WO2018002031A1 - Anti-cd19 antibody formulations - Google Patents

Anti-cd19 antibody formulations Download PDF

Info

Publication number
WO2018002031A1
WO2018002031A1 PCT/EP2017/065819 EP2017065819W WO2018002031A1 WO 2018002031 A1 WO2018002031 A1 WO 2018002031A1 EP 2017065819 W EP2017065819 W EP 2017065819W WO 2018002031 A1 WO2018002031 A1 WO 2018002031A1
Authority
WO
WIPO (PCT)
Prior art keywords
formulation
concentration
antibody
seq
sequence
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2017/065819
Other languages
English (en)
French (fr)
Inventor
Patrick Garidel
Andreas Langer
Martin Hessling
Daniel WEINFURTNER
Bodo Brocks
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Morphosys AG
Original Assignee
Morphosys AG
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to IL263764A priority Critical patent/IL263764B2/en
Priority to KR1020237016157A priority patent/KR20230074823A/ko
Priority to EP17735440.4A priority patent/EP3475303B1/en
Priority to RU2019100221A priority patent/RU2748024C2/ru
Priority to SG11201810429UA priority patent/SG11201810429UA/en
Priority to JP2018567742A priority patent/JP2019524671A/ja
Priority to KR1020197002043A priority patent/KR102533875B1/ko
Priority to PL17735440T priority patent/PL3475303T3/pl
Priority to ES17735440T priority patent/ES2874640T3/es
Priority to MA45450A priority patent/MA45450B1/fr
Priority to MDE20190533T priority patent/MD3475303T2/ro
Priority to NZ748681A priority patent/NZ748681B2/en
Priority to SM20210317T priority patent/SMT202100317T1/it
Priority to DK17735440.4T priority patent/DK3475303T3/da
Priority to SI201730801T priority patent/SI3475303T1/sl
Priority to AU2017289085A priority patent/AU2017289085B2/en
Priority to LTEP17735440.4T priority patent/LT3475303T/lt
Application filed by Morphosys AG filed Critical Morphosys AG
Priority to CN201780039737.6A priority patent/CN109415440B/zh
Priority to US16/310,555 priority patent/US11352423B2/en
Priority to MX2018016362A priority patent/MX2018016362A/es
Priority to EP21167818.0A priority patent/EP3909985A1/en
Priority to CA3029137A priority patent/CA3029137A1/en
Priority to HRP20210945TT priority patent/HRP20210945T1/hr
Priority to CN202211458395.0A priority patent/CN115998859A/zh
Priority to RS20210748A priority patent/RS62035B1/sr
Publication of WO2018002031A1 publication Critical patent/WO2018002031A1/en
Anticipated expiration legal-status Critical
Priority to ZA2019/00483A priority patent/ZA201900483B/en
Priority to CY20211100532T priority patent/CY1124521T1/el
Priority to US17/700,809 priority patent/US20220213190A1/en
Priority to JP2022081779A priority patent/JP7603201B2/ja
Priority to JP2024083988A priority patent/JP7824990B2/ja
Priority to AU2024205042A priority patent/AU2024205042A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/715Polysaccharides, i.e. having more than five saccharide radicals attached to each other by glycosidic linkages; Derivatives thereof, e.g. ethers, esters
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39591Stabilisation, fragmentation
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/08Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing oxygen, e.g. ethers, acetals, ketones, quinones, aldehydes, peroxides
    • A61K47/12Carboxylic acids; Salts or anhydrides thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/26Carbohydrates, e.g. sugar alcohols, amino sugars, nucleic acids, mono-, di- or oligo-saccharides; Derivatives thereof, e.g. polysorbates, sorbitan fatty acid esters or glycyrrhizin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/30Macromolecular organic or inorganic compounds, e.g. inorganic polyphosphates
    • A61K47/36Polysaccharides; Derivatives thereof, e.g. gums, starch, alginate, dextrin, hyaluronic acid, chitosan, inulin, agar or pectin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/54Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
    • A61K47/549Sugars, nucleosides, nucleotides or nucleic acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/14Particulate form, e.g. powders, Processes for size reducing of pure drugs or the resulting products, Pure drug nanoparticles
    • A61K9/19Particulate form, e.g. powders, Processes for size reducing of pure drugs or the resulting products, Pure drug nanoparticles lyophilised, i.e. freeze-dried, solutions or dispersions
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies

