WO2017112536A1 - Ccl20 as a predictor of clinical response to il23-antagonists - Google Patents
Ccl20 as a predictor of clinical response to il23-antagonists Download PDFInfo
- Publication number
- WO2017112536A1 WO2017112536A1 PCT/US2016/067120 US2016067120W WO2017112536A1 WO 2017112536 A1 WO2017112536 A1 WO 2017112536A1 US 2016067120 W US2016067120 W US 2016067120W WO 2017112536 A1 WO2017112536 A1 WO 2017112536A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- ccl20
- patient
- level
- disease
- antibody
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/24—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
- C07K16/244—Interleukins [IL]
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6863—Cytokines, i.e. immune system proteins modifying a biological response such as cell growth proliferation or differentiation, e.g. TNF, CNF, GM-CSF, lymphotoxin, MIF or their receptors
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6863—Cytokines, i.e. immune system proteins modifying a biological response such as cell growth proliferation or differentiation, e.g. TNF, CNF, GM-CSF, lymphotoxin, MIF or their receptors
- G01N33/6869—Interleukin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/55—Medicinal preparations containing antigens or antibodies characterised by the host/recipient, e.g. newborn with maternal antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55522—Cytokines; Lymphokines; Interferons
- A61K2039/55527—Interleukins
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/52—Assays involving cytokines
- G01N2333/521—Chemokines
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/06—Gastro-intestinal diseases
- G01N2800/065—Bowel diseases, e.g. Crohn, ulcerative colitis, IBS
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/52—Predicting or monitoring the response to treatment, e.g. for selection of therapy based on assay results in personalised medicine; Prognosis
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- the present disclosure relates to the use of expression levels of the Chemokine (C-C motif) ligand 20 (CCL20) cytokine to stratify and/or identify populations of patients having an IL23 -mediated disease or disorder suitable for treatment with an IL23 antagonist (including, e.g., an anti-IL23 antibody or fragment thereof).
- CCL20 Chemokine (C-C motif) ligand 20
- Interleukin (IL)-23 is a proinflammatory cytokine implicated in the pathogenesis of various inflammatory conditions including but not limited to Crohn' s disease (CD), ulcerative colitis (UC), psoriasis, psoriatic arthritis, rheumatoid arthritis, and ankylosing spondylitis.
- IL23 induces T-cells to express a number of inflammatory genes including IL17A, IL17A receptor, TNF-a, and GM-CSF.
- IL23 The main known effects of IL23 are to drive the differentiation of T helper Thl7 cells, as well as macrophages, natural killer (NK) cells, dendritic cells, and innate lymphoid cells leading to up-regulation of IL17, IL22, TNFa, GMCSF, and IFN- ⁇ , and down-regulation of IL10.
- Interleukin (IL)-23 is a heterodimeric cytokine consisting of 2 subunits: p40 and pl9.
- the p40 subunit is shared by IL12 and IL23 as a common subunit, and is targeted by inhibitors of IL12/23, e.g. , ustekinumab/STELARA® (Janssen Biotech, Inc, Horsham, PA) and briakinumab/ABT-874 (Abbott Laboratories, Abbott Park, IL).
- IL12/23 e.g. , ustekinumab/STELARA® (Janssen Biotech, Inc, Horsham, PA) and briakinumab/ABT-874 (Abbott Laboratories, Abbott Park, IL).
- CD Crohn's disease
- UC ulcerative colitis
- IL23 is also elevated in other diseases including rheumatoid arthritis (RA), ankylosing spondylitis (AS), chronic obstructive pulmonary disease (COPD), and neuromyelitis optica.
- RA rheumatoid arthritis
- AS ankylosing spondylitis
- COPD chronic obstructive pulmonary disease
- anti-IL12/23p40 antibodies e.g. , ustekinumab and briakinumab
- CD Phase 2 studies; Toedter et al. Am J Gastroenterol. 104(11):2768-73 (2009); Sandborn et al. Gastroenterol. 135: 1130-41 (2008); Mannon et al. N Eng J of Med.
- the present disclosure provides a method of treating an interleukin-23 (IL23) -mediated disease in a patient, comprising administering an IL23 antagonist to a patient if the patient is determined to have (i) a lower or decreased level of CCL20 in one or more samples taken from the patient compared to a predetermined CCL20 threshold level, or compared to a CCL20 level in one or more control samples.
- IL23 interleukin-23
- Also provided is method of treating a patient having an IL23-mediated disease comprising suspending or not initiating the administration of an IL23 antagonist to a patient if the patient is determined to have a higher or increased level of CCL20 in one or more samples taken from the patient compared to a predetermined CCL20 threshold level, or compared to a CCL20 level in one or more control samples.
- IL23 interleukin-23
- IL23 interleukin-23
- the disclosure provides also a method of determining whether to treat a patient having an IL23 -mediated disease with an IL-23 antagonist, comprising determining to treat the patient if the patient is determined to have a lower or decreased level of CCL20 in one or more samples taken from the patient compared to a predetermined CCL20 threshold level, or compared to a CCL20 level in one or more control samples.
- Also provided is a method of selecting a patient diagnosed with an IL23-mediated disease as a candidate for treatment with an IL23 antagonist comprising selecting the patient for treatment if the patient is determined to have lower or decreased level of CCL20 in one or more samples taken from the patient compared to a predetermined CCL20 threshold level, or compared to a CCL20 level in one or more control samples.
- the methods disclosed above further comprise measuring the level of CCL20 in one or more of the samples obtained from the patient or instructing a clinical laboratory or healthcare provider to measure the level of CCL20 in the sample and/or submitting the one or more samples obtained from the patient to a clinical laboratory or healthcare provider to measure the level of CCL20 in the sample. In some aspects, the methods disclosed above further comprise determining the level of CCL20 in the one or more samples obtained from the patient. In some aspects, the methods disclosed above further comprise advising a healthcare provider to
- the second sample is taken 1, 2, 4, 8, 12, or 28 weeks, or at intervening times, after administering the IL23 antagonist.
- the IL23 antagonist is an anti-IL23 antibody or antigen -binding fragment thereof.
- the anti-IL23 antibody or antigen-binding fragment thereof binds to the pl9 subunit of IL23 (SEQ ID NO: 15), to the p40 subunit of IL23 (SEQ ID NO: 16), or both.
- the anti-IL23 antibody or antigen-binding fragment thereof comprises ustekinumab, briakinumab, guselkumab, BI-655066, tildrakinumab, LY-3074828, or an antigen -binding fragment thereof.
- the anti-IL23 antibody or antigen-binding fragment thereof comprises (i) a variable region (VH) comprising or consisting of SEQ ID NO: 7 and/or a light chain variable region (VL) comprising or consisting of SEQ ID NO: 8, or (ii) a variable region (VH) comprising or consisting of SEQ ID NO: 45 and/or a light chain variable region (VL) comprising or consisting of SEQ ID NO: 46.
- the anti-IL23 antibody or antigen-binding fragment thereof comprises at least one complementarity determining region selected from SEQ ID NOS: 33-38 or SEQ ID NOS: 47-52.
- the antibody is administered at a fixed dose.
- the fixed dose is between 10 and 1000 mg/dose.
- the fixed dose is about 210 mg/dose or about 700 mg/dose.
- the patient has been treated before, during, after, or alternatively to the administration of an IL23 antagonist or anti-IL23 antibody or antigen-binding fragment with one or more additional therapies for the treatment of the IL23 -mediated disease or disorder.
- the one or more samples taken from the patient and/or the one or more control samples are one or more selected from the group consisting of: whole blood, blood serum, plasma, saliva, sputum, bronchoalveolar lavage fluid, cerebrospinal fluid, pleural fluid, pericardial fluid, ascites, synovial fluid, epithelial cells, urine, stool, skin, tissue biopsy, or a combination thereof.
- the one or more control samples are (i) a sample or samples obtained from normal healthy individuals; (ii) a sample or samples obtained from patients with a non- IL23-mediated disease; or (iii) a combination thereof.
- the patient's level of CCL20 is measured in an immunoassay.
- the methods disclosed above further comprise determining the level of one or more IL23 Pathway Biomarkers selected from the group consisting of IL22, LCN2, IL17F, IL17A/F, IL23R, IL12B, IL6, IL21, TNF, CCR6, CCL22, IL1R1, IFN- ⁇ , S 100A12, DEFB-2, DEFB-4, IL1, SERPINB3, PI3/Elafin, LL37, RORy, RORyT, IL26, S 100A7, DEFB 103B, and GM-CSF.
- the predetermined threshold level of CCL20 is selected from the group consisting of:
- the IL23-mediated disease or disorder is a pulmonary disease, an inflammatory bowel disease, a chronic inflammatory skin disease, an inflammatory disease, an autoimmune disease, a neurodegenerative disease, an infection, or a cancer.
- the IL23-mediated disease or disorder is selected from the group consisting of: asthma, IPF, COPD.
- UC ulcerative colitis
- celiac disease atopic dermatitis, allergic contact dermatitis, eczema, psoriasis, alopecia areata, palmoplantar pustulosis, psoriatic arthritis, anklyosing spondylitis, arthritis, rheumatoid arthritis (RA), a rheumatic disorder, ANCA vasculitis, Bechet's disease, autoimmune thyroiditis, type 1 diabetes, multiple sclerosis (MS), Sjogren's syndrome (SS), systemic lupus erythematosus (SLE), Alzheimer's disease, mycobacterial disease, leishmaniasis, a fungal infection, a viral infection, gastric cancer, colorectal cancer, esophageal cancer, leukemia, hepatitis B virus (HBV)-related hepatocellular carcinoma, breast cancer, lung cancer, and nasopharyngeal cancer.
- UC ulcerative
- the patient is determined to have a level of CRP > 5 mg/L and/or a level of FCP > 250 ⁇ g/g, a level of FCP > 200 ⁇ g/g, a level of FCP > 150 ⁇ g/g, a level of FCP > 100 ⁇ g/g, or a level of FCP at least about 100 ⁇ g/g to at least about 250 ⁇ g/g in one or more samples taken from the patient.
- the predetermined CCL20 threshold level is at least about 5 pg/mL to at least about 55 pg/mL as measured using an immunoassay.
- the predetermined CCL20 threshold level is about 22.6 pg/mL as measured using an immunoassay.
- administration of the IL23 antagonist or anti-IL23 antibody or antigen-binding fragment thereof results in a Crohn's Disease Activity Index (CDAI) response score reduction of at least 100 points and/or a reduction in the total CDAI score to below 150 points after first administering the anti-IL23 antibody or antigen-binding fragment thereof.
- CDAI response score reduction of at least 100 points or reduction in the total CDAI score to below 150 points occurs within 1, 2, 4, 8, 12, 16 or 24 weeks or later after first administering the IL23 antagonist or anti-IL23 antibody or antigen-binding fragment thereof.
- FIG. 1 shows patient disposition up to Week 24.
- the chart summarizes the number and disposition of enrolled and randomized patients in a phase 2a study (clinicaltrials.gov identifier: NCT01714726) evaluating MEDI2070 in patients having moderate or severe CD.
- mITT Modified Intent-to-Treat Population
- PP per protocol
- OL Open Label.
- FIG. 2A shows clinical efficacy at Week 8 in the Modified Intent-to-Treat Population as indicated by CDAI clinical effect, CDAI remission, and CR100.
- FIG. 2B shows clinical efficacy at Week 8 in the Modified Intent-to-Treat Population as indicated by composite end points.
- CDAI Crohn's Disease Activity Index
- CI confidence interval
- CRP C-reactive protein
- FCP fecal calprotectin
- p p-value.
