Classifications

• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
  • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
  • C07K14/575—Hormones
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
  • A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P11/00—Drugs for disorders of the respiratory system
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P13/00—Drugs for disorders of the urinary system
  • A61P13/12—Drugs for disorders of the urinary system of the kidneys
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P17/00—Drugs for dermatological disorders
  • A61P17/02—Drugs for dermatological disorders for treating wounds, ulcers, burns, scars, keloids, or the like
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P25/00—Drugs for disorders of the nervous system
  • A61P25/06—Antimigraine agents
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P27/00—Drugs for disorders of the senses
  • A61P27/02—Ophthalmic agents
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P35/00—Antineoplastic agents
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P7/00—Drugs for disorders of the blood or the extracellular fluid
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P7/00—Drugs for disorders of the blood or the extracellular fluid
  • A61P7/10—Antioedematous agents; Diuretics
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P9/00—Drugs for disorders of the cardiovascular system
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P9/00—Drugs for disorders of the cardiovascular system
  • A61P9/04—Inotropic agents, i.e. stimulants of cardiac contraction; Drugs for heart failure
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P9/00—Drugs for disorders of the cardiovascular system
  • A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P9/00—Drugs for disorders of the cardiovascular system
  • A61P9/12—Antihypertensives
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
  • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
  • C07K14/575—Hormones
  • C07K14/57527—Calcitonin gene related peptide
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
  • C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
  • C07K16/26—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against hormones ; against hormone releasing or inhibiting factors
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K38/00—Medicinal preparations containing peptides
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2319/00—Fusion polypeptide