Definitions

  • the present disclosure is related to stable lyophilized pharmaceutical formulations of an anti- CD19 antibody and provides methods of making and methods of using such formulations.
  • B cells are lymphocytes that play a large role in the humoral immune response. They are produced in the bone marrow of most mammals, and represent 5-15% of the circulating lymphoid pool. The principal function of B cells is to make antibodies against various antigens, and are an essential component of the adaptive immune system.
  • lymphomas and leukemias.
  • NHL non- Hodgkin's lymphoma
  • CLL chronic lymphocytic leukemia
  • ALL acute lymphoblastic leukemia
  • the human CD19 molecule is a structurally distinct cell surface receptor expressed on the surface of human B cells, including, but not limited to, pre-B cells, B cells in early development ⁇ i.e., immature B cells), mature B cells through terminal differentiation into plasma cells, and malignant B cells.
  • CD 19 is expressed by most pre-B acute lymphoblastic leukemias (ALL), non-Hodgkin's lymphomas, B cell chronic lymphocytic leukemias (CLL), pro-lymphocytic leukemias, hairy cell leukemias, common acute lymphocytic leukemias, and some Null-acute lymphoblastic leukemias (Nadler et al, J.
  • CD19 antigen is a target for immunotherapy in the treatment of non-Hodgkin's lymphoma (including each of the subtypes described herein), chronic lymphocytic leukemia and/or acute lymphoblastic leukemia.
  • MOR208 (previously named XmAb5574) is an Fc engineered humanized monoclonal antibody that binds CD19.
  • ADCC antibody dependent cell-mediated cytotoxicity
  • ADCP antibody dependent cell-mediated phagocytosis
  • apoptosis direct cytotoxic effects
  • MOR208 has or is currently being studied in clinical trials in CLL, ALL and NHL. Specifically, a Phase I trial titled Safety and Tolerability of XmAb®5574 in Chronic Lymphocytic Leukemia, and a Phase I la trial titled Study of Fc-Optimized Anti-CD19 Antibody (MOR208) to treat B-cell Acute Lymphoblastic Leukemia (B-ALL) are completed. A Phase I la trial titled Study of Fc-Optimized Anti- CD19 Antibody (MOR208) to Treat Non-Hodgkin ' s Lymphoma (NHL) has completed recruitment.
  • B-ALL B-cell Acute Lymphoblastic Leukemia
  • Therapeutic antibodies and antibody fragments are large and more complex molecules than traditional organic and inorganic drugs small molecules as antibodies possess multiple functional groups in addition to complex three-dimensional structures and, therefore, the formulation of such proteins poses special challenges.
  • a formulation must preserve the conformational integrity of at least a core sequence of the protein's amino acids while at the same time protecting the protein's multiple functional groups from degradation.
  • Formulations of antibodies may have short shelf lives and the formulated antibodies may lose biological activity resulting from chemical and physical instabilities during storage.
  • the three most common pathways for protein degradation are protein aggregation, deamidation and oxidation (Cleland et al., Critical Reviews in Therapeutic Drug Carrier Systems 10(4): 307-377 (1993)).
  • aggregation can potentially lead to increased immune response in patients, leading to safety concerns and must be minimised or prevented.
  • Suitable formulations for therapeutic antibodies can be an aqueous pharmaceutical composition or a lyophilisate which can be reconstituted to provide a solution for administration to a patient.
  • the formulation comprises an anti-CD19 antibody, a buffer, sucrose, and a surfactant, wherein the formulation has a pH of about 6.0 wherein said anti-CD19 antibody comprises a heavy chain constant domain of the sequence
  • a stable lyophilized pharmaceutical formulation comprising an anti-CD19 antibody in a concentration of about 20 mg/ml to about 125 mg/ml, a buffer, polysorbate in a concentration of about 0.005% (w/v) to about 0.06% (w/v), and pH of about 6.0, wherein the formulation further comprises a) trehalose in a concentration of about 180 mM to about 240 mM
  • said anti-CD19 antibody comprises an HCDR1 region comprising of sequence SYVMH (SEQ ID NO: 1 ), an HCDR2 region comprising of sequence NPYNDG (SEQ ID NO: 2), an HCDR3 region comprising of sequence GTYYYGTRVFDY (SEQ ID NO: 3), an LCDR1 region comprising of sequence RSSKSLQNVNGNTYLY (SEQ ID NO: 4), an LCDR2 region comprising of sequence RMSNLNS (SEQ ID NO: 5), and an LCDR3 region comprising of sequence MQHLEYPIT (SEQ ID NO: 6).
  • said anti-CD19 antibody comprises an HCDR1 region of sequence SYVMH (SEQ ID NO: 1 ), an HCDR2 region of sequence NPYNDG (SEQ ID NO: 2), an HCDR3 region of sequence GTYYYGTRVFDY (SEQ ID NO: 3), an LCDR1 region of sequence RSSKSLQNVNGNTYLY (SEQ ID NO: 4), an LCDR2 region of sequence RMSNLNS (SEQ ID NO: 5), and an LCDR3 region of sequence MQHLEYPIT (SEQ ID NO: 6).
  • said anti-CD19 antibody comprises a variable heavy chain of the sequence
  • said anti-CD19 antibody comprises a heavy chain constant domain of the sequence
  • the anti-CD19 antibody in the formulation has a concentration of about 20 mg/ml to about 80 mg/ml. In some embodiments, the anti-CD19 antibody in the formulation has a concentration of about 40 mg/ml.
  • said buffer in the formulation is citrate buffer or phosphate buffer.
  • said trehalose in the formulation is about 200 mM. In some embodiments, said trehalose in the formulation is 200 mM.
  • said Mannitol in the formulation is about 219 mM and Sucrose in the formulation is about 29 mM. In some embodiments, said Mannitol in the formulation is 219 mM and Sucrose in the formulation is 29 mM.
  • the formulation has a pH of about 6.0. In some embodiments, the formulation has a pH of 6.0.
  • said polysorbate in the formulation is polysorbate 20.
  • said polysorbate (e.g., polysorbate 20) in the formulation is of about 0.005% (w/v) to about 0.06% (w/v).
  • said polysorbate (e.g., polysorbate 20) in the formulation is about 0.02% (w/v).
  • said polysorbate (e.g., polysorbate 20) in the formulation is 0.02% (w/v).
  • a stable lyophilized pharmaceutical formulation comprising an anti-CD19 antibody in a concentration of about 40 mg/ml, citrate in a concentration of about 25 mM, trehalose in a concentration of about 200 mM, polysorbate in a concentration of about 0.02% (w/v), and a pH of about 6.0.
  • a stable lyophilized pharmaceutical formulation comprising an anti-CD19 antibody in a concentration of 40 mg/ml, citrate in a concentration of 25 mM, trehalose in a concentration of 200 mM, polysorbate in a concentration of 0.02% (w/v), and a pH of 6.0.
  • a stable lyophilized pharmaceutical formulation comprising an anti-CD19 antibody in a concentration of about 40 mg/ml, citrate in a concentration of about 25 mM, Mannitol in a concentration of about 219 mM, Sucrose in a concentration of about 29 mM, polysorbate in a concentration of about 0.02% (w/v), and a pH of about 6.0.
  • a stable lyophilized pharmaceutical formulation comprising an anti-CD19 antibody in a concentration of 40 mg/ml, citrate in a concentration of 25 mM, Mannitol in a concentration of 219 mM, Sucrose in a concentration of 29 mM, polysorbate in a concentration of 0.02% (w/v), and a pH of 6.0.
  • said anti-CD19 antibody in the formulation is not subject to prior lyophilization., e.g. is liquid
  • said anti-CD19 antibody in the formulation is a monoclonal antibody.
  • said anti-CD19 antibody in the formulation is a full length antibody.
  • said anti-CD19 antibody in the formulation is an IgG antibody.
  • said anti-CD19 antibody in the formulation is a humanized or a human antibody.
  • said anti-CD19 antibody in the formulation is an antibody fragment comprising an antigen-binding region.
  • the antibody fragment is a Fab or F(ab')2 fragment.
  • Figure 1 Provided are the amino acid sequences of MOR208.
  • Figure 2 Subvisible particle (SVP) count of MOR208 after 3 months at 40oC.
  • Formulation 3 and Formulation 9 were compared and the mannitol/sucrose formulation generated more particles over time especially in the range between 2 ⁇ and 1000 ⁇ .
  • antibody means monoclonal antibodies, including any isotype, such as, IgG, IgM,
  • IgA, IgD and IgE An IgG antibody is comprised of two identical heavy chains and two identical light chains that are joined by disulfide bonds. Each heavy and light chain contains a constant region and a variable region. Each variable region contains three segments called “complementarity-determining regions" ("CDRs") or “hypervariable regions", which are primarily responsible for binding an epitope of an antigen. They are referred to as CDR1 , CDR2, and CDR3, numbered sequentially from the N- terminus. The more highly conserved portions of the variable regions outside of the CDRs are called the "framework regions".
  • CDRs complementarity-determining regions
  • an “antibody fragment” means an Fv, scFv, dsFv, Fab, Fab' F(ab')2 fragment, or other fragment, which contains at least one variable heavy or variable light chain, each containing CDRs and framework regions.
  • VH refers to the variable region of an immunoglobulin heavy chain of an antibody, or antibody fragment.
  • VL refers to the variable region of the immunoglobulin light chain of an antibody, or antibody fragment.
  • CD19 refers to the protein known as CD19, having the following synonyms: B4, B-lymphocyte antigen CD19, B-lymphocyte surface antigen B4, CVID3, Differentiation antigen CD19, MGC12802, and T-cell surface antigen Leu-12.
  • Human CD19 has the amino acid sequence of:
  • SIRGQPGPNHEEDADSYENMDNPDGPDPAWGGGGRMGTWSTR (SEQ ID NO: 7)
  • MOR208 is an anti-CD19 antibody.
  • the amino acid sequence of the variable domains is provided in Figure 1.
  • the amino acid sequence of the heavy and light chain Fc regions of MOR208 are provided in Figure 1 .
  • “MOR208” and “XmAb 5574” are used as synonyms to describe the antibody shown in Figure 1 .
  • the MOR208 antibody is described in US patent application serial number 12/377,251 , which is incorporated by reference in its entirety.
  • pharmaceutical formulation refers to a preparation for administration to subjects. Such subjects may be humans.
  • a “stable" formulation is one that can be administered to patients after storage.
  • the formulation essentially retains its physical and chemical properties , as well as its biological activity upon storage.
  • Various analytical techniques for measuring protein stability are available in the art and are reviewed in Peptide and Protein Drug Delivery, 247-301 , Vincent Lee Ed., Marcel Dekker, Inc., New York, N.Y., Pubs. (1991 ) and Jones, A. Adv. Drug Delivery Rev. 10: 29-90 (1993), for example.
  • Stability can be evaluated qualitatively and/or quantitatively in a variety of different ways, including evaluation of aggregate formation (for example using size exclusion chromatography, by measuring turbidity, and/or by visual inspection); by assessing charge heterogeneity using ion exchange chromatography (IEC), size exclusion chromatography (HP-SEC), SDS-PAGE analysis to compare reduced and intact antibody; evaluating biological activity or antigen binding function of the antibody; etc.
  • Instability may involve any one or more of: aggregation, deamidation (e.g. Asn deamidation), oxidation (e.g. Met oxidation), isomerization (e.g. Asp isomerization), clipping/hydrolysis/fragmentation (e.g. hinge region fragmentation), succinimide formation, unpaired cysteine(s), N-terminal extension, C-terminal processing, glycosylation differences, etc.
  • biological activity of a monoclonal antibody refers to the ability of the antibody to bind to antigen. It can further include antibody binding to antigen and resulting in a measurable biological response which can be measured in vitro or in vivo.
  • buffer refers to a buffered solution that resists changes in pH by the action of its acid-base conjugate components.
  • the buffer of this invention preferably has a pH in the range from about 4.5 to about 7.0, preferably from about 5.6 to about 7.0.
  • the buffer has a pH of about 6.0 or a pH of 6.0.
  • a citrate buffer or a phosphate buffer are each an example of buffers that will control the pH in this range.
  • a "surfactant” refers to a surface-active agent.
  • the surfactant is a nonionic surfactant.
  • examples of surfactants herein include polysorbate (for example, polysorbate 20 and, polysorbate 80); poloxamer (e.g.
  • poloxamer 188 Triton; sodium dodecyl sulfate (SDS); sodium laurel sulfate; sodium octyl glycoside; lauryl-, myristyl-, linoleyl-, or stearyl-sulfobetaine; lauryl-, myristyl-, linoleyl- or stearyl-sarcosine; linoleyl-, myristyl-, or cetyl-betaine; lauroamidopropyl- , cocamidopropyl-, linoleamidopropyl-, myristamidopropyl-, palmidopropyl-, or isostearamidopropyl- betaine (e.g.
  • the surfactant herein is polysorbate 20.
  • Fc region means the constant region of an antibody, which in humans may be of the lgG1 , 2, 3, 4 subclass or others.
  • the sequences of human Fc regions are available at IMGT, Human IGH C-REGIONs,
  • administering includes but is not limited to delivery by an injectable form, such as, for example, an intravenous, intramuscular, intradermal or subcutaneous route or mucosal route, for example, as a nasal spray or aerosol for inhalation or as an ingestable solution, capsule or tablet.
  • an injectable form such as, for example, an intravenous, intramuscular, intradermal or subcutaneous route or mucosal route, for example, as a nasal spray or aerosol for inhalation or as an ingestable solution, capsule or tablet.
  • a “therapeutically effective amount” of a compound or combination refers to an amount sufficient to at least partially arrest the clinical manifestations of a given disease or disorder and its complications.
  • the amount that is effective for a particular therapeutic purpose will depend on the severity of the disease or injury as well as on the weight and general state of the subject. It will be understood that determination of an appropriate dosage may be achieved, using routine experimentation, by constructing a matrix of values and testing different points in the matrix, all of which is within the ordinary skills of a trained physician or clinical scientist.
  • the "CDRs" herein are defined by either Chothia et al or Kabat et al. See Chothia C, Lesk AM. (1987) Canonical structures for the hypervariable regions of immunoglobulins.
  • Cross competes means the ability of an antibody or other binding agent to interfere with the binding of other antibodies or binding agents to CD19 in a standard competitive binding assay.
  • the ability or extent to which an antibody or other binding agent is able to interfere with the binding of another antibody or binding molecule to CD19, and, therefore whether it can be said to cross- compete according to the invention, can be determined using standard competition binding assays.
  • One suitable assay involves the use of the Biacore technology (e.g. by using the BIAcore 3000 instrument (Biacore, Uppsala, Sweden)), which can measure the extent of interactions using surface plasmon resonance technology.