- FIG. 3A shows efficacy at various time points through Week 24 in the Open-Label Population using nonresponder imputation as indicated by Crohn's Disease Activity Index effect rate (from baseline to week 24).
- FIG. 3B shows efficacy at various time points through Week 24 in the open-label population using nonresponder imputation as indicated by Crohn's Disease Activity Index remission rate (from baseline to week 24).
- FIG. 4 shows percent of patients with CDAI- 100 response over time by baseline CCL20 Levels.
- CCL20 LO baseline CCL20 ⁇ 22.6 pg/mL;
- CCL20 HI baseline CCL20 >22.6 pg/mL.
- CI confidence interval.
- Patients with baseline serum CCL20 level ⁇ 22.6 pg/mL had a statistically significant increased CDAI- 100 response compared to placebo at week 8.
- FIG. 5 shows percent of patients with CDAI- 100 response over time by baseline IL22 levels.
- IL22 LO baseline IL22 ⁇ 15.6 pg/mL;
- IL22 HI baseline IL22 >15.6 pg/mL.
- CI confidence interval.
- 116 patients had evaluable baseline IL22 values.
- Patients with baseline serum IL22 levels >15.6 pg/mL had a statistically significant increased CDAI- 100 response compared to placebo at week 8.
- FIG. 6 shows percent of patients with CDAI- 100 response over time by baseline LCN2 Levels.
- LCN2 LO baseline LCN2 ⁇ 215 ng/niL
- LCN2 HI baseline LCN2 >215 ng/niL.
- CI confidence interval.
- FIG. 7 shows the differential clinical response rate between subjects treated with MEDI2070 compared to placebo as measured by the difference between the percentage (%) of subjects achieving a CDAI score ⁇ 150 or a reduction in CDAI score of >100) at Week 8 as a function of baseline CCL20, IL22 or LCN2 levels (by deciles).
- each distribution was divided into 10 levels, or deciles, such that each of the 11 analyte cut-offs (noted as "quantile" in FIGS. 7-9) progressively segmented the study population into groups with 10% less of the total study population.
- FIG. 8 shows the differential clinical response rate between subjects treated with MEDI2070 compared to placebo as measured by the difference between the percentage (%) of subjects achieving a 100 point improvement in CDAI score at Week 8 as a function of baseline CCL20, IL22, or LCN2 levels (by deciles).
- FIG. 9 shows the differential clinical response rate between subjects treated with MEDI2070 compared to placebo as measured by the difference between the percentage (%) of subjects achieving a CDAI score ⁇ 150 or a reduction in CDAI score of >100, + also achieving a >50% reduction in either FCP or CRP compared to baseline FCP or CRP; between subjects treated with MEDI2070 and placebo at Week 8 as a function of baseline CCL20, IL22 and LCN2 levels (by deciles).
- Clinical Response rates are reported as the delta or difference between the rate observed for MEDI2070 treated subjects and the rate observed for subjects treated with placebo ("Response Rate Differential").
- CD patients treated with MED 12070 having increasingly higher levels of baseline IL22 or LCN2 achieved higher clinical response rates (as measured using three different clinical response measurements) compared to placebo, illustrating that MEDI2070 induced better clinical responses in patients with high baseline IL22 or LCN2 serum levels at week 8.
- Subjects with high levels of IL22 or LCN2 including, e.g., subjects with IL22 or LCN2 levels at the 5 th , 6 th or 7 th deciles (0.5, 0.6 or 0.7 quantiles)
- had greater clinical response rate differences from placebo irrespective of which of the three different clinical response measurements was used
- IL22 or LCN2 low subjects including, e.g.
- CD patients treated with MED 12070 having increasingly lower levels of baseline CCL20 achieved higher clinical response rates (as measured using three different clinical response measurements) compared to placebo, illustrating that MEDI2070 induced better clinical responses in patients with low baseline CCL20 serum levels at week 8.
- Subjects with low levels of CCL20 including, e.g., subjects with CCL20 levels at the 1 st or 2 nd deciles (0.1 or 0.2 quantiles)) had greater clinical response rate differences from placebo (irrespective of which of the three different clinical response measurements was used) compared to the CCL20 high subjects (including, e.g.
- FIG. 10 compares the differential clinical response rate (defined as the difference in the percentage (%) of subjects achieving a CDAI- 100 response between treatment and placebo ("CDAI Response Delta vs. Placebo")) (y axis) and the differential clinical remission rate (defined as the difference in the percentage (%) of subjects achieving a total CDAI score of below 150 points between treatment and placebo ("CDAI Remission Delta vs. Placebo”)) (x axis) for patients treated with various molecules administered for 4- 10 weeks as shown.
- CDAI Response Delta vs. Placebo the differential clinical remission rate
- the present disclosure relates to the use of chemokine (CC motif) ligand 20 (CCL20), alone or in combination with one or more biomarkers, e.g., interleukin-22 (IL22), lipocalin-2 (LCN2), C-reactive protein (CRP), or fecal calprotectin (FCP), to predict clinical outcomes in patients suffering from interleukin 23 (IL23)-mediated diseases and treated with an IL23 antagonist which target, for example, the p40 subunit of IL12 and IL23 (targeted, e.g. , by ustekinumab), or the pl9 subunit of IL23 (targeted, e.g.
- Genes or proteins in the IL23 pathway that can be used as biomarkers in combination with CCL20 according to the methods disclosed herein include, e.g.
- interleukin-22 IL22
- lipocalin-2 IL23R
- IL12B IL6, IL21, TNF, CCR6, CCL22, IL1R1, IFN gamma
- S 100 calcium-binding protein A12 S 100A12
- defensin B2 DEFB-2, DEFB-4
- interleukin- 1 beta ILI
- SEPINB3 interleukin- 1 beta
- PI3 peptidase inhibitor 3
- Elafin peptidase inhibitor 3
- PI3/Elafin human cathelicidin (LL37), retinoid-related orphan receptor- ⁇ (RORy and RORyT
- interleukin-26 IL26
- psoriasin S 100A7
- defensin beta 103B DEFB 103B
- GM-CSF GM-CSF
- the present disclosure provides, for example, methods to treat, prevent and/or ameliorate an IL23 -mediated disease, to predict clinical outcomes, select patients for treatment, or stratify a population of patients suffering from a specific disease or disorder mediated by IL23 based on determining the expression level of CCL20 alone, or in combination with the expression level of one, two, three, or more biomarkers, including, e.g. , IL22, LCN2, CRP, and FCP. Accordingly, in one aspect, the present disclosure provides methods comprising determining the expression level of CCL20, alone or in combination with one or more biomarkers (e.g. , levels of IL22, levels of LCN2, levels of FCP, levels or CRP, or combinations thereof) in a sample obtained from a subject having an IL23-mediated disease to determine the appropriate course of treatment.
- biomarkers e.g. , levels of IL22, levels of LCN2, levels of FCP, levels or CRP, or combinations thereof
- CD is a chronic transmural inflammatory disease of unknown etiology that most commonly affects the distal ileum and colon, and may occur in any part of the gastrointestinal (GI) tract.
- Patients with CD have uncontrolled inflammation that causes direct or collateral damage to the intestinal mucosa.
- This inflammation can result either from persistence of inflammatory stimulus, due to impaired gut barrier function, or from a dysregulated inflammatory response (Sandborn et al. Gastroenterol. 135: 1130-41 (2008); Rutgeerts et al. Aliment Pharmacol Ther. 17(12): 1435-50 (2003)).
- CD occurs most commonly between the ages of 15 and 35 years, although patients of any age may be affected.
- Commonly used medical therapies include aminosalicylates, (including sulfasalazine and mesalamine), systemic corticosteroids, immunosuppressive agents (e.g. , azathioprine and methotrexate); antibacterial agents; and biologic agent, e.g.
- adalimumab/HuMlRA® (Abbott laboratories, IL) (SEQ ID NOS: 23, 24), infliximab/REMlCADE® (Janssen Biotech, Inc), certolizumab/ClMZlA® (UCB, Inc, Smyrna, GA) (SEQ ID NOS: 25, 26), vedolizumab/ENTYVIO® (Takeda Pharmaceuticals America, Inc., Deerfield, IL), and Natalizumab/TYSABRITM (Biogen pou Inc, Cambridge, MA). Being a highly heterogeneous disease, it is difficult to predict whether a patient will respond favorably to a certain therapy.
- the biomarkers disclosed herein can be used to stratify and/or identify a population of subjects having an IL23 -mediated disease such as CD suitable for treatment with an IL23 antagonists (including, e.g. , an anti-IL23 antibody or antigen-binding fragment thereof).
- the biomarkers disclosed herein can be used, for example, for diagnosing a patient, treating a patient, for example, with an IL23 antagonist (e.g. , an anti-IL23 antibody targeting, e.g. , the pl9 subunit of IL23); selecting or non-selecting a patient for treatment, for example, with an IL23 antagonist (e.g. , an anti-IL23 antibody targeting, e.g.
- the pl9 subunit of IL23 selecting a certain treatment, for example, with an IL23 antagonist (e.g. , an anti-IL23 antibody targeting, e.g. , the pl9 subunit of IL23); suspending or modifying temporarily or permanently a treatment; determining the prognosis of a patient; or monitoring the effect of a treatment, wherein those methods comprise, for example, determining an expression range and/or threshold level of CCL20, alone or in combination with, for example, elevated or high levels of clinical biomarkers IL22, LCN2, CRP, FCP, and combinations thereof.
- an IL23 antagonist e.g. , an anti-IL23 antibody targeting, e.g. , the pl9 subunit of IL23
- suspending or modifying temporarily or permanently a treatment determining the prognosis of a patient; or monitoring the effect of a treatment, wherein those methods comprise, for example, determining an expression range and/or threshold level of CCL20, alone or in combination with, for example, elevated
- the IL23 antagonist is an anti-IL23 antibody which can specifically bind to the pl9 subunit of IL23 (SEQ ID NO: 15), to the p40 subunit of IL23 (SEQ ID NO: 16), or both.
- the IL23 antagonist is an anti-IL23 antibody or other molecule (e.g. , small molecule, aptamer, scaffolding molecule, etc) which can compete for binding to the pl9 subunit of IL23 (SEQ ID NO: 15), to the p40 subunit of IL23 (SEQ ID NO: 16), or both, with MED 12070 or another anti-IL23 antibody known in the art.
- the anti-IL23 antibody or antigen-binding fragment thereof comprises the heavy chain (HC) (SEQ ID NO: 17) and/or the light chain (SEQ ID NO: 18) of MEDI2070, or an antigen-binding fragment, variant, or derivative thereof.
- the anti-IL23 antibody or antigen-binding fragment thereof comprises the variable region (VH) (SEQ ID NO: 7) and/or the light chain variable region (VL) (SEQ ID NO: 8) of MEDI2070.
- the anti-IL23 antibody or antigen-binding fragment thereof comprises at least one of the complementarity determining regions of MEDI2070 (SEQ ID NOS: 33-38).
- the anti-IL23 antibody or antigen-binding fragment thereof comprises a VH region comprising the sequence of SEQ ID NO: 45 and/or a VL region comprising the sequence of SEQ ID NO: 46, or an antigen-binding fragment, variant, or derivative thereof.
- the anti-IL23 antibody or antigen-binding fragment thereof comprises at least one of the complementarity determining regions of SEQ ID NOS: 47-49 (CDRs of the VH of SEQ ID NO: 45) and/or SEQ ID NOS: 50-52 (CDRs of the VL of SEQ ID NO:46).
