO : 35), RPPRKASLG (SEO ID NO : 36), RPPRRPSLG (SEO ID NO : 37), RPPRRPSI (SEO ID NO : 38), PRRPTI (SEO ID NO : 39) et RYLRRASLG (SEO ID NO : 40).
Dans un mode de réalisation, l'invention concerne une méthode de diagnostic et/ou de pronostic telle que définie précédemment, dans laquelle ladite valeur de référence est la moyenne de l'activité de ladite protéine kinase déterminée dans un échantillon de même nature que ledit échantillon biologique, pour un groupe de sujets sains.
Dans un mode de réalisation, l'invention concerne une méthode de diagnostic et/ou de pronostic telle que définie précédemment, dans laquelle ladite valeur de référence est la moyenne de l'activité de ladite protéine kinase déterminée dans un échantillon de même nature que ledit échantillon biologique, pour un groupe de sujets présentant une maladie inflammatoire. Dans un mode de réalisation, l'invention concerne une méthode de diagnostic et/ou de pronostic telle que définie précédemment, comprenant en outre : - une étape iii) de déduction de l'état du sujet.
Dans un mode de réalisation, l'invention concerne une méthode de diagnostic et/ou de pronostic telle que définie précédemment, comprenant :
- une étape i) de détermination de l'activité de ladite protéine kinase dans un échantillon biologique dudit sujet,
- une étape ii) de comparaison de l'activité de ladite protéine kinase déterminée à l'étape (i) par rapport à une valeur de référence,
- une étape iii) de déduction de l'état du sujet.
Dans un mode de réalisation, l'invention concerne une méthode de diagnostic et/ou de pronostic telle que définie précédemment, dans laquelle, à l'étape iii), ledit sujet est susceptible de présenter une maladie inflammatoire, notamment une maladie inflammatoire chronique, si l'activité de ladite protéine kinase dans l'échantillon biologique dudit sujet est inférieure par rapport à l'activité de ladite protéine kinase mesurée chez un individu sain dans les mêmes conditions.
Dans un mode de réalisation, l'invention concerne une méthode de diagnostic et/ou de pronostic telle que définie précédemment, dans laquelle, à l'étape iii), ledit sujet est susceptible de présenter une maladie inflammatoire, notamment une maladie inflammatoire chronique, si l'activité de ladite protéine kinase dans l'échantillon biologique dudit sujet est inférieure à 0,04 pmol/min/μΙ, en particulier inférieure à 0,02 pmol/min/μΙ. Dans un mode de réalisation, l'invention concerne une méthode de diagnostic et/ou de pronostic telle que définie précédemment, dans laquelle, à l'étape iii), ledit sujet est susceptible de présenter une maladie inflammatoire, notamment une maladie inflammatoire chronique, si l'activité de ladite protéine kinase dans l'échantillon biologique dudit sujet est inférieure 0,04, 0,03, 0,02 ou 0,01 pmol/min/μΙ. Dans un mode de réalisation, l'invention concerne une méthode de diagnostic et/ou de pronostic telle que définie précédemment, dans laquelle, à l'étape iii), ledit sujet est susceptible de présenter une maladie inflammatoire, notamment une maladie inflammatoire chronique, si l'activité de ladite protéine kinase dans l'échantillon biologique dudit sujet est au moins 2 fois inférieure, en particulier au moins 3 fois inférieure, plus particulièrement au moins 3,5 fois inférieure, par rapport à l'activité de ladite protéine kinase mesurée chez un individu sain dans les mêmes conditions.
Dans un mode de réalisation, l'invention concerne une méthode de diagnostic et/ou de pronostic telle que définie précédemment, dans laquelle :
à l'étape i), l'activité de ladite protéine kinase est déterminée à l'aide d'un substrat peptidique comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ ID NO : 1), où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, Q, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, à l'étape iii), ledit sujet est susceptible de présenter une maladie inflammatoire, notamment une maladie inflammatoire chronique, si l'activité de ladite protéine kinase dans l'échantillon biologique dudit sujet est au moins 2 fois inférieure, en particulier au moins 3 fois inférieure, plus particulièrement au moins 3,5 fois inférieure, par rapport à l'activité de ladite protéine kinase mesurée chez un individu sain dans les mêmes conditions. Dans un mode de réalisation, l'invention concerne une méthode de diagnostic et/ou de pronostic telle que définie précédemment, dans laquelle :
à l'étape i), l'activité de ladite protéine kinase est déterminée à l'aide d'un substrat peptidique comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ. ID NO : 1), où :
Xi est un acide aminé de préférence R,
X2 est un acide aminé de préférence P, X3 est un acide aminé choisi parmi L, F, V, I, Q., R, M, K, H et C, de préférence choisi parmi L, F, V et I,
à l'étape iii), ledit sujet est susceptible de présenter une maladie inflammatoire, notamment une maladie inflammatoire chronique, si l'activité de ladite protéine kinase dans l'échantillon biologique dudit sujet est au moins 2 fois inférieure, en particulier au moins 3 fois inférieure, plus particulièrement au moins 3,5 fois inférieure, par rapport à l'activité de ladite protéine kinase mesurée chez un individu sain dans les mêmes conditions. Dans un mode de réalisation, l'invention concerne une méthode de diagnostic et/ou de pronostic telle que définie précédemment, dans laquelle :
à l'étape i), l'activité de ladite protéine kinase est déterminée à l'aide d'un substrat peptidique comprenant ou consistant en la séquence consensus R-Xa-Xb-R-Xi-X2-S/T-X3 (SEQ ID NO : 2),
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, Q., R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, Xa et Xb sont des acides aminés naturels ou non naturels, de préférence choisis parmi P et un acide aminé en D-isomère.
à l'étape iii), ledit sujet est susceptible de présenter une maladie inflammatoire, notamment une maladie inflammatoire chronique, si l'activité de ladite protéine kinase dans l'échantillon biologique dudit sujet est au moins 2 fois inférieure, en particulier au moins 3 fois inférieure, plus particulièrement au moins 3,5 fois inférieure, par rapport à l'activité de ladite protéine kinase mesurée chez un individu sain dans les mêmes conditions.
Dans un mode de réalisation, l'invention concerne une méthode de diagnostic et/ou de pronostic telle que définie précédemment, dans laquelle l'activité de ladite protéine kinase est déterminée dans un échantillon de sang dudit sujet à l'aide d'un substrat peptidique comprenant ou consistant en : - la séquence LRRASLG (SEQ ID NO : 4),
et dans laquelle, à l'étape iii), ledit sujet est susceptible de présenter une maladie inflammatoire, notamment une maladie inflammatoire chronique, si l'activité de ladite protéine kinase dans l'échantillon de sang dudit sujet est au moins 2 fois inférieure, en particulier au moins 3 fois inférieure, plus particulièrement au moins 3,5 fois inférieure, par rapport à l'activité de ladite protéine kinase mesurée chez un individu sain dans les mêmes conditions.
Dans un mode de réalisation, l'invention concerne une méthode de diagnostic et/ou de pronostic telle que définie précédemment, dans laquelle l'activité de ladite protéine kinase est déterminée dans un échantillon de sang dudit sujet à l'aide d'un substrat peptidique comprenant ou consistant en :
- la séquence PRRPSLG (SEQ ID NO : 5),
et dans laquelle, à l'étape iii), ledit sujet est susceptible de présenter une maladie inflammatoire, notamment une maladie inflammatoire chronique, si l'activité de ladite protéine kinase dans l'échantillon de sang dudit sujet au moins 2 fois inférieure, en particulier au moins 3 fois inférieure, plus particulièrement au moins 3,5 fois inférieure, par rapport à l'activité de ladite protéine kinase mesurée chez un individu sain dans les mêmes conditions.
Dans un mode de réalisation, l'invention concerne une méthode de diagnostic et/ou de pronostic telle que définie précédemment, dans laquelle l'activité de ladite protéine kinase est déterminée dans un échantillon de sang dudit sujet à l'aide d'un substrat peptidique comprenant ou consistant en :
- la séquence LPRRPSI (SEQ ID NO : 6),
et dans laquelle, à l'étape iii), ledit sujet est susceptible de présenter une maladie inflammatoire, notamment une maladie inflammatoire chronique, si l'activité de ladite protéine kinase dans l'échantillon de sang dudit sujet au moins 2 fois inférieure, en particulier au moins 3 fois inférieure, plus particulièrement au moins 3,5 fois inférieure, par rapport à l'activité de ladite protéine kinase mesurée chez un individu sain dans les mêmes conditions. Dans un mode de réalisation, l'invention concerne une méthode de diagnostic et/ou de pronostic telle que définie précédemment, dans laquelle l'activité de ladite protéine kinase est déterminée dans un échantillon de sang dudit sujet à l'aide d'un substrat peptidique comprenant ou consistant en :
- la séquence LRRASLG (SEQ ID NO : 4),
et dans laquelle, à l'étape iii), ledit sujet est susceptible de présenter une maladie inflammatoire, notamment une maladie inflammatoire chronique, si l'activité de ladite protéine kinase dans l'échantillon biologique dudit sujet est inférieure à 0,04 pmol/min/μΙ, en particulier inférieure à 0,02 pmol/min/μΙ.
Dans un mode de réalisation, l'invention concerne une méthode de diagnostic et/ou de pronostic telle que définie précédemment, dans laquelle l'activité de ladite protéine kinase est déterminée dans un échantillon de sang dudit sujet à l'aide d'un substrat peptidique comprenant ou consistant en :
- la séquence PRRPSLG (SEQ ID NO : 5),
et dans laquelle, à l'étape iii), ledit sujet est susceptible de présenter une maladie inflammatoire, notamment une maladie inflammatoire chronique, si l'activité de ladite protéine kinase dans l'échantillon biologique dudit sujet est inférieure à 0,04 pmol/min/μΙ, en particulier inférieure à 0,02 pmol/min/μΙ.
Dans un mode de réalisation, l'invention concerne une méthode de diagnostic et/ou de pronostic telle que définie précédemment, dans laquelle l'activité de ladite protéine kinase est déterminée dans un échantillon de sang dudit sujet à l'aide d'un substrat peptidique comprenant ou consistant en :
- la séquence LPRRPSI (SEQ ID NO : 6),
et dans laquelle, à l'étape iii), ledit sujet est susceptible de présenter une maladie inflammatoire, notamment une maladie inflammatoire chronique, si l'activité de ladite protéine kinase dans l'échantillon biologique dudit sujet est inférieure à 0,04 pmol/min/μΙ, en particulier inférieure à 0,02 pmol/min/μΙ. Dans un mode de réalisation, l'invention concerne une méthode de diagnostic et/ou de pronostic telle que définie précédemment, comprenant en outre :
- une étape iv) de traitement de la maladie inflammatoire, notamment de la maladie inflammatoire chronique, avec un agent anti-inflammatoire adapté à ladite maladie inflammatoire, notamment ladite maladie inflammatoire chronique.
Dans un mode de réalisation, l'invention concerne une méthode de diagnostic et/ou de pronostic telle que définie précédemment, comprenant:
une étape i) de détermination de l'activité de ladite protéine kinase dans un échantillon biologique dudit sujet,
une étape ii) de comparaison de l'activité de ladite protéine kinase déterminée à l'étape (i) par rapport à une valeur de référence,
une étape iii) de déduction de l'état du sujet.
une étape iv) de traitement de la maladie inflammatoire, notamment de la maladie inflammatoire chronique, avec un agent anti-inflammatoire adapté à ladite maladie inflammatoire, notamment ladite maladie inflammatoire chronique
Dans un mode de réalisation, l'invention concerne une méthode de diagnostic et/ou de pronostic telle que définie précédemment, dans laquelle, à l'étape iii), ledit sujet est susceptible de présenter une maladie inflammatoire, notamment une maladie inflammatoire chronique, si l'activité de ladite protéine kinase dans l'échantillon biologique dudit sujet est inférieure par rapport à l'activité de ladite protéine kinase mesurée chez un individu sain dans les mêmes conditions, ladite étape iii) pouvant être suivie d'un traitement à l'aide d'un agent anti-inflammatoire adapté à ladite maladie inflammatoire diagnostiquée, notamment à ladite maladie inflammatoire chronique diagnosiquée.
Dans un mode de réalisation, l'invention concerne une méthode de diagnostic et/ou de pronostic telle que définie précédemment, dans laquelle, à l'étape iii), ledit sujet est susceptible de présenter une maladie inflammatoire, notamment une maladie inflammatoire chronique, si l'activité de ladite protéine kinase dans l'échantillon biologique dudit sujet est inférieure à 0,04 pmol/min/μΙ, en particulier inférieure à 0,02 pmol/min/μΙ, ladite étape iii) pouvant être suivie d'un traitement à l'aide d'un agent antiinflammatoire adapté à ladite maladie inflammatoire diagnostiquée, notamment à ladite maladie inflammatoire chronique diagnostiquée. Dans un mode de réalisation, l'invention concerne une méthode de diagnostic et/ou de pronostic telle que définie précédemment, dans laquelle, à l'étape iii), ledit sujet est susceptible de présenter une maladie inflammatoire, notamment une maladie inflammatoire chronique, si l'activité de ladite protéine kinase dans l'échantillon biologique dudit sujet est inférieure 0,04, 0,03, 0,02 ou 0,01 pmol/min/μΙ, ladite étape iii) pouvant être suivie d'un traitement à l'aide d'un agent anti-inflammatoire adapté à ladite maladie inflammatoire diagnostiquée, notamment à ladite maladie inflammatoire chronique diagnostiquée.
Dans un mode de réalisation, l'invention concerne une méthode de diagnostic et/ou de pronostic telle que définie précédemment, dans laquelle, à l'étape iii), ledit sujet est susceptible de présenter une maladie inflammatoire, notamment une maladie inflammatoire chronique, si l'activité de ladite protéine kinase dans l'échantillon biologique dudit sujet est au moins 2 fois inférieure, en particulier au moins 3 fois inférieure, plus particulièrement au moins 3,5 fois inférieure, par rapport à l'activité de ladite protéine kinase mesurée chez un individu sain dans les mêmes conditions, ladite étape iii) pouvant être suivie d'un traitement à l'aide d'un agent anti-inflammatoire adapté à ladite maladie inflammatoire diagnostiquée, notamment à ladite maladie inflammatoire chronique diagnostiquée. L'activité de ladite protéine kinase peut être mesurée par le biais de la quantité de susbtrat phosphorylé.