  • Another assay for measuring cross-competing uses an ELISA- based approach.
  • a high throughput process for "epitope binning" antibodies based upon their cross- competition is described in International Patent Application No. WO 2003/48731
  • epitope includes any protein determinant capable of specific binding to an antibody or otherwise interacting with a molecule.
  • Epitopic determinants generally consist of chemically active surface groupings of molecules such as amino acids or carbohydrate or sugar side chains and can have specific three-dimensional structural characteristics, as well as specific charge characteristics.
  • An epitope may be "linear” or “conformational”.
  • linear epitope refers to an epitope with all of the points of interaction between the protein and the interacting molecule (such as an antibody) occur linearally along the primary amino acid sequence of the protein (continuous).
  • formational epitope refers to an epitope in which discontinuous amino acids that come together in three dimensional conformation. In a conformational epitope, the points of interaction occur across amino acid residues on the protein that are separated from one another.
  • “Binds the same epitope as” means the ability of an antibody or other binding agent to bind to CD19 and having the same epitope as the exemplified antibody.
  • the epitopes of the exemplified antibody and other antibodies to CD19 can be determined using standard epitope mapping techniques.
  • Epitope mapping techniques well known in the art include Epitope Mapping Protocols in Methods in Molecular Biology, Vol. 66 (Glenn E.Morris, Ed., 1996) Humana Press, Totowa, New Jersey.
  • linear epitopes may be determined by e.g., concurrently synthesizing large numbers of peptides on solid supports, the peptides corresponding to portions of the protein molecule, and reacting the peptides with antibodies while the peptides are still attached to the supports.
  • Such techniques are known in the art and described in, e.g., U.S. Patent No. 4,708,871 ; Geysen et al, (1984) Proc. Natl. Acad. Sci. USA 8:3998-4002; Geysen et al, (1985) Proc. Natl. Acad. Sci. USA 82:78-182; Geysen et al, (1986) Mol. Immunol.
  • conformational epitopes are readily identified by determining spatial conformation of amino acids such as by, e.g., hydrogen/deuterium exchange, x-ray crystallography and two-dimensional nuclear magnetic resonance. See, e.g., Epitope Mapping Protocols, supra.
  • Antigenic regions of proteins can also be identified using standard antigenicity and hydropathy plots, such as those calculated using, e.g., the Omiga version 1.0 software program available from the Oxford Molecular Group. This computer program employs the Hopp/Woods method, Hopp et al, (1981 ) Proc. Natl. Acad. Sci USA 78:3824- 3828; for determining antigenicity profiles, and the Kyte-Doolittle technique, Kyte et al, (1982) J. Mol. Biol. 157: 105-132; for hydropathy plots.
  • a stable lyophilized pharmaceutical formulation comprising an anti-CD19 antibody in a concentration of about 20 mg/ml to about 125 mg/ml, a buffer, polysorbate in a concentration of about 0.005% (w/v) to about 0.06% (w/v), and pH of about 6.0, wherein the formulation further comprises a) trehalose in a concentration of about 180 mM to about 240 mM
  • a stable lyophilized pharmaceutical formulation comprising an anti-CD19 antibody in a concentration of about 20 mg/ml to about 125 mg/ml, a citrate buffer or phosphate buffer, polysorbate in a concentration of about 0.005% (w/v) to about 0,06% (w/v), and pH of about 6.0, wherein the formulation further comprises a) trehalose in a concentration of about 180 mM to about 240 mM
  • said buffer in the formulation is in a concentration of 10 to 75 mM. In some embodiments, said buffer in the formulation is in a concentration of 20 to 50 mM. In some embodiments, said buffer in the formulation is in a concentration of 20 to 40 mM. In some embodiments, said buffer in the formulation is in a concentration of 20 to 30 mM. In some embodiments, said buffer in the formulation is in a concentration of about 25 mM. In some embodiments, said buffer in the formulation is in a concentration of 25 mM. In some embodiments, said buffer in the formulation is citrate buffer or phosphate buffer.
  • said citrate buffer in the formulation is in a concentration of of 10 to 75 mM. In some embodiments, said citrate buffer in the formulation is in a concentration of 20 to 50 mM. In some embodiments, said citrate buffer in the formulation is in a concentration of 20 to 30 mM. In some embodiments, said citrate buffer in the formulation is in a concentration of about 25 mM. In some embodiments, said citrate buffer in the formulation is in a concentration of 25 mM.
  • said phosphate buffer in the formulation is in a concentration of of 10 to 75 mM. In some embodiments, said phosphate buffer in the formulation is in a concentration of of 20 to 50 mM. In some embodiments, said phosphate buffer in the formulation is in a concentration of 20 to 30 mM. In some embodiments, said phosphate buffer in the formulation is in a concentration of about 25 mM. In some embodiments, said phosphate buffer in the formulation is in a concentration of 25 mM.
  • a stable lyophilized pharmaceutical formulation comprising an anti-CD19 antibody in a concentration of about 20 mg/ml to about 125 mg/ml, a citrate buffer or phosphate buffer in a concentration of of 20 to 50 mM, polysorbate in a concentration of about 0.005% (w/v) to about 0,06% (w/v), and pH of about 6.0, wherein the formulation further comprises a) trehalose in a concentration of about 180 mM to about 240 mM or
  • a stable lyophilized pharmaceutical formulation comprising an anti-CD19 antibody in a concentration of about 20 mg/ml to about 125 mg/ml, a citrate buffer or phosphate buffer in a concentration of about 25 mM, polysorbate in a concentration of about 0.005% (w/v) to about 0,06% (w/v), and pH of about 6.0, wherein the formulation further comprises a) trehalose in a concentration of about 180 mM to about 240 mM or
  • a stable lyophilized pharmaceutical formulation comprising an anti-CD19 antibody in a concentration of about 20 mg/ml to about 125 mg/ml, a citrate buffer in a concentration of about 25 mM, polysorbate in a concentration of about 0.005% (w/v) to about 0,06% (w/v), and pH of about 6.0, wherein the formulation further comprises a) trehalose in a concentration of about 180 mM to about 240 mM
  • a stable lyophilized pharmaceutical formulation comprising an anti-CD19 antibody in a concentration of about 20 mg/ml to about 125 mg/ml, a phosphate buffer in a concentration of about 25 mM, polysorbate in a concentration of about 0.005% (w/v) to about 0,06% (w/v), and pH of about 6.0, wherein the formulation further comprises a) trehalose in a concentration of about 180 mM to about 240 mM
  • said anti-CD19 antibody is a full length antibody.
  • said anti-CD19 antibody is an IgGI, an lgG2, an lgG3 or an lgG4 antibody.
  • said anti-CD19 antibody is a humanized or a human antibody.
  • said anti-CD19 antibody is an antibody fragment comprising an antigen-binding region.
  • said antibody fragment is a Fab or F(ab')2 fragment.
  • said stable lyophilized pharmaceutical formulation is stable at 2-8oC for at least 6 months, at least 12 months, at least 18 months, at least 24 months or at least 36 months.
  • said stable lyophilized pharmaceutical formulation is stable at about 40oC for at least about 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16 or more weeks. In certain embodiments, said stable lyophilized pharmaceutical formulation is stable at about 40oC for at least about 1 , 2, 3, 4, 5 or more months. In certain embodiments, said stable lyophilized pharmaceutical formulation is stable at about 25oC for at least 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12 or more months.
  • said stable lyophilized pharmaceutical formulation is stable at about 5oC for at least 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, 30, 31 , 32, 33, 34, 35, 36, 37, 38, 39, 40, 41 , 42, 43, 44, 45, 46, 47, 48, or more months.
  • said stable lyophilized pharmaceutical formulation is stable at about 5+/-3 oC for at least 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, 30, 31 , 32, 33, 34, 35, 36, 37, 38, 39, 40, 41 , 42, 43, 44, 45, 46, 47, 48, or more months.
  • said stable lyophilized pharmaceutical formulation is stable at about -20oC for at least 1 , 2, 3, 4, 5 , 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, 30, 31 , 32, 33, 34, 35, 36, 37, 38, 39, 40, 41 , 42, 43, 44, 45, 46, 47, 48, or more months.
  • said stable lyophilized pharmaceutical formulation is stable at 5oC or -20oC for at least 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, 30, 31 , 32, 33, 34, 35, 36, 37, 38, 39, 40, 41 , 42, 43, 44, 45, 46, 47, 48, or more months.
  • the anti-CD19 antibody in the formulation retains at least 60%, at least 70%, at least 80%, at least 90%, at least 95% of its biological activity after storage.
  • the biological activity is measured by antibody binding to CD19.
  • the biological activity is measured by antibody binding to CD19 in a FACS CD19 binding assay.
  • the biological activity is measured by ADCC activity of said anti-CD19 antibody.
  • stable lyophilized pharmaceutical formulation is sterile.
  • said stable lyophilized pharmaceutical formulation is suitable to be administered to a subject. In a further embodiment said said stable lyophilized pharmaceutical formulation is suitable for intravenous (IV) administration or subcutaneous administration.
  • an article of manufacture comprising a container holding the stable lyophilized pharmaceutical formulation as disclosed herein.
  • said container is a glass vial or a metal alloy container.
  • the metal alloy is 316L stainless steel or hastelloy.
  • provided herein is method of treating a disease or disorder in a subject comprising administering an effective amount of the formulation disclosed herein to the subject, wherein the disease or disorder is cancer.
  • the use of the stable lyophilized pharmaceutical formulation as disclosed herein for the treatment of a disease or disorder in a subject comprising administering an effective amount of said formulation to the subject, wherein the disease or disorder is cancer.
  • the disease or disorder is non-Hodgkin's lymphoma (including each the subtypes described herein), chronic lymphocytic leukemia and/or acute lymphoblastic leukemia.
  • the non- Hodgkin's lymphoma is selected from the group consisting of follicular lymphoma, small lymphocytic lymphoma, mucosa-associated lymphoid tissue, marginal zone, diffuse large B cell, Burkitt's, and mantle cell.
  • a stable lyophilized pharmaceutical formulation comprising an anti-CD19 antibody in a concentration of about 20 mg/ml to about 125 mg/ml, a citrate buffer in a concentration of about 25 mM, polysorbate in a concentration of about 0.005% (w/v) to about 0,06% (w/v), and pH of about 6.0, wherein the formulation further comprises a) trehalose in a concentration of about 180 mM to about 240 mM
  • said anti-CD19 antibody comprises an HCDR1 region of sequence SYVMH (SEQ ID NO: 1 ), an HCDR2 region of sequence NPYNDG (SEQ ID NO: 2), an HCDR3 region of sequence GTYYYGTRVFDY (SEQ ID NO: 3), an LCDR1 region of sequence RSSKSLQNVNGNTYLY (SEQ ID NO: 4), an LCDR2 region of sequence RMSNLNS (SEQ ID NO: 5), and an LCDR3 region of sequence MQHLEYPIT (SEQ ID NO: 6).
  • a stable lyophilized pharmaceutical formulation comprising an anti-CD19 antibody in a concentration of about 20 mg/ml to about 125 mg/ml, a citrate buffer in a concentration of about 25 mM, polysorbate in a concentration of about 0.005% (w/v) to about 0,06% (w/v), and pH of about 6.0, wherein the formulation further comprises a) trehalose in a concentration of about 180 mM to about 240 mM
  • RFSGSGSGTEFTLTISSLEPEDFAVYYCMQHLEYPITFGAGTKLEIK SEQ ID NO: 1 1 .
  • a stable lyophilized pharmaceutical formulation comprising an anti-CD19 antibody in a concentration of about 20 mg/ml to about 125 mg/ml, a citrate buffer in a concentration of about 25 mM, polysorbate in a concentration of about 0.005% (w/v) to about 0,06% (w/v), and pH of about 6.0, wherein the formulation further comprises a) trehalose in a concentration of about 180 mM to about 240 mM
  • a stable lyophilized pharmaceutical formulation comprising an anti-CD19 antibody in a concentration of about 40 mg/ml, a citrate buffer in a concentration of about 25 mM, polysorbate in a concentration of about 0.02% (w/v), and pH of about 6.0, wherein the formulation further comprises
  • said anti-CD19 antibody comprises an HCDR1 region of sequence SYVMH (SEQ ID NO: 1 ), an HCDR2 region of sequence NPYNDG (SEQ ID NO: 2), an HCDR3 region of sequence GTYYYGTRVFDY (SEQ ID NO: 3), an LCDR1 region of sequence RSSKSLQNVNGNTYLY (SEQ ID NO: 4), an LCDR2 region of sequence RMSNLNS (SEQ ID NO: 5), and an LCDR3 region of sequence MQHLEYPIT (SEQ ID NO: 6).
  • a stable lyophilized pharmaceutical formulation comprising an anti-CD19 antibody in a concentration of about 40 mg/ml, a citrate buffer in a concentration of about 25 mM, polysorbate in a concentration of about 0.02% (w/v), and pH of about 6.0, wherein the formulation further comprises
  • a stable lyophilized pharmaceutical formulation comprising an anti-CD19 antibody in a concentration of about 40 mg/ml, a citrate buffer in a concentration of about 25 mM, polysorbate in a concentration of about 0.02% (w/v), and pH of about 6.0, wherein the formulation further comprises
  • a stable lyophilized pharmaceutical formulation comprising an anti-CD19 antibody in a concentration of about 40 mg/ml, a citrate buffer in a concentration of about 25 mM, polysorbate in a concentration of about 0.02% (w/v), and pH of about 6.0, wherein the formulation further comprises
  • variable light chain having at least 85%, 86%, 87%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to the sequence DIVMTQSPATLSLSPGERATLSCRSSKSLQNVNGNTYLYWFQQKPGQSPQLLIYRMSNLNSGVPD RFSGSGSGTEFTLTISSLEPEDFAVYYCMQHLEYPITFGAGTKLEIK (SEQ ID NO: 1 1 ).
  • a stable lyophilized pharmaceutical formulation comprising an anti-CD19 antibody in a concentration of about 40 mg/ml, a citrate buffer in a concentration of about 25 mM, polysorbate in a concentration of about 0.02% (w/v), and pH of about 6.0, wherein the formulation further comprises
  • a stable lyophilized pharmaceutical formulation comprising an anti-CD19 antibody in a concentration of about 40 mg/ml, a citrate buffer in a concentration of about 25 mM, polysorbate in a concentration of about 0.02% (w/v), and pH of about 6.0, wherein the formulation further comprises trehalose in a concentration of about 200 mM, wherein said anti-CD19 antibody comprises an HCDR1 region of sequence SYVMH (SEQ ID NO: 1 ), an HCDR2 region of sequence NPYNDG (SEQ ID NO: 2), an HCDR3 region of sequence GTYYYGTRVFDY (SEQ ID NO: 3), an LCDR1 region of sequence RSSKSLQNVNGNTYLY (SEQ ID NO: 4), an LCDR2 region of sequence RMSNLNS (SEQ ID NO: 5), and an LCDR3 region of sequence MQHLEYPIT (SEQ ID NO: 6).