Definitions

• the present embodiments relate to superagonists and superantagonists of the adrenomedullin (ADM)/calcitonin gene-related peptide (CGRP)/intermedin (adrenomedullin 2, IMD) family of peptide hormones and therapeutic uses thereof.
• ADM adrenomedullin
• CGRP calcitonin gene-related peptide
• IMD intermedin
• G protein-coupled receptors are cell surface receptors and represent one of the largest protein families in the human genome. Based on phylogenetic criteria, the large superfamily of human GPCRs can be subdivided into the five main subfamilies: Glutamate, Rhodopsin, Adhesion, Frizzled/Taste and Secretin ('GRAFS' nomenclature), among which the Secretin family (resembling the class B GPCR family in the Kolakowski/NC-IUPHAR extended nomenclature system) is among the most studied subclass. So far, more than one-third of all drugs target GPCRs.
• the efficacy of a ligand is derived from concentration-effect curves and quantified by the efficacy concentration (EC50) and maximum effect (E max ) relative to E max of a standard compound such as the endogenous ligands (Langmead and Christopoulos (2013) Br J Pharmacol 169:353-356).
• Drugs that induce the maximum response in a system may nevertheless differ in efficacy, because the fraction of receptors required to be agonist-bound can depend on the individual efficacy for receptor activation. Therefore, the response usually has a certain assay- dependent limit.
• GPCR ligands are usually classified according to their efficacy, i.e. the ability to elicit a receptor-mediated pharmacological response (Smith et al. (201 1) Mol Cell Endocrinol 331 :241 -247).
• the ADM/CGRP/IMD peptide family includes calcitonin gene-related peptides (CGRPa and CGRP ⁇ ), adrenomedullin (ADM), intermedin (IM), calcitonin (CT) and amylin.
• CGRPs, ADM and IMD are structurally similar and signal through receptor complexes consisting of two transmembrane components, the calcitonin receptor-like receptor (CLR) and one of the three receptor activity-modifying proteins (RAMP1 , 2, and 3). Co-expression of the calcitonin receptor-like receptor (CLR) and receptor activity-modifying proteins (RAMPs) is required to generate functional receptors for CGRPs, ADM and IMD.
• CLR calcitonin receptor-like receptor
• RAMPs receptor activity-modifying proteins
• the 52-amino-acid ADM is produced in adrenal gland, lung, kidney, heart muscle and other organs; whereas CGRP peptides are neurotransmitters.
• the plasma levels of ADM, CGRPs, and IMD are in the picomolar range.
• Activation of the CLR/RAMP receptors leads to intracellular elevation of adenosine 3', 5'-cyclic monophosphate (cAMP) in the receptor-bearing cells.
• CLR/RAMP receptors are present on different cell types in almost all organs including endothelial cells.
• ADM and IMD were first characterized as potent vasotone regulators, subsequent investigations have revealed that the functions of these peptides go far beyond the hypotensive effects, and they exhibit pleiotropic effects in a variety of organs.
• ADM and IMD are counter-regulatory hormones that are increased in diseased state as a compensatory response to injury and hypoxia.
• ADM has been shown to ameliorate acute or chronic lung injuries induced by lipopolysaccharide (LPS), elastase, monocrotaline, bleomycin, ischemia-reperfusion, and carrageenan in a variety of animal models.
• LPS lipopolysaccharide
• elastase monocrotaline
• bleomycin bleomycin
• ischemia-reperfusion and carrageenan in a variety of animal models.
• exogenous ADM and IMD have been shown to stimulate the proliferation and migration of endothelial and lymphendothelial cells in vitor as well as to revascularize damaged lymphatic and blood vessels in a variety of animal models.
• these hormones exhibit neuroprotective, renoprotective, diuresis and/or natriuresis effects in animals with heart failure, myocardial infarction, stroke, resistant hypertension, pulmonary arterial hypertension, preeclampsia, secondary lymphedema, and diabetic ulcer, by improving endothelial cell survival, angiogenesis and vascular integrity, cardiac output, and renal glomerular filtration.
• ADM can mobilize and enhance the survival, differentiation, and the angiogenic potency of a variety of stem/progenitor cells.
• CGRPs are sensory neuropeptides with potent vasodilatory, cardiotonic, and pain transmission action as described in U.S. Pat. No. 4,530,838 to Evans, et al.
• CGRP is present in both the central and peripheral nervous systems and is concentrated in those areas of the body receiving sensory input from the dorsal horn with limited amounts associated with autonomic input.
• the peptide is present in the nuclei of sensory and motor cranial nerves and in cell bodies in the hypothalamus, preoptic area, ventromedial thalamus, hippocampus, and the like (Poyner, D. 1992, Pharmac. Ther. 56:23-51).
• ADM/CGRP/IMD family peptides are known to have potent stimulatory effects on the proliferation of endothelial cells that serve as starter materials for blood vessels, angiogenesis, and vascular remodeling. Because ADM, CGRP, and IMD are among the most potent known vasodilators in humans, these peptides may be functionally important for maintaining high flow/low resistance circulation and feto-placental tissue development during normal physiology and pregnancy.
• CLR/RAMP receptor superagonists could be of use as a tool for stimulating vascular CLR/RAMP receptors and thus stimulating tissue regeneration in pathological conditions such as heart failure, myocardial infarction, resistant hypertension, malignant hypertension, vasospasm, stroke, vasospasm, bronchopulmonary dysplasia, pulmonary arterial hypertension, lymphedema, wound healing, acute lung injury, pressure ulcer, age-related macular degeneration, multiple sclerosis, Alzheimer's disease, Parkinson's disease, epilepsy, retinopathy, organ preservation, eclampsia, and preeclampsia.
• the physiological functions of the hormone peptides in the CT/CGRP family are determined by receptor-binding specificity and the tissue expression profiles of individual ligands and their respective receptors and have been shown to be involved in cardiovascular morphogenesis, sensory neurotransmission, inflammatory reactions, nociceptive behavior and glucose homeostasis (see, e.g., Hay, et al. 2001 , Trends Pharmacol. Sci. 22:57-59; Shindo, et al. 2001 , Circulation 104: 1964-1971 ; Zhang et al. 2001 , Pain 89:265-273; Salmon et al. (1999) Neuroreport 10:849-854; Salmon, et al. 2001 , Nat. Neurosci. 4: 357-358; and Mulder, et al. 2000, Am. /. Physiol. 278 ⁇ 684- ⁇ 691).
• Inhibitors at the receptor level to CGRP and ADM are postulated to be useful in pathophysiologic conditions where excessive CGRP and/or ADM receptor activation has occurred. Some of these include neurogenic vasodilation, neurogenic inflammation, migraine, cluster headache and other headaches, thermal injury, circulatory shock, menopausal flushing, and asthma. CGRP receptor activation has particularly been implicated in the pathogenesis of migraine headache (Edvinsson L. 2001 , CNS Drugs 15(10):745-53; Williamson, D. J. 2001 Microsc. Res. Tech. 53: 167-178.; Grant, A. D. 2002, Brit. J Pharmacol. 135:356-362).
• migraines Headache associated with migraines is thought to be a result of profound cerebral vasodilation associated with migraine events (Moskowitz 1992, Trends Pharmacol. Sci. 13:307-31 1).
• Migraine patients exhibit elevated basal CGRP levels compared to controls (Ashina, et al., 2000, Pain 86(1-2)133-8), and serum levels of CGRP are elevated during migraine (Goadsby, et al. 1990, Ann. Neurol. 28:183-7).
• Treatment with anti-migraine therapeutic candidates returns CGRP levels to normal coincident with alleviation of headache (Gallai, et al.
• CGRP antagonists could be useful for blocking cerebrovascular CGRP receptors and thus blocking migraine.
• Peptide antagonists of the CGRP receptor include peptides comprising the sequence of CGRP but lacking at least the first seven amino acids of the 37-amino-acid CGRP sequence (e.g., CGRP (8-37), CGRP (28-37), [Tyr°]CGRP (28-37), CGRP (12-37), h-a-CGRP (9-37), h-a- CGRP (10-37), h-a-CGRP (1 1-37), [Ala 9]-h-a-CGRP (8-37), [Ala 10]-h-a-CGRP (8-37), [Ala n]- h-a-CGRP (8-37), [Ala 12 ]-h-a-CGRP (8-37), h-a-CGRP (19-37), h-a-CGRP (23-37) and acetyl-h-a-CGRP (19-37); Mimeault, M.
• CGRP (8-37) CGRP (28-37), [
• Inhibitors at the receptor level to ADM include ADM22-52. Tertiary structure analyses indicated that the binding domain of ADM family peptides is characterized by an unstructured string. Because (1) ADM acts as a mitogenic factor for tumor cells and surrounding vessels in tumors with a lung, breast, colon, brain, pancreas, endometrium, ovary, kidney, or prostate origin, (2) ADM expression in tumors is associated with the aggressiveness of tumors, distant metastasis and poor patient prognosis, and (3) blockage of CLR/RAMP receptor signaling reduces growth, microvessel density, tumor-associated macrophage-induced angiogenesis, and metastasis of tumor xenografts, CLR/RAMP2 and/or CLR/RAMP3 receptor antagonists are antiangiogenic drug candidates for cancer therapy.
• CGRP8-37 and ADM22-52 which are specific for CGRP-mediated CLR/RAMP1 and ADM-mediated CLR/RAMP2 signaling, respectively
• small molecule CGRP receptor antagonist e.g., telcagepant
• anti-ligand antibodies e.g., anti-CGRP or anti-ADM antibody
• anti- receptor antibodies e.g., anti-CLR or anti-RAMP antibody
• existing therapeutic candidates are associated with efficacy or safety concerns.
• peptide antagonists such as CGRP8-37 and ADM22-52 have extremely short half-lives and low potencies, and are receptor- specific.
• the small molecule CLR/RAMP1 receptor antagonists suffer liver toxicity in humans.
• the anti-ligand and anti-receptor antibodies are specific for one of the ligands or receptor components; therefore, they only act on a small subgroup of targets.
• the antibodies have limited access to CLR/RAMP receptors in the central nervous system. Therefore, a pan-specific or CLR/RAMP receptorl-, 2-, or 3-specific super-antagonist represents excellent anti-CLR/RAMP receptor therapeutic drug candidates because peptide antagonists such as CGRP8-37 has been shown to cross the blood-brain barrier (BBB) efficiently when compared to small molecule CLR/RAMP1 antagonist and anti-CGRP antibodies.
• BBB blood-brain barrier
• compositions and methods relate to adrenomedullin and intermedin analogs that exhibit superagonistic or superantagonist activity on CLR/RAMP receptors (i.e., CLR/RAMP 1 , 2, and 3).
• Such chimeric peptides may be referred to herein as pan-specific superagonists.
• adrenomedullin analogs are provided that contain N-terminal mini-PEG and acylation moieties, which analogs exhibit superagonistic activity toward CLR/RAMP2 and/or CLR/RAMP3 receptor, when compared to wild type ligands.
• Such analogs may be referred to herein as CLR/RAMP2-receptor specific superagonists.
• antagonistic analogs comprising chimeric sequences of adrenomedullin and intermedin with N-terminal acylation are provided, which exhibit superior antagonistic activities toward CLR/RAMP1 , CLR/RAMP2, and/or CLR/RAMP3 receptors in term of IC50 when compared to known CLR/RAMP receptor antagonist.
• Such chimeric peptides may be referred to herein as pan-specific, CLR/RAMP1 -specific, or CLR/RAMP2-specific superantagonists.
• FIG. 1 Stimulation of human lymphatic endothelial cell proliferation in medium with 2% FBS by superagonists.
• HLECs were incubated in endothelial cell basal medium supplemented with 2% fetal bovine serum (FBS) and different concentrations of the agonist (30, 100, and 300 nM). The cells were cultured for 72 hrs, and cell viability was assayed with the MTS assay (Promega).
• the normal agonists SEQ ID NOS: 52, 53, 54, and 59
• Significant differences in % of cell proliferation are indicated by asterisks above the bar graph.
• FIG. 1 Stimulation of human lymphatic endothelial cell survival in medium with 0.1 % FBS by superagonists.
• HLECs were incubated in endothelial cell basal medium supplemented with 0.1 % fetal bovine serum (FBS) and different concentrations of the agonist (30, 100, and 300 nM). The cells were cultured for 72 hrs, and cell viability was assayed with the MTS assay (Promega).
• the normal agonists SEQ ID NOS: 52, 53, 54, and 59
• Significant differences in % of cell survival are indicated by asterisks above the bar graph.
• agonist refers to a biologically active ligand that binds to its complementary biologically active receptor and activates the latter either to cause a biological response in the receptor or to enhance preexisting biological activity of the receptor.
• An antagonist refers to a biologically active ligand that binds to a biologically active receptor and decreases the response.
• antagonist refers to a biologically active ligand which inhibits the physiological response of the receptor.
• a superagonist is an agonist that has a greater biological activity than the native ligand, including without limitation the wild-type human intermedin, adrenomedullin or calcitonin gene-related peptide (CGRP).
• CGRP calcitonin gene-related peptide
• CLR calcitonin receptor-like receptor
• RAMP1 receptor activity-modifying proteins
• ADM has high affinity for CLR/RAMP2 and 3 receptors. IMD exhibits no distinct preference for the three CLR/RAMP receptors.
• a peptide may be a superagonist for a specific receptor, relative to the native ligand for the receptor, or may be a superagonist with respect to multiple receptors, and any native ligand for one of the receptors.
• a superagonist has activity that is greater than about 105%, 1 10%, 125%, 150%, 175%, 2-fold, 3-fold, 5-fold or more relative to a native ligand for the receptor or receptors.
• a specific superagonist has high activity for a selected receptor, where the superagonist may be greater than about 5-fold, greater than about 10-fold, greater than about 20-fold or more, active against one member of the CLR/RAMP receptor family. In some embodiments a superagonist is specific for CLR/RAMP1 relative to CLR/RAMP2. In other embodiments a superagonist is specific for CLR/RAMP2 relative to CLR/RAMP1.
• a superantagonist, or antagonist herein inhibits the biological activity of one or more receptors, particularly a receptor activated by ADM, IMD and CGRPs.
• a superantagonist may inhibit the activity to a degree greater than the inhibition of a native ligand.
• An antagonist or superantagonist may inhibit receptor activity by 105%, 1 10%, 125%, 150%, 175%, 2-fold, 3- fold, 5-fold or more, for example in the presence of a native ligand.
• a superantagonist or antagonist may be pan-specific.
• a pan-specific superagonist, agonist, or antagonist has activity for two or more receptors.
• the receptors include two or more of CLR/RAMP1 , CLR/RAMP2 and CLR/RAMP3.
• the receptors are CLR/RAMP1 , CLR/RAMP2 and/or CLR/RAMP3.
• mini-PEG moiety may be defined as CAS number: 166108-71-0; Fmoc-NH- (PEG)-COOH, or Fmoc-8-amino-3,6-dioxaoctanoic acid; Molecular weight: 385.42 g/mol; having a structure:
• mini-PEG behaves similarly to amino acids: the free acid end of mini-PEG will react with free amino group of the last N-terminus amino acid (in our case, the Lys residue) to form a peptide bond.
• the protecting group Fmoc was cleaved off to expose the free amino group of mini-PEG.
• CGRP Native adrenomedullin, intermedin or calcitonin gene-related peptide
• the term refers to the common wild-type counterparts of these peptides as known in the art. Included are the wild-type human peptides, although other mammalian counterparts may also find use, e.g. non-human primates, apes, canines, equines, murines, felines, lagomorphs, bovines, ovines, porcines, and the like.
• pharmaceutically acceptable salt refers to the non-toxic alkali metal, alkaline earth metal, and ammonium salts commonly used in the pharmaceutical industry including the sodium, potassium, lithium, calcium, magnesium, barium, ammonium, and protamine zinc salts.
• non-toxic acid addition salts which are generally prepared by reacting the CLR/RAMP receptor superagonists disclosed herein with a suitable organic or inorganic acid.
• Representative salts include the hydrochloride, hydrobromide, sulfate, bisulfate, acetate, oxalate, valerate, oleate, laurate, borate, benzoate, lactate, phosphate, tosylate, citrate, maleate, fumarate, succinate, tartrate, napsylate, and the like.
• the term refers to those salts which retain the biological effectiveness and properties of the free bases and which are not biologically or otherwise undesirable, formed with inorganic acids such as hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid and the like, and organic acids such as acetic acid, propionic acid, glycolic acid, pyruvic acid, oxalic acid, malic acid, malonic acid, succinic acid, maleic acid, fumaric acid, tartaric acid, citric acid, benzoic acid, cinnamic acid, mandelic acid, menthanesulfonic acid, ethanesulfonic acid, p- toluenesulfonic acid, salicylic acid and the like.
• inorganic acids such as hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid and the like
• organic acids such as acetic acid, propionic acid, glycolic acid, pyruvic acid, ox
• esters refers to those esters which retain, upon hydrolysis of the ester bond, the biological effectiveness and properties of the carboxylic acid or alcohol and are not biologically or otherwise undesirable.
• the alcohol component of the ester will generally comprise (i) a C 2 -C 12 aliphatic alcohol that can or cannot contain one or more double bonds and can or cannot contain branched carbons or (ii) a C 7 -C 12 aromatic or heteroaromatic alcohols.
• amides are typically formed from the corresponding carboxylic acid and an amine.
• amide formation can be accomplished via conventional synthetic techniques. See, for example, Mark, et al. 1980 Encyclopedia of Chemical Technology, John Wiley & Sons, New York.
• pharmaceutically acceptable carrier refers to a carrier medium which does not interfere with the effectiveness of the biological activity of the active ingredients and which is not toxic to the host or patient.
• stereoisomer refers to an entity having the same molecular weight, chemical composition, and bonding sequence as another, but having its atoms grouped differently in space about one or more chiral centers. That is, stereoisomers of the same chemical formula will contain identical chemical moieties located in different spatial orientations about at least one chiral center. When pure, stereoisomers have the ability to rotate plane- polarized light.
• the peptides disclosed herein may have one or more asymmetrical carbon atoms and therefore include various stereoisomers. All stereoisomers are included within the scope of the embodiments.
• compositions as disclosed herein refers to the amount of composition sufficient to induce a desired biological result. That result can be alleviation of the signs, symptoms, or causes of a disease, or any other desired alteration of a biological system.
• peptide residue and "peptidic structure” are intended to include peptides comprised of naturally-occurring L-amino acids and the corresponding D- amino acids, as well as peptide derivatives, peptide analogues and peptidomimetics of the naturally-occurring L-amino acid, structures.
• Approaches to designing peptide analogues, derivatives and mimetics are known in the art. For example, see Veber and Freidinger 1985 TINS p. 392; Evans, et al. 1987 J. Med. Chem. 30:229.
• Peptidomimetics that are structurally similar to therapeutically useful peptides may be used to produce an equivalent or enhanced therapeutic or prophylactic effect, by methods known in the art and further described in the following references: Spatola, A. F. 1983 in: Chemistry and Biochemistry of Amino Acids, Peptides, and Proteins, B. Weinstein, eds., Marcel Dekker, New York, p. 267; Holladay, et al. 1983 Tetrahedron Lett. 24:4401-4404.