- the IL23 antagonist is an anti-IL23 antibody selected from ustekinumab or briakinumab (targeting the p40 subunit of IL23), guselkumab, tildrakizumab, BI-655066 or LY-3074828 (targeting the pl9 subunit of IL23), an antigen-binding fragment thereof, or a combination thereof.
- the IL23 antagonist is a molecule competing with ustekinumab or briakinumab (targeting the p40 subunit of IL23), guselkumab, tildrakizumab, BI-655066 or LY-3074828 (targeting the pl9 subunit of IL23), an antigen-binding fragment thereof, or a combination thereof for binding to IL23.
- the methods disclosed herein are not only applicable to IL23-binding antibodies.
- the method disclosed herein can be applied to any inhibitors of the pl9 subunit of IL23, including for example antibodies and antigen-binding fragments thereof, aptamers, scaffolding molecules, small molecules, soluble IL23 receptors, etc.
- Amino acids are referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Unless otherwise indicated, amino acid sequences are written left to right in amino to carboxy orientation.
- Nucleotides are referred to by their commonly accepted single-letter codes. Unless otherwise indicated, nucleic acids are written left to right in 5' to 3' orientation. Nucleotides are referred to herein by their commonly known one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Accordingly, A represents adenine, C represents cytosine, G represents guanine, T represents thymine, U represents uracil.
- polynucleotide oligonucleotide
- nucleic acid nucleic acid molecule
- gene a polymer of nucleotides of any length, and ribonucleotides, deoxyribonucleotides, analogs thereof, or mixtures thereof.
- DNA sequence refers to a contiguous nucleic acid sequence.
- the sequence can be either single stranded or double stranded, DNA or RNA, but double stranded DNA sequences are preferable.
- the sequence can be an oligonucleotide of 6 to 20 nucleotides in length to a full length genomic sequence of thousands or hundreds of thousands of base pairs.
- polypeptide polypeptide
- peptide protein
- polymers of amino acids of any length can be linear or branched, it can comprise modified amino acids, and it can be interrupted by non-amino acids.
- the terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling component.
- polypeptides containing one or more analogs of an amino acid including, for example, unnatural amino acids such as homocysteine, ornithine, p-acetylphenylalanine, D-amino acids, and creatine), as well as other modifications known in the art.
- a polypeptide, antibody, polynucleotide, vector, cell, or composition which is "isolated” is a polypeptide, polynucleotide, or composition which is in a form not found in nature. Isolated polypeptides, polynucleotides, or compositions include those which have been purified to a degree that they are no longer in a form in which they are found in nature. In some aspects, a polypeptide, polynucleotide, or composition which is isolated is substantially pure.
- amino acid substitution refers to replacing an amino acid residue present in a parent sequence with another amino acid residue.
- An amino acid can be substituted in a parent sequence, for example, via chemical peptide synthesis or through recombinant methods known in the art.
- references to a "substitution at position X" or “substitution at position X” refer to the substitution of an amino acid present at position X with an alternative amino acid residue.
- substitution patterns can described according to the schema AXY, wherein A is the single letter code corresponding to the amino acid naturally present at position X, and Y is the substituting amino acid residue.
- substitution patterns can described according to the schema XY, wherein Y is the single letter code corresponding to the amino acid residue substituting the amino acid naturally present at position X.
- a "conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain.
- Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
- basic side chains e
- a string of amino acids can be conservatively replaced with a structurally similar string that differs in order and/or composition of side chain family members.
- Non-conservative substitutions include those in which (i) a residue having an electropositive side chain (e.g., Arg, His or Lys) is substituted for, or by, an electronegative residue (e.g., Glu or Asp), (ii) a hydrophilic residue (e.g., Ser or Thr) is substituted for, or by, a hydrophobic residue (e.g., Ala, Leu, He, Phe or Val), (iii) a cysteine or proline is substituted for, or by, any other residue, or (iv) a residue having a bulky hydrophobic or aromatic side chain (e.g., Val, His, He or Trp) is substituted for, or by, one having a smaller side chain (e.g., Ala, Ser) or no side chain (e.g., Gly).
- an electropositive side chain e.g., Arg, His or Lys
- an electronegative residue e.g., Glu or Asp
- substitutions can be readily identified by workers of ordinary skill.
- a substitution can be taken from any one of D-alanine, glycine, beta-alanine, L-cysteine and D-cysteine.
- a replacement can be any one of D- lysine, arginine, D-arginine, homo-arginine, methionine, D-methionine, ornithine, or D- ornithine.
- substitutions in functionally important regions that can be expected to induce changes in the properties of isolated polypeptides are those in which (i) a polar residue, e.g., serine or threonine, is substituted for (or by) a hydrophobic residue, e.g., leucine, isoleucine, phenylalanine, or alanine; (ii) a cysteine residue is substituted for (or by) any other residue; (iii) a residue having an electropositive side chain, e.g., lysine, arginine or histidine, is substituted for (or by) a residue having an electronegative side chain, e.g., glutamic acid or aspartic acid; or (iv) a residue having a bulky side chain, e.g., phenylalanine, is substituted for (or by) one not having such a side chain, e.g., glycine.
- a polar residue e.g
- amino acid insertion refers to introducing a new amino acid residue between two amino acid residues present in the parent sequence.
- An amino acid can be inserted in a parent sequence, for example, via chemical peptide synthesis or through recombinant methods known in the art.
- the phrase "insertion between positions X and Y" wherein X and Y correspond to amino acid positions refers to the insertion of an amino acid between the X and Y positions, and also to the insertion in a nucleic acid sequence of a codon encoding an amino acid between the codons encoding the amino acids at positions X and Y.
- percent sequence identity between two polypeptide or polynucleotide sequences refers to the number of identical matched positions shared by the sequences over a comparison window, taking into account additions or deletions (i.e., gaps) that must be introduced for optimal alignment of the two sequences.
- a matched position is any position where an identical nucleotide or amino acid is presented in both the target and reference sequence. Gaps presented in the target sequence are not counted since gaps are not nucleotides or amino acids. Likewise, gaps presented in the reference sequence are not counted since target sequence nucleotides or amino acids are counted, not nucleotides or amino acids from the reference sequence.
- the percentage of sequence identity is calculated by determining the number of positions at which the identical amino-acid residue or nucleic acid base occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity.
- the comparison of sequences and determination of percent sequence identity between two sequences can be accomplished using readily available software both for online use and for download. Suitable software programs are available from various sources, and for alignment of both protein and nucleotide sequences.
- One suitable program to determine percent sequence identity is bl2seq, part of the BLAST suite of program available from the U.S.
- B12seq performs a comparison between two sequences using either the BLASTN or BLASTP algorithm.
- BLASTN is used to compare nucleic acid sequences
- BLASTP is used to compare amino acid sequences.
- Other suitable programs are, e.g., Needle, Stretcher, Water, or Matcher, part of the EMBOSS suite of bioinformatics programs and also available from the European Bioinformatics Institute (EBI) at www.ebi.ac.uk/Tools/psa.
- Different regions within a single polynucleotide or polypeptide target sequence that align with a polynucleotide or polypeptide reference sequence can each have their own percent sequence identity. It is noted that the percent sequence identity value is rounded to the nearest tenth. For example, 80.11, 80.12, 80.13, and 80.14 are rounded down to 80.1, while 80.15, 80.16, 80.17, 80.18, and 80.19 are rounded up to 80.2. It also is noted that the length value will always be an integer.
- the percentage identity "X" of a first amino acid sequence to a second sequence amino acid is calculated as 100 x (Y/Z), where Y is the number of amino acid residues scored as identical matches in the alignment of the first and second sequences (as aligned by visual inspection or a particular sequence alignment program) and Z is the total number of residues in the second sequence. If the length of a first sequence is longer than the second sequence, the percent identity of the first sequence to the second sequence will be higher than the percent identity of the second sequence to the first sequence.
- sequence alignments are not limited to binary sequence-sequence comparisons exclusively driven by primary sequence data. Sequence alignments can be derived from multiple sequence alignments.
- One suitable program to generate multiple sequence alignments is ClustalW2, available from www.clustal.org.
- Another suitable program is MUSCLE, available from www.drive5.com/muscle/.
- ClustalW2 and MUSCLE are alternatively available, e.g., from the EBI.
- sequence alignments can be generated by integrating sequence data with data from heterogeneous sources such as structural data (e.g., crystallographic protein structures), functional data (e.g., location of mutations), or phylogenetic data.
- a suitable program that integrates heterogeneous data to generate a multiple sequence alignment is T-Coffee, available at www.tcoffee.org, and alternatively available, e.g., from the EBI. It will also be appreciated that the final alignment used to calculate percent sequence identity can be curated either automatically or manually.
- the term "antibody” refers to at least the minimal portion of an antibody which is capable of binding to antigen, e.g.
- IL23 comprising at least the variable domain of a heavy chain (VH) and the variable domain of a light chain (VL) in the context of a typical antibody produced by a B cell.
- VH heavy chain
- VL variable domain of a light chain
- Antibodies or antigen-binding fragments, variants, or derivatives thereof include, but are not limited to, polyclonal, monoclonal, human, humanized, or chimeric antibodies, single chain antibodies, epitope-binding fragments, e.g., Fab, Fab' and F(ab')2, Fd, Fvs, single-chain Fvs (scFv), single-chain antibodies, disulfide-linked Fvs (sdFv), fragments comprising either a VL or VH domain, fragments produced by a Fab expression library.
- ScFv molecules are known in the art and are described, e.g., in U.S. Patent No. 5,892,019.
- Immunoglobulin or antibody molecules encompassed by this disclosure can be of any type (e.g., IgG, IgE, IgM, IgD, IgA, and IgY), class (e.g., IgGl, IgG2, IgG3, IgG4, IgAl and IgA2) or subclass of immunoglobulin molecule.
- references to an antibody e.g., the anti-IL23 antibody MEDI2070, refer to the MEDI2070 antibody and also to antigen- binding fragments, variants, and derivatives thereof.
- the antibody is an anti- IL23 antibody which can specifically bind to the pl9 subunit of IL23 (SEQ ID NO: 15), to the p40 subunit of IL23 (SEQ ID NO: 16), or both.
- the anti-IL23 antibody or antigen-binding fragment thereof comprises, consists, or consists essentially of the heavy chain (HC) (SEQ ID NO: 17) and/or the light chain (SEQ ID NO: 18) of MEDI2070, or an antigen-binding fragment, variant, or derivative thereof.
- the anti-IL23 antibody or antigen-binding fragment thereof comprises, consists, or consists essentially of the heavy chain variable region (VH) (SEQ ID NO: 7) and/or the light chain variable region (VL) (SEQ ID NO: 8) of MEDI2070.
- the anti-IL23 antibody or antigen-binding fragment thereof comprises at least one of the complementarity determining regions of MEDI2070 (SEQ ID NOS: 33-38), e.g., it comprises one, two, three, four, five, or the six complementarity determining regions of MEDI2070.
- the anti-IL23 antibody or antigen-binding fragment thereof comprises a VH region comprising, consisting, or consisting essentially of the sequence of SEQ ID NO: 45 and/or a VL region comprising, consisting, or consisting essentially of the sequence of SEQ ID NO: 46, or an antigen-binding fragment, variant, or derivative thereof.
- the anti-IL23 antibody or antigen-binding fragment thereof comprises at least one of the complementarity determining regions of SEQ ID NOS: 47-49 (CDRs of the VH of SEQ ID NO:45) and/or SEQ ID NOS: 50-52 (CDRs of the VL of SEQ ID NO: 46). See U.S. Pat. No. 8,722,033, which is herein incorporated by reference in its entirety.