  • a stable lyophilized pharmaceutical formulation comprising an anti-CD19 antibody in a concentration of about 40 mg/ml, a citrate buffer in a concentration of about 25 mM, polysorbate in a concentration of about 0.02% (w/v), and pH of about 6.0, wherein the formulation further comprises Mannitol in a concentration of about 219 mM and Sucrose in a concentration of about 29mM, wherein said anti-CD19 antibody comprises an HCDR1 region of sequence SYVMH (SEQ ID NO: 1 ), an HCDR2 region of sequence NPYNDG (SEQ ID NO: 2), an HCDR3 region of sequence GTYYYGTRVFDY (SEQ ID NO: 3), an LCDR1 region of sequence RSSKSLQNVNGNTYLY (SEQ ID NO: 4), an LCDR2 region of sequence RMSNLNS (SEQ ID NO: 5), and an LCDR3 region of sequence MQHLEYPIT (SEQ ID NO:
  • a stable lyophilized pharmaceutical formulation comprising an anti-CD19 antibody in a concentration of about 40 mg/ml, a citrate buffer in a concentration of about 25 mM, polysorbate in a concentration of about 0.02% (w/v), and pH of about 6.0, wherein the formulation further comprises trehalose in a concentration of about 200 mM wherein said anti-CD19 antibody comprises a variable heavy chain of the sequence EVQLVESGGGLVKPGGSLKLSCAASGYTFTSYVMHWVRQAPGKGLEWIGYINPYNDGTKYNEKF QGRVTISSDKSISTAYMELSSLRSEDTAMYYCARGTYYYGTRVFDYWGQGTLVTVSS
  • a stable lyophilized pharmaceutical formulation comprising an anti-CD19 antibody in a concentration of about 40 mg/ml, a citrate buffer in a concentration of about 25 mM, polysorbate in a concentration of about 0.02% (w/v), and pH of about 6.0, wherein the formulation further comprises Mannitol in a concentration of about 219 mM and Sucrose in a concentration of about 29mM, wherein said anti-CD19 antibody comprises a variable heavy chain of the sequence EVQLVESGGGLVKPGGSLKLSCAASGYTFTSYVMHWVRQAPGKGLEWIGYINPYNDGTKYNEKF
  • a stable lyophilized pharmaceutical formulation comprising an anti-CD19 antibody in a concentration of about 40 mg/ml, a citrate buffer in a concentration of about 25 mM, polysorbate in a concentration of about 0.02% (w/v), and pH of about 6.0, wherein the formulation further comprises trehalose in a concentration of about 200 mM, wherein said anti-CD19 antibody comprises a heavy chain constant domain of the sequence
  • a stable lyophilized pharmaceutical formulation comprising an anti-CD19 antibody in a concentration of about 40 mg/ml, a citrate buffer in a concentration of about 25 mM, polysorbate in a concentration of about 0.02% (w/v), and pH of about 6.0, wherein the formulation further comprises Mannitol in a concentration of about 219 mM and Sucrose in a concentration of about 29mM, wherein said anti-CD19 antibody comprises a heavy chain constant domain of the sequence
  • a stable lyophilized pharmaceutical formulation comprising an anti-CD19 antibody in a concentration of about 40 mg/ml, a phosphate buffer in a concentration of 20 to 40 mM, polysorbate in a concentration of about 0.02% (w/v), and pH of about 6.0, wherein the formulation further comprises trehalose in a concentration of about 200 mM, wherein said anti-CD19 antibody comprises a heavy chain constant domain of the sequence
  • a stable lyophilized pharmaceutical formulation comprising an anti-CD19 antibody in a concentration of about 40 mg/ml, a phosphate buffer in a concentration of 20 to 40 mM, polysorbate in a concentration of about 0.02% (w/v), and pH of about 6.0, wherein the formulation further comprises Mannitol in a concentration of about 219 mM and Sucrose in a concentration of about 29mM, wherein said anti-CD19 antibody comprises a heavy chain constant domain of the sequence
  • a stable lyophilized pharmaceutical formulation comprising an anti-CD19 antibody in a concentration of about 40 mg/ml, a phosphate buffer in a concentration of about 25 mM, polysorbate in a concentration of about 0.02% (w/v), and pH of about 6.0, wherein the formulation further comprises trehalose in a concentration of about 200 mM, wherein said anti-CD19 antibody comprises a heavy chain constant domain of the sequence
  • a stable lyophilized pharmaceutical formulation comprising an anti-CD19 antibody in a concentration of about 40 mg/ml, a phosphate buffer in a concentration of about 25 mM, polysorbate in a concentration of about 0.02% (w/v), and pH of about 6.0, wherein the formulation further comprises Mannitol in a concentration of about 219 mM and Sucrose in a concentration of about 29mM, wherein said anti-CD19 antibody comprises a heavy chain constant domain of the sequence
  • a stable lyophilized pharmaceutical formulation comprising an anti-CD19 antibody in a concentration of 40 mg/ml, a citrate buffer in a concentration of 25 mM, polysorbate in a concentration of 0.02% (w/v), and pH of 6.0, wherein the formulation further comprises trehalose in a concentration of 200 mM, wherein said anti-CD19 antibody comprises an HCDR1 region of sequence SYVMH (SEQ ID NO: 1 ), an HCDR2 region of sequence NPYNDG (SEQ ID NO: 2), an HCDR3 region of sequence GTYYYGTRVFDY (SEQ ID NO: 3), an LCDR1 region of sequence RSSKSLQNVNGNTYLY (SEQ ID NO: 4), an LCDR2 region of sequence RMSNLNS (SEQ ID NO: 5), and an LCDR3 region of sequence MQHLEYPIT (SEQ ID NO: 6).
  • a stable lyophilized pharmaceutical formulation comprising an anti-CD19 antibody in a concentration of 40 mg/ml, a citrate buffer in a concentration of 25 mM, polysorbate in a concentration of 0.02% (w/v), and pH of 6.0, wherein the formulation further comprises Mannitol in a concentration of 219 mM and Sucrose in a concentration of 29mM, wherein said anti-CD19 antibody comprises an HCDR1 region of sequence SYVMH (SEQ ID NO: 1 ), an HCDR2 region of sequence NPYNDG (SEQ ID NO: 2), an HCDR3 region of sequence GTYYYGTRVFDY (SEQ ID NO: 3), an LCDR1 region of sequence RSSKSLQNVNGNTYLY (SEQ ID NO: 4), an LCDR2 region of sequence RMSNLNS (SEQ ID NO: 5), and an LCDR3 region of sequence MQHLEYPIT (SEQ ID NO: 6).
  • a stable lyophilized pharmaceutical formulation comprising an anti-CD19 antibody in a concentration of 40 mg/ml, a citrate buffer in a concentration of 25 mM, polysorbate in a concentration of 0.02% (w/v), and pH of 6.0, wherein the formulation further comprises trehalose in a concentration of 200 mM wherein said anti-CD19 antibody comprises a variable heavy chain of the sequence
  • a stable lyophilized pharmaceutical formulation comprising an anti-CD19 antibody in a concentration of 40 mg/ml, a citrate buffer in a concentration of 25 mM, polysorbate in a concentration of 0.02% (w/v), and pH of 6.0, wherein the formulation further comprises Mannitol in a concentration of 219 mM and Sucrose in a concentration of 29mM, wherein said anti-CD19 antibody comprises a variable heavy chain of the sequence
  • a stable lyophilized pharmaceutical formulation comprising an anti-CD19 antibody in a concentration of 40 mg/ml, a citrate buffer in a concentration of 25 mM, polysorbate in a concentration of 0.02% (w/v), and pH of 6.0, wherein the formulation further comprises trehalose in a concentration of 200 mM, wherein said anti-CD19 antibody comprises a heavy chain constant domain of the sequence
  • a stable lyophilized pharmaceutical formulation comprising an anti-CD19 antibody in a concentration of 40 mg/ml, a phosphate buffer in a concentration of 25 mM, polysorbate in a concentration of 0.02% (w/v), and pH of 6.0, wherein the formulation further comprises trehalose in a concentration of 200 mM, wherein said anti-CD19 antibody comprises a heavy chain constant domain of the sequence
  • a stable lyophilized pharmaceutical formulation comprising an anti-CD19 antibody in a concentration of 40 mg/ml, a citrate buffer in a concentration of 25 mM, polysorbate in a concentration of 0.02% (w/v), and pH of 6.0, wherein the formulation further comprises Mannitol in a concentration of 219 mM and Sucrose in a concentration of 29mM, wherein said anti-CD19 antibody comprises a heavy chain constant domain of the sequence ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL SSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPDVFLFPPKPK DTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQD WLNGKEYKCKVSNKALPAPEEKTIS
  • a stable lyophilized pharmaceutical formulation comprising an anti-CD19 antibody in a concentration of 40 mg/ml, a phosphate buffer in a concentration of 25 mM, polysorbate in a concentration of 0.02% (w/v), and pH of 6.0, wherein the formulation further comprises Mannitol in a concentration of 219 mM and Sucrose in a concentration of 29mM, wherein said anti-CD19 antibody comprises a heavy chain constant domain of the sequence
  • MOR208 The biophysical properties of MOR208 were analyzed for the purpose of characterization, preformulation-screening and high concentration feasibility.
  • MOR208 samples were diluted to a concentration of 1 .1 mg/mL.
  • the hydrophobic dye sypro-orange was added to detect unfolding of the protein and respective melting curves were generated.
  • the samples showed a relatively low melting temperature of 47 oC indicated by a step increase i n fluorescence.
  • MOR208 is a humanized monoclonal antibody binding to CD19 on B-cells and their progenitors.
  • the Fc region has been engineered (S239D/ I332E) to enhance the effector functions supporting B-cell depletion. According to the current working hypothesis this Fc region format leads to CH2 domain flexibility, which results in enhanced ADCC potency but may be accompanied with adecreased melting temperature of the Fc domain.
  • MgCI 2 The impact of MgCI 2 on the thermal stability of MOR208 was tested using concentrations of 1 , 5 and 10 mM. The results of the DSC and RALS measurements showed no significant impact of MgCI 2 at the tested concentrations on the thermal stability of MOR208.
  • Formulation F1 10 mM Citrate, pH 6.0 + 0.01 % PS 20 + 150 mM NaCI
  • Formulation F2 25 mM Citrate, pH 6.0 + 0.02 % PS 20 + 125 mM NaCI
  • Formulation F3 25 mM Citrate, pH 6.0 + 0.02 % PS 20 + 200 mM Trehalose
  • Formulation F4 25 mM Citrate, pH 6.0 + 0.02 % PS 20 + 210 mM Sucrose
  • Formulation F5 25 mM Histidine, pH 6.0 + 0.02 % PS 20 + 140 mM NaCI
  • Formulation F6 25 mM Histidine, pH 6.0 + 0.02 % PS 20 + 230 mM Trehalose ⁇
  • Formulation F7 25 mM Succinat, pH 6.0 + 0.02 % PS 20 + 215 mM Trehalose
  • the protein concentration was 20 mg/mL for all formulations. From each formulation 10 mL were filled in a 10 mL vial, closed with a coated rubber stopper and stored upside down at a controlled temperature of 25oC for 12 weeks. Analytical testin g was performed prior storage (tO) after 4, 8 and 12 weeks.
  • Formulations 1 , 3, 5 and 7 generated less subvisible particles over 12 weeks compared to the other formulations.
  • the particles were measured by MFI.
  • Formulation 5 showed the lowest number of SVP in the range >10 ⁇ and >25 ⁇ .
  • the shift in pH also indicates the degradation of sucrose in formulation 4.
  • formulations 6, 7 and 8 showed a stronger decrease in peak 3 area% compared to the other formulations.
  • formulation 8 showed a strong reduction from 66.1 % (initial value) to 52.2% after 12 weeks.
  • the physicochemical characterization of MOR208 identified the most stable pH range between pH 6.0 and 7.0.
  • Citrate, Histidine and Succinate buffer were selected as pharmaceutical acceptable buffer systems in the mentioned pH range. All buffer systems were used at a concentration of 25 mM providing sufficient buffer capacity for a protein concentration of 20 mg/mL.
  • the addition of NaCI at a minimum concentration of 125 mM had a weak positive effect on the thermal stability of MOR208 (based on DSC data).
  • the addition of sucrose, trehalose, mannitol/sucrose and polysorbate 20 did not alter the thermal stability of MOR208.
  • Formulations 1 and 5 provided the highest stability but all liquid formulations generated subvisible particles after 8 months above the pharmacopeia specifications (NMT 6000 particles ⁇ 10/ m per vial and NMT 600 particles ⁇ 25 ⁇ m per vial). Therfore the desired shelf life of at least 24 months at 2-8oC was not be reached by one of the tested liqui d formulations with 20 mg/mL protein.
  • the appearance of the lyo cake for both formulations was acceptable.
  • the trehalose containing formulation was completely amorphous and shows a higher degree of shrinkage which is just a cosmetic observation and is typically not linked to product quality or stability.
  • the mannitol containing formulation was partially cristalline and provides a cake of high pharmaceutical elegance without shrinkage.
  • HP-SEC testing showed a higher increase in aggregates for F9 after 3 months of storage (Table 3).
  • the aggregate level for F3 increased from 0.8% to 1.7% where the aggregate level of F9 increased from 0.8% to 2.6%.
  • formulation 3 containing trehalose showed a higher stability at 40oC compared to formulation 9. Differences in stability were seen in SVP (MFI) and aggregate level (HPSEC).
  • the lyophilization feasibility study showed that MOR208 can be freeze dried without an impact on product quality using both formulations and a protein concentration of 40 mg/mL.
  • the stability conditions were 40oC (75% rH) over a period of 3 mo nths.
  • the trehalose containing formulation was identified with a higher stability compared to the mannitol/sucrose formulation.
  • the performed stability studies comprise stability indicating and state of the art methods to monitor Drug Products regarding concentration, activity, purity, pharmaceutical and microbiological parameters during storage.
  • the product specific activity assays CD19 binding assay (FACS), CD16 binding assay (SPR) and ADCC potency assay showed sensitivity to a relevant stress sample.
  • MOR208 The functional activity of MOR208 was monitored with three different activity assays: CD19 binding assay (FACS), CD16 binding assay (SPR) and an ADCC based potency assay. With the combination of these three assays the antigen binding, the relevant effector binding as well as the major mode of action (ADCC) are covered.
  • FACS CD19 binding assay
  • SPR CD16 binding assay
  • ADCC ADCC based potency assay
  • ADCC based potency assay shows some increase over time (both under real term and accelerated conditions) but as the assay also shows a higher variability the tendency is not yet considered to be significant.
  • all content and activity assays are well within the specification and do not indicate any critical changes in product quality over 36 months.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Immunology (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • Molecular Biology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biochemistry (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Mycology (AREA)
  • Microbiology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Oil, Petroleum & Natural Gas (AREA)
  • Inorganic Chemistry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Endocrinology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicinal Preparation (AREA)
  • Peptides Or Proteins (AREA)
PCT/EP2017/065819 2016-06-27 2017-06-27 Anti-cd19 antibody formulations Ceased WO2018002031A1 (en)