• a "derivative" of a compound refers to a form of that compound in which one or more reactive groups in the compound have been derivatized with a substituent group.
• peptide derivatives include peptides in which an amino acid side chain, the peptide backbone, or the amino- or carboxy-terminus has been derivatized (for example, peptidic compounds with methylated amide linkages or hydroxylated amino acids or amino acid residues).
• an "analogue" of a compound refers to a compound which retains chemical structures of the reference compound necessary for functional activity of that compound yet which also contains certain chemical structures which differ from the reference compound.
• a “mimetic” of a compound refers to a compound in which chemical structures of the referenced compound necessary for functional activity of that compound have been replaced with other chemical structures that mimic the conformation of the referenced compound.
• Examples of peptidomimetics include peptidic compounds in which the peptide backbone is substituted with one or more benzodiazepine molecules, peptides in which all L- amino acids are substituted with the corresponding D-amino acids and "retro-inverso" peptides (see U.S. Pat.
• amino acid structure is intended to include the amino acid, as well as analogues, derivatives and mimetics of the amino acid that maintain the functional activity of the compound.
• phenylalanine structure is intended to include phenylalanine as well as pyridylalanine and homophenylalanine.
• leucine structure is intended to include leucine, as well as substitution with valine, isoleucine or other natural or non-natural amino acid having an aliphatic side chain, such as norleucine.
• amino- and/or carboxy-terminus of the peptide compounds disclosed herein can be standard amino and carboxy termini as seen in most proteins.
• amino- and/or carboxy-terminus of the peptide compound can be chemically altered by the addition or replacement of a derivative group.
• Amino-derivative groups which can be present at the N- terminus of a peptide compound include acetyl, aryl, aralkyl, acyl, epoxysuccinyl and cholesteryl groups.
• Carboxy-derivative groups which can be present at the C-terminus of a peptide compound include alcohol, aldehyde, epoxysuccinate, acid halide, carbonyl, halomethane, diazomethane groups and carboxamide. Carboxamide is preferred.
• imaging agent refers to materials, which when covalently attached to a compound, permit detection of the compound, including but not limited to, detection in vivo in a patient to whom a CLR/RAMP receptor superagonist has been administered.
• Suitable imaging agents are well known in the art and include, by way of example, radioisotopes, fluorescent labels (for example, fluorescein), and the like. Selection of the label relative to such factors is well within the skill of the art.
• Covalent attachment of the detectable label to the peptide or peptidomimetic is accomplished by conventional methods well known in the art.
• covalent attachment of 125 l to the peptide or the peptidomimetic can be achieved by incorporating the amino acid tyrosine into the peptide or peptidomimetic and then iodinating the peptide (see, for example, Weaner, et al. 1994 Synthesis and Applications of Isotopically Labelled Compounds; pp. 137-140).
• therapeutic agent means an agent capable of having a desired therapeutic effect for a specific disease indication, including without limitation, a heart failure or blood pressure-reducing agent.
• modified refers to a polypeptide which retains the overall structure of a related polypeptide but which differs by at least one residue from that related polypeptide.
• a modified C-terminus is a C-terminus of a polypeptide that has a chemical structure other than a standard peptide carboxy group, an example of such a modified C- terminus being a C-terminal carboxamide.
• pharmaceutically acceptable carrier refers to a carrier medium which does not interfere with the effectiveness of the biological activity of the active ingredients and which is not toxic to the host or patient.
• peptide residue and "peptidic structure” are intended to include peptides comprised of naturally-occurring L-amino acids and the corresponding D- amino acids, as well as peptide derivatives, peptide analogues and peptidomimetics of the naturally-occurring L-amino acid structures.
• Approaches to designing peptide analogues, derivatives and mimetics are known in the art (see Farmer, P.S. in: Drug Design E.J. Ariens, ed. Academic Press, New York, 1980, vol. 10, pp. 1 19-143; Ball J.B. & Alewood, P.F. 1990 /. Mol. Recognition 3:55; Luthman, et al.
• constrained peptides comprising a consensus sequence or a substantially identical consensus sequence variation may be generated by methods known in the art (Rizo, et al. 1992 Ann. Rev. Biochem. 61 :387); for example, by adding internal cysteine residues or organic linkers capable of forming intramolecular bridges which cyclize the peptide, adding cyclic lactam bridge, or the use of flexible 6-aminohexanoic acid (Ahx), rigid aminoisobutyric acid (Aib) or D-amino acid residues to alter the stability of the helix.
• Synthetic or non-naturally occurring amino acids refer to amino acids which do not naturally occur in vivo but which, nevertheless, can be incorporated into the peptide structures described herein.
• modified peptides described herein can be prepared by, for example, by using standard solid phase techniques. (See Merrifield, 1963. Am. Chem. Soc. 85:2149; J.M. Stewart and J.D. Young, 1984 Solid Phase Peptide Syntheses 2nd Ed., Pierce Chemical Company). These procedures can also be used to synthesize peptides in which amino acids other than the 20 naturally occurring, genetically encoded amino acids are substituted at one, two, or more positions of any of the modified peptides as disclosed herein. For instance, naphthylalanine can be substituted for tryptophan, facilitating synthesis.
• Other synthetic amino acids that can be substituted into the peptides of the present embodiments include L-hydroxypropyl, L-3, 4- dihydroxy-phenylalanyl, d amino acids such as L-d-hydroxylysyl and D-d-methylalanyl, L-a- methylalanyl, ⁇ -amino acids, and isoquinolyl.
• D amino acids and non-naturally occurring synthetic amino acids can also be incorporated into the peptides of the present embodiments (see Roberts, et al. 1983 Unusual Amino/Acids in Peptide Synthesis 5:341 -449).
• the naturally occurring side chains of the 20 genetically encoded amino acids, or any other side chain as disclosed herein can be transposed to the nitrogen of the amino acid, instead of the ⁇ -carbon as typically found in peptides.
• modified peptide agonists that have 60%-99% amino acid sequence identity with a full-length polypeptide sequence as disclosed herein (e.g., SEQ ID NOS: 28-51 , 69-70, 92, 94, 101 , 103, and 1 10) or any other specifically defined fragment of a full-length polypeptide sequence as disclosed herein.
• Percent (%) amino acid sequence identity with respect to the polypeptide sequences identified herein is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the specific polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
• Variations in the sequence of the agonist or antagonist peptides described herein can be made, for example, using any of the techniques and guidelines for conservative and non- conservative mutations set forth, for instance, in U.S. Pat. No. 5,364,934 (Drayna et al., issued Nov. 15, 1994). Variations may be a substitution, deletion or insertion of the agonist or antagonist peptides that results in a change in the amino acid sequence of the agonist or antagonist peptides as compared with the reference agonist or antagonist peptide sequences.
• Stabilized superagonistic and superantagonistic peptide derivatives are provided where the sequence and/or side chains of the peptide derivatives are altered.
• the bioactivity of the derivatives toward CLR/RAMP receptors is superior when compared to wt ADM, CGRP, or IMD.
• the stabilized superagonistic peptides also show superior pharmacological action as compared to wt peptides on the basis of their specific action on endothelial cell proliferation and/or viability in vitro.
• these modified peptide derivatives are covalently linked to a heterologous moiety, which may comprise a polymer, an Fc, an FcRn binding ligand, immunoglobulin, albumin, a collagen-binding motif, a RGD motif, and an albumin-binding ligand, or by N- methylation.
• a heterologous moiety which may comprise a polymer, an Fc, an FcRn binding ligand, immunoglobulin, albumin, a collagen-binding motif, a RGD motif, and an albumin-binding ligand, or by N- methylation.
• a covalently linked polymer may be selected from the group consisting of optionally substituted, saturated, or mono- or di-unsaturated, linear or branched C3-C100 carboxylic acids, preferably C4-C30 carboxylic acids (lipidation), a polyethyleneglycol (PEG) moiety, a polypropylenglycol (PPG) moiety, a PAS moiety, which is an amino acid sequence comprising mainly alanine and serine residues or comprising mainly alanine, serine, and proline residues, the amino acid sequence forming random coil conformation under physiological conditions [US No.
• HES hydroxyethylstarch
• the PEG molecular weight may be between about 1 kDa and about 100 kDa for ease in handling and manufacturing.
• the PEG may have an average molecular weight of about 200, 500, 1000, 2000, 4000, 8000, 16,000, 32,000, 64,000, or 100,000 kDa.
• the PEG may have a branched structure (U.S. Pat. No. 5,643,575; Morpurgo et al. Appl. Biochem. Biotechnol.
• modified peptide derivatives comprise one or more substitutions of disulfide bonds with lactam bridges to increase the metabolic stability of the peptides.
• Cystathiones are resistant towards thiol reduction. Therefore, substitutions of disulfides with thioethers, or selenosulfide, diselenide and ditelluride bridges can provide protection against reduction [Knerr et al., ACS Chem Biol , 6(7), 753-760, 201 1 ; Muttenthaler et al. J Med Chem., 53(24), 8585- 8596, 2010].
• Peptide disulfide bond mimics based on diaminodiacids can also be used to improve the stability of analogs (Cui et al., Angew Chem, 125, 9737-9741 , 2013).
• the disulfide bridge can also be modified either by the insertion of linkers or bridges of a different nature.
• Polymer matrices that contain a drug molecule in a noncovalently bound state can be injectable as solution, hydro gels, micro particles or micelles [D.H. Lee et al, J. Contr. Rel., 92, 291-299, 2003].
• Permanent PEGylation of peptides or proteins to enhance their solubility, reduce immunogenicity and increase half live by reducing renal clearance is known in the art [Caliceti P.,Veronese F.M., Adv. Drug Deliv. Rev., 55, 1261-1277, 2003; T. Peleg-Shulman et al., J. Med. Chem., 47, 4897-4904, 2004].
• modified peptide derivatives are modified by the addition of one or more alkane, cholesterol, or PEG-cholesterol moieties to increase the metabolic stability of the peptides.
• Stapled peptides via the introduction of a synthetic brace (staple), can be synthesized using ring-closing metathesis to lock a peptide in a specific conformation and reduce conformational entropy.
• the present invention also includes prodrugs of the compounds of formula (I), (II), and (III), i.e. compounds which themselves can be biologically active or inactive, but are converted (for example metabolically or hydrolytically) into compounds of formula (I), (II), and (III) in the body.
• Prodrugs may be based on masking amine functionalities, or masking the phenolic group of a tyrosine (the internal nucleophile assisted cleavage of a carbamate on the phenolic group); and the like.
• Polymer based prodrugs are provided that comprise superagonistic or superantagonistic peptides described herein.
• a prodrug is any compound that undergoes biotransformation before exhibiting its pharmacological effects.
• Carrier-linked prodrug (Carrier prodrug) comprises a temporary linkage of a given active substance with a transient carrier group that produces improved physicochemical or pharmacokinetic properties and that can be removed in vivo, by a biochemical cleavage.
• PEG-based carrier prodrugs need enzymatic activation of the linker between the active drug and the carrier, mostly initiated by enzymatic hydrolysis. Commonly used cascading linkers attach an amine functionality in the peptide or protein.
• a masking group is removed as the rate limiting step in the cascade. This activates the linker to decompose in a second position to release the peptide or protein.
• the masking group can be removed by an enzymatic mechanism [R.B. Greenwald et al. in WO 2002/089789, Greenwald, et al., J. Med. Chem. 1999, 42, 3657-3667, F.M.H. DeGroot et al. in WO 2002/083180 and WO 2004/043493, and D. Shabat et al. in WO 2004/019993].
• the pharmacokinetic properties of peptides can be adjusted by lipidation. Lipidation can occur to the N-terminus or to the side chain functionalities of amino acids within the peptide sequence. Lipidation is described in publications and patents (Zhang et al. Curr Med 19: 1602- 18, 2012; Gerauer et al. Wiley Encyclopedia of Chemical Biology, Volume 2, 520-530, 2009, (Hrsg. Begley, T. P.). John Wiley & Sons, Hoboken, NJ. Lipidation of an ADM sequence is described in WO 2012/138867. Labeled ADM derivatives for use as imaging and also therapeutic agent are known [J. assemblage et al. in CA 2567478 and WO 2008/138141 ].
• ADM derivatives a complexating cage like molecular structure capable of binding radioactive isotopes was attached to the N terminus of ADM in a direct manner or via a spacer unit potentially also including short PEG spacers.
• the diagnostic or therapeutic value of theses drugs arises from the targeted delivery of the radioactive molecule.
• the present invention also encompasses all suitable isotopic variants of the compounds of formula (I), (II), and (III) according to the invention.
• An isotopic variant of a compound is understood to mean a compound in which at least one atom within the compound according to the invention has been exchanged for another atom of the same atomic number, but with a different atomic mass than the atomic mass which usually or predominantly occurs in nature.
• isotopes which can be incorporated into a compound are those of hydrogen, carbon, nitrogen, oxygen, phosphorus, sulphur, fluorine, chlorine, bromine and iodine, such as 2 H (deuterium), 3 H (tritium), 13 C, 14 C, 15 N, 17 0, 18 0 , 32 P, 33 P, 33 S, 34 S, 35 S, 36 S, 18 F, 36 C1 , 82 Br, 123 I 124 I 129
• Particular isotopic variants of a compound may be beneficial, for example, for the examination of the mechanism of action or of the active compound distribution in the body.
• the incorporation of isotopes, for example of deuterium can lead to particular therapeutic benefits as a consequence of greater metabolic stability of the compound, for example an extension of the half -life in the body or a reduction in the active dose required.
• the peptides described herein are optionally provided as a minaturized molecular mass that facilitates the permeation and diffusion of molecules in vivo, and the access to the central nervous system, thereby improving the utility in the treatment of diseases.
• the generation of miniaturized receptor agonists or antagonists not only facilitates the diffusion of the peptides within extracellular fluid, but also allows the molecules to enter limited space that is too small to allow the entrance of a larger analog.
• Prior ADM or IMD analogs were 39 and 40 amino-acid long, respectively; and CGRP analogs were 37 amino acids in length.
• the peptides provided herein comprise examples of miniaturized superagonists of 35-36 amino-acid in length, and miniaturized super-antagonists of 17-28 amino-acid in length.
• the miniaturized analogs are also unique in that no CLR/RAMP receptor ligands that contain a truncation in the middle of the continugous sequences of the wild type peptides have been previously described.
• a CLR/RAMP receptor superagonist having the structure of Formula I: B a -C a -D a (I)
• B a is a modified N-terminal fragment of adrenomedullin peptide family member comprising from twenty to twenty eight amino acid residues, wherein two amino acid residues of the N-terminal fragment are cysteine (Cys), and wherein the C-terminal residue of the fragment is threonine (Thr).
• B a may be represented by the structure: (B° " B 1 -B 2 -C-B 4 -B 5 -G-B 7 -C- B 9 -B 10 -B 11 -B 12 -B 13 -B 14 -B 15 -B 16 -B 17 -B 18 -B 19 -B 20 -B 21 ) '
• C a is a central core consist of 3-12 amino acids
• D a is a modified C-terminal fragment of intermedin (IMD) comprising 3-6 amino acid residues with a C-terminal amide, where at least one amino acid of D a is selected from histidine (His), proline (P), serine (Ser), and tyrosine (Tyr).
• IMD intermedin
• B a is characterized by two cysteines present in the sequence that form a disulfide bond. Residues between the two cys residues involved in the disulfide bond are unconstrained in sequence. The aforementioned disulfide bond stabilizes the structure of B a -C a -D a , facilitating both formation of an alpha-helix, and binding of B a -C a -D a to the transmembrane component of a target receptor.
• a superagonist comprises acylation modification in the absence of mini-PEG.
• Addition of residues N-terminal to the first cysteine of B a -C a -D a may not affect the superagonistic characteristics of the polypeptide.
• the peptide is joined to an amino acid residue or polypeptide at the residues N-terminal to the first cysteine of the peptide of Formula I.
• the peptide of formula I may be joined to a polypeptide, e.g. a serum polypeptide such as albumin, an immunoglobulin, including an immunoglobulin constant region, and the like.
• a CLR/RAMP receptor superagonist of Formula I comprises, consists or consists essentially of an amino acid sequence selected from the group consisting of (where "pal” signifies a palmitate moiety, and "ace” signifies acetylated terminus):
• miniPEG-K(PAL)GCRFGTCTVQKLAHQIYQFTDKDKDNVDPSSPHSY-NH 2 (SEQ ID NO: 94)
• miniPEG-K(PAL)GCRFGTCTVQKLAHQIYQFTDKDVAPRSKISPQGY-NH 2 (SEQ ID NO: 101)
• the peptides may comprise fragments derived from ADM and/or IMD, as evident by an alignment of the sequences.
• one or more amino acid residues are fused N-terminally to B 1 , thereby generating a polypeptide with an N-terminal extension of residues with respect to B 1 .
• the extension does not affect the bioactivity of the superagonist.
• the superagonist of Formula I comprises a central core C a comprising 3 to 12 amino acid residues.
• the length of the central core is constrained not by the number of residues but by the steric considerations that require B a and D a to be positioned so that they may interact with a target receptor at the cell membrane surface.
• the central core comprises a fragment of adrenomedullin or intermedin from any of a range of species, including without limitation mammalian species.
• C a has sequence identity of at least 60%, of at least 85%, of at least 90%, of at least 95%, of at least 99%, or 100% with the sequence DKDKDNVAPRSK (SEQ ID NO: 18), DKDKDNSAPVDP (SEQ ID NO:19), PAGRQDSAPVDP (SEQ ID NO:20), DKDKDNVAPVDP (SEQ ID NO:21), DKDKQDSAPVDP (SEQ ID NO:22), DKGRQDSAPVDP (SEQ ID NO:23), DKDKDSAPVDP (SEQ ID NO:24), DKDKSAPVDP (SEQ ID NO:25), or DKDSAPVDP (SEQ ID NO:26).
• C a has an 60% or greater sequence identity with any of SEQ ID NO: 18-26.
• D a is a C-terminal fragment of IMD peptide comprising 3, 4, 5, 6, or more amino acid residues from the C-terminus of intermedin.