- the IL23 antagonist is an anti-IL23 antibody selected from ustekinumab or briakinumab (targeting the p40 subunit of IL23), guselkumab, tildrakizumab, BI-655066 or LY-3074828 (targeting the pl9 subunit of IL23), an antigen-binding fragment thereof, or a combination thereof.
- the IL23 antagonist is a molecule competing with ustekinumab or briakinumab (targeting the p40 subunit of IL23), guselkumab, tildrakizumab, BI-655066 or LY-3074828 (targeting the pl9 subunit of IL23), an antigen-binding fragment thereof, or a combination thereof, for binding to IL23.
- the antibody is a naturally-occurring antibody, e.g., an antibody isolated and/or purified from a mammal, or produced by a hybridoma generated from a mammalian cell.
- the antibody is a genetically-engineered antibody, e.g., a humanized antibody, a chimeric antibody, a CDR-grafted antibody, a humaneered antibody, a bispecific antibody, a trispecific antibody, and the like. Genetic engineering techniques also provide the ability to make fully human antibodies in a non-human source.
- the antibody is generated using phage display.
- the antibody is in polymeric, oligomeric, or multimeric form. In certain aspects in which the antibody comprises two or more distinct antigen binding regions fragments, the antibody is considered bispecific, trispecific, or multi- specific, or bivalent, trivalent, or multivalent, depending on the number of distinct epitopes that are recognized and bound by the antibody.
- the binding agent is an antigen binding fragment of any antibody of the preceding paragraphs.
- the antigen binding fragment (also referred to herein as "antigen binding portion") may be an antigen binding fragment of any of the antibodies described herein.
- the antigen binding fragment can be any part of an antibody that has at least one antigen binding site, including, but not limited to, Fab, Fab', F(ab')2, Fd, Fvs, dsFv, disulfide- linked Fvs (sdFv), single chain Fvs (scFVs), fragments comprising either a light or heavy chain variable domain, single-chain antibodies, diabodies, triabodies, bis-scFvs, fragments expressed by a Fab expression library, domain antibodies, VhH domains, V-NAR domains, VH domains, VL domains, and the like.
- a typical antibody comprises at least two heavy (H) chains and two light (L) chains interconnected by disulfide bonds.
- Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as VH, VH region, or VH domain) and a heavy chain constant region.
- the heavy chain constant region is comprised of three or four constant domains, CHI, CH2, CH3, and CH4.
- Each light chain is comprised of a light chain variable region (abbreviated herein as VL, VL region, or VL domain) and a light chain constant region.
- the light chain constant region is comprised of one domain, CL.
- VH and VL regions can be further subdivided into regions of hypervariability, termed Complementarity Determining Regions (CDR), interspersed with regions that are more conserved, termed framework regions (FW).
- CDR Complementarity Determining Regions
- FW framework regions
- Each VH and VL is composed of three CDRs and four FWs, arranged from amino-terminus to carboxy-terminus in the following order: FW1, CDR1, FW2, CDR2, FW3, CDR3, FW4.
- Framework regions can be designated according to their respective VH and VL regions.
- VH-FWl would refer to the first framework region of VH.
- the variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
- the constant regions of the antibodies can mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system.
- an antibody e.g., an anti-IL23 antibody
- fragment, variant, or derivative thereof binds to an epitope via its antigen- binding domain, and that the binding entails some complementarity between the antigen binding domain and the epitope.
- an antibody is said to "specifically bind” to an epitope when it binds to that epitope via its antigen-binding domain more readily than it would bind to a random, unrelated epitope.
- epitope refers to an antigenic protein determinant capable of binding to an antibody (e.g., an anti-IL23 antibody) or fragment, variant, or derivative thereof binds disclosed herein.
- epitope refers to a protein determinant (e.g., an amino acid sequence) of the pl9 subunit of IL23.
- epitope refers to a protein determinant (e.g., an amino acid sequence) of the p40 subunit of IL23.
- Epitopes usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three dimensional structural characteristics, as well as specific charge characteristics.
- the part of an antibody or binding molecule that recognizes the epitope is called a paratope.
- the epitopes of protein antigens are divided into two categories, conformational epitopes and linear epitopes, based on their structure and interaction with the paratope.
- a conformational epitope is composed of discontinuous sections of the antigen's amino acid sequence. These epitopes interact with the paratope based on the 3-D surface features and shape or tertiary structure of the antigen.
- linear epitopes interact with the paratope based on their primary structure.
- a linear epitope is formed by a continuous sequence of amino acids from the antigen.
- antibody binding site refers to a region in the antigen (e.g., an amino acid sequence of the pl9 subunit of IL23, or an amino acid sequence of the p40 subunit of IL23) comprising a continuous or discontinuous site (i.e., an epitope) to which a complementary antibody specifically binds.
- the antibody binding site can contain additional areas in the antigen which are beyond the epitope and which can determine properties such as binding affinity and/or stability, or affect properties such as antigen enzymatic activity or dimerization. Accordingly, even if two antibodies bind to the same epitope within an antigen, if the antibody molecules establish distinct intermolecular contacts with amino acids outside of the epitope, such antibodies are considered to bind to distinct antibody binding sites.
- An antibody or fragment, variant, or derivative thereof is said to competitively inhibit binding of a reference antibody or antigen binding fragment to a given epitope if it preferentially binds to that epitope to the extent that it blocks, to some degree, binding of the reference antibody or antigen binding fragment to the epitope.
- Competitive inhibition can be determined by any method known in the art, for example, competition ELISA assays.
- a binding molecule can be said to competitively inhibit binding of the reference antibody or antigen-binding fragment to a given epitope by at least 90%, at least 85%, at least 80%, at least 75%, at least 70%, at least 65%, at least 60%, at least 55%, at least 50%, at least 45%, at least 40%, at least 35%, at least 30%, or at least 25%.
- Antibodies or antigen-binding fragments, variants, or derivatives thereof disclosed herein can be described or specified in terms of the epitope(s) or portion(s) of an antigen, e.g., a target polysaccharide that they recognize or specifically bind.
- the portion of IL23 that specifically interacts with the antigen-binding domain of an anti-IL23 antibody is an "epitope.”
- IL23 -mediated disease or disorder used interchangeably with “IL23- mediated disease” herein, as well as grammatical variants thereof, refers to any pathology known in the art to be caused by (alone or in association with other mediators), exacerbated by, associated with, or prolonged by abnormal levels of IL23 or abnormal activation of the IL23 pathway in the subject having the disorder.
- Non-limiting examples include IL23- mediated inflammatory bowel diseases (e.g., Crohn's disease), as well as pulmonary diseases, chronic inflammatory skin diseases, inflammatory diseases, autoimmune diseases, neurodegenerative diseases, or cancer.
- the IL23-mediated inflammatory bowel disease is CD, ulcerative colitis (UC), Behcet's disease, or celiac disease.
- the IL23-mediated pulmonary disease is asthma (e.g., allergic asthma, atopic asthma, corticosteroid naive asthma, chronic asthma, corticosteroid resistant asthma, corticosteroid refractory asthma, asthma due to smoking, or asthma uncontrolled on corticosteroids), idiopathic pulmonary fibrosis (IPF), or chronic obstructive pulmonary disease (COPD).
- asthma e.g., allergic asthma, atopic asthma, corticosteroid naive asthma, chronic asthma, corticosteroid resistant asthma, corticosteroid refractory asthma, asthma due to smoking, or asthma uncontrolled on corticosteroids
- IPF idiopathic pulmonary fibrosis
- COPD chronic obstructive pulmonary disease
- the IL23-mediated chronic inflammatory skin disease is atopic dermatitis, allergic contact dermatitis, eczema, psoriasis, alopecia areata, or palmoplantar pustulosis.
- the IL23-mediated inflammatory disease is psoriatic arthritis, anklyosing spondylitis, arthritis, rheumatoid arthritis (RA), a rheumatic disorder, ANCA vasculitis, Bechet's disease, or autoimmune thyroiditis.
- the IL23-mediated autoimmune disease is multiple sclerosis (MS), Sjogren's syndrome (SS), systemic lupus erythematosus (SLE), autoimmune encephalomyelitis, collagen-induced arthritis, or type 1 diabetes mellitus.
- the IL23-mediated neurodegenerative disease is Alzheimer's disease.
- the IL23-mediated cancer is melanoma, colorectal cancer, stomach cancer, myeloma, prostate cancer, colitis-associated cancer, ovarian cancer, oral cancer, esophageal cancer, leukemia hepatitis B virus (HBV)-related hepatocellular carcinoma, breast cancer, lung cancer, and nasopharyngeal cancer.
- the IL23-mediated disease or disorder is a microbial infection, including, e.g., mycobacterial disease, or leishmaniasis.
- the IL23-mediated disease or disorder is a fungal or a viral infection (see, e.g., Khader et al., Mucosal Immunol 2(5): 403-411 (2009)).
- the terms "treat,” “treating,” “treatment, “ or “treatment of” as used herein refers methods that are aimed at (1) to reducing the potential for an IL23 -mediated disease or disorder, e.g., delaying or preventing the onset of an IL23-mediated disease or disorder, (2) reducing the occurrence of the IL23 -mediated disease or disorder, e.g., slowing down or stopping the progression or aggravation of the symptoms or physical deterioration associated with the IL23 -mediated disease or disorder, (3) a reduction in the severity or amelioration of the symptoms of the IL23 -mediated disease or disorder, preferably, to an extent that the subject no longer suffers discomfort and/or altered function due to it (for example, a relative reduction in CD exacerbations or disease severity when compared to untreated patients), and/or (4) curing the IL23 -mediated disease or disorder.
- a treatment may be administered prior to the onset of the disease, for a prophylactic or preventive action. It may also be administered after initiation of the IL23- mediated disease or disorder, for a therapeutic action. In some aspects, treatment of an IL23- mediated disease or disorder can comprise surgery.
- subject or “patient” as used herein refer to any subject, particularly a mammalian subject, for whom diagnosis, prognosis, or therapy of an IL23-mediated disease or disorder is desired.
- subject or “patient” include any human or nonhuman animal.
- nonhuman animal includes all vertebrates, e.g. , mammals and non-mammals, such as nonhuman primates, sheep, dogs, cats, horses, cows, bears, chickens, amphibians, reptiles, etc.
- phrases such as "a patient having an IL23-mediated disease” includes subjects, such as mammalian subjects, including humans that would benefit from the administration of a therapy, imaging or other diagnostic procedure, and/or preventive treatment for that IL23-mediated disease.
- a subject is a naive subject.
- a "naive subject” is a subject that has not been administered a therapy, for example a therapeutic agent.
- a naive subject has not been treated with a therapeutic agent prior to being diagnosed as having an IL23-mediated disease.
- a subject has received therapy and/or one or more doses of a therapeutic agent (e.g. , a therapeutic agent capable of modulating an IL23- mediated disease) prior to being diagnosed as having an IL23-mediated disease.
- the term "patient having an IL23-mediated disease” also encompasses subjects suspected of having an IL23-mediated disease or disorder (e.g., CD) or who may have one or more risk factor (e.g., age, sex, family history, etc). The term also encompasses subjects that have not been tested for an IL23-mediated disease or disorder, as well as subjects that have received an initial diagnosis.
- IL23-mediated disease or disorder e.g., CD
- risk factor e.g., age, sex, family history, etc.
- the term also encompasses subjects that have not been tested for an IL23-mediated disease or disorder, as well as subjects that have received an initial diagnosis.
- the term "therapy” as used herein includes any means for curing, mitigating, or preventing an IL23 -mediated disease or disorder, including, for example, therapeutic agents, instrumentation, supportive measures, and surgical or rehabilitative procedures.