Priority Applications (31)

Application Number Priority Date Filing Date Title
LTEP17735440.4T LT3475303T (lt) 2016-06-27 2017-06-27 Anti-cd19 antikūno kompozicijos
EP17735440.4A EP3475303B1 (en) 2016-06-27 2017-06-27 Anti-cd19 antibody formulations
RU2019100221A RU2748024C2 (ru) 2016-06-27 2017-06-27 Составы на основе антитела к CD19
SG11201810429UA SG11201810429UA (en) 2016-06-27 2017-06-27 Anti-cd19 antibody formulations
JP2018567742A JP2019524671A (ja) 2016-06-27 2017-06-27 抗cd19抗体製剤
KR1020197002043A KR102533875B1 (ko) 2016-06-27 2017-06-27 항-cd19 항체 제제
PL17735440T PL3475303T3 (pl) 2016-06-27 2017-06-27 Formulacje przeciwciała anty-cd19
ES17735440T ES2874640T3 (es) 2016-06-27 2017-06-27 Formulaciones de anticuerpos anti-CD19
MA45450A MA45450B1 (fr) 2016-06-27 2017-06-27 Formulations d'anticorps anti-cd19
MDE20190533T MD3475303T2 (ro) 2016-06-27 2017-06-27 Formulări de anticorp anti-CD19
NZ748681A NZ748681B2 (en) 2017-06-27 Anti-cd19 antibody formulations
SM20210317T SMT202100317T1 (it) 2016-06-27 2017-06-27 Formulazioni di anticorpi anti-cd19
DK17735440.4T DK3475303T3 (da) 2016-06-27 2017-06-27 Anti-cd19-antistofformuleringer
SI201730801T SI3475303T1 (sl) 2016-06-27 2017-06-27 Formulacija protitelesa proti CD19
AU2017289085A AU2017289085B2 (en) 2016-06-27 2017-06-27 Anti-CD19 antibody formulations
IL263764A IL263764B2 (en) 2016-06-27 2017-06-27 Anti-cd19 antibody formulations
KR1020237016157A KR20230074823A (ko) 2016-06-27 2017-06-27 항-cd19 항체 제제
CN201780039737.6A CN109415440B (zh) 2016-06-27 2017-06-27 抗-cd19抗体制剂
US16/310,555 US11352423B2 (en) 2016-06-27 2017-06-27 Anti-CD19 antibody formulations
MX2018016362A MX2018016362A (es) 2016-06-27 2017-06-27 Formulaciones de anticuerpo anti-cd19.
EP21167818.0A EP3909985A1 (en) 2016-06-27 2017-06-27 Anti-cd19 antibody formulations
CA3029137A CA3029137A1 (en) 2016-06-27 2017-06-27 Anti-cd19 antibody formulations
HRP20210945TT HRP20210945T1 (hr) 2016-06-27 2017-06-27 Formulacije protutijela anti-cd19
CN202211458395.0A CN115998859A (zh) 2016-06-27 2017-06-27 抗-cd19抗体制剂
RS20210748A RS62035B1 (sr) 2016-06-27 2017-06-27 Formulacije anti-cd19 antitela
ZA2019/00483A ZA201900483B (en) 2016-06-27 2019-01-23 Anti-cd19 antibody formulations
CY20211100532T CY1124521T1 (el) 2016-06-27 2021-06-14 Σκευασματα αντισωματος anti-cd19
US17/700,809 US20220213190A1 (en) 2016-06-27 2022-03-22 Anti-cd19 antibody formulations
JP2022081779A JP7603201B2 (ja) 2016-06-27 2022-05-18 抗cd19抗体製剤
JP2024083988A JP7824990B2 (ja) 2016-06-27 2024-05-23 抗cd19抗体製剤
AU2024205042A AU2024205042A1 (en) 2016-06-27 2024-07-24 Anti-CD19 antibody formulations