• D a has a C-terminal amide.
• At least one amino acid of D a is selected from proline (Pro), histidine (His), tyrosine (Tyr), and serine (Ser).
• Pro proline
• His histidine
• Tyr tyrosine
• Ser serine
• D a is constrained not by its sequence but by its ability to interact with both CLR/RAMP1 and CLR/RAMP2 receptors. In the case of D a that requirement is that it interacts with a target receptor at a site in its extracellular domain such that when the agonist binds the receptors become activated.
• D a comprises at least one tyrosine residue.
• a CLR/RAMP2 receptor-specific superagonist comprises, consists or consists essentially of the peptide of SEQ ID NO:69, 70, 94, 202, 103 or 1 10.
• a CLR/RAMP receptor superagonist that retains the sequence of an agonist that binds the CLR/RAMP receptors at the cellular membrane, but that differs at least one amino acid residue from the agonist sequence.
• the chimeric superagonists derived from ADM and IMD are part of the structure used to increase efficacy of the superagonist or superantagonist.
• B a is selected from the group consisting of the peptide of SEQ ID NO: 1 -16.
• a CLR/RAMP receptor superagonist of Formula I comprises a first peptide fragment having from about nineteen amino acid residues or more from an ADM sequence, including without limitation human ADM, a second peptide fragment having from about three amino acid residues or more from ADM and IMD, including without limitation human ADM and IMD, and a third peptide fragment from IMD, including without limitation human IMD.
• a CLR/RAMP receptor superagonist of Formula I comprises a contiguous second and third peptide fragment. Antagonists and Superantagonists
• Certain select amino acids in the N-terminal portion of the ADM/CGRP/IMD family peptides are responsible for the peptide agonist activity. Truncation or substituting of certain amino acids in the N-terminal portion of these peptides can tune the activity from an agonist to an antagonist. It has been discovered that additional substitutions or modifications can provide additional desirable characteristics to the antagonists. For example, the blockage of CGRP signaling may be useful for preventing the development or progression of migraine headache; whereas the blockage of CLR/RAMP2 signaling represents an anti-angiogenesis approach to reduce tumor growth and cancer progression. However, existing CLR/RAMP receptor antagonists are associated with efficacy concerns. Peptide antagonists such as CGRP8-37 and ADM22-52 have extremely short half-lives and low potencies, and are receptor-specific.
• a CLR/RAMP receptor superantagonist is provided, said antagonist having the structure of Formula II:
• B b is an N-terminal fragment of adrenomedullin peptide family member comprising from twelve to thirteen amino acid residues, wherein B b may be represented by the structure: (B°-B 1 - B 2 -B 3 -B 4 -B 5 -B 6 -B 7 -B 8 -B 9 -B 10 -B 11 -B 12 );
• C b is a central core consisting of from about 3, about 4, about 5, about 6, about 7, about 8, about 9, about 10, about 1 1 , about 12 amino acids;
• D b is a modified C-terminal fragment of intermedin (IMD) comprising of from about 3, about 4, about 5, about 6 amino acid residues with a C-terminal amide, where at least one amino acid of the C-terminal fragment is selected from histidine (His), proline (P), serine (Ser), tyrosine (Tyr).
• IMD intermedin
• a pan-specific, CLR/RAMP1 -specific, and CLR/RAMP2-specific receptor superantagonist comprises, consists or consists essentially of:
• a CLR/RAMP receptor superantagonist comprises an amino acid sequence having greater than 60%, greater than 70%, greater than 870%, greater than 90%, greater than 95% sequence identity to the amino acid sequence of SEQ ID NO: 77-78, 1 12, 1 14, 1 19, 120-125, or 139 wherein said peptide retains antagonist activity.
• a CLR/RAMP receptor superantagonist may comprise a stereoisomer, derivative, or peptidomimetics to the amino acid sequence of SEQ ID NO: 77-78, 1 12, 1 14, 1 19, 120-125, or 139.
• the antagonist comprises a third peptide fragment (D b ) having 6 amino acid residues or less, wherein said third peptide fragment has a sequence from ADM or IMD.
• the second peptide fragment and the third peptide fragment are contiguous.
• the sequence comprises a fragment of an ADM or IMD from any of a range of species.
• the analogs can have a 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95% sequence identity with the SEQ ID NOS: 77-78, 1 12, 1 14, 1 19, 120-125, or 139.
• B b is a modified N-terminal fragment of ADM and IMD peptide family member comprising from four to thirteen amino acid residues; C b is a central core comprising from three to six amino acid residues; and D b is a C-terminal fragment of IMD comprising from three to six amino acid residues with a C-terminal amide, where at least one amino acid of the C-terminal fragment is histidine (His), proline (P), serine (Ser), or tyrosine (Tyr), or pharmaceutically acceptable salt thereof.
• His histidine
• P proline
• Ser serine
• Tyr tyrosine
• the length of the B b , C b , and D b is constrained not by the number of residues per se but by the steric considerations that allow the analogs to interact with a target receptor at the cell membrane surface and at an extracellular domain (i.e. , a functional requirement), respectively, in competition with wild type ADM/CGRP/IMD family peptides.
• said CLR/RAMP receptor superantagonists have a loss of the activation activity of the molecule in interactions with a CLR/RAMP receptor or with a member of the calcitonin/CGRP family of receptors as compared to the wild-type molecule, but may not affect the binding to the receptor.
• said CLR/RAMP receptor superantagonists represent a molecule which can occupy the receptor, but which antagonize rather than activates the signal transduction pathway by making the receptor unavailable for binding by signal-transducing agonists or by repelling the hydrophilicity of ligands.
• superantagonists have the structure of Formula II, wherein the B b fragment comprises: (B°-B 1 -B 2 -B 3 -B 4 -B 5 -B 6 -B 7 -B 8 -B 9 -B 10 -B 11 -B 12 (SEQ ID NO: 16), where: B° can be selected from the group consisting of a natural amino acid or absent; B 1 , B 2 , B 3 , B 4 , B 5 , B 6 , B 7 , B 8 , B 9 , B 10 , B 11 , and B 12 can be selected from the group consisting of valine (Val), leucine (Leu), alanine (Ala), isoleucine (lie), cysteine (Cys), serine (Ser), and tyrosine (Tyr), arginine (Arg), asparagine (Asn), aspartic acid (Asp), glutamic acid (Glu), glutamine (Gin),
• a superantagonist has a structure of Formula III:
• B° is selected from the group consisting of an empty residue, acylated histidine (acy- His), acylated arginine (acy-Arg), acylated lysine (acy-Lys), acylated serine (acy-Ser), acylated threonine (acy-Thr), acylated tyrosine (acy-Tyr), acylated aspartic acid (acy-Asp), acylated glutamic acid (acy-Glu), acylated glutamine (acy-GIn), acylated asparagine (acy-Asn); acylated valine (acy-Val), acylated alanine (acy-Ala), acylated glycine (acy-Gly), acylated isoleucine (acy-lle), acylated leucine (acy-Leu), acylated phenylalanine (acy-Phe), acylated tryptophan (acy-Trp), acylated
• B 1 is selected from the group consisting of an empty residue, Val, Ala, Gly, lie, and Leu
• B 2 is selected from the group consisting of an empty residue, Gin, Glu, Asp, and Asn;
• B 3 is selected from the group consisting of an empty residue, His, Arg, Lys, Gin, and Asp;
• B 4 is selected from the group consisting of an empty residue, Val, Ala, Gly, lie, and Leu;
• B 5 is selected from the group consisting of an empty residue, Val, Ala, Gly, lie, Leu, Ser, Th, and Tyr;
• B 6 is selected from the group consisting of an empty residue, His, Arg, and Lys;
• B 7 is selected from the group consisting of an empty residue, Gin, and Asn, His, Arg, and Lys;
• B 8 is selected from the group consisting of an empty residue, Val, Ala, Gly, lie, and Leu;
• B 9 is selected from the group consisting of an empty residue, Trp, Phe, Ser, Thr, and Tyr;
• B 10 is selected from the group consisting of an empty residue, Gin, Glu, Asp, and Asn;
• B 11 is selected from the group consisting of an empty residue, Trp, Phe, Val, Ala, Gly, lie, and
• B 12 is selected from the group consisting of an empty residue, Ser, Thr, and Tyr; Met, Trp, and Phe;
• B 13 is selected from the group consisting of an empty residue, Gin, Glu, Asp, and Asn, Val, Ala, Gly, lie, and Leu;
• B 14 is selected from the group consisting of an empty residue, His, Arg, Lys, Val, Ala, Gly, lie, Leu, and Pro;
• B 15 is selected from the group consisting of an empty residue, Gin, Glu, Asp, Asn, Val, Ala, Gly, lie, and Leu;
• B 16 is selected from the group consisting of an empty residue, Val, Ala, Gly, lie, and Leu;
• B 17 is selected from the group consisting of an empty residue, Ser, Thr, and Tyr;
• B 18 is selected from the group consisting of an empty residue, Val, Ala, Gly, lie, and Leu;
• B 19 is selected from the group consisting of an empty residue, Val, Ala, Gly, lie, Leu, and Pro;
• B 20 is selected from the group consisting of an empty residue, His, Arg, Lys, Val, Ala, Gly, lie, and Leu;
• B 21 is selected from the group consisting of an empty residue, Ser, Thr, Tyr, Gin, Glu, Asp, and Asn;
• B 22 is selected from the group consisting of an empty residue, His, Arg, Lys, Val, Ala, Gly, lie, Leu, and Pro;
• B 23 is selected from the group consisting of an empty residue, Ser, Thr, Tyr, Val, Ala, Gly, lie, and Leu;
• B 24 is selected from the group consisting of an empty residue, Ser, Thr, and Tyr;
• B 25 is selected from the group consisting of an empty residue, Val, Ala, Gly, lie, Leu, and Pro;
• B 26 is selected from the group consisting of an empty residue, His, Arg, Lys, Gin, Glu, Asp, and
• B 27 is selected from the group consisting of an empty residue, Val, Ala, Gly, lie, Leu, Ser, Thr, and Tyr;
• B 28 is selected from the group consisting of an empty residue, Ser, Thr, and Tyr.
• a superantagonist may be provided as a pharmaceutical composition comprising one of superantagonist peptides.
• the pharmaceutical composition can be used in a method for treating headache, migraine, arthritis pain, tumor-associated pain, neuropathic pain, endometriosis, morphine tolerance, macular degeneration, tumor angiogenesis, tumor metastasis, or angioedema in an individual, the method comprising administering to an individual an effective amount of a CLR/RAMP receptor superantagonist.
• Some embodiments provide a pharmaceutical composition comprising a pharmaceutically acceptable excipient and the superantagonist as disclosed and described herein.
• Some embodiments provide a method of treating a headache or a tumor in an individual, the method comprising administering to the individual an effective amount of the superantagonist as disclosed and described herein.
• the method can further comprise identifying a subject suffering from headache or tumor.
• the headache is a migraine.
• Some embodiments provide a method of treating a condition associated with aberrant levels of CGRP comprising the administration of the superantagonist as disclosed and described herein, to an individual, the method comprising administering to the individual an effective amount of a superantagonist as disclosed and described herein.
• the condition is a migraine.
• one or more residues are fused N-terminally to B b of the agonist in formula I and antagonist in formula II and III, thereby generating a polypeptide with an N- terminal extension of residues with respect to the analogs.
• this extension affects the stability of the agonist or the antagonist after administration.
• addition of residues N-terminal or C-terminal to B b of the agonist or antagonist may extend the stability of the analog (Schellenberger et al., 2009, Nature Biotechnology 27 (12): 1186-1192).
• the addition of residues N-terminal or C-terminal may increase the half-life of an administered drug.
• Some embodiments provide a method of identifying a CLR/RAMP receptor binding ligand by providing the superantagonist bound to a CLR/RAMP receptor, providing a test compound or library of test compounds, and identifying compounds which are capable of dissociating the superantagonist from the CLR/RAMP receptor. Such compounds identified by this method may be further screened against other CLR/RAMP receptor binding agents to identify selective CLR/RAMP receptor binding ligands.
• a CLR/RAMP receptor superagonist or superantagonist peptide in which the peptide comprises, consists or consists essentially of an amino acid sequence having at least 60%, at least 70%, at least 80%, at least 90%, at least 95% or more sequence identity to the amino acid sequence of SEQ ID NOS: 28- 51 , 69-70, 77-78, 92, 94, 101 , 103, 1 10, 1 12, 1 14, 1 19, 120-125, and 139, wherein said peptide retains agonist or antagonist activity.
• therapeutic agents e.g. drugs, therapeutic polypeptides, etc. that are linked to a CLR/RAMP receptor superagonist or superantagonist of the invention, where the CLR/RAMP receptor superagonist or superantagonist acts as a targeting moiety for the therapeutic agent.
• methods of delivering the therapeutic agent linked to a CLR/RAMP receptor superagonist or superantagonist of the invention comprising administering an effective dose of the linked therapeutic agent to an individual in need thereof.
• the therapeutic agent is an imaging agent. Labeled CLR/RAMP receptor liganid (e.g., adrenomedullin derivatives for use as imaging and also therapeutic agent is described by J. collaborating et al.
• Some embodiments provide a method of identifying a CLR/RAMP receptor by providing a CLR/RAMP receptor superagonist or superantagonist bound to a CLR/RAMP receptor, providing a test compound or library of test compounds, and for imaging CLR/RAMP receptors in vivo.
• a heterologous moiety is linked to the superagonist or superantagonist.
• the heterologous moiety is a PAS sequence.
• a PAS sequence as used herein, means an amino acid sequence comprising mainly alanine and serine residues or comprising mainly alanine, serine, and proline residues, the amino acid sequence forming random coil conformation under physiological conditions.
• an amino acid polymer also may form random coil conformation when residues other than alanine, serine, and proline are added as a minor constituent in the PAS sequence.
• the amino acids different from alanine, serine and proline may be selected from the group consisting of Arg, Asn, Asp, Cys, Gin, Glu, Gly, His, He, Leu, Lys, Met, Phe, Thr, Trp, Tyr, and Val.
• the PAS sequence stretch forms a random coil conformation and thereby can mediate an increased in vivo and/or in vitro stability.
• the PAS sequences that form random coil domain are biologically inert, especially with respect to proteolysis in blood plasma, immunogenicity, isoelectric point/electrostatic behavior, binding to cell surface receptors or internalization, but are still biodegradable, which provides clear advantages over synthetic polymers such as PEG.
• Non-limiting examples of the PAS sequences forming random coil conformation comprise an amino acid sequence selected from the group consisting of ASPAAPAPASPAAPAPSAPA, AAPASPAPAAPSAPAPAAPS, and AS AAAP AAAS AAAS AP S AAA, or any combinations thereof (see US Pat. Publ. No. 2010/0292130 Al and PCT Appl. Publ. No. WO 2008/155134 Al).
• a heterologous moiety that is linked to the superagonist or superantagonist is hydroxyethyl starch (HES) or a derivative thereof.
• HES hydroxyethyl starch
• HES is a derivative of naturally occurring amylopectin and is degraded by alpha amylase in the body, and exhibits advantageous biological properties. It is used as a blood volume replacement agent and in hemodilution therapy in the clinics (Sommermeyer et al., Whypharmazie, 8(8), 271-278 (1987); and Weidler et al, Arzneim.- Anlagen/Drug Res., 41 , 494-498 (1991)).
• a heterologous moiety linked to the superagonist or superantagonist is a mixture of hydroxyethyl starches having different mean molecular weights and/or different degrees of substitution and/or different ratios of C2: C6 substitution.
• a heterologous moiety that is linked to the superagonist or superantagonist is a polysialic acid (PSAs) or a derivative thereof.
• PSAs polysialic acids
• Polysialic acids (PSAs) are naturally occurring unbranched polymers of sialic acid produced by certain bacterial strains and in mammals in certain cells Roth J. , et al. (1993) in Polysialic Acid: From Microbes to Man, eds Roth J.
• Sialic acid may also be found in alternating copolymers with monomers other than sialic acid.
• Polysialic acids have important biological functions including the evasion of the immune and complement systems by pathogenic bacteria and the regulation of glial adhesiveness of immature neurons during fetal development (wherein the polymer has an anti-adhesive function; Cho and Troy, P.N.A.S. , USA, 91 (1994) 1 1427-1 1431 ).
• Various methods of attaching or conjugating polysialic acids to a peptide or polypeptide have been described (see U.S. Pat. No. 5,846,951 ; WO-A-0187922, and US 2007/0191597 Al).
• the heterologous moiety that is linked to the superagonist or superantagonist is a glycine-rich homo-amino-acid polymer (HAP).
• HAP sequence can comprise a repetitive sequence of glycine, which has at least 50 amino acids, at least 100 amino acids, 200 amino acids, or 500 amino acids in length.
• the HAP sequence is capable of extending half-life of a moiety fused to or linked to the HAP sequence.
• Non-limiting examples of the HAP sequence includes, but are not limited to (Gly)n, (Gly4Ser)n or S(Gly4Ser)n, wherein n is 1 -200.
• a compound of the invention is covalently linked to at least one heterologous moiety that is or comprises an XTEN polypeptide or fragment, variant, or derivative thereof.
• XTEN polypeptide refers to extended length polypeptides with non-naturally occurring, substantially non-repetitive sequences that are composed mainly of small hydrophilic amino acids, with the sequence having a low degree or no secondary or tertiary structure under physiologic conditions.
• XTENs can serve as a half-life extension moiety.
• XTEN can provide desirable properties including but are not limited to enhanced pharmacokinetic parameters and solubility characteristics.
• an XTEN moiety can increase pharmacokinetic properties such as longer in vivo half-life or increased area under the curve (AUC), so that a compound or conjugate of the invention stays in vivo and has procoagulant activity for an increased period of time compared to a compound or conjugate with the same but without the XTEN heterologous moiety (See International Patent Publication Nos. WO 201 0091 122 Al, WO 2010144502 A2, WO 2010144508 Al, WO 201 1028228 Al, WO 201 1028229 Al, or WO 201 1028344 A2) .
• Fc is to be understood as immunoglobulin constant region or a portion thereof, such as an Fc region or a FcRn binding partner.
• the compound or conjugate is linked to one or more truncated Fc regions that are nonetheless sufficient to confer Fc receptor (FcR) binding properties to the Fc region.
• an Fc region that binds to FcRn comprises from about amino acids 282-438 of lgG 1 , EU numbering (with the primary contact sites being amino acids 248, 250-257, 272, 285, 288, 290-291 , 308-31 1 , and 314 of the CH2 domain and amino acid residues 385-387, 428, and 433-436 of the CH3 domain.
• an Fc region in a biologically active peptide derivative of the invention may comprise or consist of an FcRn binding portion.
• FcRn binding portions may be derived from heavy chains of any isotype, including lgG1 , lgG2, lgG3 and lgG4. In one embodiment, an FcRn binding portion from an antibody of the human isotype lgG1 is used. In another embodiment, an FcRn binding portion from an antibody of the human isotype lgG4 is used.