- therapy encompasses any protocol, method and/or therapeutic or diagnostic that can be used in prevention, management, treatment, and/or amelioration of an IL23- mediated disease or disorder.
- therapeutic agent refers to any therapeutically active substance that is administered to a subject having an IL23-mediated disease or disorder to produce a desired, usually beneficial, effect.
- therapeutic agent includes, e.g. , classical low molecular weight therapeutic agents commonly referred to as small molecule drugs and biologies including but not limited to antibodies or active fragments thereof, peptides, protein drugs, protein conjugate drugs, etc.
- a therapeutic agent can also be a prodrug, which metabolizes into the desired therapeutically active substance when administered to a subject.
- the therapeutic agent is a prophylactic agent.
- a therapeutic agent can be pharmaceutically formulated.
- the term "effective amount” or “pharmaceutically effective amount” or “therapeutically effective amount” refers to a quantity of the compound(s) in a preparation which, when administered to a subject is sufficient to achieve a desired therapeutic and/or prophylactic effect, e.g. , an amount which alleviates a symptom, ameliorates a condition, or slows the onset of disease conditions according to clinically acceptable standards for the disorder or condition to be treated.
- the amount of a composition administered to the subject will depend on the type and severity of the IL23-mediated disease or disorder and on the characteristics of the individual, such as general health, age, sex, body weight and tolerance to drugs. It will also depend on the degree, severity and type of disease. The skilled artisan will be able to determine appropriate dosages depending on these and other factors.
- the compositions can also be administered in combination with one or more additional therapeutic compounds and/or treatments.
- bio sample is used herein in its broadest sense.
- the methods disclosed herein can be carried out using any sample that may contain the disclosed biomarkers, i.e., CCL20 alone or in combination with at least one additional biomarker, e.g., IL22, LCN2, CRP, FCP, or a combination thereof.
- a biological sample is generally obtained from a subject.
- a sample may be of any biological tissue or fluid with which biomarkers of the present disclosure may be assayed. Frequently, a sample will be a "clinical sample", i.e., a sample derived from a patient.
- non-limiting examples of the sample obtained from the subject comprises, for example, whole blood, blood serum, plasma, saliva, sputum, bronchoalveolar lavage fluid, cerebrospinal fluid, pleural fluid, pericardial fluid, ascites, synovial fluid, epithelial cells, urine, stool, skin, tissue, pinch or fine needle biopsy samples, and archival samples with known diagnosis, treatment and/or outcome history.
- Biological samples may also include sections of tissues such as frozen sections taken for histological purposes, or combinations thereof. Samples can be obtained by any means known in the art.
- biological sample also encompasses any material derived by processing a biological sample. Derived materials include, but are not limited to, proteins extracted from the sample, nucleic acids extract from the sample, or nucleic acid sequences PCR amplified from the sample. Processing of a biological sample may involve one or more of: filtration, distillation, extraction, concentration, inactivation of interfering components, addition of reagents, and the like. For example, a blood sample can be fractionated into serum or into fractions containing particular types of cells
- a sample can be a combination of samples from an individual, such as a combination of a tissue and fluid sample.
- the sample can be pretreated as necessary by dilution in an appropriate buffer solution or concentrated. Any of a number of standard aqueous buffer solutions and/or protease inhibitor, employing any of a variety of buffers, such as phosphate, TRIS, or the like, at physiological pH, can be used.
- a sample can be a combination of samples from multiple individuals.
- samples obtained to diagnose and/or determine expression levels of biomarkers for a certain IL23 -mediated disease or disorder can vary depending on the specific methods used in the art.
- samples can be, for example, biological samples (whole blood, blood serum, plasma, saliva, sputum, bronchoalveolar lavage fluid, stool, epithelial cells, tissue biopsy samples, intestinal tissue biopsy samples, urine, skin, polyps, cerebrospinal fluid, pleural fluid, pericardial fluid, ascites, synovial fluid, etc), physical exam data (e.g., presence of fever, pain and/or abdominal tenderness), family history, results from laboratory tests (e.g., blood protein levels, blood sedimentation rates, body mineral levels, red blood cell counts, white blood cell counts, presence of blood and/or infectious microbes in stool samples), imaging studies and endoscopy (e.g., barium X-rays and other X-rays, CT scans, colonoscopy, sigmoidoscopy, video capsule endo
- control when used to characterize a subject, refers to a subject that is healthy or to a patient who has been diagnosed with a specific disease other than an IL23-mediated disease or disorder.
- control sample refers to one, or more than one, biological samples obtained from a healthy subject or from a patient diagnosed with a disease other than an IL23 -mediated disease or disorder.
- a sample from a patient can be obtained before or after the administration of a therapy to treat an IL23-mediated disease or disorder. In some cases, successive samples can be obtained from the patient after therapy has commenced or after therapy has ceased. Samples can, for example, be requested by a healthcare provider (e.g. , a doctor) or healthcare benefits provider, obtained and/or processed by the same or a different healthcare provider (e.g. , a nurse, a hospital) or a clinical laboratory, and after processing, the results can be forwarded to the original healthcare provider or yet another healthcare provider, healthcare benefits provider or the patient.
- a healthcare provider e.g. , a doctor
- healthcare benefits provider obtained and/or processed by the same or a different healthcare provider (e.g. , a nurse, a hospital) or a clinical laboratory, and after processing, the results can be forwarded to the original healthcare provider or yet another healthcare provider, healthcare benefits provider or the patient.
- the quantification of the expression level of a biomarker disclosed herein i.e., CCL20 alone or in combination with at least one additional biomarker, e.g., IL22, LCN2, CRP, FCP, or a combination thereof; comparisons and/or ratios between biomarker gene or protein expression levels; evaluation of the absence or presence biomarkers; determination of biomarker levels with respect to a certain threshold; treatment decisions; or combinations thereof, can be performed by one or more healthcare providers, healthcare benefits providers, and/or clinical laboratories.
- additional biomarker e.g., IL22, LCN2, CRP, FCP, or a combination thereof
- healthcare provider refers to individuals or institutions that directly interact and administer to living subjects, e.g. , human patients.
- Non-limiting examples of healthcare providers include doctors, nurses, technicians, therapist, pharmacists, counselors, alternative medicine practitioners, medical facilities, doctor's offices, hospitals, emergency rooms, clinics, urgent care centers, alternative medicine clinics/facilities, and any other entity providing general and/or specialized treatment, assessment, maintenance, therapy, medication, and/or advice relating to all, or any portion of, a patient's state of health, including but not limited to general medical, specialized medical, surgical, and/or any other type of treatment, assessment, maintenance, therapy, medication, and/or advice.
- the term "clinical laboratory” refers to a facility for the examination or processing of materials derived from a living subject, e.g. , a human being.
- processing include biological, biochemical, serological, chemical, immunohematological, hematological, biophysical, cytological, pathological, genetic, or other examination of materials derived from the human body for the purpose of providing information, e.g. , for the diagnosis, prevention, or treatment of any disease or impairment of, or the assessment of the health of living subjects, e.g. , human beings.
- These examinations can also include procedures to collect or otherwise obtain a sample, prepare, determine, measure, or otherwise describe the presence or absence of various substances in the body of a living subject, e.g. , a human being, or a sample obtained from the body of a living subject, e.g. , a human being.
- a clinical laboratory can, for example, collect or obtain a sample, process a sample, submit a sample, receive a sample, transfer a sample, analyze or measure a sample, quantify a sample, provide the results obtained after analyzing/measuring/quantifying a sample, receive the results obtained after analyzing/measuring/quantifying a sample, compare/score the results obtained after analyzing/measuring/quantifying one or more samples, provide the comparison/score from one or more samples, obtain the comparison/score from one or more samples, or other related activities.
- healthcare benefits provider encompasses individual parties, organizations, or groups providing, presenting, offering, paying for in whole or in part, or being otherwise associated with giving a patient access to one or more healthcare benefits, benefit plans, health insurance, and/or healthcare expense account programs.
- a healthcare provider can administer or instruct another healthcare provider to administer a therapy to treat an IL23 -mediated disease or disorder.
- a healthcare provider can implement or instruct another healthcare provider or patient to perform, for example, the following actions: obtain a sample, process a sample, submit a sample, receive a sample, transfer a sample, analyze or measure a sample, quantify a sample, provide the results obtained after analyzing/measuring/quantifying a sample, receive the results obtained after analyzing/measuring/quantifying a sample, compare/score the results obtained after analyzing/measuring/quantifying one or more samples, provide the comparison/score from one or more samples, obtain the comparison/score from one or more samples, administer a therapy (e.g.
- a therapeutic agent that treats a IL23-mediated disease or disorder commences administration of a therapy, cease the administration of a therapy, continue the administration of a therapy, temporarily interrupt the administration of a therapy, increase the amount of an administered therapeutic agent, decrease the amount of an administered therapeutic agent, continue the administration of an amount of a therapeutic agent, increase the frequency of administration of a therapeutic agent, decrease the frequency of administration of a therapeutic agent, maintain the same dosing frequency on a therapeutic agent, replace a therapy or therapeutic agent by at least another therapy or therapeutic agent, combine a therapy or therapeutic agent with at least another therapy or additional therapeutic agent.
- a healthcare benefits provider can authorize or deny, for example, collection of a sample, processing of a sample, submission of a sample, receipt of a sample, transfer of a sample, analysis or measurement a sample, quantification a sample, provision of results obtained after analyzing/measuring/quantifying a sample, transfer of results obtained after analyzing/measuring/quantifying a sample, comparison/scoring of results obtained after analyzing/measuring/quantifying one or more samples, transfer of the comparison/score from one or more samples, administration of a therapy or therapeutic agent, commencement of the administration of a therapy or therapeutic agent, cessation of the administration of a therapy or therapeutic agent, continuation of the administration of a therapy or therapeutic agent, temporary interruption of the administration of a therapy or therapeutic agent, increase of the amount of administered therapeutic agent, decrease of the amount of administered therapeutic agent, continuation of the administration of an amount of a therapeutic agent, increase in the frequency of administration of a therapeutic agent, decrease in the frequency of administration of a therapeutic agent,
- a healthcare benefits provider can, e.g. , authorize or deny the prescription of a therapy, authorize or deny coverage for therapy, authorize or deny reimbursement for the cost of therapy, determine or deny eligibility for therapy, etc.
- Thl7 CD4 + T cell subset
- IL23-mediated diseases and disorders for example CD or psoriasis
- CD or psoriasis are heterogeneous diseases showing a wide spectrum of symptoms, severity and therefore drug responsiveness.
- One of the problems in clinical management of IL23 -mediated diseases and disorders is the difficulty to identify specific subgroups of patients undergoing early clinical flare-up of symptoms for a timely and appropriate treatment, or the identification of specific subgroups of patients that may or may not benefit from a certain therapy, e.g. , treatment with an IL23-antagonist.
- a certain therapy e.g. , treatment with an IL23-antagonist.
- CCL20 like human beta-defensin (hBD)-2, is a potent chemoattractant for CCR6-positive immature dendritic cells and T cells.
- CCL20 is increased in rheumatoid arthritis and psoriasis (Melis et al., Ann. Rheum. Dis. 69:618-23 (2010); Mrabet et al. Rheumatology International 33:265-66 (2013); Schlenk et al. J. Rheumatol.
- none of the cited references discloses an inverse correlation between decreasing CCL20 levels in a population of patients having an IL23 -mediated disease and increased response to anti-IL23 therapies. More importantly with respect to the present disclosure none of the cited references suggest that low or decreased levels of CCL20 could be used to stratify or identify a population of patients having an IL23-mediated disease for treatment with a specific IL23 antagonist (e.g., an anti-IL-23 antibody targeting, e.g., the pl9 subunit of IL23).