Une augmentation de la quantité de substrat phosphorylé indique une augmentation de l'activité de ladite protéine kinase dans l'échantillon.
Une diminution de la quantité de substrat phosphorylé indique une diminution de l'activité de ladite protéine kinase dans l'échantillon. Un troisième aspect de l'invention a pour objet une méthode d'évaluation et/ou de suivi de l'efficacité d'un traitement d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, chez un sujet comprenant :
- une étape i) de détermination de l'activité d'une protéine kinase capable de phosphoryler un substrat peptidique comprenant ou consistant en la séquence consensus
R-X1-X2-S/T-X3 (SEQ I D NO : 1), où
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, Q, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, dans un échantillon biologique dudit sujet,
- une étape ii) de comparaison de l'activité de ladite protéine kinase déterminée dans ledit échantillon biologique prélevé à différentes dates. Dans un mode de réalisation, l'invention a pour objet une méthode d'évaluation et/ou de suivi de l'efficacité d'un traitement d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, ladite maladie inflammatoire, notamment ladite maladie inflammatoire chronique étant choisie parmi les maladies inflammatoires chroniques de l'intestin y compris la maladie de Crohn et la colite ulcéreuse ou rectocolite hémorragique, les lombalgies inflammatoires chroniques, les maladies cardiovasculaires, la maladie pulmonaire obstructive chronique (M POC), et les diabètes.
Dans un mode de réalisation, l'invention a pour objet une méthode d'évaluation et/ou de suivi de l'efficacité d'un traitement des lombalgies inflammatoires chroniques chez un sujet comprenant :
- une étape i) de détermination de l'activité d'une protéine kinase capable de phosphoryler un substrat peptidique comprenant ou consistant en la séquence consensus R-X1-X2-S/T-X3 (SEQ I D NO : 1), où
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel, X3 est un acide aminé naturel choisi parmi L, F, V, I, Q, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, dans un échantillon biologique dudit sujet,
- une étape ii) de comparaison de l'activité de ladite protéine kinase déterminée dans ledit échantillon biologique prélevé à différentes dates.
Dans un mode de réalisation, l'invention a pour objet une méthode d'évaluation et/ou de suivi de l'efficacité d'un traitement d'une maladie cardiovasculaire chez un sujet comprenant :
- une étape i) de détermination de l'activité d'une protéine kinase capable de phosphoryler un substrat peptidique comprenant ou consistant en la séquence consensus R-X1-X2-S/T-X3 (SEQ ID NO : 1), où
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, Q., R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, dans un échantillon biologique dudit sujet,
- une étape ii) de comparaison de l'activité de ladite protéine kinase déterminée dans ledit échantillon biologique prélevé à différentes dates.
Dans un mode de réalisation, l'invention a pour objet une méthode d'évaluation et/ou de suivi de l'efficacité d'un traitement d'une maladie pulmonaire obstructive chronique chez un sujet comprenant :
- une étape i) de détermination de l'activité d'une protéine kinase capable de phosphoryler un substrat peptidique comprenant ou consistant en la séquence consensus R-X1-X2-S/T-X3 (SEQ ID NO : 1), où
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, O, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, dans un échantillon biologique dudit sujet, - une étape ii) de comparaison de l'activité de ladite protéine kinase déterminée dans ledit échantillon biologique prélevé à différentes dates.
Dans un mode de réalisation, l'invention a pour objet une méthode d'évaluation et/ou de suivi de l'efficacité d'un traitement du diabète chez un sujet comprenant :
- une étape i) de détermination de l'activité d'une protéine kinase capable de phosphoryler un substrat peptidique comprenant ou consistant en la séquence consensus R-X1-X2-S/T-X3 (SEQ ID NO : 1), où
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, Q, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, dans un échantillon biologique dudit sujet,
- une étape ii) de comparaison de l'activité de ladite protéine kinase déterminée dans ledit échantillon biologique prélevé à différentes dates.
Dans un mode de réalisation, l'invention a pour objet une méthode d'évaluation et/ou de suivi de l'efficacité d'un traitement d'une maladie inflammatoire chronique de l'intestin chez un sujet comprenant :
- une étape i) de détermination de l'activité d'une protéine kinase capable de phosphoryler un substrat peptidique comprenant ou consistant en la séquence consensus
R-X1-X2-S/T-X3 (SEQ ID NO : 1), où
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, O, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, dans un échantillon biologique dudit sujet,
- une étape ii) de comparaison de l'activité de ladite protéine kinase déterminée dans ledit échantillon biologique prélevé à différentes dates. Dans un mode de réalisation, l'invention concerne une méthode d'évaluation et/ou de suivi de l'efficacité d'un traitement d'une maladie inflammatoire chronique de l'intestin telle que définie précédemment, dans laquelle ladite maladie inflammatoire chronique de l'intestin est choisie parmi : la maladie de Crohn et la colite ulcéreuse.
Dans un mode de réalisation, la méthode d'évaluation et/ou de suivi de l'efficacité d'un traitement d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, telle que définie précédemment est effectuée à partir d'un échantillon biologique.
Dans un mode de réalisation, l'invention concerne une méthode d'évaluation et/ou de suivi de l'efficacité d'un traitement d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, telle que définie précédemment dans laquelle ledit échantillon biologique est un échantillon biologique extracellulaire.
Dans un mode de réalisation, l'invention concerne une méthode la méthode d'évaluation et/ou de suivi de l'efficacité d'un traitement d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, telle que définie précédemment dans laquelle ledit échantillon biologique contient ladite protéine kinase.
Dans un mode de réalisation, l'invention concerne une méthode la méthode d'évaluation et/ou de suivi de l'efficacité d'un traitement d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, telle que définie précédemment dans laquelle ladite protéine kinase est une protéine kinase extracellulaire ou un protéine kinase présente dans un échantillon biologique extracellulaire.
Dans un mode de réalisation, l'invention concerne une méthode d'évaluation et/ou de suivi de l'efficacité d'un traitement d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, telle que définie précédemment, dans laquelle ledit échantillon biologique est un échantillon de sang, de plasma ou de sérum. Dans un mode de réalisation, l'invention concerne une méthode d'évaluation et/ou de suivi de l'efficacité d'un traitement d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, telle que définie précédemment, dans laquelle à l'étape i), l'activité de ladite protéine kinase est déterminée dans un échantillon de sang dudit sujet.
Dans un mode de réalisation, l'invention concerne une méthode d'évaluation et/ou de suivi de l'efficacité d'un traitement d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, telle que définie précédemment, dans laquelle, à l'étape i), l'activité de ladite protéine kinase est déterminée à l'aide d'un substrat peptidique comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ ID NO : 1), où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, Q, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da.
Dans un mode de réalisation, l'invention concerne une méthode d'évaluation et/ou de suivi de l'efficacité d'un traitement d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, telle que définie précédemment, dans laquelle, à l'étape i), l'activité de ladite protéine kinase est déterminée à l'aide d'un substrat peptidique comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ. ID NO : 1), où :
Xi est un acide aminé de préférence R,
X2 est un acide aminé de préférence P,
X3 est un acide aminé choisi parmi L, F, V, I, O, R, M, K, H et C, de préférence choisi parmi L, F, V et I.
Dans un mode de réalisation, l'invention concerne une méthode d'évaluation et/ou de suivi de l'efficacité d'un traitement d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, telle que définie précédemment, dans laquelle, à l'étape i), l'activité de ladite protéine kinase est déterminée à l'aide d'un substrat peptidique comprenant ou consistant en la séquence consensus R-Xa-Xb- -Xi-X2-S/T-X3 (SEQ ID NO : 2),
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, 0, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, Xa et Xb sont des acides aminés naturels ou non naturels, de préférence choisis parmi P et un acide aminé en D-isomère.
Dans un mode de réalisation, l'invention concerne une méthode d'évaluation et/ou de suivi de l'efficacité d'un traitement d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, telle que définie précédemment, dans laquelle, à l'étape i), l'activité de ladite protéine kinase est déterminée à l'aide d'un substrat peptidique comprenant ou consistant en une séquence choisie parmi :
LRRASLG (SEO ID NO : 4), PRRPSLG (SEO ID NO : 5), LPRRPSI (SEO ID NO : 6), PRRASLG (SEO ID NO : 7), PRRWSLG (SEO ID NO : 8), PRRKSLG (SEO ID NO : 9), PRRLSLG (SEO ID NO : 10), PRRRSLG (SEO ID NO : 11), PRRTSLG (SEO ID NO : 12), PRRGSLG (SEO I D NO : 13), PRRESLG (SEO ID NO : 14), PRRSSLG (SEO ID NO : 15), PRRYSLG (SEO ID NO : 16), PRRHSLG (SEO ID NO : 17), PRRVSLG (SEO ID NO : 18), PRRNSLG (SEO ID NO : 19), PRRCSLG (SEO ID NO : 20), PRROSLG (SEO ID NO : 21), PRRDSLG (SEO ID NO : 22), PRRASFG (SEO ID NO : 23), PRRASVG (SEO ID NO : 24), PRRASIG (SEO ID NO : 25), PRRASMG (SEO ID NO : 26), PRRASOG (SEO ID NO : 27), PRRASNG (SEO ID NO : 28), PRRASCG (SEO ID NO : 29), RDLRRASLV (SEO ID NO : 30), RYLRRATLV(SEO ID NO : 31), RYLRRPSLG (SEO ID NO : 32), RPPRRASLG (SEO ID NO : 33), R{dY}{dL}RRASLG (où d indique la forme D-isomère d'une acide aminé) (SEO ID NO : 34), R{dY}{dL}RRPSLG (où d indique la forme D-isomère d'une acide aminé) (SEO ID NO : 35), RPPRKASLG (SEO ID NO : 36), RPPRRPSLG (SEO ID NO : 37), RPPRRPSI (SEO ID NO : 38), PRRPTI (SEO ID NO : 39) et RYLRRASLG (SEO ID NO : 40). Dans un mode de réalisation, l'invention concerne une méthode d'évaluation et/ou de suivi de l'efficacité d'un traitement d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, telle que définie précédemment, dans laquelle, à l'étape ii), ledit échantillon biologique est prélevé avant et après administration dudit traitement audit sujet. Dans un mode de réalisation, l'invention concerne une méthode d'évaluation et/ou de suivi de l'efficacité d'un traitement d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, telle que définie précédemment, comprenant en outre
- une étape iii) de déduction de l'efficacité dudit traitement d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique,
où :
le traitement est efficace, si l'activité de ladite protéine kinase augmente au cours du temps, et
le traitement n'est pas efficace, si l'activité de ladite protéine kinase stagne ou diminue au cours du temps.
Dans un mode de réalisation, l'invention concerne une méthode d'évaluation et/ou de suivi de l'efficacité d'un traitement d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, telle que définie précédemment, comprenant :
- une étape i) de détermination de l'activité de ladite protéine kinase dans un échantillon biologique dudit sujet,
- une étape ii) de comparaison de l'activité de ladite protéine kinase déterminée dans ledit échantillon biologique :
- prélevé à différentes dates après administration dudit traitement audit sujet, ou - prélevé avant et après administration dudit traitement audit sujet,
- une étape iii) de déduction de l'efficacité dudit traitement d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique.
Dans un mode de réalisation, l'invention concerne une méthode d'évaluation et/ou de suivi de l'efficacité d'un traitement d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, telle que définie précédemment, dans laquelle, à l'étape iii), ledit traitement présente un effet thérapeutique contre ladite maladie inflammatoire, notamment contre ladite maladie inflammatoire chronique, si l'activité de ladite protéine kinase a augmenté après l'administration dudit traitement audit sujet. Dans un mode de réalisation, l'invention concerne une méthode d'évaluation et/ou de suivi de l'efficacité d'un traitement d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, telle que définie précédemment, dans laquelle, à l'étape iii), ledit traitement présente un effet thérapeutique contre ladite maladie inflammatoire, notamment contre ladite maladie inflammatoire chronique, si l'activité de ladite protéine kinase a augmenté d'au moins 2 fois, en particulier d'au moins 3 fois, plus particulièrement d'au moins 3,5 fois, après l'administration dudit traitement audit sujet par rapport à l'activité de la protéine kinase A chez ledit sujet avant l'administration dudit traitement. Dans un mode de réalisation, l'invention concerne une méthode d'évaluation et/ou de suivi de l'efficacité d'un traitement d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, telle que définie précédemment, dans laquelle la concentration de ladite protéine kinase est déterminée dans ledit échantillon biologique. Un quatrième aspect de l'invention a pour objet une méthode de dosage de l'activité d'une protéine kinase capable de phosphoryler un substrat peptidique comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ. ID NO : 1), où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, Q., R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, dans un échantillon biologique, comprenant :