• an Fc region comprises at least one of: a hinge (e.g., upper, middle, and/or lower hinge region) domain (about amino acids 216-230 of an antibody Fc region according to EU numbering), a CH2 domain (about amino acids 231 - 340 of an antibody Fc region according to EU numbering), a CH3 domain (about amino acids 341 -438 of an antibody Fc region according to EU numbering), a CH4 domain, or a variant, portion, or fragment thereof.
• a hinge e.g., upper, middle, and/or lower hinge region
• a hinge domain about amino acids 216-230 of an antibody Fc region according to EU numbering
• a CH2 domain about amino acids 231 - 340 of an antibody Fc region according to EU numbering
• a CH3 domain about amino acids 341 -438 of an antibody Fc region according to EU numbering
• a CH4 domain or a variant, portion, or fragment thereof.
• an Fc region comprises a complete Fc domain (i.e
• an Fc region comprises, consists essentially of, or consists of a hinge domain (or a portion thereof) fused to a CH3 domain (or a portion thereof), a hinge domain (or a portion thereof) fused to a CH2 domain (or a portion thereof), a CH2 domain (or a portion thereof) fused to a CH3 domain (or a portion thereof), a CH2 domain (or a portion thereof) fused to both a hinge domain (or a portion thereof) and a CH3 domain (or a portion thereof).
• an Fc region lacks at least a portion of a CH2 domain (e.g., all or part of a CH2 domain).
• an Fc region comprises or consists of amino acids corresponding to EU numbers 221 to 447.
• An Fc in a biologically active peptide derivative of the invention can include, for example, a change (e.g., a substitution) at one or more of the amino acid positions disclosed in Int'l.
• the Fc has a mutation leading to reduced glycosylation (e.g., N- or O-linked glycosylation) or may comprise an altered glycoform of the wild-type Fc moiety (e.g., a low fucose or fucose-free glycan).
• the compound or conjugate of the invention is linked to a heterologous moiety comprising albumin or a functional fragment thereof.
• Human serum albumin (HSA, or HA) a protein of 609 amino acids in its full-length form, is responsible for a significant proportion of the osmotic pressure of serum and also functions as a carrier of endogenous and exogenous ligands.
• albumin as used herein includes full-length albumin or a functional fragment, variant, derivative, or analog thereof. Examples of albumin or the fragments or variants thereof are disclosed in US Pat. Publ. Nos. 2008/0194481 Al, 2008/0261877 Al, or 2008/0153751 Al or PCT Appl. Publ. Nos. 2008/033413 A2, 2009/058322 Al, or 2007/021494 A2.
• the heterologous moiety is albumin, a fragment, or a variant thereof which is further linked to a heterologous moiety selected from the group consisting of an immunoglobulin constant region or portion thereof (e.g., an Fc region), a PAS sequence, HES, and PEG.
• a heterologous moiety selected from the group consisting of an immunoglobulin constant region or portion thereof (e.g., an Fc region), a PAS sequence, HES, and PEG.
• the heterologous moiety is an albumin binding moiety, which comprises an albumin binding peptide, a bacterial albumin binding domain, an albumin-binding antibody fragment, or any combinations thereof.
• the albumin binding protein can be a bacterial albumin binding protein, an antibody or an antibody fragment including domain antibodies (see U.S. Pat. No. 6,696,245).
• An albumin binding protein for example, can be a bacterial albumin binding domain, such as the one of streptococcal protein G (Konig, T. and Skerra, A. (1998) J. Immunol. Methods 218, 73-83).
• Other examples of albumin binding peptides that can be used as conjugation partner are, for instance, those as described in US patent application 2003/0069395 or Dennis et al. (Dennis et al. (2002) J. Biol. Chem. 277, 35035-35043).
• albumin-binding peptides include a series of peptides having the core sequence DICLPRWGCLW (See, Dennis et al, 2002. J. Biol. Chem 277:35035-35043), albumin-binding antibody fragments are disclosed in Muller and Kontermann, Curr. Opin. Mol. Ther. 9:319-326 (2007), and Holt et al, Prot. Eng. Design Sci., 21 :283-288 (2008).
• the described superagonist and superantagonist may exist in a cyclized form with an intramolecular disulfide bond between the thiol groups of additional cysteines.
• Other embodiments include analogs of these disulfide derivatives in which one of the sulfurs has been replaced by a C3 ⁇ 4 group or other isostere for sulfur. These analogs can be made via an intramolecular or intermolecular displacement, using methods known in the art.
• the amino-terminus of the peptide can be capped with an alpha- substituted acetic acid, wherein the alpha substituent is a leaving group, such as an oc- haloacetic acid, for example, oc-chloroacetic acid, oc-bromoacetic acid, or oc-iodoacetic acid.
• the peptides of the present embodiments can be cyclized or dimerized via displacement of the leaving group by the sulfur of the cysteine or homocysteine residue. See, for example, Andreu, et al. 1994, Meth. Mol. Bio. 35(7):91 -169; Barker, et al. 1992, Med. Chem. 35:2040-2048; and Or, et al. 1991 , Org. Chem. 56:3146-3149).
• the compounds of formula (I), (II), or (III) can be further modified by N-methylation of at least one amide bond.
• N-methylation The influence of N- methylation on the metabolic stability of peptides has been described for various peptides.
• cyclosporine is a naturally occurring, cyclic, multiply N-methylated peptide that exhibits an excellent pharmacokinetic profile.
• N-methylation in general blocks enzymatic degradation - - by proteases as they are unable to cleave N-methylated peptide bonds.
• the modified peptide agonists or antagonists as disclosed and described herein may also represent a prodrug: a prodrug is any compound that undergoes biotransformation before exhibiting its pharmacological effects. Prodrugs could also include a carrier-linked prodrug, a cascade prodrug.
• the present invention further provides a method for treatment and/or prevention of disorders, in particular the disorders mentioned above, using an active amount of the compounds according to the invention, including without limitation endothelial, cardiovascular, pulmonary, lymphatic, edematous and/or inflammatory disorders.
• Some embodiments provide a method of treating a condition associated with aberrant levels of CGRP, ADM, or IMD comprising the administration of the CLR/RAMP receptor superagonist as disclosed and described herein, to an individual, the method comprising administering to the individual an effective amount of a CLR/RAMP receptor superagonist as disclosed and described herein.
• the term “treatment” or “treating” includes inhibiting, delaying, relieving, mitigating, arresting, reducing, or causing the regression of a disease, disorder, condition, or state, the development and/or progression thereof, and/or the symptoms thereof.
• prevention includes reducing the risk of having, contracting, or experiencing, a disease, disorder, condition, or state, the development and/or progression thereof, and/or the symptoms thereof.
• prevention includes prophylaxis. Treatment or prevention of a disease, disorder, condition, or state may be partial or complete.
• an effective dose of a peptide of the invention is administered alone or in a cocktail of peptides, or combined with additional active agents for the treatment of a condition as listed above.
• the effective dose may be from about 1 ng/kg weight, 10 ng/kg weight, 100 ng/kg weight, 1 ⁇ g/kg weight, 10 ⁇ g/kg weight, 25 ⁇ g/kg weight, 50 ⁇ g/kg weight, 100 ⁇ g/kg weight, 250 ⁇ g/kg weight, 500 ⁇ g/kg weight, 750 ⁇ g/kg weight, 1 mg/kg weight, 5 mg/kg weight, 10 mg/kg weight, 25 mg/kg weight, 50 mg/kg weight, 75 mg/kg weight, 100 mg/kg weight, 250 mg/kg weight, 500 mg/kg weight, 750 mg/kg weight, and the like.
• the dosage may be administered multiple times as needed, e.g. every 30 minutes, every hour, every 2 hours, every 4 hours, every 6 hours, every 8 hours, every 12 hours, every 18 hours, daily, every 2 days, every 3 days, weekly, and the like.
• the dosage may also be administered as a continuous infusion, e.g. in acute treatment methods.
• the peptides of the invention find use in reducing hypertension associated with preeclampsia and eclampsia, and may be administered for a period of time sufficient to stabilize the subject and allow for safe delivery of the pregnancy.
• Preeclampsia is new-onset hypertension and proteinuria after 20 wk gestation. Eclampsia is unexplained generalized seizures in patients with preeclampsia. Diagnosis is clinical and by urine protein measurement. Conventional treatment is usually with IV Mg sulfate and delivery at term. Preeclampsia affects 3 to 7% of pregnant women. Preeclampsia and eclampsia develop after 20 wk gestation; up to 25% of cases develop postpartum, most often within the first 4 days but sometimes up to 6 wk postpartum. Untreated preeclampsia usually smolders for a variable time, then suddenly progresses to eclampsia, which occurs in 1/200 patients with preeclampsia. Untreated eclampsia is usually fatal.
• Preeclampsia may be asymptomatic or may cause edema or excessive weight gain.
• Nondependent edema such as facial or hand swelling (the patient's ring may no longer fit her finger), is more specific than dependent edema.
• Reflex reactivity may be increased, indicating neuromuscular irritability, which can progress to seizures (eclampsia).
• Petechiae may develop, as may other signs of coagulopathy.
• Diagnosis is of new-onset hypertension (BP > 140/90 mm Hg) plus new unexplained proteinuria > 300 mg/24 h after 20 wk. Diagnosis is suggested by symptoms or presence of hypertension, defined as systolic BP > 140 mm Hg, diastolic BP > 90 mm Hg, or both. Except in emergencies, hypertension should be documented in > 2 measurements taken at least 4 h apart. Urine protein excretion is measured in a 24-h collection. Proteinuria is defined as > 300 mg/24 h. Alternatively, proteinuria is diagnosed based on a proteinxreatinine ratio > 0.3 or a dipstick reading of 1 + (used only if other quantitative methods are not available). Absence of proteinuria on less accurate tests (eg, urine dipstick testing, routine urinalysis) does not rule out preeclampsia.
• preeclampsia is also diagnosed if pregnant women have new-onset hypertension plus new onset of any of the following: Thrombocytopenia (platelets ⁇ 100,000/ ⁇ _); Renal insufficiency (serum creatinine > 1.1 mg/dL or doubling of serum creatinine in women without renal disease), Impaired liver function (aminotransferases > 2 times normal), Pulmonary edema, Cerebral or visual symptoms.
• Hypertension is a disease which, if untreated, strongly predisposes to atherosclerotic cardiovascular disease. It is estimated that as many as 1 in 4 adult Americans have hypertension. Hypertension is approximately twice as common in persons with diabetes as in those without. The prevalence of hypertension increases with age.
• Hypertension should not be diagnosed on the basis of a single measurement. Initial elevated readings should be confirmed on at least two subsequent visits over one week or more with average diastolic blood pressure of 90 mrnHg or greater or systolic blood pressure of 140 mmHg or greater required for diagnosis of hypertension. Special care is warranted in diagnosing hypertension in persons with diabetes because of greater variability of blood pressure and a much greater likelihood of isolated systolic hypertension. A goal blood pressure of less than 130/85 mmHg is recommended for these patients.
• pharmacological treatment may be required to control high blood pressure.
• the subject peptides may be administered to reduce arterial blood pressure.
• a secondary effect of reducing hypertension is reduction of edema and inflammatory exudate volume.
• compositions containing peptides of the invention are useful as cardioprotective agents, e.g. to ameliorate ischemic injury or myocardial infarct size consequent to myocardial ischemia.
• cardioprotective agents capable of limiting the extent of myocardial injury, i.e., the extent of myocardial infarction, following acute myocardial ischemia is a major concern of modern cardiology.
• therapies capable of providing additional myocardial protection which could be administered in conjunction with thrombolytic therapy, or alone, since retrospective epidemiological studies have shown that mortality during the first few years following infarction appears to be related to original infarct size.
• Myocardial ischemia is the result of an imbalance of myocardial oxygen supply and demand and includes exertional and vasospastic myocardial dysfunction.
• Exertional ischemia is generally ascribed to the presence of critical atherosclerotic stenosis involving large coronary arteries resulting in a reduction in subendocardial flow.
• Vasospastic ischemia is associated with a spasm of focal variety, whose onset is not associated with exertion or stress. The spasm is better defined as an abrupt increase in vascular tone.
• the compounds of this invention can be normally administered orally or parenterally, in the treatment of patients in need of cardioprotective therapy.
• the dosage regimen is that which insures maximum therapeutic response until improvement is obtained and thereafter the minimum effective level that gives relief.
• the dosages are those that are therapeutically effective in producing a cardioprotective effect, i.e. , amelioration of ischemic injury or myocardial infarct size consequent to myocardial ischemia.
• the peptides would be useful as an injectable dosage form which may be administered in an emergency to a patient suffering from myocardial ischemia, etc.
• the peptides of the invention also find use in the reduction of edema, for example in lymphedema, rheumatoid arthritis, edema secondary to brain tumors or irradiation for cancer, edema resulting from stroke, head trauma or spinal cord injury, post-surgical edema, asthma and other respiratory diseases and cystoid macular edema of the eye.
• the compounds according to the invention can be employed for treatment and/or prevention of cardiovascular diseases, in particular heart failure, especially chronic and acute heart failure, worsening heart failure, diastolic and systolic (congestive) heart failure, acute decompensated heart failure, cardiac insufficiency, coronary heart disease, angina pectoris, myocardial infarction, ischemia reperfusion injury, ischemic and hemorrhagic stroke, arteriosclerosis, atherosclerosis, hypertension, especially essential hypertension, malignant essential hypertension, secondary hypertension, renovascular hypertension and hypertension secondary to renal and endocrine disorders, hypertensive heart disease, hypertensive renal disease, pulmonary hypertension, especially secondary pulmonary hypertension, pulmonary hypertension following pulmonary embolism with and without acute cor pulmonale, primary pulmonary hypertension, and peripheral arterial occlusive disease.
• cardiovascular diseases in particular heart failure, especially chronic and acute heart failure, worsening heart failure, diastolic and systolic
• the compounds according to the invention are furthermore suitable for treatment and/or prevention of pulmonary disorders, such as chronic obstructive pulmonary disease, asthma, acute and chronic pulmonary edema, allergic alveolitis and pneumonitis due to inhaled organic dust and particles of fungal, actinomycetic or other origin, acute chemical bronchitis, acute and chronic chemical pulmonary edema, neurogenic pulmonary edema, acute and chronic pulmonary manifestations due to radiation, acute and chronic interstitial lung disorders, acute lung injury/acute respiratory distress syndrome (ALI/ARDS) in adult or child including newborn, ALI/ARDS secondary to pneumonia and sepsis, aspiration pneumonia and ALI/ARDS secondary to aspiration, ALI/ARDS secondary to smoke gas inhalation, transfusion-related acute lung injury (TRALI), ALI/ARDS or acute pulmonary insufficiency following surgery, trauma or burns, ventilator induced lung injury (VILI), pulmonary fibrosis, and mountain sickness.
• pulmonary disorders such as chronic
• the compounds according to the invention are furthermore suitable for treatment and/or prevention of gestational [pregnancy-induced] edema and proteinuria with and without hypertension (pre-eclampsia and eclampsia).
• the compounds according to the invention are furthermore suitable for treatment and/or prevention of chronic kidney diseases, renal insufficiency, diabetic nephropathy, hypertensive chronic kidney disease, glomerulonephritis, rapidly progressive and chronic nephritic syndrome, unspecific nephritic syndrome, nephrotic syndrome, hereditary nephropathies, acute and chronic tubulo-interstitial nephritis, acute kidney injury, acute kidney failure, traumatic and post procedural kidney injury, cardiorenal syndrome, and protection and functional improvement of kidney transplants.
• the compounds are moreover suitable for treatment and/or prevention of diabetes mellitus and its consecutive symptoms, such as e.g. diabetic macro- and microangiopathy, diabetic nephropathy and neuropathy.
• the compounds according to the invention can be used for treatment and/or prevention of disorders of the central and peripheral nervous system such as migraine, cluster headache, epilepsy, stroke, vasospasm, viral and bacterial meningitis and encephalitis (e.g. Zoster encephalitis), traumatic and toxic brain injury, primary or secondary malignant neoplasm of the brain and spinal cord, radiculitis and polyradiculitis, Guillain-Barre syndrome [acute or post- infective polyneuritis, Miller Fisher Syndrome], Parkinson's disease, acute and chronic polyneuropathies, pain, cerebral edema, Alzheimer's disease, degenerative diseases of the nervous system and demyelinating diseases of the central nervous system such as but not restricted to multiple sclerosis.
• disorders of the central and peripheral nervous system such as migraine, cluster headache, epilepsy, stroke, vasospasm, viral and bacterial meningitis and encephalitis (e.g. Zoster encephalitis), traumatic and toxic brain injury, primary or secondary malignant
• the compounds according to the invention are furthermore suitable for treatment and/or prevention of portal hypertension and liver fibrosis [cirrhosis] and its sequelae such as esophageal varices and ascites, for the treatment and/or prevention of pleural effusions secondary to malignancies or inflammations and for the treatment and/or prevention of primary and secondary lymphedema and of edema secondary to varices.
• the compounds according to the invention are furthermore suitable for treatment and/or prevention of inflammatory disorders of the gastrointestinal tract such as inflammatory bowel disease, Crohn's disease, ulcerative colitis, and toxic and vascular disorders of the intestine.
• the compounds according to the invention are furthermore suitable for treatment and/or prevention of sepsis, hemorrhagic shock, or multi organ failure (MOF), traumatic shock, and angioneurotic edema [Giant urticaria, Quincke's edema].
• the compounds according to the invention are furthermore suitable for treatment of edematous ocular disorders or ocular disorders associated with disturbed vascular function, including, but not being limited to, age-related macular degeneration (AMD), diabetic retinopathy, in particular diabetic macula edema (DME), subretinal edema, and intraretinal edema.
• AMD age-related macular degeneration
• DME diabetic macula edema
• subretinal edema subretinal edema
• intraretinal edema intraretinal edema.