- a specific IL23 antagonist e.g., an anti-IL-23 antibody targeting, e.g., the pl9 subunit of IL23.
- New therapeutic options e.g. , antibodies specifically targeting IL23 such as MEDI2070, have the potential to address the unmet medical needs of patients suffering from IL23-mediated diseases. Accordingly, means to identify, for example, groups of patients who are likely to have a good clinical response to MED 12070 (e.g. , a diagnostic biomarker or combination thereof) and/or other anti-IL23 therapeutics known in the art, could greatly augment their utility.
- MED 12070 e.g. , a diagnostic biomarker or combination thereof
- other anti-IL23 therapeutics known in the art could greatly augment their utility.
- CCL20 alone, or in combination with IL22 and/or, LCN2, and further in combination with other biomarkers such as CRP and/or FCP, or any combination thereof, are correlated with clinical efficacy of therapies and useful to predict clinical outcomes in specific populations of patients suffering from an IL23-mediated disease or disorder, e.g., CD.
- an IL23-mediated disease or disorder e.g., CD.
- IL23 pathway biomarker encompasses proteins in the IL23 pathway including chemokine (CC motif) ligand 20 (CCL20, MIP-3 ) and other IL23 pathway proteins such as interleukin-22 (IL22), lipocalin-2 (LCN2), interleukin-17F (IL17F), IL17A/IL17F (IL17A/F), S 100 calcium-binding protein A12 (S 100A12), interleukin 23 receptor (IL23R), interleukin 12B (IL12B), interleukin 23A (IL23A), defensin B2 (DEFB-2, DEFB-4), ILi , serine (or cysteine) proteinase inhibitor member 3 (SERPINB3), tumor necrosis factor alpha (TNF-oc), CCL6, a3 integrin, interleukin-21 (IL21), CCR6, CCL22, IL1R1, IFNy, PI3/Elafin, LL37
- IL23 pathway biomarker encompass
- the IL23 pathway biomarker or biomarkers used by the methods disclosed herein comprises CCL20, alone or in combination with the IL23 pathway biomarkers IL22 and/or LCN2.
- the IL23 pathway or set of IL23 pathway biomarkers disclosed herein can be combined with additional biomarkers such as CRP and/or FCP,
- CCL20 can be combined with other IL23 pathway biomarkers such as IL22 and/or LCN2, which in turn can be substituted or combined with one or more molecules present in other inflammation pathways known in the art, and/or with other biomarkers linked to IL23-mediated diseases or disorders known in the art, including, but not limited to, for example, C-reactive protein (CRP), calprotectin (S 100A8/S 100A9 complex), DMBT1, MIF, PAP/REG3CC, REG3y, haptoglobin, interleukin-6 (IL6), lactoferrin, GP-39 (YKL-40), GPX-2, GPX-3, neutrophil elastase, etc.
- CRP C-reactive protein
- S 100A8/S 100A9 complex calprotectin
- DMBT1 MIF
- PAP/REG3CC REG3y
- haptoglobin interleukin-6
- lactoferrin lactoferrin
- biomarker refers to a factor that is a distinctive indicator of a biological process, biological event, and/or pathologic condition, e.g. , a predictor of clinical response to treatment with an IL23 antagonist ⁇ e.g. , an anti-IL23 antibody targeting, e.g. , the pl9 subunit of IL23, or an antigen-binding fragment thereof).
- an IL23 antagonist e.g. , an anti-IL23 antibody targeting, e.g. , the pl9 subunit of IL23, or an antigen-binding fragment thereof.
- biomarker encompasses both clinical markers and biological markers.
- biomarker encompasses, e.g.
- biological biomarkers comprises, for example, CCL20 (alone or in combination with other IL23 pathway biomarkers such as IL22 and/or LCN2), other biomarkers linked to IL23-mediated diseases or disorders ⁇ e.g. , CRP and/or calprotectin), and combinations thereof.
- the biological markers disclosed herein also include the genes encoding those proteins (DNA and/or RNA), as well as metabolic products.
- the term “biomarker” also encompasses “clinical biomarkers” (also referred to as “clinical status markers”) that can be predictive of response to biological therapies, for example, gender, age, concomitant drugs, smoking status, body mass index (BMI), etc. See, e.g. , U.S.
- the biomarkers disclosed herein ⁇ e.g. , CCL20, IL22 and/or LCN2) also include proteins having 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to their respective wild type sequences ⁇ e.g.
- nucleic acids having 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to their respective wild type sequence ⁇ e.g. , in the case of CCL20, IL22, and LCN2 to SEQ ID NOS: 2, 3, and 5, respectively).
- the biomarkers disclosed herein also include fragments, variants, and derivatives thereof.
- a "variant" biomarker contains at least one amino acid sequence alteration as compared to the amino acid sequence of the corresponding wild-type polypeptide.
- An amino acid sequence alteration can be, for example, a substitution, a deletion, or an insertion of one or more amino acids, preferably conservative substitutions.
- a variant biomarker can have any combination of amino acid substitutions, deletions or insertions.
- a biomarker variant polypeptide can have an integer number of amino acid alterations such that its amino acid sequence shares at least 60, 70, 80, 85, 90, 95, 97, 98, 99, 99.5 or 100% identity with the amino acid sequence of the corresponding wild-type polypeptide.
- Chemokine Ligand 20 (CCL20)
- CCL20 refers to the chemokine ligand 20 protein (NCBI Reference Sequence NP_004582.1; SEQ ID NO: 6) encoded by the CCL20 gene (NCBI Reference Sequence NMJ304591.2; SEQ ID NO: 5). See also Uniprot Acc. No. P7855 herein incorporated by reference in its entirety.
- CCL20 also known as macrophage inflammatory protein 3 alpha (MP3a), CKb4, liver and activation-regulated chemokine (LARC), ST38, MIP3A, MIP-3a, small-inducible cytokine A20 (SSCYA20), or beta- chemokine exodus- 1, is known to play an important role in dendritic cell trafficking and in the recruitment of activated T cells. It is produced by activated Thl7 cells, and colonic epithelial cells are known to be a major site of CCL20 production in irritable bowel disease.
- MP3a macrophage inflammatory protein 3 alpha
- LOC liver and activation-regulated chemokine
- ST38 ST38
- MIP3A MIP-3a
- SSCYA20 small-inducible cytokine A20
- beta- chemokine exodus- 1 beta-chemokine exodus- 1
- the signal sequence for CCL20 is 26 amino acids long, i.e., residues 27-96 of SEQ ID NO: 6 correspond to mature CCL20.
- CCL20 also includes fragments (e.g., CCL20 can be cleaved into three different chains corresponding to positions 27-93, 27-90, and 28-96), isoforms (e.g., full length isoform 1, which is 96 amino acids long; isoform 2, which is 95 amino acids long because it lacks the alanine at position 27, therefore resulting in a mature polypeptide lacking the N-terminal alanine residue of isoform 1), variants (e.g., V47M, and other variants known in the art), and derivatives thereof (e.g., glycosylated or aglycosilated forms of the CCL20 protein, or otherwise chemically modified forms of the protein).
- isoforms e.g., full length isoform 1, which is 96 amino acids long; isoform 2, which is 95 amino acids long because it lacks the alanine at position 27, therefore resulting in a mature polypeptide lacking the N-terminal alanine residue of isoform 1
- CCL20 refers to the CCL20 gene, which includes genomic DNA, cDNA, mRNA, and fragments thereof. In some aspects, the term CCL20 also refers to oligonucleotides capable of specifically hybridizing to the CCL20 gene under stringent conditions.
- Interleukin 22 (IL22)
- IL22 refers to the interleukin 22 protein (NCBI Reference Sequence NP_065386.1 ; SEQ ID NO: 4) encoded by the IL22 gene (NCBI Reference Sequence NM_020525.4; SEQ ID NO: 3). See also Uniprot Acc. No. Q9GZX6 herein incorporated by reference in its entirety. IL22 is a pro-inflammatory cytokine known to be expressed from Thl7 cells. Wilson et al. Nature Immunol. 8:950 (2007). Increased serum levels of IL22 have also been associated with IBD. See, e.g. , Schmechel et al. Inflamm. Bowel Dis. 14:204 (2008); and Brand et al.
- IL22 has been shown to induce haptoglobin expression in hepatic cells (Dumoutier et al. Proc. Nat'l. Acad. Sci USA 97: 10144 (2000)), to upregulate expression of REG3a, REG3y, S 100A8, S 100A9 and haptoglobin in colon epithelial cells (Zheng et al. Nature Medicine 14:282 (2008)), and to upregulate expression of S 100A8 and S 100A9 in keratinocytes (Boniface et al. J. Immunol. 174:3695 (2005)).
- IL22 has a 33 amino acid signal sequence, i.e., residues 34-179 of SEQ ID NO: 4 correspond to mature IL22. Xie et al. J. Biol. Chem. 275:31335 (2000).
- the term IL22 also includes fragments, variants (e.g. , S 158G and other variants known in the art), and derivatives thereof (e.g. , glycosylated or aglycosilated forms of the IL22 protein, or otherwise chemically modified forms of the protein).
- the term IL22 refers to the IL22 gene, which includes genomic DNA, cDNA, mRNA, and fragments thereof.
- the term IL22 also refers to oligonucleotides capable of specifically hybridizing to the IL22 gene under stringent conditions.
- LCN2 refers to the lipocalin-2 protein (NCBI Reference Sequence NP_005555.2; SEQ ID NO: 6) encoded by the LCN2 gene (NCBI Reference Sequence NM_005564.3; SEQ ID NO: 5). See also Uniprot Acc. No. P80188 herein incorporated by reference in its entirety.
- LCN2 also known as 24p3 and neutrophil gelatinase-associated lipocalin (NGAL) (Kjeldsen et al. J. Biol. Chem. 268: 10425- 10432
- LCN2 is expressed in colon epithelial cells and leukocytes in Crohn's disease colon.
- LCN2 has a 20 amino acid signal sequence, i.e., residues 21- 198 of SEQ ID NO: 6 correspond to mature LCN2. See Bundgaard et al. Biochem. Biophys. Res. Comm. 202: 1468
- LCN2 also includes fragments, isoforms (e.g. , isoform 2 in which the sequence DQCIDG (SEQ ID NO: 39) between residues 193 and 198 is replaced with the sequence GNGQSG (SEQ ID NO: 40)), variants (e.g. , G9R, L13S, K82N, I155V, S 178Y, and other variants known in the art), and derivatives thereof (e.g. , glycosylated or aglycosilated forms of the LCN2 protein, or otherwise chemically modified forms of the protein).
- the term LCN2 refers to the LCN2 gene, which includes genomic DNA, cDNA, mRNA, and fragments thereof.
- the term LCN2 also refers to oligonucleotides capable of specifically hybridizing to the LCN2 gene under stringent conditions.
- the methods disclosed herein can comprise the IL23 pathway biomarkers disclosed above, for example, CCL20, IL22, or LCN2, and additional biomarkers such as CRP and/or FCP, which are described below.
- CRP C-Reactive Protein
- CCL20 and other IL23 pathway biomarkers disclosed herein can be combined for diagnostic, predictive, or monitoring purposes with other IL23 pathway biomarkers, biomarkers downstream from the therapeutic intervention point (e.g. , IL23), or biomarkers specific for a certain IL23 -mediated disease or disorders.