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
EP16176322.2 2016-06-27
EP16176322 2016-06-27

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US16/310,555 A-371-Of-International US11352423B2 (en) 2016-06-27 2017-06-27 Anti-CD19 antibody formulations
US17/700,809 Continuation US20220213190A1 (en) 2016-06-27 2022-03-22 Anti-cd19 antibody formulations

Publications (1)

Publication Number Publication Date
WO2018002031A1 true WO2018002031A1 (en) 2018-01-04

Family

ID=56368805

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2017/065819 Ceased WO2018002031A1 (en) 2016-06-27 2017-06-27 Anti-cd19 antibody formulations

Country Status (26)

Country Link
US (2) US11352423B2 (https=)
EP (2) EP3475303B1 (https=)
JP (3) JP2019524671A (https=)
KR (2) KR102533875B1 (https=)
CN (2) CN109415440B (https=)
AU (2) AU2017289085B2 (https=)
CA (1) CA3029137A1 (https=)
CY (1) CY1124521T1 (https=)
DK (1) DK3475303T3 (https=)
ES (1) ES2874640T3 (https=)
HR (1) HRP20210945T1 (https=)
HU (1) HUE054296T2 (https=)
IL (1) IL263764B2 (https=)
LT (1) LT3475303T (https=)
MA (1) MA45450B1 (https=)
MD (1) MD3475303T2 (https=)
MX (1) MX2018016362A (https=)
PL (1) PL3475303T3 (https=)
PT (1) PT3475303T (https=)
RS (1) RS62035B1 (https=)
RU (1) RU2748024C2 (https=)
SG (2) SG10201912369QA (https=)
SI (1) SI3475303T1 (https=)
SM (1) SMT202100317T1 (https=)
WO (1) WO2018002031A1 (https=)
ZA (1) ZA201900483B (https=)

Cited By (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2021067598A1 (en) 2019-10-04 2021-04-08 Ultragenyx Pharmaceutical Inc. Methods for improved therapeutic use of recombinant aav
WO2021084063A1 (en) 2019-10-31 2021-05-06 Morphosys Ag Anti-tumor combination therapy comprising anti-cd19 antibody and gamma delta t-cells
WO2021259902A1 (en) 2020-06-22 2021-12-30 Morphosys Ag Anti-tumor combination therapy comprising anti-cd19 antibody and polypeptides blocking the sirpα-cd47 innate immune checkpoint
WO2022074206A1 (en) 2020-10-08 2022-04-14 Affimed Gmbh Trispecific binders
WO2023007023A1 (en) 2021-07-30 2023-02-02 Affimed Gmbh Duplexbodies
WO2023073645A1 (en) 2021-10-29 2023-05-04 Takeda Pharmaceutical Company Limited Therapy comprising anti-cd19 antibody and sumo-activating enzyme inhibitor
WO2023078968A1 (en) 2021-11-03 2023-05-11 Affimed Gmbh Bispecific cd16a binders
WO2023215674A1 (en) * 2022-05-03 2023-11-09 Xencor, Inc. Methods for treating lymphoma
WO2024038115A1 (en) 2022-08-17 2024-02-22 Morphosys Ag Therapy comprising anti-cd19 antibody and ezh2 modulators
US12194095B2 (en) 2015-08-21 2025-01-14 Incyte Corporation Combinations and uses thereof
US12358983B2 (en) 2016-10-28 2025-07-15 Incyte Corporation Combination of anti CD19 antibody with a BCL-2 inhibitor and uses thereof
US12491244B2 (en) 2018-09-12 2025-12-09 GC Cell Corporation Pharmaceutical combinations for treating tumor comprising anti-CD19 antibody and natural killer cell