• AMD age-related macular degeneration
• the compounds according to the invention are furthermore suitable for treatment of ocular hypertension (glaucoma).
• the compounds according to the invention can moreover be used for treatment and/or prevention of operation-related states of ischemia and consecutive symptoms thereof after surgical interventions, in particular interventions on the heart using a heart-lung machine, interventions on the carotid arteries, aorta, or with instrumental opening or penetration of the skull cap.
• the compounds are furthermore suitable for general treatment and/or prevention in the event of surgical interventions with the aim of accelerating wound healing and shortening the reconvalescence time. They are further suited for the promotion of wound healing.
• the compounds are furthermore suitable for treatment and/or prevention of disorders of bone density and structure such as but not restricted to osteoporosis, osteomalacia and hyperparathyroidism-related bone disorders.
• the present invention further provides for the use of the compounds according to the invention for preparing a medicament for treatment and/or prevention of disorders, in particular the disorders mentioned above.
• the invention further provides medicaments comprising a compound according to the invention and one or more further active ingredients, in particular for treatment and/or prevention of the disorders mentioned above.
• exemplary and preferred active ingredient combinations are:
• ACE inhibitors angiotensin receptor antagonists, beta-2 receptor agonists, phosphodiesterase inhibitors, glucocorticoid receptor agonists, diuretics, or angiotensin converting enzyme-2 or acetylsalicylic acid (aspirin).
• the compounds according to the invention are administered in combination with an ACE inhibitor, such as, by way of example and preferably, enalapril, quinapril, captopril, lisinopril, ramipril, delapril, fosinopril, perindopril, cilazapril, imidapril, benazepril, moexipril, spirapril or trandopril.
• an ACE inhibitor such as, by way of example and preferably, enalapril, quinapril, captopril, lisinopril, ramipril, delapril, fosinopril, perindopril, cilazapril, imidapril, benazepril, moexipril, spirapril or trandopril.
• the compounds according to the invention are administered in combination with an angiotensin receptor antagonist, such as, by way of example and preferably, losartan, candesartan, valsartan, telmisartan or embusartan.
• angiotensin receptor antagonist such as, by way of example and preferably, losartan, candesartan, valsartan, telmisartan or embusartan.
• the compounds according to the invention are administered in combination with a beta-2 receptor agonist, such as, by way of example and preferably, salbutamol, pirbuterol, salmeterol, terbutalin, fenoterol, tulobuterol, clenbuterol, reproterol or formoterol.
• a beta-2 receptor agonist such as, by way of example and preferably, salbutamol, pirbuterol, salmeterol, terbutalin, fenoterol, tulobuterol, clenbuterol, reproterol or formoterol.
• the compounds according to the invention are administered in combination with a phosphodiesterase (PDE) inhibitor, such as, by way of example and preferably, milrinone, amrinone, pimobendan, cilostazol, sildenafil, vardenafil or tadalafil.
• PDE phosphodiesterase
• the compounds according to the invention are administered in combination with a glucocorticoid receptor agonist, such as, by way of example and preferably, Cortisol, cortisone, hydrocortisone, prednisone, methyl-prednisolone, prednylidene, deflazacort, fluocortolone, triamcinolone, dexamethasone or betamethasone.
• a glucocorticoid receptor agonist such as, by way of example and preferably, Cortisol, cortisone, hydrocortisone, prednisone, methyl-prednisolone, prednylidene, deflazacort, fluocortolone, triamcinolone, dexamethasone or betamethasone.
• the compounds according to the invention are administered in combination with diuretics, such as, by way of example and preferably, furosemide, torasemide and hydrochlorothiazide.
• diuretics such as, by way of example and preferably, furosemide, torasemide and hydrochlorothiazide.
• the compounds according to the invention are administered in combination with natriuretic peptides, such as nesiritide (human B-type natriuretic peptide (hBNP)) and carperitide (alpha-human atrial natriuretic polypeptide (hANP)).
• natriuretic peptides such as nesiritide (human B-type natriuretic peptide (hBNP)) and carperitide (alpha-human atrial natriuretic polypeptide (hANP)
• the compounds according to the invention are administered in combination with urodilatin, a derivative of ANP still under development for acute heart failure.
• the compounds according to the invention are administered in combination with LCZ696 (Entresto), a neprilysin (enkephalinase, neutral endopeptidase, NEP, also involved in the metabolism of ADM) inhibitor.
• the compounds according to the invention is used to stimulate the propagation of endothelial or lymphendothelial cell from humans or animals in vitro or in vivo.
• Endothelial dysfunction is a leading cause of micro and macrovascular complications in a variety of life-threatening diseases, including atherosclerosis, cardiomyopathy, stoke, resistant hypertension, preeclampsia, pulmonary arterial hypertension, and diabetic ulcers.
• Endothelial dysfunction represents an early event along the natural course of these diseases.
• the function of vascular endothelium includes the synthesis of substances that modulate vascular tone, the inhibition of platelet aggregation, and control of proliferation of vascular cells.
• Damage to the endothelium can lead to increased endothelium-derived contracting factors, reduced nitric oxide production, and breakdown of endothelial barriers, leading to hypertension, atherosclerosis, thrombosis, inflammation, vascular resistance, vascular leakage, edema, and functional impairment in many organs. Because of this there has been a significant interest in finding methods to ameliorate endothelial dysfunction.
• ACE angiotensin converting enzyme
• ARB angiotensin-receptor antagonists
• beta-blockers mineralocorticoid receptor antagonists
• calcium channel antagonists calcium channel antagonists
• statins and anti-diabetes drug metformin, and inhibitor of xanthine oxidase such as allopurinol have been shown to improve endothelial functions in patients.
• the present invention can be used applied to prevent or treat endothelial dysfunction in a variety of diseases, and to facilitate efficient propagation of endothelial cells, which can be applied for the treatment of endothelial dysfunction in its own right.
• Formulations and medicaments are provided that comprise at least one compound according to the invention, normally together with one or more inert, nontoxic, pharmaceutically suitable excipients and to the use thereof for the aforementioned purposes.
• they can be administered in a suitable way, for example by the parenteral, pulmonary, nasal, sublingual, lingual, buccal, dermal, transdermal, conjunctival, optic route or as implant or stent.
• the active agent can be a single peptide disclosed herein; or may be formulated as a cocktail of one or more peptides, e.g. 1 , 2, 3, 4, 5, 6, 7 8, 9, 10 or more different peptides, e.g.
• a peptide comprising, consisting or consisting essentially of the structure of a peptide sequence of Table 1 ; or comprising, consisting or consisting essentially of an amino acid sequence having at least 60%, at least 70%, at least 80%, at least 90%, at least 95% or more sequence identity to the amino acid sequence of SEQ ID NOS: 28-51 , 69-70, 92, 94, 101 , 103, and 1 10, wherein said peptide retains agonist or superagonist activity.
• the peptide may be provided as a pharmaceutical acceptable salt.
• compositions comprising, as an active ingredient, at least one of the instant modified peptides (D-amino acids or peptidomimetics) disclosed herein in association with a pharmaceutical carrier or diluent.
• These pharmaceutical compositions can be administered by any means, as known to those of skill in the art, and include, without limitation, oral, pulmonary, parenteral (intramuscular, intraperitoneal, intravenous, or subcutaneous injection), inhalational (via a fine powder formulation, or aerosol), transdermal, intranasal or sublingual routes of administration and can be formulated in dosage forms appropriate for each route of administration.
• the compounds can also be administered in sustained or controlled release dosage forms, including without limitation, depot injections, osmotic pumps, transdermal (including electrotransport) patches, and the like, for prolonged and/or timed, pulsed administration at a predetermined rate.
• compositions of the present embodiments may be manufactured in a manner that is itself known, e.g., by means of conventional mixing, dissolving, granulating, dragee-making, levigating, emulsifying, encapsulating, entrapping or tabletting processes.
• Pharmaceutical compositions for use in accordance with the present embodiments thus may be formulated in conventional manner using one or more physiologically acceptable carriers comprising excipients and auxiliaries which facilitate processing of the active compounds into preparations which can be used pharmaceutically. Any of the well-known techniques, carriers, and excipients may be used as suitable and as understood in the art.
• injectables can be prepared in conventional forms, either as liquid solutions or suspensions, solid forms suitable for solution or suspension in liquid prior to injection, or as emulsions.
• Suitable excipients are, for example, water, saline, dextrose, mannitol, lactose, lecithin, albumin, sodium glutamate, cysteine hydrochloride, and the like.
• the injectable pharmaceutical compositions may contain minor amounts of nontoxic auxiliary substances, such as wetting agents, pH buffering agents, and the like.
• Physiologically compatible buffers include, but are not limited to, Hanks's solution, Ringer's solution, or physiological saline buffer. If desired, absorption enhancing preparations (for example, liposomes), may be utilized.
• penetrants appropriate to the barrier to be permeated may be used in the formulation.
• Pharmaceutical formulations for parenteral administration include aqueous solutions of the active compounds in water-soluble form. Additionally, suspensions of the active compounds may be prepared as appropriate oily injection suspensions. Suitable lipophilic solvents or vehicles include fatty oils such as sesame oil, or other organic oils such as soybean, grapefruit or almond oils, or synthetic fatty acid esters, such as ethyl oleate or triglycerides, or liposomes.
• Aqueous injection suspensions may contain substances which increase the viscosity of the suspension, such as sodium carboxymethyl cellulose, sorbitol, or dextran.
• the suspension may also contain suitable stabilizers or agents that increase the solubility of the compounds to allow for the preparation of highly concentrated solutions.
• Formulations for injection may be presented in unit dosage form, e.g., in ampoules or in multi-dose containers, with an added preservative.
• the compositions may take such forms as suspensions, solutions or emulsions in oily or aqueous vehicles, and may contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
• the active ingredient may be in powder form for constitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use.
• the instant compounds for use according to the present embodiments are conveniently delivered in the form of an aerosol spray presentation from pressurized packs or a nebulizer, with the use of a suitable propellant, e.g., dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas.
• a suitable propellant e.g., dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas.
• the dosage unit may be determined by providing a valve to deliver a metered amount.
• Capsules and cartridges of, e.g., gelatin for use in an inhaler or insufflator may be formulated containing a powder mix of the compound and a suitable powder base such as lactose or starch.
• a powder mix of the compound e.g., lactose or starch.
• suitable powder base such as lactose or starch.
• preparations for administration by inhalation may be prepared according to the teaching of Quay, et al., U.S. Pat. No. 7,812,120 B2.
• compositions well known in the pharmaceutical art for uses that include intraocular, intranasal, and intraauricular delivery. Suitable penetrants for these uses are generally known in the art.
• Pharmaceutical compositions for intraocular delivery include aqueous ophthalmic solutions of the active compounds in water- soluble form, such as eye drops, or in gellan gum; ophthalmic ointments; ophthalmic suspensions, such as microparticulates, drug-containing small polymeric particles that are suspended in a liquid carrier medium, lipid-soluble formulations; and ocular inserts. All of the above-mentioned references are incorporated herein by reference in their entireties.
• compositions for intranasal delivery may also include drops and sprays often prepared to simulate in, many respects nasal secretions to ensure maintenance of normal ciliary action, such compositions include, for example and without limitation, the nasal solutions disclosed by Azria, et al., in U.S. Pat. No. 5,733,569.
• Pharmaceutical formulations for intraauricular delivery include suspensions and ointments for topical application in the ear. Common solvents for such aural formulations include glycerin and water.
• the instant compounds may also be formulated as a depot preparation. Such long acting formulations may be administered by implantation (for example subcutaneously or intramuscularly) or by intramuscular injection.
• the compounds may be formulated with suitable polymeric or hydrophobic materials (for example as an emulsion in an acceptable oil) or ion exchange resins, or as sparingly soluble derivatives, for example, as a sparingly soluble salt.
• Non-limiting examples of methods of administration include, among others, (a) administration though non-oral pathways such as intraocular, intranasal or intraauricular, which administration includes administration as an aqueous suspension, an oily preparation or the like or as a drip, spray, salve, ointment or the like; (b) administration via injection, subcutaneously, intraperitoneally, intravenously, intramuscularly, intradermal ⁇ , intraorbitally or the like, including infusion pump delivery; (c) administration locally such as by injection directly intracranially, e.g., by depot implantation; as well as (e) administration topically; as deemed appropriate by those of skill in the art for bringing the peptide of the present embodiments into contact with living tissue.
• non-oral pathways such as intraocular, intranasal or intraauricular, which administration includes administration as an aqueous suspension, an oily preparation or the like or as a drip, spray, salve, ointment or the like
• administration via injection sub
• the exact formulation, route of administration and dosage for the pharmaceutical compositions of the present embodiments can be chosen by the individual physician in view of the patient's condition.
• the dose range of the composition administered to the patient can be from about 0.000001 to 100 mg/kg of the patient's body weight.
• the dosage may be a single one or a series of two or more given in the course of one or more days, as is needed by the patient.
• the present embodiments will use those same dosages, or dosages that are between about 0.1 % and 500%, more preferably between about 25% and 250% of the established human dosage.
• a suitable human dosage can be inferred from ED 50 or ID 50 values, or other appropriate values derived from in vitro or in vivo studies, as qualified by toxicity studies and efficacy studies in animals.
• the daily dosage regimen for an adult human patient may be, for example, an intravenous, subcutaneous, or intramuscular dose of each active ingredient at an exemplary range of between 0.001 mg and 100 mg, or an exemplary range of between 0.005 mg and 5 mg. In cases of administration of a pharmaceutically acceptable salt, dosages may be calculated as the free base.
• the composition is administered 0.1 to 4 times per day or as a single acute dose, for example to ameliorate hypertension.
• the compositions as described herein may be administered by continuous intravenous infusion, preferably at a dose of each active ingredient up to 1000 mg per day.
• the peptides disclosed herein in certain situations it may be necessary to administer the peptides disclosed herein in amounts that exceed, or even far exceed, the above-stated, exemplary dosage range in order to effectively and aggressively treat particularly aggressive diseases or infections.
• the peptides will be administered for a period of continuous therapy, for example for a week or more, or for months or years.
• the effective local concentration of the drug may not be related to plasma concentration.
• the amount of the instant composition administered may be dependent on the subject being treated, on the subject's weight, the severity of the affliction, and the manner of administration.
• Compounds disclosed herein can be evaluated for efficacy and toxicity using known methods. The results of such studies are often predictive of efficacy in animals, such as mammals, or more specifically, humans. Alternatively, the efficacy of particular compounds in an animal model, such as mice, rats, rabbits, or monkeys, may be determined using known methods.
• compositions containing the compounds can be administered for prophylactic and/or therapeutic treatments.
• compositions are administered to a patient already suffering from a disease, as described above, in an amount sufficient to cure or at least partially arrest the symptoms of the disease and its complications. An amount adequate to accomplish this is defined as "therapeutically effective dose”.
• compositions described herein can also be microencapsulated by, for example, the method of Tice and Bibi (in: Treatise on Controlled Drug Delivery, ed. A. Kydonieus, Marcel Dekker, N.Y. 1992, pp. 315-339).
• the agonist peptides and peptidomimetics described herein are effective in treating CLR/RAMP receptor-mediated conditions when administered at an exemplary dosage range of, for example, from about 0.01 ⁇ g to about 50 mg/kg of body weight per day.
• the specific dose employed is regulated by the particular condition being treated, the route of administration as well as by the judgment of the attending clinician depending upon factors such as the severity of the condition, the age and general condition of the patient, and the like. Such doses can be readily determined by those of skill in the art.
• Injectables can be prepared in conventional forms, either as liquid solutions, suspensions, solid forms suitable for solution or suspension in liquid prior to injection, emulsions, or lyophilized powder in association with a pharmaceutically acceptable parenteral vehicle.
• a pharmaceutically acceptable parenteral vehicle examples include water, saline, Ringer's solution, dextrose solution, and 5% human serum albumin. Liposomes and nonaqueous vehicles such as fixed oils may also be used.
• the vehicle or lyophilized powder may contain additives that maintain isotonicity (for example, sodium chloride, mannitol) and chemical stability (for example, buffers and preservatives).
• the formulation is sterilized by commonly used techniques.
• a parenteral composition suitable for administration by injection is prepared by dissolving 1 .5% by weight of active ingredient in 0.9% sodium chloride solution.