- une étape i) d'incubation dudit échantillon, ou de la protéine kinase issue dudit échantillon, en présence d'un substrat peptidique susceptible d'être phosphorylé par ladite protéine kinase pendant au moins 10 heures, de préférence pendant au moins 18 heures. Cette invention repose sur l'observation surprenante faite par les Inventeurs qu'il est possible de mesurer une activité PKA ou PKA-like dans un échantillon biologique tel que le sang alors que ce type de kinase est normalement une enzyme intracellulaire.
Dans un mode de réalisation, la méthode de dosage telle que définie précédemment est effectuée à partir d'un échantillon biologique, de préférence à partir du sang.
Dans un mode de réalisation, l'invention concerne une méthode de dosage telle que définie précédemment dans laquelle ledit échantillon biologique est un échantillon biologique extracellulaire.
Dans un mode de réalisation, l'invention concerne une méthode de dosage telle que définie précédemment dans laquelle ledit échantillon biologique contient ladite protéine kinase.
Dans un mode de réalisation, l'invention concerne une méthode de dosage telle que définie précédemment dans laquelle ladite protéine kinase est une protéine kinase extracellulaire ou une protéine kinase présente dans un échantillon biologique extracellulaire.
Dans un mode de réalisation, l'invention concerne une méthode de dosage telle que définie précédemment, dans laquelle ladite ladite protéine kinase étant choisie parmi la protéine kinase A et une protéine PKA-like.
Dans un mode de réalisation, l'invention concerne une méthode de dosage telle que définie précédemment, comprenant :
- une étape i) d'incubation dudit échantillon, ou de ladite protéine kinase issue dudit échantillon, en présence d'ATP et d'un substrat peptidique susceptible d'être phosphorylé par ladite protéine kinase pendant au moins 10 heures, de préférence au moins 18 heures. La détection de l'activité PKA dans un échantillon de sang est difficile. Cependant, les Inventeurs ont observé qu'une incubation prolongée de l'échantillon avec le substrat permet de révéler une activité enzymatique, même faible.
Dans un mode de réalisation particulier, l'échantillon ou la protéine kinase est incubée en présence d'ATP et d'un substrat pendant au moins 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23 ou 24 heures. Dans un mode de réalisation, l'invention concerne une méthode de dosage telle que définie précédemment, dans laquelle ledit échantillon biologique est un échantillon de sang, de plasma ou de sérum.
Dans un mode de réalisation, l'invention concerne une méthode de dosage telle que définie précédemment, dans laquelle ledit substrat peptidique comprend ou consiste en la séquence consensus R-Xi-X2-S/T-X3 (SEQ ID NO : 1), où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, Q, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da.
Dans un mode de réalisation, l'invention concerne une méthode de dosage telle que définie précédemment, dans laquelle ledit substrat peptidique comprend ou consiste en la séquence consensus R-X X2-S/T-X3 (SEQ. ID NO : 1), où :
Xi est un acide aminé de préférence R,
X2 est un acide aminé de préférence P,
X3 est un acide aminé choisi parmi L, F, V, I, O, R, M, K, H et C, de préférence choisi parmi L, F, V et I. Dans un mode de réalisation, l'invention concerne une méthode de dosage telle que définie précédemment, dans laquelle ledit substrat peptidique comprend ou consiste en la séquence consensus R-Xa-Xb-R-Xi-X2-S/T-X3 (SEQ. ID NO : 2),
Xi est un acide aminé naturel ou non naturel,
5 X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, Q, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da,
Xa et Xb sont des acides aminés naturels ou non naturels, de préférence choisis parmi P et un acide aminé en D-isomère.
10
Dans un mode de réalisation, l'invention concerne une méthode de dosage telle que définie précédemment, dans laquelle ledit substrat peptidique comprend ou consiste en une séquence choisie parmi :
LRRASLG (SEQ ID NO : 4), PRRPSLG (SEQ ID NO : 5), LPRRPSI (SEQ ID NO : 6), PRRASLG 15 (SEQ ID NO : 7), PRRWSLG (SEQ ID NO : 8), PRRKSLG (SEQ ID NO : 9), PRRLSLG (SEQ ID NO :
10), PRRRSLG (SEQ ID NO : 11), PRRTSLG (SEQ ID NO : 12), PRRGSLG (SEQ ID NO : 13), PRRESLG (SEQ ID NO : 14), PRRSSLG (SEQ ID NO : 15), PRRYSLG (SEQ ID NO : 16), PRRHSLG (SEQ ID NO : 17), PRRVSLG (SEQ ID NO : 18), PRRNSLG (SEQ ID NO : 19), PRRCSLG (SEQ ID NO : 20), PRRQSLG (SEQ ID NO : 21), PRRDSLG (SEQ ID NO : 22), PRRASFG (SEQ ID NO : 20 23), PRRASVG (SEQ ID NO : 24), PRRASIG (SEQ ID NO : 25), PRRASMG (SEQ ID NO : 26), PRRASQG (SEQ ID NO : 27), PRRASNG (SEQ ID NO : 28), PRRASCG (SEQ ID NO : 29), RDLRRASLV (SEQ ID NO : 30), RYLRRATLV(SEQ ID NO : 31), RYLRRPSLG (SEQ ID NO : 32), RPPRRASLG (SEQ ID NO : 33), R{dY}{dL}RRASLG (où d indique la forme D-isomère d'une acide aminé) (SEQ ID NO : 34), R{dY}{dL}RRPSLG (où d indique la forme D-isomère d'une 25 acide aminé) (SEQ ID NO : 35), RPPRKASLG (SEQ ID NO : 36), RPPRRPSLG (SEQ ID NO : 37), RPPRRPSI (SEQ ID NO : 38), PRRPTI (SEQ ID NO : 39) et RYLRRASLG (SEQ ID NO : 40).
Dans un mode de réalisation, l'invention concerne une méthode de dosage telle que définie précédemment, dans laquelle, à l'étape i), ledit échantillon, ou la protéine kinase 30 A issue dudit échantillon, est incubé en présence d'un substrat peptidique susceptible d'être phosphorylé par ladite protéine kinase et en présence d'au moins un inhibiteur de protéase, ledit au moins un inhibiteur de protéase étant de préférence choisi parmi le groupe comprenant: la 1,10-Phénanthroline, l'AEBSF (4-(2-Aminoethyl) benzenesulfonyl fluoride hydrochloride), l'aprotinine, la bestatine, ΓΕ-64, la leupeptine, la pepstatine A, l'EDTA, l'antipaïne dihydrochloride, la chymostatine, le phosphoramidon, le Pefabloc® SC, l'acide ε-aminocaproïque, le N-Ethylmaléimide, un inhibiteur de trypsine et l'antitrypsine alpha.
De préférence, ledit au moins un inhibiteur de protéase est la 1,10-Phénanthroline et/ou l'AEBSF (4-(2-Aminoethyl) benzenesulfonyl fluoride hydrochloride).
De manière surprenante, les Inventeurs ont constaté que certains peptides sont suffisamment stables et peuvent être utilisés pour doser l'activité de la protéine kinase dans le sérum sans ajout ou avec une quantité réduite d'inhibiteur de protéase. Par exemple, les peptides suivants peuvent être utilisés pour doser l'activité PKA ou PKA- like dans un échantillon de sérum, sans ajout ou avec peu d'inhibiteur de protéase : LPRRPSI (SEQ ID NO : 6), R{dY}{dL}RRASLG (SEQ ID NO : 34) et R{dY}{dL}RRPSLG (SEO ID NO : 35). Dans un mode de réalisation, l'invention concerne une méthode de dosage telle que définie précédemment, comprenant, préalablement à l'étape i) :
- une étape de purification ou de concentration de la protéine kinase présente dans ledit d'échantillon,
de préférence à l'aide d'au moins un anticorps reconnaissant la protéine kinase.
L'utilisation d'un anticorps spécifique anti-kinase, éventuellement couplé à une bille ou à une molécule permettant sa purification, permet d'isoler les enzymes d'intérêt de l'échantillon afin de faciliter les tests d'activité (technique dite du "pull-down").
Dans un mode de réalisation, l'invention concerne une méthode de dosage telle que définie précédemment, comprenant en outre :
- une étape ii) de détermination de l'activité de la protéine kinase dans ledit échantillon. Un autre aspect de l'invention a pour objet un kit de dosage de l'activité d'une protéine kinase, comprenant au moins un substrat susceptible d'être phosphorylé par ladite protéine kinase, ledit substrat comprenant ou consistant en la séquence consensus R-X X2-S/T-X3 (SEQ ID NO : 1), où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, Q., R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da. Dans un mode de réalisation, l'invention concerne un kit de dosage de l'activité d'une protéine kinase, comprenant au moins un substrat susceptible d'être phosphorylé par ladite protéine kinase, ledit substrat comprenant ou consistant en la séquence consensus R-X1-X2-S/T-X3 (SEQ ID NO : 1), où :
Xi est un acide aminé de préférence R,
X2 est un acide aminé de préférence P,
X3 est un acide aminé choisi parmi L, F, V, I, , R, M, K, H et C, de préférence choisi parmi L, F, V et I.
Dans un mode de réalisation, l'invention concerne un kit de dosage de l'activité d'une protéine kinase, comprenant au moins un substrat susceptible d'être phosphorylé par ladite protéine kinase, ledit substrat comprenant ou consistant en la séquence consensus R-Xa-Xb-R-Xi-X2-S/T-X3 (SEO ID NO : 2),
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, , R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da,
Xa et Xb sont des acides aminés naturels ou non naturels, de préférence choisis parmi P et un acide aminé en D-isomère. Dans un mode de réalisation, l'invention concerne un kit de dosage de l'activité d'une protéine kinase, comprenant au moins un substrat susceptible d'être phosphorylé par ladite protéine kinase, ledit substrat comprenant ou consistant en la séquence consensus R-X1-X2-S/T-X3 (SEQ ID NO : 1), où :
Xi est un acide aminé chargé positivement au pH physiologique, de préférence R ou
K.
Dans un mode de réalisation, l'invention concerne un kit de dosage de l'activité d'une protéine kinase, comprenant au moins un substrat susceptible d'être phosphorylé par ladite protéine kinase, ledit substrat comprenant ou consistant en la séquence consensus R-X1-X2-S/T-X3 (SEQ ID NO : 1), où :
X2 est P.
Dans un mode de réalisation, l'invention concerne un kit de dosage de l'activité d'une protéine kinase, comprenant au moins un substrat susceptible d'être phosphorylé par ladite protéine kinase, ledit substrat comprenant ou consistant en la séquence consensus R-X1-X2-S/T-X3 (SEQ ID NO : 1), où :
X3 est un acide aminé choisi parmi : L, F, V, I, 0, R, M, K, H et C.
Dans un mode de réalisation, l'invention concerne un kit de dosage de l'activité d'une protéine kinase, comprenant au moins un substrat susceptible d'être phosphorylé par ladite protéine kinase, ledit substrat comprenant ou consistant en la séquence consensus R-X1-X2-S/T-X3 (SEQ ID NO : 1), où :
X3 est un acide aminé choisi parmi : L, F, V et I.
Dans un mode de réalisation, l'invention concerne un kit de dosage de l'activité d'une protéine kinase, comprenant au moins un substrat susceptible d'être phosphorylé par ladite protéine kinase, ledit substrat comprenant ou consistant en la séquence consensus R-X1-X2-S/T-X3 (SEQ ID NO : 1), où :
X3 est un acide aminé choisi parmi : O, R, M, K, H et C. Dans un mode de réalisation, l'invention concerne un kit de dosage tel que défini précédemment, dans laquelle ledit substrat peptidique comprend ou consiste en une séquence choisie parmi :
LRRASLG (SEQ I D NO : 4), PRRPSLG (SEQ I D NO : 5), LPRRPSI (SEQ I D NO : 6), PRRASLG 5 (SEQ I D NO : 7), PRRWSLG (SEQ ID NO : 8), PRRKSLG (SEQ ID NO : 9), PRRLSLG (SEQ ID NO :
10), PRRRSLG (SEQ I D NO : 11), PRRTSLG (SEQ I D NO : 12), PRRGSLG (SEQ I D NO : 13), PRRESLG (SEQ ID NO : 14), PRRSSLG (SEQ I D NO : 15), PRRYSLG (SEQ I D NO : 16), PRRHSLG (SEQ I D NO : 17), PRRVSLG (SEQ I D NO : 18), PRRNSLG (SEQ I D NO : 19), PRRCSLG (SEQ I D NO : 20), PRRQSLG (SEQ I D NO : 21), PRRDSLG (SEQ I D NO : 22), PRRASFG (SEQ I D NO :
10 23), PRRASVG (SEQ I D NO : 24), PRRASIG (SEQ I D NO : 25), PRRASMG (SEQ I D NO : 26), PRRASQG (SEQ I D NO : 27), PRRASNG (SEQ I D NO : 28), PRRASCG (SEQ I D NO : 29), RDLRRASLV (SEQ I D NO : 30), RYLRRATLV(SEQ ID NO : 31), RYLRRPSLG (SEQ ID NO : 32), RPPRRASLG (SEQ I D NO : 33), R{dY}{dL}RRASLG (où d indique la forme D-isomère d'une acide aminé) (SEQ I D NO : 34), R{dY}{dL}RRPSLG (où d indique la forme D-isomère d'une
15 acide aminé) (SEQ I D NO : 35), RPPRKASLG (SEQ ID NO : 36), RPPRRPSLG (SEQ I D NO : 37), RPPRRPSI (SEQ I D NO : 38), PRRPTI (SEQ ID NO : 39) et RYLRRASLG (SEQ I D NO : 40).
Dans un mode de réalisation, l'invention concerne une kit de dosage tel que défini précédemment, dans lequel ledit substrat peptidique est différent de SEQ I D NO : 4.
0
Dans un mode de réalisation, l'invention concerne un kit de dosage tel que défini précédemment, ladite protéine kinase étant choisie parmi :
- la protéine kinase A (PKA), et
- les protéines kinases (PKA-like) capables de phosphoryler un substrat peptidique 5 comprenant ou consistant en la séquence consensus R-X1-X2-S/T-X3 (SEQ ID NO : 1), où : Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel ou non naturel de caractère hydrophobe.
30 Dans un mode de réalisation, l'invention concerne un kit de dosage tel que défini précédemment, ledit kit comprenant également de l'ATP. Dans un mode de réalisation, l'invention concerne un kit de dosage tel que défini précédemment, ledit kit comprenant également au moins un inhibiteur de protéase, de préférence choisi parmi le groupe comprenant: la 1,10-Phénanthroline, l'AEBSF (4-(2- Aminoethyl) benzenesulfonyl fluoride hydrochloride), l'aprotinine, la bestatine, ΓΕ-64, la leupeptine, la pepstatine A, l'EDTA, l'antipaïne dihydrochloride, la chymostatine, le phosphoramidon, le Pefabloc® SC, l'acide ε-aminocaproïque, le N-Ethylmaléimide, un inhibiteur de trypsine et l'antitrypsine alpha. Un autre aspect de l'invention a pour objet un kit de diagnostic d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, comprenant au moins un substrat susceptible d'être phosphorylé par une protéine kinase, ledit substrat comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ ID NO : 1), où : Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi : L, F, V, I, Q, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da. Dans un mode de réalisation, l'invention a pour objet un kit de diagnostic d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, tel que défini précédemment, dans lequel ladite maladie inflammatoire, notamment ladite maladie inflammatoire chronique, est choisie parmi les maladies inflammatoires chroniques de l'intestin y compris la maladie de Crohn et la colite ulcéreuse ou rectocolite hémorragique, les lombalgies inflammatoires chroniques, les maladies cardiovasculaires, la maladie pulmonaire obstructive chronique (MPOC), et les diabètes.