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR102735988B1 (ko) 2019-02-18 2024-12-03 일라이 릴리 앤드 캄파니 치료 항체 제제
IL322510A (en) * 2023-03-02 2025-10-01 Novetide Ltd Method for preparing GLP-1 peptides with controlled particle size
CN120754244B (zh) * 2025-09-10 2025-12-12 江苏豪森药业集团有限公司 一种含抗cd19抗体的药物组合物及其用途

Citations (17)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4708871A (en) 1983-03-08 1987-11-24 Commonwealth Serum Laboratories Commission Antigenically active amino acid sequences
WO2003048731A2 (en) 2001-12-03 2003-06-12 Abgenix, Inc. Antibody categorization based on binding characteristics
WO2005012493A2 (en) 2003-07-31 2005-02-10 Immunomedics, Inc. Anti-cd19 antibodies
WO2007002223A2 (en) 2005-06-20 2007-01-04 Medarex, Inc. Cd19 antibodies and their uses
WO2007076950A1 (en) 2005-12-30 2007-07-12 Merck Patent Gmbh Anti-cd19 antibodies with reduced immunogenicity
WO2008022152A2 (en) 2006-08-14 2008-02-21 Xencor, Inc. Optimized antibodies that target cd19
WO2008031056A2 (en) 2006-09-08 2008-03-13 Medimmune, Llc Humanized anti-cd19 antibodies and their use in treatment of oncology, transplantation and autoimmune disease
WO2008150494A1 (en) 2007-05-30 2008-12-11 Xencor, Inc. Methods and compositions for inhibiting cd32b expressing cells
WO2009052431A2 (en) 2007-10-19 2009-04-23 Seattle Genetics, Inc. Cd19 binding agents and uses thereof
WO2010053716A1 (en) 2008-11-07 2010-05-14 Immunomedics, Inc. Improved anti-cd19 antibodies
WO2010095031A2 (en) 2009-02-23 2010-08-26 Glenmark Pharmaceuticals S.A. Humanized antibodies that bind to cd19 and their uses
WO2011147834A1 (en) 2010-05-26 2011-12-01 Roche Glycart Ag Antibodies against cd19 and uses thereof
WO2012010561A1 (en) 2010-07-19 2012-01-26 International - Drug - Development - Biotech Anti-cd19 antibody having adcc function with improved glycosylation profile
WO2012010562A1 (en) 2010-07-19 2012-01-26 International - Drug - Development - Biotech Anti-cd19 antibody having adcc and cdc functions and improved glycosylation profile
WO2012156455A1 (en) 2011-05-17 2012-11-22 Sanofi Use of anti-cd19 maytansinoid immunoconjugate antibody for the treatment of b-cell malignancies symptoms
WO2015075201A1 (en) * 2013-11-21 2015-05-28 Genmab A/S Antibody-drug conjugate lyophilised formulation
WO2015157286A1 (en) * 2014-04-07 2015-10-15 Seattle Genetics, Inc. Stable formulations for anti-cd19 antibodies and antibody-drug conjugates

Family Cites Families (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20080260731A1 (en) * 2002-03-01 2008-10-23 Bernett Matthew J Optimized antibodies that target cd19
CN101874042B9 (zh) 2007-09-26 2019-01-01 中外制药株式会社 利用cdr的氨基酸取代来改变抗体等电点的方法
EP2196476A1 (en) * 2008-12-10 2010-06-16 Novartis Ag Antibody formulation
MX2011009312A (es) * 2009-03-06 2012-02-29 Medimmune Llc Formulaciones de anticuerpos humanizados anti-cd19.
US20140004131A1 (en) * 2012-05-04 2014-01-02 Novartis Ag Antibody formulation
CN110538322A (zh) 2013-03-13 2019-12-06 豪夫迈·罗氏有限公司 抗体配制剂
IL269947B (en) 2013-03-13 2022-08-01 Genentech Inc Formulations with reduced oxidation
US10513555B2 (en) * 2013-07-04 2019-12-24 Prothena Biosciences Limited Antibody formulations and methods
MX375378B (es) 2013-09-27 2025-03-06 Genentech Inc Formulaciones de anticuerpos anti-pdl1.

Patent Citations (20)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4708871A (en) 1983-03-08 1987-11-24 Commonwealth Serum Laboratories Commission Antigenically active amino acid sequences
WO2003048731A2 (en) 2001-12-03 2003-06-12 Abgenix, Inc. Antibody categorization based on binding characteristics
WO2005012493A2 (en) 2003-07-31 2005-02-10 Immunomedics, Inc. Anti-cd19 antibodies
US7109304B2 (en) 2003-07-31 2006-09-19 Immunomedics, Inc. Humanized anti-CD19 antibodies
WO2007002223A2 (en) 2005-06-20 2007-01-04 Medarex, Inc. Cd19 antibodies and their uses
US8097703B2 (en) 2005-06-20 2012-01-17 Medarex, Inc. CD19 antibodies and their uses
WO2007076950A1 (en) 2005-12-30 2007-07-12 Merck Patent Gmbh Anti-cd19 antibodies with reduced immunogenicity
WO2008022152A2 (en) 2006-08-14 2008-02-21 Xencor, Inc. Optimized antibodies that target cd19
WO2008031056A2 (en) 2006-09-08 2008-03-13 Medimmune, Llc Humanized anti-cd19 antibodies and their use in treatment of oncology, transplantation and autoimmune disease
WO2008150494A1 (en) 2007-05-30 2008-12-11 Xencor, Inc. Methods and compositions for inhibiting cd32b expressing cells
US7968687B2 (en) 2007-10-19 2011-06-28 Seattle Genetics, Inc. CD19 binding agents and uses thereof
WO2009052431A2 (en) 2007-10-19 2009-04-23 Seattle Genetics, Inc. Cd19 binding agents and uses thereof
WO2010053716A1 (en) 2008-11-07 2010-05-14 Immunomedics, Inc. Improved anti-cd19 antibodies
WO2010095031A2 (en) 2009-02-23 2010-08-26 Glenmark Pharmaceuticals S.A. Humanized antibodies that bind to cd19 and their uses
WO2011147834A1 (en) 2010-05-26 2011-12-01 Roche Glycart Ag Antibodies against cd19 and uses thereof
WO2012010561A1 (en) 2010-07-19 2012-01-26 International - Drug - Development - Biotech Anti-cd19 antibody having adcc function with improved glycosylation profile
WO2012010562A1 (en) 2010-07-19 2012-01-26 International - Drug - Development - Biotech Anti-cd19 antibody having adcc and cdc functions and improved glycosylation profile
WO2012156455A1 (en) 2011-05-17 2012-11-22 Sanofi Use of anti-cd19 maytansinoid immunoconjugate antibody for the treatment of b-cell malignancies symptoms
WO2015075201A1 (en) * 2013-11-21 2015-05-28 Genmab A/S Antibody-drug conjugate lyophilised formulation
WO2015157286A1 (en) * 2014-04-07 2015-10-15 Seattle Genetics, Inc. Stable formulations for anti-cd19 antibodies and antibody-drug conjugates

Non-Patent Citations (27)