• the compounds can be administered in a time release formulation, for example in a composition which includes a slow release polymer.
• the active compounds can be prepared with carriers that will protect the compound against rapid release, such as a controlled release formulation, including implants and microencapsulated delivery systems.
• Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, poly anhydrides, polyglycolic acid, collagen, polyorthoesters, polylactic acid (PLA), polylactic, polyglycolic copolymers (PLG), or poly(lactic-co-glycolic acid)(PLGA). Many methods for the preparation of such formulations are generally known to those skilled in the art.
• Suitable excipients are, for example, water, saline, dextrose, mannitol, lactose, lecithin, albumin, sodium glutamate, cysteine hydrochloride, and the like.
• the injectable pharmaceutical compositions may contain minor amounts of nontoxic auxiliary substances, such as wetting agents, pH buffering agents, and the like.
• absorption enhancing preparations for example, liposomes
• the compositions may take such forms as suspensions, solutions or emulsions in oily or aqueous vehicles, and may contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
• Aqueous injection suspensions may contain substances which increase the viscosity of the suspension, such as sodium carboxymethyl cellulose, sorbitol, or dextran.
• Suitable lipophilic solvents or vehicles include fatty oils such as sesame oil, or other organic oils such as soybean, grapefruit or almond oils, or synthetic fatty acid esters, such as ethyl oleate or triglycerides, or liposomes.
• the instant compounds for use according to the present embodiments are conveniently delivered in the form of an aerosol spray presentation from pressurized packs or a nebulizer, with the use of a suitable propellant, e.g., dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas.
• a suitable propellant e.g., dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas.
• the dosage unit may be determined by providing a valve to deliver a metered amount.
• preparations for administration by inhalation may be prepared according to the teaching of Quay, et al., US Pat. No. 7,812, 120 B2, issued October 12, 2010.
• compositions described herein can also be microencapsulated by, for example, the method of Tice and Bibi (in: Treatise on Controlled Drug Delivery, ed. A. Kydonieus, Marcel Dekker, N.Y. 1992, pp. 315-339).
• compositions for intraocular delivery include aqueous ophthalmic solutions of the active compounds in water-soluble form, such as eye drops, or in gellan gum (Shedden et al, 2001 , Clin. Ther., 23(3):440-50) or hydrogels (Mayer et al., 1996, Ophthalmologica, 210(2): 101-3); ophthalmic ointments; ophthalmic suspensions, such as microparticulates, drug- containing small polymeric particles that are suspended in a liquid carrier medium (Joshi, A., 1994. Ocul.
• compositions for intranasal delivery may also include drops and sprays often prepared to simulate in many respects nasal secretions to ensure maintenance of normal ciliary action
• such compositions include, for example and without limitation, the nasal solutions disclosed by Azria, et al., in US Patent No. 5,733,569, issued March 31 , 1998.
• Pharmaceutical formulations for intraauricular delivery include suspensions and ointments for topical application in the ear. Common solvents for such aural formulations include glycerin and water.
• the compounds may also be formulated as a depot preparation. Such long acting formulations may be administered by implantation (for example subcutaneously or intramuscularly) or by intramuscular injection.
• the compounds may be formulated with suitable polymeric or hydrophobic materials (for example as an emulsion in an acceptable oil) or ion exchange resins, or as sparingly soluble derivatives, for example, as a sparingly soluble salt.
• Non-limiting examples of methods of administration include, among others, (a) administration via injection, subcutaneously, intraperitoneally, intravenously, intramuscularly, intradermally, intraorbitally or the like, including infusion pump delivery; (b) administration locally such as by injection directly intracranially, e.g., by depot implantation; as well as (c) administration topically; as deemed appropriate by those of skill in the art for bringing the peptide of the present embodiments into contact with living tissue.
• the dose range of the composition administered to the patient can be from about 0.000001 to 100 mg/kg of the patient's body weight.
• the dosage may be a single one or a series of two or more given in the course of one or more days, as is needed by the patient.
• Dosage amount and interval may be adjusted individually to provide plasma levels of the active moiety which are sufficient to maintain the modulating effects, or minimal effective concentration (MEC). Dosage intervals can also be determined using MEC value.
• Compositions should be administered using a regimen which maintains plasma levels above the MEC for 10- 90% of the time.
• Some embodiments provide a CLR/RAMP receptor superagonist or superantagonist having the structure selected from the following peptide sequences, listed in Table 1 .
• Ace-K(PAL)GCRFGTCTVQKLAHQIYQFT- (SEQ ID NO: 6)
• Ace-K(PAL)GCRFGTCTVQKLAHLWQLM- (SEQ ID NO: 7)
• Ace-TK(Pal)KTLRTGCRFGTCTVQKLAHQIYQFT- (SEQ ID NO: 10)
• Ace-TK(Pal)KTLRTGCRFGTCTVQKLAHQIYQFT- (SEQ ID NO: 1 1) miniPEG-TK(Pal)KTLRTGCRFGTCTVQKLAHQIYQFT- (SEQ ID NO: 12) miniPEG-K(PAL)CRFGTCTVQKLAHQIYQFT- (SEQ ID NO: 13)
• miniPEG-K(PAL)GCRFGTCTVQKLAHQIYQFTDKDKDNSAPVDPSSPHSY-NH 2 SEQ ID NO: 28
• miniPEG-K(PAL)GCRFGTCTVQKLAHQIYQFTPAGRQDSAPVDPSSPHSY-NH 2 SEQ ID NO: 29
• Ace-K(PAL)GCRFGTCTVQKLAHQIYQFTDKDKDNSAPVDPSSPHSY-NH 2 (SEQ ID NO: 32)
• Ace-K(PAL)GCRFGTCTVQKLAHQIYQFTPAGRQDSAPVDPSSPHSY-NH 2 (SEQ ID NO: 33) Pal-KGCRFGTCTVQKLAHQIYQFTDKDKDNVAPVDPSSPHSY-NH 2 (SEQ ID NO: 34)
• ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH 2 (SEQ ID NO: 143)
• Ace-VGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKSSPHSY-NH 2 (SEQ ID NO: 55)
• Ace-VGCRFGTCTVQKLAHQIYQFTDKDKDNSAPVDPSSPHSY-NH 2 (SEQ ID NO: 56)
• Ace-VGCRFGTCTVQKLAHQIYQFTPAGRQDSAPVDPSSPHSY-NH 2 (SEQ ID NO: 57)
• Ace-VGCRFGTCTVQKLAHLWQLMGPAGRQDSAPVDPSSPHSY-NH 2 (SEQ ID NO: 58)
• Ace-K(PAL)GCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKSSPHSY-NH 2 (SEQ ID NO: 65)
• Ace-K(PAL)GCRFGTCTVQKLAHLWQLMGPAGRQDSAPVDPSSPHSY-NH 2 (SEQ ID NO: 66)
• miniPEG-K(PAL)GCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH 2 SEQ ID NO: 69
• miniPEG- SEQ ID NO: 70
• miniPEG-K(PAL)GCRFGTCTVQKLAHQIYQFTDKDKDNVDPSSPHSY-NH 2 SEQ ID NO: 94
• miniPEG-K(PAL)GCRFGTCTVQKLAHQIYQFTDKDVAPRSKISPQGY-NH 2 SEQ ID NO: 101
• Ace-K(Pal)GCDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH 2 (SEQ ID NO: 74)
• Ace-TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH 2 SEQ ID NO: 75
• Ace-VTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH 2 (SEQ ID NO: 137)
• Ace-VTHRLAGLLSRFTDKDKDNVAPRSKISPQGY-NH 2 (SEQ ID NO: 1 15)
• Ace-TVQKLAHRLWQLMGPDKDNVAPRSKISPQGY-NH 2 (SEQ ID NO: 1 16)
• Synthetic Amino Acids These procedures can also be used to synthesize peptides in which amino acids other than the 20 naturally occurring, genetically encoded amino acids are substituted at one, two, or more positions of any of the peptides of the invention as disclosed herein. For instance, naphthylalanine can be substituted for tryptophan, facilitating synthesis.
• Other synthetic amino acids that can be substituted into the peptides of the present embodiments include L-hydroxypropyl, L-3,4-dihydroxy-phenylalanyl, d amino acids such as L- d-hydroxylysyl and D-d-methylalanyl, L-a-methylalanyl, ⁇ -amino acids, and isoquinolyl.
• D amino acids and non-naturally occurring synthetic amino acids can also be incorporated into the peptides of the present embodiments (see, for example, Roberts, et al. 1983 Unusual Amino/Acids in Peptide Synthesis 5:341 -449).
• the naturally occurring side chains of the 20 genetically encoded amino acids, or any other side chain as disclosed herein can be transposed to the nitrogen of the amino acid, instead of the a-carbon as typically found in peptides.
• the amino acid sequence of a CLR/RAMP receptor superagonist can be modified, relative to the sequence of SEQ ID NOS: 28-51 , 69-70, 92, 94, 101 , 103, and 1 10 such that the modification reduces the susceptibility to enzymatic proteolysis.
• this modification comprises N-terminal addition of a sequence comprising all or part of the human serum albumin or immunoglobulin proteins.
• peptides of the invention comprise one or more D-amino acid residues.
• the amino acid sequence of a peptide of the invention is modified, relative to the sequence of SEQ ID NOS: 28-51 , 69-70, 92, 94, 101 , 103, and 1 10, such that the modification includes replacement of one or more L-amino acids residues with corresponding D-amino acids residues.
• the amino acid sequence of peptides of the invention are modified, relative to the sequence of SEQ ID NOS: 28-51 , 69-70, 92, 94, 101 , 103, and 1 10 such that the modification is substitution of one or more amino acids with a conservative amino acid.
• Naturally occurring residues may be divided into classes based on common side chain properties:
• hydrophobic norleucine (Nor), Met, Ala, Val, Leu, De
• neutral hydrophilic Cys, Ser, Thr, Asn, Gin;
• Conservative amino acid substitutions may involve exchange of a member of a class with another member of the same class.
• Conservative amino acid substitutions may encompass non-naturally occurring amino acid residues, which are typically incorporated by chemical peptide synthesis rather than by synthesis in biological systems. These include peptidomimetics and other reversed or inverted forms of amino acids.
• conservative substitutions can include the substitution of one non-polar (hydrophobic) amino acid residue such as isoleucine, valine, leucine norleucine, alanine, or methionine for another, the substitution of one polar (hydrophilic) amino acid residue for another such as between arginine and lysine, between glutamine and asparagine, between threonine and serine, the substitution of one basic amino acid residue such as lysine, arginine or histidine for another, or the substitution of one acidic residue, such as aspartic acid or glutamic acid for another (Table 3).
• the phrase "conservative amino acid substitution” also includes the use of a chemically derivatized residue in place of a non-derivatized residue, provided that such polypeptide displays the requisite agonist activity.
• amino acid residue substitutions that can be useful in accordance with the present embodiments include the following:
• a basic moiety of an amino acid as disclosed herein, such as the guanidine of Arg, can be replaced by a base bioisostere.
• peptides as disclosed herein also serve as a basis to prepare peptidomimetics with similar biological activity.
• Peptides typically are synthesized as the free acid but, as noted above, could be readily prepared as the amide or ester.
• Amino terminus modifications include methylation (i.e.,— NHCH 3 or— NH(CH 3 ) 2 ), acetylation, adding a benzyloxycarbonyl group, or blocking the amino terminus with any blocking group containing a carboxylate functionality defined by RCOO— , where R is selected from the group consisting of naphthyl, acridinyl, steroidyl, and similar groups.
• Amino terminus modifications are as recited above and include alkylating, acetylating, adding a carbobenzoyi group, forming a succinimide group, etc. See, for example, Murray, et al. 1995 Burger's Medicinal Chemistry and Drug Discovery 5th ed., Vol. 1 , Manfred E. Wolf, ed., John Wiley and Sons, Inc.
• the N-terminus may also be modified through the addition of at least one residues N- terminal to the B a fragment.
• Techniques for assessing the impact of N-terminal extensions to peptides are known in the art in, for example, Schellenberger, et al., 2009, Nature Biotechnology 27(12) : 1 186- 1 192.
• Carboxy terminus modifications include replacing the free acid with a carboxamide group or forming a cyclic lactam at the carboxy terminus to introduce structural constraints.
• a benzhydrylamine resin is used as the solid support for peptide synthesis.
• hydrogen fluoride treatment to release the peptide from the support results directly in the free peptide amide (i.e., the C-terminus is— C(0)NH 2 ).
• the modified peptide agonists described herein can advantageously be modified with or covalently coupled to one or more of a variety of hydrophilic polymers. It has been found that when the peptide compounds are derivatized with a hydrophilic polymer, their solubility and circulation half-lives are increased and their immunogenicity is masked.
• the CLR/RAMP receptor superagonists as disclosed and described herein can be derivatized with or coupled to such polymers using any of the methods set forth in Zallipsky, S. 1995 Bioconjugate Chem 6:150-165; Monfardini, C, et al. 1995 Bioconjugate Chem 6:62-69.
• peptide derivatives of the compounds are described in Hruby, et al. 1990 Biochem. J. 268(2):249-262.
• the peptide compounds also serve as structural models for non-peptidic compounds with similar biological activity.
• Those of skill in the art recognize that a variety of techniques are available for constructing compounds with the same or similar desired biological activity as the lead peptide compound but with more favorable activity than the lead with respect to solubility, stability, and susceptibility to hydrolysis and proteolysis. See Morgan, et al. 1989 Ann. Rep. Med. Chem. 24:243-252, incorporated herein by reference in its entirety.
• the compounds may exist in a cyclized form with one or more intramolecular disulfide bond between the thiol groups of the cysteines.
• Other embodiments include analogs of these disulfide derivatives in which one of the sulfurs has been replaced by a CH 2 group or other isostere for sulfur. These analogs can be made via an intramolecular or intermolecular displacement, using methods known in the art.
• the amino-terminus of the peptide can be capped with an alpha- substituted acetic acid, wherein the alpha substituent is a leaving group, such as an a- haloacetic acid, for example, a-chloroacetic acid, a-bromoacetic acid, or a-iodoacetic acid.
• the peptides of the present embodiments can be cyclized or dimerized via displacement of the leaving group by the sulfur of the cysteine or homocysteine residue. See, for example, Andreu, et al. 1994, Meth. Mol. Bio. 35(7):91 -169.
• the peptides of the invention as disclosed and described herein as well as their fusion proteins may also be prepared by recombinant DNA techniques well known in the art.
• the fusion proteins may include, but are not limited to, those with human serum albumin, immunoglobulin, Fc, Fc derivatives, microglobulin, or other serum proteins.
• the compounds described herein can be used as reagents for selectively detecting CLR/RAMP receptors on living cells, fixed cells, in biological fluids, in tissue homogenates, in human bodies, etc.
• An antibody that specifically binds to one or more of the peptides described herein can be generated by methods known to one of skill in the art, which antibody may be used, for example, in the detection and analysis of the peptides described herein.
• CLR/RAMP receptors for adrenomedullin there are three CLR/RAMP receptors for adrenomedullin, CGRPs, and intermedin. These are CLR/RAMP1 , 2, and 3 receptors, which are expressed throughout the vascular system. It has been reported that CGRPs are selective agonists for CLR/RAMP1 whereas adrenomedullin interact with high affinity with CLR/RAMP2. On the other hand, intermedin is a low potency ligand and does not exhibit specific preference among CLR/RAMP1 , 2, and 3 receptors.
• molecule comprising the sequence of ADM and IMD was shown to compete for CGRP and ADM interaction with CLR/RAMP1 , 2, and/or 3 receptors with high potency when compared to general CLR/RAMP 1 receptor antagonist CGRP8-38 and/or CLR/RAMP2 receptor antagonist ADM22-52.
• select superantagonistic analogs exhibit CLR/RAMP1- or CLR/RAMP2-specific antagonistic activities.
• the analog thus represents a pan-specific or selective superantagonist which binds to its complementary biologically active receptor and inhibits the physiological response of the receptor stronger than the physiological ligands.
• a receptor activation assay Using a receptor activation assay, the dose-dependent stimulatory response of peptide agonists of the present invention on a CLR/RAMP1 receptor, a CLR/RAMP2, or a CLR/RAMP3 receptor complex was determined.
• a cell line carrying the recombinant CLR/RAMP1 , CLR/RAMP2, or a CLR/RAMP3 receptor was employed in the assay.
• Peptide agonist activities were tested, in duplicate, at 10 different concentrations, starting with 1.0 ⁇ and serially diluted 3-fold, in DMSO.
• SEQ ID NOS: 28, 30, 31 , 34, and 36 also exhibited a >1 10% maximum activity in CLR/RAMP2 receptor when compared to adrenomedullin.
• some of these potent agonistic peptides represent miniaturized agonists.
• SEQ ID NOS: 48 and 92 contain only 36 amino acids, which are much smaller than the 39- or 40-amino-acid wild type peptides.
• some of these agonistic peptides also exhibit superagonistic activities toward CLR/RAMP3.
• results demonstrate the surprisingly high potency of the selected peptides, for example, many have EC 50 concentrations in the high picomolar range compared to the high nanomolar EC 50 concentration of wild type-peptides.
• wild-type ADM SEQ ID NOS: 53 and 54
• wild-type IMD SEQ ID NO: 52
• a principle chimeric peptide SEQ ID NO: 59
• the synthetic analogs were pre-incubated with the cells before adding the reference ligand at its EC80.
• the assays showed that the wild type ADM22-52 (SEQ ID NO: 75) inhibited the CGRP-stimulated CLR/RAMP1 and ADM-stimulated CLR/RAMP2 receptor activation with IC50 of >20000 and 631 nM, respectively (Table 3).
• the CLR/RAMP1 -specific CGRP8-37 (SEQ ID NO: 137) has an IC 50 of 133 and >10000 nM, for CLR/RAMP1 and CLR/RAMP3, respectively.
• CGRP8-37 and ADM22-52 are low potency antagonists specific for CLR/RAMP1 and CLR/RAMP2, respectively.
• the chimeric peptide consist of ADM and IMD sequence (SEQ ID NO: 76) appear to have mildly improved antagonistic activity toward CLR/RAMP1 and 2 receptors.
• the IC 50 for CGRP-stimulated CLR/RAMP1 and ADM-stimulated CLR/RAMP2 receptor signaling was 1 123 and 289 nM, respectively.
• the chimeric peptide with an N-terminal palmitoylation, or a palmitoylation and mini-PEG modification (SEQ ID NOS: 77-78, 1 12, 1 14, 1 19, 120-125, or 139) exhibited highly potent antagonistic activity toward CGRP-stimulated CLR/RAMP1 and/or ADM-stimulated CLR/RAMP2 receptor signaling.
• SEQ ID NOS: 77-78, 1 12, 121 , and 125 are pan-specific.
• SEQ ID NOS: 1 14, 120, 122-124, and 139 are CLR/RAMP1 -specific; whereas SEQ ID NO: 1 19 is CLR/RAMP2-specific.
• the IC 50 for CGRP-stimulated CLR/RAMP1 and ADM-stimulated CLR/RAMP2 receptor signaling for these analogs was 1 .8-9.9 and 0.6-47 nM, respectively.
• two synthetic peptides that have been reported to exhibit potent antagonistic activities for CLR/RAMP receptors SEQ ID NOS: 1 15 and 1 16; Table 3) did not show superantagonistic activities in the same assays.
• CLR/RAMP3 receptor-activation activites showed that select peptides are superagonists for CLR/RAMP3 as well.
• CGRP8-37 and ADM22-52 which have an IC 50 of 574 and 330 nM for CLR/RAMP3, respectively; the IC 50 of SEQ ID NOS: 78, 1 12, 1 14, 1 19, 120-122, and 123 were 0.8-9.2 nM.
• SEQ ID NOS: 78, 1 12, 1 14, 1 19, 120-122, and 123 were 0.8-9.2 nM.
• some of these superantagonists are miniaturized antagonists which contain only 17-28 amino acids.
• the CGRP8-37 and ADM22-52 contain 30 and 31 amino acids, respectively.