Dans un mode de réalisation, l'invention a pour objet un kit de diagnostic des lombalgies inflammatoires chroniques, comprenant au moins un substrat susceptible d'être phosphorylé par une protéine kinase, ledit substrat comprenant ou consistant en la séquence consensus R-X X2-S/T-X3 (SEQ. ID NO : 1), où : Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi : L, F, V, I, Q, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da.
Dans un mode de réalisation, l'invention a pour objet un kit de diagnostic d'une maladie cardiovasculaire, comprenant au moins un substrat susceptible d'être phosphorylé par une protéine kinase, ledit substrat comprenant ou consistant en la séquence consensus R- X1-X2-S/T-X3 (SEQ ID NO : 1), où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi : L, F, V, I, Q., R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da. Dans un mode de réalisation, l'invention a pour objet un kit de diagnostic d'une maladie pulmonaire obstructive chronique, comprenant au moins un substrat susceptible d'être phosphorylé par une protéine kinase, ledit substrat comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ. ID NO : 1), où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi : L, F, V, I, O, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da.
Dans un mode de réalisation, l'invention a pour objet un kit de diagnostic du diabète, comprenant au moins un substrat susceptible d'être phosphorylé par une protéine kinase, ledit substrat comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ ID NO : 1), où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi : L, F, V, I, O, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da. Dans un mode de réalisation, l'invention a pour objet un kit de diagnostic d'une maladie inflammatoire chronique de l'intestin, comprenant au moins un substrat susceptible d'être phosphorylé par une protéine kinase, ledit substrat comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ ID NO : 1), où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi : L, F, V, I, Q, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da.
Dans un mode de réalisation, l'invention concerne un kit de diagnostic d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, comprenant au moins un substrat susceptible d'être phosphorylé par une protéine kinase, ledit substrat comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ. ID NO : 1), où :
Xi est un acide aminé de préférence R,
X2 est un acide aminé de préférence P,
X3 est un acide aminé choisi parmi L, F, V, I, O, R, M, K, H et C, de préférence choisi parmi L, F, V et I. Dans un mode de réalisation, l'invention concerne un kit de diagnostic d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, comprenant au moins un substrat susceptible d'être phosphorylé par une protéine kinase, ledit substrat comprenant ou consistant en la séquence consensus R-Xa-Xb-R-Xi-X2-S/T-X3 (SEQ ID NO : 2),
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, O, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, Xa et Xb sont des acides aminés naturels ou non naturels, de préférence choisis parmi P et un acide aminé en D-isomère. Dans un mode de réalisation, l'invention concerne un kit de diagnostic d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, comprenant au moins un substrat susceptible d'être phosphorylé par une protéine kinase, ledit substrat comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ ID NO : 1), où :
Xi est un acide aminé chargé positivement au pH physiologique, de préférence R ou
K.
Dans un mode de réalisation, l'invention concerne un kit de diagnostic d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, comprenant au moins un substrat susceptible d'être phosphorylé par une protéine kinase, ledit substrat comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ. ID NO : 1), où :
X2 est P.
Dans un mode de réalisation, l'invention concerne un kit de diagnostic d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, comprenant au moins un substrat susceptible d'être phosphorylé par une protéine kinase, ledit substrat comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ ID NO : 1), où :
X3 est un acide aminé choisi parmi : L, F, V, I, 0, R, M, K, H et C. Dans un mode de réalisation, l'invention concerne un kit de diagnostic d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, comprenant au moins un substrat susceptible d'être phosphorylé par une protéine kinase, ledit substrat comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ ID NO : 1), où :
X3 est un acide aminé choisi parmi : L, F, V et I.
Dans un mode de réalisation, l'invention concerne un kit de diagnostic d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, comprenant au moins un substrat susceptible d'être phosphorylé par une protéine kinase, ledit substrat comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ ID NO : 1), où :
X3 est un acide aminé choisi parmi : O, R, M, K, H et C. Dans un mode de réalisation, l'invention concerne un kit de diagnostic tel que défini précédemment, dans lequel ledit substrat peptidique comprend ou consiste en une séquence choisie parmi :
LRRASLG (SEQ I D NO : 4), PRRPSLG (SEQ I D NO : 5), LPRRPSI (SEQ I D NO : 6), PRRASLG 5 (SEQ I D NO : 7), PRRWSLG (SEQ I D NO : 8), PRRKSLG (SEQ ID NO : 9), PRRLSLG (SEQ ID NO :
10), PRRRSLG (SEQ I D NO : 11), PRRTSLG (SEQ I D NO : 12), PRRGSLG (SEQ I D NO : 13), PRRESLG (SEQ ID NO : 14), PRRSSLG (SEQ I D NO : 15), PRRYSLG (SEQ I D NO : 16), PRRHSLG (SEQ I D NO : 17), PRRVSLG (SEQ I D NO : 18), PRRNSLG (SEQ I D NO : 19), PRRCSLG (SEQ I D NO : 20), PRRQSLG (SEQ I D NO : 21), PRRDSLG (SEQ I D NO : 22), PRRASFG (SEQ I D NO :
10 23), PRRASVG (SEQ I D NO : 24), PRRASIG (SEQ I D NO : 25), PRRASMG (SEQ I D NO : 26), PRRASQG (SEQ I D NO : 27), PRRASNG (SEQ I D NO : 28), PRRASCG (SEQ I D NO : 29), RDLRRASLV (SEQ I D NO : 30), RYLRRATLV(SEQ ID NO : 31), RYLRRPSLG (SEQ ID NO : 32), RPPRRASLG (SEQ I D NO : 33), R{dY}{dL}RRASLG (où d indique la forme D-isomère d'une acide aminé) (SEQ I D NO : 34), R{dY}{dL}RRPSLG (où d indique la forme D-isomère d'une
15 acide aminé) (SEQ I D NO : 35), RPPRKASLG (SEQ ID NO : 36), RPPRRPSLG (SEQ ID NO : 37), RPPRRPSI (SEQ I D NO : 38), PRRPTI (SEQ I D NO : 39) et RYLRRASLG (SEQ ID NO : 40).
Dans un mode de réalisation, l'invention concerne un kit de diagnostic tel que défini précédemment, ladite protéine kinase étant choisie parmi :
0 - la protéine kinase A (PKA), et
- les protéines kinases (PKA-like) capables de phosphoryler un substrat peptidique comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ I D NO : 1), où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
5 X3 est un acide aminé naturel choisi parmi L, F, V, I, Q, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da.
Dans un mode de réalisation, l'invention concerne un kit de diagnostic tel que défini précédemment, dans lequel ledit substrat peptidique est différent de SEQ I D NO : 4.
30 Dans un mode de réalisation, l'invention concerne un kit de diagnostic tel que défini précédemment, ledit kit comprenant également de ΓΑΤΡ.
Dans un mode de réalisation, l'invention concerne un kit de diagnostic tel que défini précédemment, ledit kit comprenant également au moins un inhibiteur de protéase, de préférence choisi parmi le groupe comprenant: la 1,10-Phénanthroline, l'AEBSF (4-(2- Aminoethyl) benzenesulfonyl fluoride hydrochloride), l'aprotinine, la bestatine, l'E-64, la leupeptine, la pepstatine A, l'EDTA, l'antipaïne dihydrochloride, la chymostatine, le phosphoramidon, le Pefabloc® SC, l'acide ε-aminocaproïque, le N-Ethylmaléimide, un inhibiteur de trypsine et l'antitrypsine alpha.
Un autre aspect de l'invention a pour objet l'utilisation d'un peptide comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ ID NO : 1), où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, Q, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, pour le diagnostic in vitro d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, à partir d'un échantillon biologique d'un patient.
Dans un mode de réalisation, l'invention a pour objet l'utilisation d'un peptide telle que définie précédemment, dans laquelle, ladite maladie inflammatoire, notamment ladite maladie inflammatoire chronique, est choisie parmi les maladies inflammatoires chroniques de l'intestin y compris la maladie de Crohn et la colite ulcéreuse ou rectocolite hémorragique, les lombalgies inflammatoires chroniques, les maladies cardiovasculaires, la maladie pulmonaire obstructive chronique (MPOC), et les diabètes.
Dans un mode de réalisation, l'invention a pour objet l'utilisation d'un peptide comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ. ID NO : 1), où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel, X3 est un acide aminé naturel choisi parmi L, F, V, I, Q, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, pour le diagnostic in vitro des lombalgies inflammatoires chroniques à partir d'un échantillon biologique d'un patient.
Dans un mode de réalisation, l'invention a pour objet l'utilisation d'un peptide comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ. ID NO : 1), où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, O, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, pour le diagnostic in vitro d'une maladie cardiovasculaire à partir d'un échantillon biologique d'un patient. Dans un mode de réalisation, l'invention a pour objet l'utilisation d'un peptide comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ ID NO : 1), où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, O, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, pour le diagnostic in vitro d'une maladie pulmonaire obstructive chronique à partir d'un échantillon biologique d'un patient.
Dans un mode de réalisation, l'invention a pour objet l'utilisation d'un peptide comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ ID NO : 1), où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, O, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, pour le diagnostic in vitro d'un diabète à partir d'un échantillon biologique d'un patient. Dans un mode de réalisation, l'invention a pour objet l'utilisation d'un peptide comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ ID NO : 1), où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, Q, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, pour le diagnostic in vitro d'une maladie inflammatoire chronique de l'intestin (MICI) à partir d'un échantillon biologique d'un patient. Dans un mode de réalisation, l'invention concerne l'utilisation d'un peptide comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ. ID NO : 1), où :
Xi est un acide aminé de préférence R,
X2 est un acide aminé de préférence P,
X3 est un acide aminé choisi parmi L, F, V, I, O, R, M, K, H et C, de préférence choisi parmi L, F, V et I,
pour le diagnostic in vitro d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, à partir d'un échantillon biologique d'un patient.
Dans un mode de réalisation, l'invention concerne l'utilisation d'un peptide comprenant ou consistant en la séquence consensus R-Xa-Xb-R-Xi-X2-S/T-X3 (SEQ ID NO : 2),
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, O, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, Xa et Xb sont des acides aminés naturels ou non naturels, de préférence choisis parmi P et un acide aminé en D-isomère,
pour le diagnostic in vitro d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, à partir d'un échantillon biologique d'un patient. Dans un mode de réalisation, l'invention concerne l'utilisation d'un peptide comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ ID NO : 1), où : Xi est un acide aminé chargé positivement au pH physiologique, de préférence R ou
K,
pour le diagnostic in vitro d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, à partir d'un échantillon biologique d'un patient.
Dans un mode de réalisation, l'invention concerne l'utilisation d'un peptide comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ ID NO : 1), où :
X2 est P,
pour le diagnostic in vitro d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, à partir d'un échantillon biologique d'un patient.
Dans un mode de réalisation, l'invention concerne l'utilisation d'un peptide comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ. ID NO : 1), où :
X3 est un acide aminé choisi parmi : L, F, V, I, 0, R, M, K, H et C,
pour le diagnostic in vitro d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, à partir d'un échantillon biologique d'un patient.
Dans un mode de réalisation, l'invention concerne l'utilisation d'un peptide comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ ID NO : 1), où :
X3 est un acide aminé choisi parmi : L, F, V et I,
pour le diagnostic in vitro d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, à partir d'un échantillon biologique d'un patient.
Dans un mode de réalisation, l'invention concerne l'utilisation d'un peptide comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ ID NO : 1), où :
X3 est un acide aminé choisi parmi : O, R, M, K, H et C,