* Cited by examiner, † Cited by third party
Title
"Epitope Mapping Protocols in Methods in Molecular Biology", vol. 66, 1996, HUMANA PRESS
"Peptide and Protein Drug Delivery", 1991, MARCEL DEKKER, INC., pages: 247 - 301
ANDERSON ET AL., BLOOD, vol. 63, 1984, pages 1424 - 1433
CHOTHIA C; LESK AM.: "Canonical structures for the hypervariable regions of immunoglobulins.", J MOL BIOL., vol. 196, no. 4, 1987, pages 901 - 917, XP024010426, DOI: doi:10.1016/0022-2836(87)90412-8
CLELAND ET AL., CRITICAL REVIEWS IN THERAPEUTIC DRUG CARRIER SYSTEMS, vol. 10, no. 4, 1993, pages 307 - 377
CLELAND J L ET AL: "A specific molar ratio of stabilizer to protein is required for storage stability of a lyophilized monoclonal antibody", JOURNAL OF PHARMACEUTICAL SCIENCES, AMERICAN PHARMACEUTICAL ASSOCIATION, WASHINGTON, US, vol. 90, no. 3, 1 March 2001 (2001-03-01), pages 310 - 321, XP008182396, ISSN: 0022-3549 *
CONNOLLY BRIAN D ET AL: "Protein Aggregation in Frozen Trehalose Formulations: Effects of Composition, Cooling Rate, and Storage Temperature", JOURNAL OF PHARMACEUTICAL SCIENCES, ELSEVIER INC, US, vol. 104, no. 12, 1 December 2015 (2015-12-01), pages 4170 - 4184, XP008182395, ISSN: 1520-6017 *
ESTEVES M I ET AL: "STABILISATION OF IMMUNOCONJUGATES BY TREHALOSE", BIOTECHNOLOGY LETTERS, SPRINGER NETHERLANDS, NL, vol. 22, no. 5, 1 January 2000 (2000-01-01), pages 417 - 420, XP009044207, ISSN: 0141-5492, DOI: 10.1023/A:1005605616356 *
GEYSEN ET AL., MOL. IMMUNOL, vol. 23, 1986, pages 709 - 715
GEYSEN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 8, 1984, pages 3998 - 4002
GEYSEN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 78 - 182
GROSSBARD ET AL., BR. J. HAEMATOL, vol. 102, 1998, pages 509 - 515
HOPP ET AL., PROC. NATL. ACAD. SCI USA, vol. 78, 1981, pages 3824 - 3828
JONES, A., ADV. DRUG DELIVERY REV., vol. 10, 1993, pages 29 - 90
KABAT E.A; WU T.T; PERRY H.M.; GOTTESMAN K.S.; FOELLER C.: "Sequences of Proteins of Immunological Interest", 1991, NIH PUBLICATION NO. 91-3242
KYTE ET AL., J.MOL. BIOL., vol. 157, 1982, pages 105 - 132
LOKEN ET AL., BLOOD, vol. 70, 1987, pages 1316 - 1324
NADLER ET AL., ET AL, J. IMMUNOL., vol. 131, 1983, pages 244 - 250
PAWEL ROBAK ET AL: "Emerging immunological drugs for chronic lymphocytic leukemia", EXPERT OPINION ON EMERGING DRUGS, vol. 20, no. 3, 3 July 2015 (2015-07-03), UK, pages 423 - 447, XP055303771, ISSN: 1472-8214, DOI: 10.1517/14728214.2015.1046432 *
SCHEUERMANN, LEUK. LYMPHOMA, vol. 18, 1995, pages 385 - 397
SELVA CORRADO ET AL: "Trehalose preserves the integrity of lyophilized phycoerythrin-antihuman CD8 antibody conjugates and enhances their thermal stability in flow cytometric assays", JOURNAL OF PHARMACEUTICAL SCIENCES, AMERICAN PHARMACEUTICAL ASSOCIATION, WASHINGTON, US, vol. 102, no. 2, 1 February 2013 (2013-02-01), pages 649 - 659, XP002736578, ISSN: 0022-3549, DOI: 10.1002/JPS.23398 *
TREON ET AL., SEMIN. ONCOL, vol. 30, 2003, pages 248 - 252
UCKUN ET AL., BLOOD, vol. 71, 1988, pages 13 - 29
WOJCIECH JURCZAK ET AL: "Single-agent MOR208 salvage and maintenance therapy in a patient with refractory/relapsing diffuse large B-cell lymphoma: a case report", JOURNAL OF MEDICAL CASE REPORTS, vol. 111, no. 12, 14 May 2016 (2016-05-14), pages 5446, XP055312723, DOI: 10.1186/s13256-016-0875-x *
WOYACH J A ET AL: "A phase 1 trial of the Fc-engineered CD19 antibody XmAb5574 (MOR00208) demonstrates safety and preliminary efficacy in relapsed CLL", BLOOD, AMERICAN SOCIETY OF HEMATOLOGY, US, vol. 124, no. 24, 4 December 2014 (2014-12-04), pages 3553 - 3560, XP002737891, ISSN: 0006-4971, [retrieved on 20141009], DOI: 10.1182/BLOOD-2014-08-593269 *
ZHOU CHEN ET AL: "Formation of Stable Nanobubbles on Reconstituting Lyophilized Formulations Containing Trehalose.", JOURNAL OF PHARMACEUTICAL SCIENCES JUL 2016, vol. 105, no. 7, 8 June 2016 (2016-06-08), pages 2249 - 2253, XP008182400, ISSN: 1520-6017 *
ZHOU CHEN ET AL: "Reduced Subvisible Particle Formation in Lyophilized Intravenous Immunoglobulin Formulations Containing Polysorbate 20.", JOURNAL OF PHARMACEUTICAL SCIENCES AUG 2016, vol. 105, no. 8, 9 June 2016 (2016-06-09), pages 2302 - 2309, XP008182399, ISSN: 1520-6017 *

Cited By (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12194095B2 (en) 2015-08-21 2025-01-14 Incyte Corporation Combinations and uses thereof
US12358983B2 (en) 2016-10-28 2025-07-15 Incyte Corporation Combination of anti CD19 antibody with a BCL-2 inhibitor and uses thereof
US12491244B2 (en) 2018-09-12 2025-12-09 GC Cell Corporation Pharmaceutical combinations for treating tumor comprising anti-CD19 antibody and natural killer cell
WO2021067598A1 (en) 2019-10-04 2021-04-08 Ultragenyx Pharmaceutical Inc. Methods for improved therapeutic use of recombinant aav
US12544437B2 (en) 2019-10-04 2026-02-10 Ultragenyx Pharmaceutical Inc. Methods for improved therapeutic use of recombinant AAV
WO2021084063A1 (en) 2019-10-31 2021-05-06 Morphosys Ag Anti-tumor combination therapy comprising anti-cd19 antibody and gamma delta t-cells
EP4706673A2 (en) 2019-10-31 2026-03-11 Incyte Corporation Anti-tumor combination therapy comprising anti-cd19 antibody and gamma delta t-cells
WO2021259902A1 (en) 2020-06-22 2021-12-30 Morphosys Ag Anti-tumor combination therapy comprising anti-cd19 antibody and polypeptides blocking the sirpα-cd47 innate immune checkpoint
WO2022074206A1 (en) 2020-10-08 2022-04-14 Affimed Gmbh Trispecific binders
WO2023007023A1 (en) 2021-07-30 2023-02-02 Affimed Gmbh Duplexbodies
WO2023073645A1 (en) 2021-10-29 2023-05-04 Takeda Pharmaceutical Company Limited Therapy comprising anti-cd19 antibody and sumo-activating enzyme inhibitor
WO2023078968A1 (en) 2021-11-03 2023-05-11 Affimed Gmbh Bispecific cd16a binders
WO2023215674A1 (en) * 2022-05-03 2023-11-09 Xencor, Inc. Methods for treating lymphoma
WO2024038115A1 (en) 2022-08-17 2024-02-22 Morphosys Ag Therapy comprising anti-cd19 antibody and ezh2 modulators

Also Published As

Publication number Publication date
DK3475303T3 (da) 2021-05-31
KR20190021373A (ko) 2019-03-05
EP3475303A1 (en) 2019-05-01
RU2019100221A (ru) 2020-07-28
LT3475303T (lt) 2021-06-25
CY1124521T1 (el) 2022-07-22
NZ748681A (en) 2025-06-27
MX2018016362A (es) 2019-04-22
ZA201900483B (en) 2021-06-30
EP3475303B1 (en) 2021-04-14
ES2874640T3 (es) 2021-11-05
AU2017289085A1 (en) 2018-12-13
RS62035B1 (sr) 2021-07-30
PT3475303T (pt) 2021-06-25
MA45450B1 (fr) 2021-04-30
CA3029137A1 (en) 2018-01-04
KR102533875B1 (ko) 2023-05-18
JP2024109816A (ja) 2024-08-14
JP2019524671A (ja) 2019-09-05
RU2748024C2 (ru) 2021-05-19
MD3475303T2 (ro) 2021-09-30
IL263764A (en) 2019-01-31
EP3909985A1 (en) 2021-11-17
US11352423B2 (en) 2022-06-07
CN109415440A (zh) 2019-03-01
PL3475303T3 (pl) 2021-12-06
JP7603201B2 (ja) 2024-12-20
RU2019100221A3 (https=) 2020-11-30
HUE054296T2 (hu) 2021-08-30
IL263764B2 (en) 2024-09-01
JP2022119854A (ja) 2022-08-17
AU2024205042A1 (en) 2024-08-15
CN109415440B (zh) 2022-12-06
AU2017289085B2 (en) 2024-07-18
HRP20210945T1 (hr) 2021-09-17
US20190322742A1 (en) 2019-10-24
SG11201810429UA (en) 2018-12-28
SI3475303T1 (sl) 2021-12-31
CN115998859A (zh) 2023-04-25
KR20230074823A (ko) 2023-05-31
US20220213190A1 (en) 2022-07-07
IL263764B1 (en) 2024-05-01
JP7824990B2 (ja) 2026-03-05
SMT202100317T1 (it) 2021-07-12
SG10201912369QA (en) 2020-02-27

Similar Documents

Publication Publication Date Title
US20220213190A1 (en) Anti-cd19 antibody formulations
EP3157553A1 (en) Treatment for chronic lymphocytic leukemia (cll)
CN110732023A (zh) 一种her2抗体药物组合物及其用途
CN110960490A (zh) 一种抗egfr抗体偶联药物组合物及其用途
WO2018223958A1 (zh) 一种含c-Met抗体药物偶联物的药物组合物及其用途
HK40064043A (en) Anti-cd19 antibody formulations
RU2848327C1 (ru) Составы на основе антитела к CD19
HK40004579A (en) Anti-cd19 antibody formulations
HK40004579B (en) Anti-cd19 antibody formulations
NZ789731A (en) Anti-CD19 antibody formulations
HK40004117A (en) Anti-cd19 antibody formulations
HK40004117B (zh) 抗-cd19抗体制剂
AU2021212193A1 (en) Anti-CD30 antibody-drug conjugates and their use for the treatment of non-Hodgkin lymphoma
WO2024083074A1 (en) Formulations containing anti-tigit antibody and methods of use thereof
CA3250813A1 (en) PHARMACEUTICAL FORMULATIONS OF AN ANTI-ILT4 ANTIBODY OR AN ANTIGEN-BINDING FRAGMENT OF IT AND METHODS OF USE

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17735440

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2017289085

Country of ref document: AU

Date of ref document: 20170627

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 3029137

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2018567742

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 20197002043

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2017735440

Country of ref document: EP

Effective date: 20190128

WWG Wipo information: grant in national office

Ref document number: 748681

Country of ref document: NZ