Landscapes

• Health & Medical Sciences (AREA)
• Chemical & Material Sciences (AREA)
• Organic Chemistry (AREA)
• Life Sciences & Earth Sciences (AREA)
• General Health & Medical Sciences (AREA)
• Medicinal Chemistry (AREA)
• Public Health (AREA)
• Animal Behavior & Ethology (AREA)
• Veterinary Medicine (AREA)
• Chemical Kinetics & Catalysis (AREA)
• General Chemical & Material Sciences (AREA)
• Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
• Bioinformatics & Cheminformatics (AREA)
• Pharmacology & Pharmacy (AREA)
• Engineering & Computer Science (AREA)
• Biochemistry (AREA)
• Genetics & Genomics (AREA)
• Biophysics (AREA)
• Proteomics, Peptides & Aminoacids (AREA)
• Molecular Biology (AREA)
• Endocrinology (AREA)
• Gastroenterology & Hepatology (AREA)
• Toxicology (AREA)
• Zoology (AREA)
• Cardiology (AREA)
• Heart & Thoracic Surgery (AREA)
• Hematology (AREA)
• Pain & Pain Management (AREA)
• Urology & Nephrology (AREA)
• Diabetes (AREA)
• Immunology (AREA)
• Pulmonology (AREA)
• Vascular Medicine (AREA)
• Hospice & Palliative Care (AREA)
• Biomedical Technology (AREA)
• Neurology (AREA)
• Neurosurgery (AREA)
• Ophthalmology & Optometry (AREA)
• Dermatology (AREA)
• Rheumatology (AREA)

Priority Applications (6)

Applications Claiming Priority (2)

Related Child Applications (2)

Publications (1)

Family

ID=59274070

Family Applications (1)

Country Status (6)

Cited By (3)

Citations (4)

Family Cites Families (25)

• 2017
  • 2017-01-04 US US16/066,609 patent/US11034745B2/en active Active
  • 2017-01-04 WO PCT/US2017/012171 patent/WO2017120220A1/en not_active Ceased
  • 2017-01-04 CN CN202310002994.XA patent/CN116063580A/zh active Pending
  • 2017-01-04 CN CN201780015231.1A patent/CN109311959A/zh active Pending
  • 2017-01-04 JP JP2018553861A patent/JP7360794B2/ja active Active
  • 2017-01-04 EP EP17736247.2A patent/EP3400237A4/en active Pending
  • 2017-01-04 TW TW106100180A patent/TW201734035A/zh unknown
• 2021
  • 2021-05-10 US US17/316,153 patent/US20220340633A1/en active Pending

Patent Citations (4)

Also Published As

Similar Documents

Legal Events