pour le diagnostic in vitro d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, à partir d'un échantillon biologique d'un patient. Dans un mode de réalisation, l'invention concerne l'utilisation d'un peptide comprenant ou consistant en une séquence peptidique choisie parmi : LRRASLG (SEQ ID NO : 4), PRRPSLG (SEQ ID NO : 5), LPRRPSI (SEQ ID NO : 6), PRRASLG (SEQ ID NO : 7), PRRWSLG (SEQ ID NO : 8), PRRKSLG (SEQ ID NO : 9), PRRLSLG (SEQ ID NO : 10), PRRRSLG (SEQ ID NO : 11), PRRTSLG (SEQ ID NO : 12), PRRGSLG (SEQ ID NO : 13), PRRESLG (SEQ ID NO : 14), PRRSSLG (SEQ ID NO : 15), PRRYSLG (SEQ ID NO : 16), PRRHSLG (SEQ ID NO : 17), PRRVSLG (SEQ ID NO : 18), PRRNSLG (SEQ ID NO : 19), PRRCSLG (SEQ ID NO : 20), PRRQSLG (SEQ ID NO : 21), PRRDSLG (SEQ ID NO : 22), PRRASFG (SEQ ID NO : 23), PRRASVG (SEQ ID NO : 24), PRRASIG (SEQ ID NO : 25), PRRASMG (SEQ ID NO : 26), PRRASQG (SEQ ID NO : 27), PRRASNG (SEQ ID NO : 28), PRRASCG (SEQ ID NO : 29), RDLRRASLV (SEQ ID NO : 30), RYLRRATLV(SEQ ID NO : 31), RYLRRPSLG (SEQ ID NO : 32), RPPRRASLG (SEQ ID NO : 33), R{dY}{dL}RRASLG (où d indique la forme D-isomère d'une acide aminé) (SEQ. ID NO : 34), R{dY}{dL}RRPSLG (où d indique la forme D-isomère d'une acide aminé) (SEQ ID NO : 35), RPPRKASLG (SEQ ID NO : 36), RPPRRPSLG (SEQ ID NO : 37), RPPRRPSI (SEQ ID NO : 38), PRRPTI (SEQ ID NO : 39) et RYLRRASLG (SEQ ID NO : 40), pour le diagnostic in vitro d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique à partir d'un échantillon biologique d'un patient.
Dans un mode de réalisation, l'utilisation d'un peptide telle que définie précédemment est effectuée à partir d'un échantillon biologique de préférence, à partir du sang. Dans un mode de réalisation, l'invention concerne l'utilisation d'un peptide telle que définie précédemment dans laquelle ledit échantillon biologique est un échantillon biologique extracellulaire.
Dans un mode de réalisation, l'invention concerne l'utilisation d'un peptide telle que définie précédemment dans laquelle ledit échantillon biologique contient ladite protéine kinase.
Dans un mode de réalisation, l'invention concerne l'utilisation d'un peptide telle que définie précédemment dans laquelle ladite protéine kinase est une protéine kinase extracellulaire ou une protéine kinase présente dans un échantillon biologique extracellulaire. Un autre aspect de l'invention a pour objet un peptide comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ ID NO : 1), où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, Q, R, M, K, H et C ou d'un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da.
Dans un mode de réalisation, l'invention concerne un peptide comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ. ID NO : 1), où :
Xi est un acide aminé de préférence R,
X2 est un acide aminé de préférence P,
X3 est choisi parmi L, F, V, I, O, R, M, K, H et C.
Dans un mode de réalisation, l'invention concerne un peptide comprenant ou consistant en la séquence consensus R-Xa-Xb-R-Xi-X2-S/T-X3 (SEQ ID NO : 2), où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, O, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, Xa et Xb sont des acides aminés naturels ou non naturels, de préférence choisis parmi P et un acide aminé en D-isomère.
Dans un mode de réalisation, l'invention concerne un peptide comprenant ou consistant en une séquence peptidique choisie parmi :
PRRPSLG (SEQ ID NO : 5), LPRRPSI (SEQ ID NO : 6), PRRASLG (SEQ ID NO : 7), PRRWSLG (SEQ ID NO : 8), PRRKSLG (SEQ ID NO : 9), PRRLSLG (SEQ ID NO : 10), PRRRSLG (SEQ ID NO : 11), PRRTSLG (SEQ ID NO : 12), PRRGSLG (SEQ ID NO : 13), PRRESLG (SEQ ID NO : 14), PRRSSLG (SEQ ID NO : 15), PRRYSLG (SEQ ID NO : 16), PRRHSLG (SEQ ID NO : 17), PRRVSLG (SEQ ID NO : 18), PRRNSLG (SEQ ID NO : 19), PRRCSLG (SEQ ID NO : 20), PRRQSLG (SEQ ID NO : 21), PRRDSLG (SEQ ID NO : 22), PRRASFG (SEQ ID NO : 23), PRRASVG (SEQ ID NO : 24), PRRASIG (SEQ ID NO : 25), PRRASMG (SEQ ID NO : 26), PRRASQG (SEQ ID NO : 27), PRRASNG (SEQ ID NO : 28), PRRASCG (SEQ ID NO : 29), RDLRRASLV (SEQ ID NO : 30), RYLRRATLV(SEQ ID NO : 31), RYLRRPSLG (SEQ ID NO : 32), RPPRRASLG (SEQ ID NO : 33), R{dY}{dL}RRASLG (où d indique la forme D-isomère d'une acide aminé) (SEQ ID NO : 34), R{dY}{dL}RRPSLG (où d indique la forme D-isomère d'une acide aminé) (SEQ ID NO : 35), RPPRKASLG (SEQ ID NO : 36), RPPRRPSLG (SEQ ID NO : 37), RPPRRPSI (SEQ ID NO : 38), PRRPTI (SEQ ID NO : 39) et RYLRRASLG (SEQ ID NO : 40).
Dans un mode de réalisation, l'invention concerne un peptide tel que défini ci-dessus, ledit peptide étant différent de SEQ ID NO : 4.
Les peptides de l'invention peuvent être produits selon les différentes techniques connues de l'homme du métier, comme par exemple par l'expression dans une cellule eucaryote ou procaryote, ou par synthèse chimique. Un autre aspect de l'invention a pour objet l'utilisation d'un peptide comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ ID NO : 1), où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, O, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, en tant que substrat d'une protéine kinase, en particulier en tant que substrat de la protéine kinase A et/ou d'une protéine kinase A-like.
Dans un mode de réalisation, l'invention concerne l'utilisation d'un peptide comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ ID NO : 1), où :
Xi est un acide aminé de préférence R,
X2 est un acide aminé de préférence P,
X3 est choisi parmi L, F, V, I, O, R, M, K, H et C, de préférence choisi parmi L, F, V et I, en tant que substrat d'une protéine kinase, en particulier en tant que substrat de la protéine kinase A et/ou d'une protéine kinase A-like. Dans un mode de réalisation, l'invention concerne l'utilisation d'un peptide comprenant ou consistant en la séquence consensus R-Xa-Xb-R-Xi-X2-S/T-X3 (SEQ. ID NO : 2), où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, 0, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da,
Xa et Xb sont des acides aminés naturels ou non naturels, de préférence choisis parmi P et un acide aminé en D-isomère,
en tant que substrat d'une protéine kinase, en particulier en tant que substrat de la protéine kinase A et/ou d'une protéine kinase A-like.
Dans un mode de réalisation, l'invention concerne l'utilisation d'un peptide comprenant ou consistant en une séquence peptidique choisie parmi :
PRRPSLG (SEQ ID NO : 5), LPRRPSI (SEQ ID NO : 6), PRRASLG (SEQ ID NO : 7), PRRWSLG (SEQ ID NO : 8), PRRKSLG (SEQ ID NO : 9), PRRLSLG (SEQ ID NO : 10), PRRRSLG (SEQ ID NO : 11), PRRTSLG (SEQ ID NO : 12), PRRGSLG (SEQ ID NO : 13), PRRESLG (SEQ ID NO : 14), PRRSSLG (SEQ ID NO : 15), PRRYSLG (SEQ ID NO : 16), PRRHSLG (SEQ ID NO : 17), PRRVSLG (SEQ ID NO : 18), PRRNSLG (SEQ ID NO : 19), PRRCSLG (SEQ ID NO : 20), PRRQSLG (SEQ ID NO : 21), PRRDSLG (SEQ ID NO : 22), PRRASFG (SEQ ID NO : 23), PRRASVG (SEQ ID NO : 24), PRRASIG (SEQ ID NO : 25), PRRASMG (SEQ ID NO : 26), PRRASQG (SEQ ID NO : 27), PRRASNG (SEQ ID NO : 28), PRRASCG (SEQ ID NO : 29), RDLRRASLV (SEQ ID NO : 30), RYLRRATLV(SEQ ID NO : 31), RYLRRPSLG (SEQ ID NO : 32), RPPRRASLG (SEQ ID NO : 33), R{dY}{dL}RRASLG (où d indique la forme D-isomère d'une acide aminé) (SEQ ID NO : 34), R{dY}{dL}RRPSLG (où d indique la forme D-isomère d'une acide aminé) (SEQ ID NO : 35), RPPRKASLG (SEQ ID NO : 36), RPPRRPSLG (SEQ ID NO : 37), RPPRRPSI (SEQ ID NO : 38), PRRPTI (SEQ ID NO : 39) et RYLRRASLG (SEQ ID NO : 40), en tant que substrat d'une protéine kinase, en particulier en tant que substrat de la protéine kinase A et/ou d'une protéine kinase A-like. Dans un mode de réalisation, l'invention concerne l'utilisation d'un peptide tel que définie ci-dessus, ledit peptide étant différent de SEQ ID NO : 4. Les figures et les exemples suivants illustreront mieux l'invention, sans pour autant en limiter sa portée.
LEGENDES DES FIGURES
Fifiure 1. Courbe standard du test de mesure de l'activité kinase.
L'axe des abscisses indique la quantité de kinase recombinante (en ng) et l'axe des ordonnées indique la quantité de peptide substrat fluorescent (SEQ ID NO : 5) phosphorylé (en pmol/min).
Les résultats ont été obtenus avec une enzyme recombinante. A partir de ces données, il est possible de déterminer l'activité kinase spécifique dans un échantillon vis-à-vis du peptide substrat. Dans les conditions testées (37°C), l'activité est de 3,5 ± 0,12 pmol/min/ng (R2 = 0,99).
Fifiure 2. Analyse de la cohorte italienne avec le test d'activité : patients souffrant d'une maladie inflammatoire chronique de l'intestin (M ICI) versus individus sains.
Les résultats du test d'activité pour chaque population sont présentés sous la forme d'un diagramme de dispersion (médiane et intervalle interquartile). Le peptide substrat fluorescent est SEQ ID NO : 5. (Voir les détails en exemple II)
Fifiure 3. Analyse ROC de la cohorte italienne : patients souffrant d'une maladie inflammatoire chronique de l'intestin (MICI) versus individus sains.
La courbe a été obtenue à partir des résultats présentés dans la figure 2. L'axe des abscisses indique la spécificité (en %) et l'axe des ordonnées indique la sensibilité (en %).
Figure 4. Analyse ROC de la cohorte américaine : patients souffrant d'une maladie inflammatoire chronique de l'intestin (MICI) versus individus sains.
L'axe des abscisses indique la spécificité (en %) et l'axe des ordonnées indique la sensibilité (en %). Le peptide substrat fluorescent est SEQ ID NO : 5.
Figure 5. Concentrations sériques en enzyme active pour les patients souffrant d'une maladie inflammatoire chronique de l'intestin (MICI) versus les individus sains.
Les individus de la cohorte italienne sont nommés CMl et ceux de la cohorte américaine CM2. Les témoins correspondent aux individus sains de chaque centre. L'axe des ordonnées indique la concentration en enzyme active (ng.mr1). L'activité spécifique est mesurée avec le peptide substrat fluorescent (SEQ ID NO : 5)
Fifiure 6. Distribution des fréquences relatives d'activité observées dans la cohorte italienne (A) et la cohorte américaine (B).
L'axe des abscisess indique la quantité de produit phosphorylé (en %) et l'axe des ordonnées indique la fréquence relative (en % de la valeur totale de produit phosphorylé). La courbe grise (inverse Gaussienne) correspond aux patients souffrant de MICI (MC ou CU). La courbe noire correspond aux individus sains (Gaussienne). Le peptide substrat fluorescent est SEQ ID NO : 5.
Fifiure 7. Evaluation de la sensibilité du test d'activité de l'invention par comparaison avec d'autres tests sérolo iques.
L'axe des ordonnées indique la quantité relative de protéine mésurée avec chacun des tests sérologiques.
Abréviations : Hs CRP (High sensitivity C-reactive protein); PSA (Prostate Spécifie Antigen); CK (Créatine Kinase); PKA (activité mesurée avec le peptide fluorescent SEQ ID NO: 5).
Fifiure 8. Activité relative d'une PKA recombinante en fonction de substrats peptidiques VDPRRASXgG (SEQ ID NO : 41) portant un acide aminé différent en position X¾.
L'activité (en % de substrat phosphorylé) est indiquée en fonction de la masse moléculaire (en Da) de l'acide aminé en position X3. Les cercles représentent des acides aminés hydrophobes ou non polaires et les carrés représentent des acides aminés polaires ou chargés positivement. Chaque groupe est distribué selon une courbe de Gauss produisant une activité maximale à 145,1 ± 23,4 Da (R2 = 0.92) pour les acides aminés hydrophobes ou non polaires et 149,2 ± 19.31 Da (R2 = 0.93) pour les acides aminés polaires ou chargés positivement.
Figure 9 : Activité carboxypeptidase N/B dans les sérums des patients souffrant de d'une maladie inflammatoire chronique de l'intestin (MICI) versus les sérums d'individus sains. Les sérums ont été incubés avec le peptide substrat fluorescent SEQ. I D NO : 62 pour détecter l'activité carboxypeptidase N/B aboutissant à la suppression de l'arginine en C- terminal. (A). L'activité carboxypeptidase est représentée en % de produit (% de substrat décarboxylé) en indiquant la moyenne ± la déviation standard pour les individus sains (48,0 ± 9,0; n = 379) et les patients souffra nt d'I BD (47,0 ± 8,9; n = 367). Le test statistique non apparié de Mann Whitney indique que les deux populations ne sont pas significativement différentes (P = 0,1). (B) L'analyse ROC des données présentées en (A) indique que les deux populations ont une distribution similaire concernant l'activité carboxypeptidase (ROC AUC = 0,53 ± 0,02; P = 0,1).
Fifiure 10 : Analyse de une cohorte des patients souffrant de lombalfiies inflammatoires chroniques (avec cLBP, chrome Low back Pain) versus d'individus sains (sans cLBP).
(i) L'activité de la protéine kinase est représentée en % de produit formé (= % substrat phosphorylé) pour chaque échantillon testé et la moyenne ± la déviation standard est donnée pour les individus sains (56.6 ± 20,2; n = 407) et pour les patients souffrant de lombalgies inflammatoires chroniques (44.8 ± 16,0; n = 450). Le test statistique non apparié de Mann Whitney indique que les deux populations sont significativement différentes (P < 0.0001). (ii) L'analyse de la distribution des fréquences montre des distributions différentes pour les deux types de populations concernant les valeurs d'activité kinase. (iii) L'analyse ROC des données présentées en (i) indique que les deux populations ont une distribution différente (ROC AUC = 0,7 ± 0,1; P < 0,0001). Le peptide substrat fluorescent est SEO I D NO : 5.
Fifiure 11 : Activité carboxypeptidase N/B dans les sérums de patients souffrant de lombalfiies inflammatoires chroniques (avec cLBP, chrome Low Back Pain) versus d'individus sains (sans cLBP).
Les sérums ont été incubés avec le peptide substrat fluorescent SEO I D NO : 62 pour détecter l'activité carboxypeptidase N/B aboutissant à la suppression de l'arginine en C- terminal. (i) L'activité carboxypeptidase est représentée en % de produit formé (% substrat décarboxylé) pour chaque échantillon testé et la moyenne ± la déviation standard est donnée pour les individus sains (57,4 ± 9.6; n = 407) et pour les patients souffrant de lombalgies inflammatoires chroniques (58,5 ± 8,9; n = 450). Le test statistique non apparié de Mann Whitney indique que les deux populations ne sont pas significativement différentes (P < 0,12). (ii) L'analyse de la distribution des fréquences montre des distributions similaires pour les deux types de populations concernant les valeurs d'activité carboxypeptidase. (iii) L'analyse ROC des données présentées en (i) indique que les deux populations ont une distribution similaire (ROC AUC = 0,53 ± 0,02; P = 0,1).