- IL23 pathway biomarkers e.g. , IL22 and/or LCN2
- biomarkers downstream from the therapeutic intervention point e.g. IL23
- biomarkers specific for a certain IL23 -mediated disease or disorders e.g., IL23 -mediated disease or disorders.
- IBD inflammatory bowel disease
- CD or UC fecal calprotectin
- CRP refers to the C-reactive protein (NCBI Reference Sequence NP_000558.2; SEQ ID NO: 10) encoded by the CRP gene (NCBI Reference Sequence NM_000567.2; SEQ ID NO: 9). See also Uniprot Acc. No. P02741 herein incorporated by reference in its entirety.
- CRP also known as PTX1
- PTX1 has long been recognized as an acute phase reactant that rises dramatically in concentration after tissue injury or inflammation. Elevated CRP levels have been associated with coronary artery disease.
- CRP has long been used as a marker for inflammatory bowel disease, especially Crohn's disease. See, e.g. , Vermerie et cd. (2004) Inflamm.
- CRP levels may be determined using a custom- designed ELISA assay, or, for example, using a commercially available ELISA kit, such as the QUANTIKINE® human CRP Immunoassay kit from R&D Systems (Minneapolis, Minnesota, USA) and the AssayMax® human lactoferrin ELISA kit from AssayPro (St. Charles, Missouri, USA).
- CRP has an 18 amino acid signal sequence, i.e., residues 19-224 of SEQ ID NO: 10 correspond to mature CRP.
- CRP also includes fragments, variants (e.g., K1G, TIG, L170V, substitution of the sequence YSIFSYATKRQDNEIL (SEQ ID NO: 41) starting at position 16 with the sequence TVFSRMPPRDKTMRFF (SEQ ID NO: 42), deletion of sequence from position 80 to 98, and other variants known in the art), and derivatives thereof (e.g., the pyrrolidine N- terminal carboxylic acid modified form of CRP produced after cleavage of the residues 1-19 signal peptide, and other chemically modified forms of the protein).
- isoform 2 of CRP the sequence from position 67 to 199 is missing.
- CRP refers to the CRP gene, which includes genomic DNA, cDNA, mRNA, and fragments thereof. In some aspects, the term CRP also refers to oligonucleotides capable of specifically hybridizing to the CRP gene under stringent conditions.
- FCP refers to fecal calprotectin.
- FCP is a complex of the mammalian proteins S 100A8 and S 100A9 produced by neutrophils, monocytes, and epithelial cells under inflammatory conditions, Foell et al. J. Leukocyte Biol. 81:28 (2007).
- Calprotectin can inhibit the growth of Staphylococcus aureus in abscesses by chelation of nutrient Mn 2+ and Zn 2+ .
- Calprotectin has long been associated with intestinal inflammation, and has been proposed as a marker for IBD. See, e.g., Lugering et al.
- fecal calprotectin levels of over 50 ⁇ g/g are regarded as a "positive" result, based on median fecal calprotectin levels of over 1700 ⁇ g/g (e.g. 200 - 20.000 ⁇ g/g) in IBD patients and 25 ⁇ g/g normal healthy subjects.
- S 100A8 (SlOO calcium-binding protein A8) (NCBI Reference Sequence NP_002955.2; SEQ ID NO: 12), also known as calgranulin A, cystic fibrosis antigen, myeloid-related protein 8, granulocyte LI protein, calprotectin L1L subunit, CFAG, leukocyte LI complex light chain, migration inhibitory factor-related protein 8, MRP-8, S lOO calcium-binding protein A8, and urinary stone protein band A, is encoded by the S 100A8 gene (NCBI Reference Sequence NM_002964.3; SEQ ID NO: 11). See also Uniprot Acc. No. P05109 herein incorporated by reference in its entirety.
- S 100A9 (SlOO calcium-binding protein A9) (NCBI Reference Sequence NP_002956.1 ; SEQ ID NO: 14), also known as calgranulin B, cystic fibrosis antigen B, myeloid-related protein 14, calprotectin L1H subunit, leukocyte LI complex heavy chain, migration inhibitory factor-related protein 14, and MRP- 14, is encoded by the S 100A9 gene (NCBI Reference Sequence NM_002965.3; SEQ ID NO: 13).
- calprotectin also includes fragments, variants of the S 100A8 and S 100A9 proteins.
- the initiator methionine of the S 100A8 can be removed to yield N-terminally processed S 100A8 protein comprising amino acid residues 2 to 93.
- the cysteine amino acid at position 42 in the S 100A8 protein can be S-nitrosylated to yield S- nitrosocysteine.
- S 100A8 protein In a variant of the S 100A8 protein, the sequence from amino positions 80 to 93, VAAHKKSHEESHKE (SEQ ID NO: 43) is replaced with WQPTKKAMKKATKSS (SEQ ID NO: 44).
- Known variants of the S 100A9 subunit of calprotectin include C3A, E36Q, M63A, E78Q, M81A, M83A, S6H, K25F, H28L, and H20R.
- the initiator methionine of S 100A9 can be removed to yield N-terminally processed S 100A9 protein comprising amino acid residues 2 to 114. After removal of the N-terminal Met, the N-terminal Thr can be blocked.
- the cysteine amino acid at position 3 in S 100A9 can also be transiently S- nitrosylated to yield S-nitrosocysteine.
- S-nitrosylation of Cys3 is implicated in LDL(ox)- induced S-nitrosylation of GAPDH at Cys247 through a transnitrosylase mechanism involving a iNOS-S 100A8/S 100A9 complex.
- the histidine at position 105 (His 105) in S 100A9 can also be modified to pros-methylhistidine.
- the threonine at position 113 (Thrl 13) of S 100A9 can be phosphorylated by MAPK14 to yield phosphothreonine.
- calprotectin or FCP refer to the genes encoding S 100A8 and/or S 100A9, which includes genomic DNA, cDNA, mRNA, and fragments thereof.
- FCP or calprotectin also refer to oligonucleotides capable of specifically hybridizing to the genes encoding S 100A8 or S 100A9 under stringent conditions.
- CCL20 in combination with at least one additional IL23 pathway biomarker and at least one additional biomarker related to inflammation e.g.:
- CCL20 i. CCL20, IL22, LCN2, FCP (S 100A8 and/or S 100A9), and CRP
- biomarkers disclosed above in combination with at least one of biomarker selected from the group consisting of IL17F, IL17A/F, IL23R, IL12B, IL6, IL21, TNF, CCR6, CCL22, IL1R1, IFN- ⁇ , S 100A12, DEFB-2, DEFB-4, IL1, SERPINB3, PI3/Elafin, LL37, RORy, RORyT, IL26, S 100A7, DEFB 103B, and GM- CSF.
- biomarker selected from the group consisting of IL17F, IL17A/F, IL23R, IL12B, IL6, IL21, TNF, CCR6, CCL22, IL1R1, IFN- ⁇ , S 100A12, DEFB-2, DEFB-4, IL1, SERPINB3, PI3/Elafin, LL37, RORy, RORyT, IL26, S 100A7, DEFB 103B, and
- the methods disclosed herein can be applied in IL23-mediated diseases such as inflammatory bowel disease (IBD) (including, e.g. , CD or UC) by using a set of biomarkers comprising IL22 and/or LCN2 and optional additional biomarker such as CRP and/or calprotectin, as well as any combination or subset thereof.
- IBD inflammatory bowel disease
- biomarkers comprising IL22 and/or LCN2 and optional additional biomarker such as CRP and/or calprotectin, as well as any combination or subset thereof.
- CCL20, IL22, and/or LCN2 encompasses the individual components of the list as well as combinations thereof considering that each component in the list is linked by the term "and/or.”
- CCL20, IL22 and/or LCN2 is equivalent to "CCL20 and/or IL22 and/or LCN2" and encompasses CCL20 alone, IL22 alone, LCN2 alone, CCL20+IL22, CCL20+LCN2, IL22+LNC2, and CCL20+IL22+LCN2.
- CCL20 and other biomarkers disclosed herein e.g., IL22, LCN2, CRP and/or FCP (either their expressed protein levels, or their respective nucleic acid levels, such as mRNA levels) can be detected and quantified by any of a number of methods well known to those of skill in the art.
- These methods include analytic biochemical methods such as electrophoresis, capillary electrophoresis, high performance liquid chromatography (HPLC), thin layer chromatography (TLC), hyperdiffusion chromatography, mass spectroscopy and the like, or various immunological methods such as fluid or gel precipitin reactions, immunodiffusion (single or double), immunohistochemistry, affinity chromatography, Immunoelectrophoresis, radioimmunoassay (RIA), enzyme-linked immunosorbent assay (ELISAs), chemi- luminescence immunoassay (CLIA), immunofluorescent assays, Western blotting, and the like.
- analytic biochemical methods such as electrophoresis, capillary electrophoresis, high performance liquid chromatography (HPLC), thin layer chromatography (TLC), hyperdiffusion chromatography, mass spectroscopy and the like
- immunological methods such as fluid or gel precipitin reactions, immunodiffusion (single or double), immunohistochemistry, affinity
- the method used to detect and/or quantify CCL20 or any other biomarker disclosed herein, e.g. , IL22, LCN2, CRP and/or FCP comprises measuring the level, concentration, or amount of RNA, e.g. , mRNA, encoded by the gene or gene segments in the sample.
- RNA e.g. , mRNA
- levels of RNA, e.g. , mRNA may be measured by any technique known in the art, including but not limited to northern blotting or quantitative PCR (qPCR), including methods such as reverse transcription qPCR, real time qPCR, and end-point qPCR.
- qPCR quantitative PCR
- "tag based" technologies such as Serial analysis of gene expression (SAGE) and RNA-Seq, may be carried out to provide a relative measure of the cellular concentration of different mRNAs.
- SAGE Serial analysis of gene expression
- RNA-Seq may be carried out to provide a relative measure of the cellular concentration of different
- the method used to detect and/or quantify CCL20 and other biomarkers disclosed herein comprises measuring the level, concentration, or amount of the protein product encoded by the gene or gene segments in the sample.
- Suitable methods of determining expression levels of protein products are known in the art and include immunoassays (e.g. , Western blotting, an enzyme-linked immunosorbent assay (ELISA), a radioimmunoassay (RIA), or a sandwich immunoassay or an immunohistochemical assay).
- the biomarkers disclosed herein can be detected and/or quantified in an electrophoretic polypeptide separation (e.g. , a 1- or 2-dimensional electrophoresis).
- electrophoretic polypeptide separation e.g. , a 1- or 2-dimensional electrophoresis.
- Means of detecting polypeptides using electrophoretic techniques are well known to those skilled in the art (see generally, R. Scopes (1982) Polypeptide Purification, Springer- Verlag, N.Y.; Deutscher, (1990) Methods in Enzymology Vol. 182: Guide to Polypeptide Purification, Academic Press, Inc., N.Y.).
- a Western blot (immunoblot) analysis is used to detect and quantify the presence of CCL20, IL22, LCN2, FCP, CRP, or any combination thereof in the sample.
- This technique generally comprises separating sample polypeptides by gel electrophoresis on the basis of molecular weight, transferring the separated polypeptides to a suitable solid support (such as a nitrocellulose filter, a nylon filter, or derivatized nylon filter), and incubating the sample with antibodies that specifically bind the analyte.
- a suitable solid support such as a nitrocellulose filter, a nylon filter, or derivatized nylon filter
- Antibodies that specifically bind to the analyte may be directly labeled or alternatively may be detected subsequently using labeled antibodies (e.g.
- the biomarkers disclosed herein can be detected and/or quantified in the biological sample using an immunoassay.