Figure 12: Analyses des cohortes des patients souffrant de maladie pulmonaire obstructive chronique (MPOC), de maladies cardiovasculaires (MCV) ou de diabète versus d'individus sains.
L'activité kinase est représentée en % de produit formé (% substrat total phosphorylé) pour chaque échantillon testé (Le peptide substrat fluorescent est SEO ID NO : 5). Cette activité est présentée sur un diagramme du type boîte à moustache (avec 10-90 percentile). Pour chaque échantillon, le nombre d'échantillons (n), la moyenne avec écart-type, et la valeur p sont indiqués: maladie pulmonaire obstructive chronique ou MPOC (n =15, 46 ± 13, p < 0.01) , maladie cardiovasculaire ou MVD (n = 34, 45 ± 16, p <0.001), diabète (n = 100, 47 ± 18, p <0.0001), témoin (57 ± 20, n = 449). Les astérisques représentent le niveau de signification des test t pour une série non appariée.
Figure 13: Inhibition de l'activité de la protéine kinase A ou A-like par le PKI
A. Analyse sur gel. Les réactions dans les puits 1 à 9 ont été réalisées avec du sérum et les réactions dans les puits 10 et 11 ont été réalisées avec la protéine kinase A recombinante (rPKA). Les résultats montrent que la phosphorylation des sérums par la protéine kinase induit une modification de la mobilité du peptide substrat (A2) de la PKA, (SEQ ID NO : 5), présent dans le sérum, équivalente à celle produite par la protéine kinase A recombinante (rPKA) dans le puit 10. Cette modification de la mobilité du peptide (A2) (SEQ ID NO : 5) est dépendante de l'ATP (puits 2 et 3), est inhibée par la PKI (puits 4) et la staurosporine (ST) (puits 5). La modification est réversible lorsque l'incubation se fait en présence de phosphatase (puit 9). B. Analyse microfluidique: Dans ce cas, la séparation est effectuée dans des microcapillaires, et les pics du substrat (S) et du produit phosphorylé (P) sont détectés et quantifiés par fluorescence induite par un laser. Dans cet exemple, les réactions sont effectuées en présence ou en absence de sérums et d'inhibiteurs de la protéine kinase PKI et PKC. Le peptide substrat fluorescent est SEQ ID NO : 5. Les résultats sont les suivants:
(i) PIC S: sans le sérum; Pic P: avec le sérum. La modification de la mobilité électrophorétique vue avec le produit phosphorylé est due à l'ajout de charge négative suite à la phosphorylation (ajout d'un phosphate).
(ii) Pic S: avec le sérum plus PKI; Pic P: avec le sérum plus PKC. Une modification de la mobilité électrophorétique est observée en présence de l'inhibiteur PKC mais pas en présence de l'inhibiteur PKI. Cela montre que l'activité protéine kinase dans le sérum est sensible de l'inhibition par PKI.
Fifiure 14: Purification de la protéine kinase A ou A-like du sérum
La protéine a été purifiée avec l'inhibiteur PKI immobilisée sur une colonne streptavidine- biotine. (A) Séquence du peptide inhibiteur biotine-aminohexanoic-protéine kinase A. (B) Résumé schématique des trois étapes de la purification. L : chargement ; F : lavage ; E : élution. La colonne a été pré-incubée avec 300 nmol de biotine-PKI/ml streptavadine- sepharose. Le sérum a été dilué avec un tampon de réaction pour kinase (concentration finale : 50 mM Tris.HCI, pH 7.5; 5 mM MgCI2 supplémenté avec des inhibiteurs de protéases, 2.5 mM phénanthroline; 0.5 mM AEBSF), chargé sur la colonne et lavé dans le même tampon en présence de 250 μΜ d'ATP. L'élution a été réalisée dans le tampon de réaction pour kinase en absence d'ATP, sans inhibiteurs de protease, et en présence de 500 nM de NaCI + 10 mM imadazole. (C) Inhibition de l'activité PKA sérique par la biotine- PKI (IC50= 90nM). (D) Détection de l'activité PKA dans les fractions d'élutions. Le rendement est de 46% des protéines totales chargées
Fifiure 15: Comparaison des cohortes contrôles
Les résultats du test d'activité pour deux cohortes contrôles indépendantes sont présentés sous la forme d'un diagramme de dispersion (médiane et intervalle interquartile). Le peptide substrat fluorescent est SEQ. ID NO : 5. Les individus sont également analysés par leur sexe (homme, femmes). Le détail des résultats est présenté dans le tableau 5 voir exemple X.
EXEMPLES Matériels et Méthodes
Peptides: Les peptides utilisés pour mesurer l'activité de la protéine kinase A et/ou des protéines kinases A-like ont été déterminés à partir de la séquence consensus R~3-Xi~2-X2 _1- S°/T°-X3+1 (SEQ I D NO : 1), où Xi est un acide aminé naturel ou non naturel, de préférence R, et X2 est un acide aminé naturel ou non naturel, de préférence P (la numérotation indiquant la position par rapport à l'acide aminé phosphorylé (S0 ou T°) par la PKA ou la PKA-like). L'utilisation de l'acide aminé P en position X2 confère une meilleure résistance aux protéases sériques.
Les peptides peuvent être prolongés à partir de SEQ I D NO : 1 en ajoutant des acides aminés supplémentaires en C-ter et/ou N-ter sans altérer les propriétés de ces peptides comme substrats des kinases PKA ou PKA-like. Pa r exemple, dans les peptides testés dans les tableaux 2 et 3, la séquence SEQ ID NO : 1 est précédée de 3 acides aminés VDP et prolongée d'un acide aminé G.
Les substrats PRRPSLG (SEQ I D NO: 5) et R{dY}{dL}RRPSLG (SEQ I D NO : 35) sont préférés dans nos tests d'activité car ils possèdent une meilleure résistance aux protéases sériques durant des incubations prolongées et, par conséquent, leur utilisation nécessite moins d'inhibiteurs de protéases, lesquels sont susceptibles de réduire l'activité PKA ou PKA- like.
Echantillons: Des échantillons de sérum ont été reçus de centres cliniques différents pour les cohortes des patients diagnostiqués cliniquement comme souffrant de M ICI (Maladie de Crohn ou Colite ulcéreuse), de lombalgies inflammatoires chroniques, de la maladie pulmonaire obstructive chronique (M POC), de maladies cariovasculaires (MCV) ou de diabète. Des échantillons provenant d'individus sains ont égalament été obtenus de deux centres Italiens indépendants (Cl et C2) et d'un centre Américan (utilisé uniquement pour comparer la cohorte Américaine de M ICI), démographiquement en correspondance vis-à- vis de l'âge et du sexe avec les patients. Les valeurs obtenues avec les deux cohortes contrôles, Cl et C2, sont quaisiment identiques, permettant leur ultilisation pour contrôler les autres maladies inflammatoires après correspondance démographique (voir la figure 15).
Tous les échantillons de sérum ont été collectés dans des tubes contenant du gel pour éviter une contamination par les cellules sanguines. Des échantillons de sérum contrôle ont été obtenus à partir d'individus sains en utilisa nt le même protocole. Les échantillons ont été conservés à -40°C avant les analyses. Des analyses de contrôle de la qualité ont été effectuées pour vérifier la qualité des échantillons (notamment la mesure de l'activité carboxypeptidase). Les échantillons ont ainsi montré moins de 15% de perte d'activité après 32 cycles de congélation-décongélation.
La protéine kinase A recombinante (PKA): La PKA recombinante pure a été obtenue à partir de la surexpression et de la purification à plus de 95% d'homogénéité de la sous- unité catalytique de PKA a (PRKACA; SEQ. I D: 60 - obtenue chez UniProtKB - P17612 (KAPCA_HUMAN)). La purification, facilitée par l'expression de PRKACA sous la forme d'une protéine fusionnée avec une étiquette poly-histidine (6x HIS) à son extrémité N- terminale dans les cellules Escherichia coli BL21 (DE3), a été effectuée grâce à l'affinité du métal immobilisé sur des colonnes d'aga rose Ni-NTA. L'enzyme recom binante a été éluée avec 200 m M d'imidazole avant d'être déssalée da ns du tampon (50 m M de Tris.HCI, pH 7,5, 10 mM de MgCI2, 40% de glycérol) puis stockée à -20°C avant utilisation.
Test d'activité kinase : Les peptides fluorescents ont été synthétisés par addition d'un groupement carboxyfluorescéine (FAM) en N-terminal via un spacer acide aminohexanoïque (ahx) et par formation d'un amide en C-terminal (e.g. FAM-ahx- peptide-CONH2). Les peptides lyophilisés ont été dissouts à une concentration de 2m M dans de l'eau stérile, doublement distillée. De manière générale, 10 μΜ de peptide substrats fluorescents ont été incubus avec 3 μΙ de sérum dans un tampon de réaction pour kinase (concentration finale : 50 mM Tris.HCI, pH 7.5; 5 mM MgCI2) supplémenté avec des inhibiteurs de protéase (2.5 mM phéna nthroline; 0.5 mM AEBSF) et 0.25 mM de cofacteur adénosine triphosphate (ATP). Ces conditions générales représentent un juste milieu entre l'économie de réactifs pour du screening à grande échelle et la mesure efficace de l'activité kinase (la concentration de peptide utilisé est sensiblement égale à la valeur du Km de la réaction). Néanmoins, des concentrations (plus fortes ou faibles) de peptide, de sérum ou de cofacteur peuvent être utilisées en ajustant le temps d'incubation et en déterminant le nombre de moles de produit de phosphorylation/minute/mg de sérum.
Les mélanges réactionnels ont été préparés à l'aide d'un système 96-well benchtop pipettor (Sorenson Bioscience, I nc) dans des plaques noire de microtitatrion 384 puits et incubés à 37°C pendant 18 heures avant de stopper la réaction en ajoutant de l'EDTA à une concentration finale de 50 mM . Les mélanges réactionnels ont ensuite été anlysés par électrophorèse en conditions non-dénaturantes à ha ut voltage (2000V à une pression de 1.5 psi) dans des canaux microfluidiques en utilisant un LabChip® EZReader (Perkin Elmer).
Les peptides phosphorylés et non-phosphorylés ont été séparés par modification de la mobilité électrophorétique dûe à la charge avant la détection et la quantification de la fluorescence induite par laser (excitation à 470 nm, émission 530 nm) (voir la figure 13B, analyse microfluidique).
Pour les tests concernant l'inhibition de l'activité kinase, les inhibiteurs PKI, PKC ou staurosporine (ST) ont été ajoutés à une concentration finale de 1 μΜ . La détection d'une potentielle phosphorylation (ou de son inhibition) est effectuée par observation d'un décalage de mobilité des protéines phosphorylées après électrophorèse sur un gel natif d'agarose (2%) et visualisation par fluorescence UV.
Analyse des données : La formation du produit de phosphorylation est exprimée d'a bord en : % de produit = aire du pic du produit / (aire du pic du produit et du substrat), puis est convertie en concentration en m ultipliant la concentration initiale de substrat par le % de produit (par exemple : 10 μΜ peptide substrat fluorescent SEQ. I D NO : 5 (A2) x (% produit/100)). Les paramètres statistiques des comparaisons contrôles/patients maladies ont été calculés en utilisant le logiciel Graphpad Prism 6 (Graphpad Software I nc.): la fréquence de distribution a été réalisée pour définir une distribution gaussienne en log par opposition à une distribution gaussienne normale, et donc distincte. Un test-t a été réalisé en utilisant la méthode Mann-Whitney pour analyser les différences statistiquement significatives des médianes respectives ± 95% Cl.
La sensibilité et la spécificité des mesures à l'aide des peptides pour distinguer les patients malades des contrôles sains ont été déterminées par des analyses ROC (Receiver Operator Characteristic) et le résultat a été rapporté en tant qu'aire sous la courbe (AUC, Area Under the Curve).
Les valeurs d'activité PKA des sérums ont été comparées, et les concentrations d'enzyme active (ng/ml) ont été extrapolées à partir de courbes standard réalisées par dilution d'une PKA recombinante active dans du sérum inactivé par chauffage et l'activité étant mesurée comme décrit plus haut.
Test de contrôle de l'activité carboxypeptidase : L'activité carboxypeptidase dans le sérum a été mesurée à l'aide d'un peptide fluorescent (FAM-ahx-RHRSDSSR"C00H SEO ID NO : 62). En conditions de réaction standard, 2 μΙ de sérum sont incubés avec 10 μΜ de ce peptide fluorescent dans un tampon de réaction carboxypeptidase 50 mM Tris-HCI (pH 8), 5 mM MgCI2, pendant 2 heures à 25°C. L'activité carboxypeptidase reste stable à cette température (>12 heures) mais est moins stable à 37°C. De manière additionnelle, l'activité totale nécessite une prédilution du sérum dans le tampon de réaction carboxypeptidase avant l'ajout du substrat. Les réactions sont réalisées dans des plaques 384 puits et achevées par addition de 10 mM de phénanthroline. Les mélanges réactionnels ont ensuite été analysés par électrophorèse en conditions non-dénaturantes à haut voltage (2500V à une pression de 1.8 psi) dans des canaux microfluidiques en utilisant un LabChip® EZReader (Perkin Elmer).
Les peptides décarboxylés ont été séparés des peptides substrats n'ayant pas réagi, sur la base de leur différence de charge. En effet, la réaction de décarboxylation retire un acide aminé basique en C-terminal, ici l'arginine, modifiant la charge de +1 à 0. Les peptides ont été séparés par modification de la mobilité électrophorétique liée à la charge avant la détection et la quantification de la fluorescence induite par laser (excitation à 470 nm, émission 530 nm) (voir la Figure 13B). Purification de la protéine kinase A ou PKA-like enzyme de sérum: La protéine responsable de l'activité kinase mesurée dans les sérums a été purifiée suite à l'utilisation de l'inhibiteur PKI immobilisé sur une colonne stréptavidine-biotine. La colonne a été préincubé avec 300 nmol biotine-PKI/ml streptavadine-sepharose (la séquence de la biotine- aminohexanoic-protéine kinase est montrée dans la figure 14A), puis chargé avec 50 ml de sérum issu des 10 individus sains (après dilution en tampon kinase en présence d'une concentration finale d'ATP de 250 mM et des inhibiteurs des proteases). La colonne a été lavée une fois avec 50 ml de tampon kinase (50 mM Tris.HCI, pH 7.5; 5 mM MgCI2) en présence de 250 mM d'ATP. La protéine kinase a été éluée en tampon kinase sans ATP mais avec 500 nM NaCI + 10 mM imadazole et collectée dans des fractions d'1 ml. L'activité de la protéine kinase récoltées dans les différentes fractions a été testé avec le substrat fluorescent SEQ. ID NO: 5 en présence de 0,5mM d'ATP à 37°C pendant 60 minutes. La concentration de protéine a été calculée à l'aide de la courbe de calibration pour la protéine recombinante montrée dans le figure 1.
I - Mise au point d'un test de mesure de l'activité PKA dans le sérum
Une courbe standard a été obtenue en mesurant l'activité de phosphorylation d'une enzyme PKA recombinante avec le peptide substrat fluorescent : SEQ ID NO : 5, dans les mêmes conditions que celles des échantillons de sérum (Figure 1). La courbe standard obtenue permet d'obtenir une estimation de la quantité d'enzyme active dans un échantillon de sérum. II - Analyse rétrospective de la cohorte italienne
Les échantillons de sérum de la cohorte italienne (Matériels et Méthodes) ont été analysés à l'aide du test de mesure de l'activité PKA avec le peptide substrat fluoresecent: SEQ ID NO : 5 (nommé A2 dans la Figure 2).
Chez les individus contrôles sains (n = 474), la quantité de produit phosphorylé est de 0,06 ± 0,02 pmol/min/μΙ, tandis que chez les patients souffrant de MICI (maladie de Crohn (MC) et colite ulcéreuse (CU)) (n = 1036), la quantité de produit phosphorylé est de 0,017 ± 0,012 pmol/min/μΙ. A l'aide de la courbe standard décrite ci-dessus, la quantité d'enzyme active a été déterminée dans les échantillons de sérum. Chez les individus sains, la quantité d'enzyme active dans le sérum est de 17,1 ± 5,7 ng/ml, tandis que chez les patients souffrant de M ICI, la quantité d'enzyme active dans le sérum est de 4,8 ± 4,2 ng/ml.
Ainsi, dans le sérum des patients souffrant de M ICI, la quantité d'enzyme active vis-à-vis du substrat peptidique est réduite de 3,4 fois par rapport à celle des individus sains.
L'analyse de la courbe ROC (Courbe de la fonction d'efficacité du récepteur, Receiver Operator Characteristic) des patients souffrant de M ICI par rapport aux individus sains présente une aire sous la courbe (ASC ou AUC, Area Under the Curve) de 93%, ce qui équivaut à une spécificité de 87% et une sensibilité de 86% (Figure 3).
Dans les conditions testées, un nivea u de phosphorylation du substrat inférieur à 0,035 ± 0,02 pmol/min/μΙ de sérum est significativement corrélé aux MICI .
Dans les conditions testées, une quantité d'enzyme active inférieure à 10 ng/ml est significativement corrélée aux MICI .
III - Analyse rétrospective de la cohorte américaine Pour vérifier la pertinence des résultats observés pour la cohorte italienne, d'autres échantillons ont été testés. Les échantillons de sérum de la cohorte américaine ont été analysés à l'aide du test d'activité PKA avec le peptide substrat fluorescent SEQ. I D NO : 5. Les résultats obtenus révèlent la même diminution significative de l'activité kinase dans le sérum chez les individus souffrant de M ICI (MC et CU) par rapport aux individus contrôles sains.
Chez les individus sains (n = 356), la quantité d'enzyme active dans le sérum est de 15,1 ± 8,0 ng/ml, tandis que chez les patients souffrant de M ICI (n = 480), la quantité d'enzyme active dans le sérum est de 9,14 ± 6,8 ng/ml (Figure 4).
Bien que l'ASC (une aire sous la courbe) soit pus faible pour la cohorte américaine en comparaison de la cohorte italienne (73% vs 93%), la phosphorylation différentielle du peptide substrat fluorescent SEO I D NO : 5 reste un bon marqueur pour diagnostiquer de M ICI (Figure 5, Tableau 2). MC vs sains CU vs sains MICI vs sains MC vs CU
Cohorte centre 1 94% 93% 93% 56%
Cohorte centre 2 73% 74% 74% 51%
Tableau 2. Comparaison de l'ASC entre les cohortes rétrospectives.
Mais surtout, les mêmes types de distribution sont observés pour les deux cohortes, c-à-d une distribution Gaussienne large pour les individus sains contre une distribution Gaussienne inverse plus étroite pour les patients souffrant de MICI (Figure 6).
IV - Evaluation de la sensibilité du test d'activité PKA par comparaison avec d'autres tests sérolofiiques
A partir des résultats présentés ci-dessus, il apparaît que le test d'activité PKA est très sensible et constitue un outil d'analyse fiable. La figure 7 compare la sensibilité de ce test par rapport à d'autres tests sérologiques couramment utilisés pour diagnostiquer l'inflammation (hs CRP), les maladies cardiovasculaires (Dimère D et Créatine kinase) ou encore le cancer (PSA, prostate spécifie antigen). Ces tests, comme celui de l'invention, sont basés sur le protéome mais concernent des concentrations de protéines très différentes dans le sérum (variation d'environ 9 log). Chacune de ces différentes techniques, ainsi que le test de l'invention, présente une variation de moins d'un log entre la quantité de protéine relative chez les individus sains et celle chez les patients malades.
V - Criblafie de différents peptides substrats
L'activité de phosphorylation d'une enzyme PKA humaine recombinante a été déterminée à l'aide de différents peptides substrats fluorescents et celle-ci a été comparée à l'activité mesurée avec le peptide fluorescent contrôle LRRASLG (SEQ. ID NO : 4) (Tableaux 3 et 4).
Figure imgf000077_0001
PRRASLG (SEQID NO : 7) >90%
PRRWSLG (SEQIDNO:8) >90%
PRRKSLG (SEQIDNO:9) >90%
PRRLSLG (SEQID NO : 10), >90%
PRRPSLG (SEQIDNO:5) >90%
PRRRSLG (SEQID NO : 11) >90%
PRRTSLG (SEQID NO : 12) >80%
PRRGSLG (SEQID NO : 13) >90%
PRRSSLG (SEQID NO : 15) >80%
PRRYSLG (SEQ ID NO : 16) >90%
PRRHSLG (SEQID NO : 17) >90%
PRRVSLG (SEQID NO : 18) >90%
PRRNSLG (SEQID NO : 19) >90%
PRRÇSLG (SEQ ID NO : 20) >90%
PRRQSLG (SEQID NO : 21) >90%
PRRDSLG (SEQID NO : 22) >50%
PRRESLG (SEQIDNO: 14) >50%
Tableau 3. Activité de la PKA observée avec différents substrats peptidiques fluorescents modifiés sur la position X2.
Figure imgf000078_0001
B RAS H G (SEQ ID NO : 57) 35.0 ± 4.0 (n =2)
A RRASEG (SEQ ID NO : 58) 3.6 ± 4.8 (n =2)
A RRASDG (SEQ ID NO : 59) 2.0
Tableau 4. Activité de la PKA observée avec différents substrats peptidiques fluorescents modifiés sur la position X3. (H, hydrophobe ; P, polaire ; NP, non polaire ; B, basique ; A, acide) Les peptides ayant en position X3 un acide aminé hydrophobe et d'un poids moléculaire de 100 à 200 Da constituent des substrats efficaces pour mesurer l'activité PKA (Figure 8).
VI - Analyse de l'activité de la protéine kinase dans le sérum de patient atteints de lombalfiies inflammatoires chroniques
Les échantillons de sérum provenant d'un centre en Italie (Matériels et Méthodes) ont été analysés à l'aide du test de mesure de l'activité protéine kinase avec le peptide substrat fluorescent SEQ. ID NO : 5 (Figure 10).
Chez les individus contrôles sains (n = 407), la quantité de produit phosphorylé est de 0.062 ± 0.022 pmol/min/μΙ, tandis que chez les patients souffrant de lombalgies inflammatoires chroniques (n = 450), la quantité de produit phosphorylé est de 0.049 ± 0.018 pmol/min/μΙ.
A l'aide de la courbe standard décrite ci-dessus, la quantité d'enzyme active a été déterminée dans les échantillons de sérum. Chez les individus sains, la quantité d'enzyme active dans le sérum est de 17.7 ± 6.3 ng/ml, tandis que chez les patients souffrant de lombalgies inflammatoires chroniques, la quantité d'enzyme active dans le sérum est de 13.9 ± 5.1 ng/ml (p <0.0001).
Ainsi, dans le sérum des patients souffrant de lombalgies inflammatoires chroniques, la quantité d'enzyme active vis-à-vis du substrat peptidique est réduite par rapport à celle des individus sains.
L'analyse de la courbe ROC (Courbe de la fonction d'efficacité du récepteur, Receiver Operator Characteristic) des patients souffrant de lombalgies inflammatoires chroniques par rapport aux individus sains présente une aire sous la courbe (ASC ou AUC, Area Under the Curve) de 68 %, ce qui équivaut à une spécificité de 62 % et une sensibilité de 60 % (Figure 10). Dans les conditions testées, un niveau de phosphorylation du substrat inférieur à 0.052 pmol/min/μΙ de sérum est significativement corrélé aux lombalgies inflammatoires chronique.
Dans les conditions testées, une quantité d'enzyme active inférieure à 14.8 ng/ml est significativement corrélée aux lombalgies inflammatoires chroniques.
VII - Analyse de l'activité de la protéine kinase dans le sérum de patient atteints de maladies pulmonaires obstructives chroniques (MPOC)
Les échantillons de sérum provenant d'un centre en Italie (Matériels et Méthodes) ont été analysés à l'aide du test de mesure de l'activité protéine kinase avec le peptide substrat fluorescent SEQ. I D NO : 5.
Chez les individus contrôles sains (n = 407), la quantité de produit phosphorylé est de 0.062 ± 0.022 pmol/min/μΙ, tandis que chez les patients souffrant de M POC (n = 15), la quantité de produit phosphorylé est de 0.051 ± 0.014 pmol/min/μΙ.
A l'aide de la courbe standard décrite ci-dessus, la quantité d'enzyme active a été déterminée dans les écha ntillons de sérum . Chez les individus sains, la quantité d'enzyme active dans le sérum est de 17.7 ± 6.3 ng/ml, tandis que chez les patients souffrant de M POC, la quantité d'enzyme active dans le sérum est de 14.5 ± 3.9 ng/ml (p<0.01).
VIII - Analyse de l'activité de la protéine kinase dans le sérum de patient atteints de maladies cardiovasculaires (MCV)
Les échantillons de sérum provenant d'un centre en Italie (Matériels et Méthodes) ont été analysés à l'aide du test de mesure de l'activité protéine kinase avec le peptide substrat fluorescent SEO I D NO : 5. Chez les individus contrôles sains (n = 407), la quantité de produit phosphorylé est de 0.062 ± 0.022 pmol/min/μΙ, tandis que chez les patients souffrant de MCV (n = 34), la quantité de produit phosphorylé est de 0.049 ± 0.017 pmol/min/μΙ (p<0.001). A l'aide de la courbe standard décrite ci-dessus, la quantité d'enzyme active a été déterminée dans les échantillons de sérum. Chez les individus sains, la quantité d'enzyme active dans le sérum est de 17.7 ± 6.3 ng/ml, tandis que chez les patients souffrant de MCV, la quantité d'enzyme active dans le sérum est de 13.9 ± 4.8 ng/ml (p<0.001). IX - Analyse de l'activité de la protéine kinase dans le sérum de patient atteints de diabète
Les échantillons de sérum provenant d'un centre en Italie (Matériels et Méthodes) ont été analysés à l'aide du test de mesure de l'activité protéine kinase avec le peptide substrat fluorescent SEQ ID NO : 5.
Chez les individus contrôles sains (n = 100), la quantité de produit phosphorylé est de 0.062 ± 0.022 pmol/min/μΙ, tandis que chez les patients souffrant de diabète (n = 100), la quantité de produit phosphorylé est de 0.052 ± 0.019 pmol/min/μΙ (p<0.0001).
A l'aide de la courbe standard décrite ci-dessus, la quantité d'enzyme active a été déterminée dans les échantillons de sérum. Chez les individus sains, la quantité d'enzyme active dans le sérum est de 17.7 ± 6.3 ng/ml, tandis que chez les patients souffrant de diabète, la quantité d'enzyme active dans le sérum est de 14.8 ± 5.4 ng/ml (p<0.0001).
X- Analyse des cohortes contrôles
Afin de démontrer la précision de la technique, les contrôles des deux cohortes séparées décrites ci-dessus ont été comparés. Cette comparaison montre une excellente reproductibilité en terme de taux d'activité de la protéine kinase. L'effet prédit n'a pas été influencé pas les facteurs démographiques testés comme le sexe des individus (voir Figure 15 et le tableau 5). Ces observations renforcent la découverte inattendue, objet de la présente invention, montrant une baisse dans l'activité de la protéine kinase (PKA-like) dans les échantillons biologiques extracellulaire des patients souffrant des maladies inflammatoires chroniques détaillé ci-dessus (la maladie de Crohn et la colite ulcéreuse ou rectocolite hémorragique, les lombalgies inflammatoires chroniques, les maladies cardiovasculaires, la maladie pulmonaire obstructive chronique (MPOC), et les diabètes).
Cohorte Toutes Homme Femme p
Cohorte 1:
n i 474 261 213
Activité: pmol peptide 0.06 ± 0.02 ; 0.06 ± 0.02 0.059 ± 0.02 0.56 phosphorylé/min^Lsérum
Cohorte 2:
n 407 193 214
Activité: pmol peptide 0.062 ± 0.022 i 0.063 ± 0.023 0.062 ± 0.021 0.68 phosphorylé/min^Lsérum
Cohorte 1 + 2
n i 881 454 427
Activité: pmol peptide 0.061 ± 0.022 \ 0.061 ± 0.023 0.061 ± 0.021 0.59 phosphorylé/min^Lsérum n : nombre des échantillons. Activité : Moyenne avec écart type
Tableau 5. Analyse comparative de l'activité protéine kinase sérique entre les cohortes contrôles et selon le sexe.
XI - L'activité de la protéine kinase sérique vis-à-vis du substrat peptidique fluorescent (SEQ ID NO: 5) montre la spécificité du substrat de la protéine kinase A et la sensibilité à l'inhibition par l'inhibiteur spécifique de la PKA, le PKI.
L'activité enzymatique de l'invention est définie comme une protéine kinase avec une spécificité similaire à la PKA (PKA-like) sur la base suivante: (i) L'activité est celle d'une protéine kinase, qui nécessite de ΓΑΤΡ pour effectuer la phosphorylation, comme montré par la charge électrophorétique dépendante de ΓΑΤΡ. Le décalage du peptide A2 (SEQ. ID NO: 5) sur des gels d'agarose à 2% est similaire à celui obtenu par la phosphorylation du même peptide par la PKA recombinante (Figure 13). La phosphorylation réalisée par la protéine kinase sérique et la PKA recombinante est inversée (déphosphorylée) par une protéine phosphatase spécifique au phosphore-thr / ser (lambda phosphatase). La phosphorylation est inhibée par l'utilisation d'un inhibiteur de kinase à large spectre, la staurosporine et par l'utilisation du PKI, inhibiteur spécifique de PKA, mais pas par un peptide inhibiteur spécifique de la classe de protéines C de la protéine kinase (inhibiteur PKC, figure 13). L'affinité pour le PKI, et donc la spécificité de type PKA, est encore montrée par la purification de l'activité de la protéine kinase du sérum sur les colonnes PKI immobilisées (figure 14). Cela indique que l'activité protéine kinase extracellulaire du sérum décrit ci-dessus, qui est significativement diminuée chez les patients atteints de maladies inflammatoires chroniques (MICI, MOPD, MCV, diabète et cLBP), est d'origine PKA ou PKA-like.

Claims

REVENDICATIONS
1. Utilisation de l'activité d'une protéine kinase capable de générer la phosphorylation d'un substrat peptidique comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ. ID NO : l),
où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, Q, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, mesurée dans un échantillon biologique, contenant ladite protéine kinase, d'un sujet suspecté de présenter une maladie inflammatoire, notamment une maladie inflammatoire chronique,
dans lequel l'activité de ladite protéine kinase est déterminée par le taux de phosphorylation dudit substrat,
ladite utilisation de l'activité d'une protéine kinase servant comme marqueur pour le diagnostic et/ou le pronostic in vitro d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, chez ledit sujet,
de préférence, ladite protéine kinase utilisée comme marqueur pour le diagnostic et/ou le pronostic in vitro d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, chez ledit sujet étant capable de phosphoryler un substrat peptidique comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ. ID NO : 1), où :
Xi est un acide aminé, de préférence R,
X2 est un acide aminé, de préférence P,
X3 est un acide aminé choisi parmi L, F, V, I, Q, R, M, K, H et C, de préférence choisi parmi L, F, V et I.
2. Utilisation de l'activité d'une protéine kinase selon la revendication 1 dans laquelle la protéine kinase est une protéine kinase extracellulaire ou une protéine kinase présente dans un échantillon biologique extracellulaire.
3. Utilisation de l'activité d'une protéine kinase selon l'une quelconque des revendications 1 ou 2 dans laquelle la maladie inflammatoire, notamment ladite maladie inflammatoire chronique, est choisie parmi les maladies inflammatoires chroniques de l'intestin y compris la maladie de Crohn et la colite ulcéreuse ou rectocolite hémorragique, les lombalgies inflammatoires chroniques, les maladies cardiovasculaires, la maladie pulmonaire obstructive chronique (MPOC), et les diabètes.
4. Méthode de diagnostic et/ou de pronostic in vitro d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, chez un sujet suspecté de présenter une maladie inflammatoire, comprenant :
- une étape i) de détermination de l'activité d'une protéine kinase capable de phosphoryler un substrat peptidique comprenant ou consistant en la séquence consensus R- X1-X2-S/T-X3 (SEQ ID NO : 1), où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, Q, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, mesurée dans un échantillon biologique, contenant ladite protéine kinase, dudit sujet,
- une étape (ii) de comparaison de l'activité de ladite protéine kinase déterminée à l'étape (i) par rapport à une valeur de référence,
dans laquelle, à l'étape i), l'activité de ladite protéine kinase est déterminée à l'aide d'un substrat peptidique comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ. ID NO : 1), où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, O, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, de préférence, à l'étape i), l'activité de ladite protéine kinase étant déterminée à l'aide d'un substrat peptidique comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ ID NO : 1), où :
Xi est un acide aminé, de préférence R,
X2 est un acide aminé, de préférence P, X3 est un acide aminé choisi parmi L, F, V, I, Q, R, M, K, H et C, de préférence choisi parmi L, F, V et I.
5. Méthode de diagnostic et/ou de pronostic in vitro selon la revendication 4, dans laquelle l'activité de ladite protéine kinase est déterminée à l'aide d'au moins un substrat peptidique comprenant ou consistant en une séquence choisie parmi :
LRRASLG (SEQ ID NO : 4), PRRPSLG (SEQ ID NO : 5), LPRRPSI (SEQ ID NO : 6), PRRASLG (SEQ ID NO : 7), PRRWSLG (SEQ ID NO : 8), PRRKSLG (SEQ ID NO : 9), PRRLSLG (SEQ ID NO : 10), PRRRSLG (SEQ ID NO : 11), PRRTSLG (SEQ ID NO : 12), PRRGSLG (SEQ ID NO : 13), PRRESLG (SEQ ID NO : 14), PRRSSLG (SEQ ID NO : 15), PRRYSLG (SEQ ID NO : 16), PRRHSLG (SEQ ID NO : 17), PRRVSLG (SEQ ID NO : 18), PRRNSLG (SEQ ID NO : 19), PRRCSLG (SEQ ID NO : 20), PRRQSLG (SEQ ID NO : 21), PRRDSLG (SEQ ID NO : 22), PRRASFG (SEQ ID NO : 23), PRRASVG (SEQ ID NO : 24), PRRASIG (SEQ ID NO : 25), PRRASMG (SEQ ID NO : 26), PRRASQG (SEQ ID NO : 27), PRRASNG (SEQ ID NO : 28), PRRASCG (SEQ ID NO : 29), RDLRRASLV (SEQ ID NO : 30), RYLRRATLV(SEQ ID NO : 31), RYLRRPSLG (SEQ ID NO : 32), RPPRRASLG (SEQ ID NO : 33), R{dY}{dL}RRASLG (où d indique la forme D-isomère d'une acide aminé) (SEQ ID NO : 34), R{dY}{dL}RRPSLG (où d indique la forme D-isomère d'une acide aminé) (SEQ ID NO : 35), RPPRKASLG (SEQ ID NO : 36), RPPRRPSLG (SEQ ID NO : 37), RPPRRPSI (SEQ ID NO : 38), PRRPTI (SEQ ID NO : 39) et RYLRRASLG (SEQ ID NO : 40).
6. Méthode de diagnostic et/ou de pronostic in vitro selon l'une quelconque des revendications 4 ou 5 dans laquelle la protéine kinase est une protéine kinase extracellulaire ou une protéine kinase présente dans un échantillon biologique extracellulaire
7. Méthode de diagnostic et/ou de pronostic in vitro selon l'une quelconque des revendications 4 à 6 dans laquelle la maladie inflammatoire, notamment la maladie inflammatoire chronique, est choisie parmi les maladies inflammatoires chroniques de l'intestin y compris la maladie de Crohn et la colite ulcéreuse ou rectocolite hémorragique, les lombalgies inflammatoires chroniques, les maladies cardiovasculaires, la maladie pulmonaire obstructive chronique (MPOC), et les diabètes.
8. Méthode d'évaluation et/ou de suivi de l'efficacité d'un traitement d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, chez un sujet comprenant :
- une étape i) de détermination de l'activité d'une protéine kinase capable de phosphoryler un substrat peptidique comprenant ou consistant en la séquence consensus R- X1-X2-S/T-X3 (SEQ ID NO : 1), où
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, Q, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, mesurée dans un échantillon biologique, contenant ladite protéine kinase, dudit sujet,
- une étape ii) de comparaison de l'activité de ladite protéine kinase, déterminée dans ledit échantillon biologique prélevé à différentes dates,
dans laquelle, à l'étape i), l'activité de ladite protéine kinase est déterminée à l'aide d'un substrat peptidique comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ. ID NO : 1), où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, O, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, en particulier, à l'étape i), l'activité de ladite protéine kinase, est déterminée à l'aide d'un substrat peptidique comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ ID NO : 1), où :
Xi est un acide aminé, de préférence R,
X2 est un acide aminé, de préférence P,
X3 est un acide aminé choisi parmi L, F, V, I, O, R, M, K, H et C, de préférence choisi parmi L, F, V et I,
plus particulièrement, à l'étape i), l'activité de ladite protéine kinase, est déterminée à l'aide d'un substrat peptidique tel que défini selon la revendication 5.
9. Méthode d'évaluation et/ou de suivi de l'efficacité d'un traitement d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, selon la revendication 8 dans laquelle la protéine kinase est une protéine kinase extracellulaire ou une protéine kinase présente dans un échantillon biologique extracellulaire.
10. Méthode d'évaluation et/ou de suivi de l'efficacité d'un traitement d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, selon l'une quelconque des revendications 8 ou 9 dans laquelle la maladie inflammatoire, notamment la maladie inflammatoire chronique, est choisie parmi les maladies inflammatoires chroniques de l'intestin y compris la maladie de Crohn et la colite ulcéreuse ou rectocolite hémorragique, les lombalgies inflammatoires chroniques, les maladies cardiovasculaires, la maladie pulmonaire obstructive chronique (MPOC), et les diabètes.
11. Méthode de dosage de l'activité d'une protéine kinase capable de phosphoryler un substrat peptidique comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ. ID NO : 1), où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, Q, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, mesurée dans un échantillon biologique, contenant ladite protéine kinase, comprenant : - une étape i) d'incubation dudit échantillon, ou de la protéine kinase, issue dudit échantillon, en présence d'un substrat peptidique susceptible d'être phosphorylé par ladite protéine kinase, pendant au moins 10 heures, de préférence pendant au moins 18 heures, ledit substrat peptidique comprenant ou consistant en la séquence consensus R-Xi-X2- S/T-X3 (SEQ. ID NO : 1), où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, Q, R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, en particulier, ledit substrat peptidique comprenant ou consistant en la séquence consensus R-X X2-S/T-X3 (SEQ ID NO : 1), où :
Xi est un acide aminé, de préférence R,
X2 est un acide aminé, de préférence P, X3 est un acide aminé choisi parmi L, F, V, I, Q, R, M, K, H et C, de préférence choisi parmi L, F, V et I,
plus particulièrement, ledit substrat peptidique est un substrat peptidique tel que défini selon la revendication 5,
en particulier, ledit échantillon biologique étant un échantillon de sang, de plasma ou de sérum.
12. Méthode de dosage de l'activité d'une protéine kinase selon la revendication 11 dans laquelle la protéine kinase est une protéine kinase extracellulaire ou une protéine kinase présente dans un échantillon biologique extracellulaire.
13. Kit de dosage de l'activité d'une protéine kinase, comprenant au moins :
- un substrat susceptible d'être phosphorylé par ladite protéine kinase, ledit substrat comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ ID NO : 1), où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel,
X3 est un acide aminé naturel choisi parmi L, F, V, I, Q., R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, et
- de l'ATP,
de préférence, ledit kit comprenant également au moins un inhibiteur de protéase, de préférence choisi parmi le groupe comprenant: la 1,10-Phénanthroline, l'AEBSF (4-(2- Aminoethyl) benzenesulfonyl fluoride hydrochloride), l'aprotinine, la bestatine, l'E-64, la leupeptine, la pepstatine A, l'EDTA, l'antipaïne dihydrochloride, la chymostatine, le phosphoramidon, le Pefabloc® SC, l'acide ε-aminocaproïque, le N-Ethylmaléimide, un inhibiteur de trypsine et l'antitrypsine alpha
14. Kit de diagnostic d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, comprenant au moins :
- un substrat susceptible d'être phosphorylé par une protéine kinase, ledit substrat comprenant ou consistant en la séquence consensus R-Xi-X2-S/T-X3 (SEQ. ID NO : 1), où :
Xi est un acide aminé naturel ou non naturel,
X2 est un acide aminé naturel ou non naturel, X3 est un acide aminé naturel choisi parmi : L, F, V, I, Q., R, M, K, H et C ou un acide aminé non naturel de caractère hydrophobe et d'un poids moléculaire de 100 à 200 Da, et - de ΙΆΤΡ,
de préférence, ledit kit comprenant également au moins un inhibiteur de protéase, de préférence choisi parmi le groupe comprenant: la 1,10-Phénanthroline, l'AEBSF (4-(2- Aminoethyl) benzenesulfonyl fluoride hydrochloride), l'aprotinine, la bestatine, l'E-64, la leupeptine, la pepstatine A, l'EDTA, l'antipaïne dihydrochloride, la chymostatine, le phosphoramidon, le Pefabloc® SC, l'acide ε-aminocaproïque, le N-Ethylmaléimide, un inhibiteur de trypsine et l'antitrypsine alpha.
15. Kit de diagnostic d'une maladie inflammatoire, notamment d'une maladie inflammatoire chronique, selon la revendication 14 dans laquelle la maladie inflammatoire, notamment la maladie inflammatoire chronique, est choisie parmi les maladies inflammatoires chroniques de l'intestin y compris la maladie de Crohn et la colite ulcéreuse ou rectocolite hémorragique, les lombalgies inflammatoires chroniques, les maladies cardiovasculaires, la maladie pulmonaire obstructive chronique (MPOC), et les diabètes.
PCT/FR2017/051811 2016-07-01 2017-07-03 Biomarqueur pour le diagnostic de maladies inflammatoires WO2018002564A1 (fr)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
FR1656343A FR3053338B1 (fr) 2016-07-01 2016-07-01 Biomarqueur pour le diagnostic de maladies inflammatoires
FR16/56343 2016-07-01

Publications (1)

Publication Number Publication Date
WO2018002564A1 true WO2018002564A1 (fr) 2018-01-04

Family

ID=56943747

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/FR2017/051811 WO2018002564A1 (fr) 2016-07-01 2017-07-03 Biomarqueur pour le diagnostic de maladies inflammatoires

Country Status (2)

Country Link
FR (1) FR3053338B1 (fr)
WO (1) WO2018002564A1 (fr)

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2012034061A2 (fr) * 2010-09-09 2012-03-15 Traxxsson, Llc Procédés combinés de diagnostic d'un cancer chez un patient
WO2012145399A2 (fr) * 2011-04-20 2012-10-26 Traxxsson, Llc Procédés de diagnostic d'un cancer chez un patient
US20140113306A1 (en) * 2012-10-17 2014-04-24 Rutgers, The State University Of New Jersey Diagnostic and screening methods for inflammation

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2012034061A2 (fr) * 2010-09-09 2012-03-15 Traxxsson, Llc Procédés combinés de diagnostic d'un cancer chez un patient
WO2012145399A2 (fr) * 2011-04-20 2012-10-26 Traxxsson, Llc Procédés de diagnostic d'un cancer chez un patient
US20140113306A1 (en) * 2012-10-17 2014-04-24 Rutgers, The State University Of New Jersey Diagnostic and screening methods for inflammation

Non-Patent Citations (4)

* Cited by examiner, † Cited by third party
Title
JEFFREY H TILL ET AL: "Use of Synthetic Peptide Libraries and Phosphopeptide-selective Mass Spectrometry to Probe Protein Kinase Substrate Specificity"", 11 March 1994 (1994-03-11), pages 7423 - 7428, XP055340765, Retrieved from the Internet <URL:http://www.jbc.org/content/269/10/7423.full.pdf> *
KISSELJOVA K ET AL: "Aza-beta<3>-amino acid containing peptidomimetics as cAMP-dependent protein kinase substrates", BIOORGANIC CHEMISTRY, ACADEMIC PRESS INC., NEW YORK, NY, US, vol. 38, no. 5, 1 October 2010 (2010-10-01), pages 229 - 233, XP027192691, ISSN: 0045-2068, [retrieved on 20100601] *
LOOG M ET AL: "Comparison of Substrate Specificities of Protein Kinases A and C Based on Peptide Substrates", BIOORGANIC CHEMISTRY, ACADEMIC PRESS INC., NEW YORK, NY, US, vol. 22, no. 3, 1 September 1994 (1994-09-01), pages 328 - 336, XP024023081, ISSN: 0045-2068, [retrieved on 19940901], DOI: 10.1006/BIOO.1994.1026 *
SATHISH KUMAR ET AL: "Extracellular phosphorylation of the amyloid [beta]-peptide promotes formation of toxic aggregates during the pathogenesis of Alzheimer's disease : Extracellular phosphorylation of the amyloid [beta]-peptide", EMBO (EUROPEAN MOLECULAR BIOLOGY ORGANIZATION) JOURNAL, vol. 30, no. 11, 1 June 2011 (2011-06-01), DE, pages 2255 - 2265, XP055416488, ISSN: 0261-4189, DOI: 10.1038/emboj.2011.138 *

Also Published As

Publication number Publication date
FR3053338A1 (fr) 2018-01-05
FR3053338B1 (fr) 2021-01-22

Similar Documents

Publication Publication Date Title
Blackinton et al. Effects of DJ-1 mutations and polymorphisms on protein stability and subcellular localization
US20100104501A1 (en) Prss23 as a biomarker, therapeutic and diagnostic target
EP1631680A2 (fr) Diagnostics et agents therapeutiques destines a des maladies liees a une dipeptidylpeptidase iv (dpp4)
US20090010919A1 (en) Diagnostics and Therapeutics for Diseases Associated With Fibroblast Activation Protein (Fap)
WO2018002564A1 (fr) Biomarqueur pour le diagnostic de maladies inflammatoires
CA2409964A1 (fr) Substrat peptidique reconnu par la toxine botulique de type bont/b et son utilisation pour doser et/ou detecter ladite toxine ou des inhibiteurs correspondants
CN102010890B (zh) 线粒体天门冬氨酸氨基转移酶测定试剂盒
EP3097124B1 (fr) Moyens et procédés de détection de malt1 activé
FR3053339A1 (fr) Biomarqueur pour le diagnostic de maladies inflammatoires chroniques de l&#39;intestin
WO2005113786A2 (fr) Methodes diagnostiques et therapeutiques pour lutter contre des maladies associees a la chymase (cma1)
WO2006010496A1 (fr) Diagnostics et therapeutiques pour des maladies associees a dipeptidase 1 (dpep1)
FR2869908A1 (fr) Substrat peptidique reconnu par la toxine botulique de type a, bont/a et son utilisation pour detecter et/ou doser ladite toxine ou des inhibiteurs de son activite
US20070258973A1 (en) Diagnostics and Therapeutics for Diseases Associated with Tripeptidyl-Peptidase 2(Tpp2)
WO2007140895A1 (fr) Utilisation de la leucyl aminopeptidase 3 (lap3) en tant que cible thérapeutique ou diagnostique
EP1745293A1 (fr) Agents utilises dans le diagnostic et le traitement des maladies associees a la dipeptidyl-peptidase 9 (dpp9)
US20070254287A1 (en) Diagnostics and Therapeutics for Diseases Associated with Dipeptidyl-Peptidase 10 (Dpp10)
Deng The Molecular and Regulatory Mechanism of Multi-Subunit N-Terminal Acetyltransferases
US20070099255A1 (en) Diagnostics and therapeutics for diseases associated with n-acetylated alpha-linked acidic dipeptidase 2(naaladase 2)
EP0498849A1 (fr) Moyens pour la detection de cellules hautement proliferatives
JP2006520600A (ja) 酵素阻害剤およびプロテインキナーゼの同定方法
WO2005106021A1 (fr) Diagnostics et therapeutique de maladies associees a la dipeptidyle peptidase 8 (dpp8)
WO2007140906A1 (fr) Utilisation de la leucyl/cystinyl aminopeptidase (lnpep) en tant que cible thérapeutique ou diagnostique
Laverdière et al. An LC-MS/MS-based Assay to Evaluate Inosine-5'-monophosphate Dehydrogenase Activity in Peripheral Blood Mononuclear Cells from Stem Cell Transplant Recipients.
US20070166715A1 (en) Diagnostics and therapeutics for diseases associated with aminopeptidase-like 1 (npepl1)
US20070202567A1 (en) Diagnostics And Therapeutics For Diseases Associated With Arginyl Aminopeptidase Rnpep (Rnpep)

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17745825

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 17745825

Country of ref document: EP

Kind code of ref document: A1