- an immunoassay see also Methods in Cell Biology Volume 37: Antibodies in Cell Biology, Asai, ed. Academic Press, Inc. New York (1993); Basic and Clinical Immunology 7th Edition, Stites & Terr, eds. (1991).
- the immunoassay can use one or more CCL20, IL22, LCN2, FCP or CRP antibodies or antigen binding fragments thereof which recognize human CCL20, IL22, LCN2, FCP or CRP, respectively.
- the immunoassay comprises a sandwich immunoassay, e.g. , an enzyme-linked immunosorbent assay (ELISA) or a sandwich electrochemiluminescent (ECL) assay, in which a first antibody or antigen-binding fragment thereof against a biomarker disclosed herein (e.g. , CCL20, IL22, LCN2, FCP or CRP) is used as a "capture" antibody.
- a biomarker disclosed herein e.g. , CCL20, IL22, LCN2, FCP or CRP
- the capture antibody is attached to a solid support, an antigen from a sample or standard is allowed to bind to the capture antibody, and then a second antibody or antigen binding fragment thereof against the same biomarker (e.g.
- a detectable label i.e., a "detection" antibody
- the detection antibody can be detected either by an enzymatic reaction, an ECL reaction, radioactivity, or any other detection method known in the art.
- the immunoassay comprises the following steps: First, the capture antibody or fragment thereof is allowed to bind to a solid support, e.g. , a multi-well plate or other assay device known to those of ordinary skill in the art.
- the capture antibody is allowed to attach for a period of time, e.g. , overnight, and then unbound antibody is removed.
- the plate can then be washed to remove any unbound capture antibody.
- the plate can then be treated with a blocking solution to allow non-specific protein to bind to any unbound regions of the solid support.
- Typical blocking solutions include an unrelated protein, e.g. , nonfat dry milk or serum albumin.
- the plate can then again be washed to remove any unbound blocking solution.
- a sample suspected of containing a biomarker disclosed herein (e.g. , CCL20, IL22, LCN2, FCP or CRP) is added to the plate.
- Samples are typically serially diluted and plated in duplicate or triplicate.
- Controls including standard amounts of biomarker (e.g. , CCL20, IL22, LCN2, FCP or CRP) or a suitable fragment thereof and various negative controls are also included.
- the antigen is allowed to bind to the capture antibody for a period of time, e.g. , one hour at room temperature. Following incubation, the plate can then be washed to remove any unbound antigen.
- a detection antibody is added.
- the detection antibody is typically an antibody that specifically binds to an epitope in the biomarker (e.g. , CCL20, IL22, LCN2, FCP or CRP) than is different from the epitope to which the capture antibody binds.
- the detection antibody can be labeled or unlabeled. Where the detection antibody is unlabeled, an addition step of addition a labeled secondary antibody will be required, as is well known by those of ordinary skill in the art.
- the detection antibody can be directly labeled with an enzyme, e.g. , horseradish peroxidase or alkaline phosphatase, or can be labeled with a tag that will allow an enzyme to bind.
- an enzyme e.g. , horseradish peroxidase or alkaline phosphatase
- the detection antibody can be conjugated to biotin, and the enzyme attached in a subsequent step by allowing enzyme-conjugated streptavidin to bind to the biotin tag.
- the detection antibody can be conjugated to a chemiluminescent, fluorescent, or ECL tag. An example of the latter is a ruthenium chelate. Following incubation, the plate can then be washed to remove any unbound detection antibody. Detection of the detection antibody can be accomplished by methods that vary based on the type of detection antibody that is used.
- the detection antibody is tagged with biotin, then enzyme-conjugated streptavidin is added, unbound streptavidin is washed away, and a substrate is added which provides a colorimetric reaction that can be read, e.g. , on a spectrophotometer. If the detection antibody is conjugated to a ruthenium chelate, the plate is subjected to electrical current, and light emission is measured.
- Immunoassays for detecting the biomarkers disclosed herein can be either competitive or noncompetitive.
- Noncompetitive immunoassays are assays in which the amount of captured analyte is directly measured.
- competitive assays the amount of analyte in the sample is measured indirectly by measuring the amount of an added (exogenous) labeled analyte displaced (or competed away) from a capture agent by the analyte present in the sample.
- a known amount of, for example, labeled CCL20 is added to the sample, and the sample is then contacted with a capture agent.
- the amount of labeled CCL20 bound to the antibody is inversely proportional to the concentration of CCL20 present in the sample.
- the method directly measures the levels of CCL20 (or any other biomarker disclosed herein) in a patient sample, where absolute levels are calculated by plotting the immunoassay results on a standard curve using, e.g. , purified full length CCL20 or an CCL20 fragment (or a full length biomarker disclosed herein or a fragment thereof). The detected signal from the detection antibody can then be quantitated based on the various standards and controls included on the plate.
- the absolute levels of CCL20 (or any other biomarker disclosed herein) in the test samples can be calculated, e.g. , in pg or ng of biomarker per mL, or pg or ng of biomarker per mg of total protein.
- Detection assays for the biomarkers disclosed herein can be scored (as positive or negative or quantity of analyte) according to standard methods well known to those of skill in the art. The particular method of scoring will depend on the assay format and choice of label. For example, a Western Blot assay can be scored by visualizing the colored product produced by the enzymatic label. A clearly visible colored band or spot at the correct molecular weight is scored as a positive result, while the absence of a clearly visible spot or band is scored as a negative. The intensity of the band or spot can provide a quantitative measure of analyte concentration.
- the measured expression levels of the biomarkers disclosed herein represent an average expression level or a mean expression level based on more than one measurement of the expression level.
- the measured expression level is an average or mean of several measurements of expression levels of the same sample.
- the measured expression level is an average or mean of several measurements of expression levels of different samples containing the same components obtained from the same subject.
- the measured expression level is quantile normalized, as is done in RNA Seq techniques using techniques well known by those of ordinary skill in the art.
- level refers to a measurement that is made using any analytical method for detecting presence or expression of the biomarker (protein expression or gene expression) in a biological sample and that indicates the presence, absence, absolute amount or concentration, relative amount or concentration, titer, expression level, ratio of measured levels, or the like, of, for, or corresponding to biomarker in the biological sample.
- the exact nature of the "value” or “level” depends on the specific designs and components of the particular analytical method (e.g. , immunoassays, mass spectrometry methods, in vivo molecular imaging, gene expression profiling, aptamer-based assays, etc.) employed to detect a biomarker disclosed herein (e.g. , CCL20, IL22, LCN2, FCP or CRP). See, e.g. , U.S. 2010/00221752.
- a biomarker disclosed herein e.g. , CCL20, IL22, LCN2, FCP or CRP.
- the terms “elevated level,” “increased level,” “higher level,” or “high level” refer to a level in a biological sample (e.g. , blood serum) that is higher than the expression level or range of the biomarker measured in a control sample ("normal level”), or a specified threshold disclosed herein.
- a biological sample e.g. , blood serum
- normal level e.g., blood serum
- the terms "lowered level,” “reduced level,” “decreased level,” or “low level” refer to a level in a biological sample (e.g. , blood serum) that is lower than the expression level or range of the biomarker measured in a control sample ("normal level”), or a specified threshold disclosed herein.
- a biological sample e.g. , blood serum
- normal level e.g., blood serum
- the normal level or range for a biomarker disclosed herein can be defined in accordance with standard practice.
- the level measured in a particular biological sample can be compared with level or range of levels determined in similar normal samples.
- a normal sample or a control sample would be, for example, a sample obtained from an individual with no detectable symptoms of an IL23-mediated disease or disorder.
- the level of, e.g., CCL20 is said to be a low level, lowered level, reduced level, decreased level, or grammatical variants thereof when the level of CCL20 is present in the test sample at a lower level or range than in a normal sample, control sample, or a specific threshold level disclosed herein.
- These thresholds include, e.g.
- the level of a biomarker disclosed herein is considered to be elevated or high if it is at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100%, 105%, 110%, 115%, 120%, 125%, 130%, 135%, 140%, 145%, 150%, 155%, 160%, 165%, 170%, 175%, 180%, 185%, 190%, 195%, 200%, 205%, 210%, 215%, 220%, 225%, 230%, 235%, 240%, 245%, 250%, 255%, 260%, 265%, 270%, 275%, 280%, 285%, 290%, 295%, 300%, 305%, 310%, 315%, 320%, 325%, 330%, 335%, 340%, 345%,
- the level of a biomarker disclosed herein is considered to be reduced or low if it is at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100%, 105%, 110%, 115%, 120%, 125%, 130%, 135%, 140%, 145%, 150%, 155%, 160%, 165%, 170%, 175%, 180%, 185%, 190%, 195%, 200%, 205%, 210%, 215%, 220%, 225%, 230%, 235%, 240%, 245%, 250%, 255%, 260%, 265%, 270%, 275%, 280%, 285%, 290%, 295%, 300%, 305%, 310%, 315%, 320%, 325%, 330%, 335%, 340%, 345%,
- threshold level refers to a level of a biomarker disclosed herein (e.g. , CCL20, IL22, LCN2, FCP and/or CRP) which may be of interest for comparative purposes.
- a threshold level may be the expression level of a protein or nucleic acid expressed as an average of the level of the expression level of a protein or nucleic acid from samples taken from a control population of healthy (disease-free) subjects.
- the threshold level may be the level in the same subject at a different time, e.g.
- samples are normalized by a common factor.
- body fluid samples are normalized by volume body fluid and cell-containing samples are normalized by protein content or cell count.
- the threshold level may also refer to the level of expression of the same biomarker in a corresponding control sample or control group of subjects which do not respond to treatment, e.g. , with an IL23 antagonist (e.g. , an anti-IL23 antibody targeting, e.g. , the pl9 subunit of IL23, or an antigen-binding fragment thereof).
- an IL23 antagonist e.g. , an anti-IL23 antibody targeting, e.g. , the pl9 subunit of IL23, or an antigen-binding fragment thereof.
- the expression level of a biomarker disclosed herein is compared to a threshold level (or alternatively herein a "predetermined threshold level”).
- a threshold level or alternatively herein a "predetermined threshold level” is a cutoff or threshold against which the measured expression level of a protein or nucleic acid is compared.
- a "threshold level" for a biomarker disclosed herein (e.g. , CCL20, IL22, LCN2, FCP or CRP) can be determined, and test samples that fall above or below the biomarker' s threshold levels indicate that the patient from whom the sample was obtained may or may not benefit from treatment with an IL23 antagonist (e.g. , an anti-IL23 antibody targeting, e.g. , the pl9 subunit of IL23, or an antigen- binding fragment thereof).
- an IL23 antagonist e.g. , an anti-IL23 antibody targeting, e.g. , the pl9 subunit of IL23, or an antigen- binding fragment thereof.
- samples falling below the threshold level for CCL20 would indicate that the patient may benefit from treatment with an IL23 antagonist.
- samples falling above the threshold level for CCL20 would indicate that the patient may not benefit from treatment with an IL23 antagonist.
- samples falling above the threshold level for IL22 or LNC2 would indicate that the patient may benefit from treatment with an IL23 antagonist.
- samples falling below the threshold level for IL22 or LCN2 would indicate that the patient may not benefit from treatment with an IL23 antagonist.
- threshold levels e.g. , protein expression levels or gene expression levels
- a biomarker disclosed herein e.g. , CCL20, IL22, LCN2, FCP or CRP
- the type of sample e.g. , serum, lung tissue, skin
- the type of disease e.g. , asthma, IPF, COPD, Crohn' s Disease, UC, or atopic dermatitis
- CCL20 protein levels quantified using the CCL20 immunoassay described in Example 3 from serum samples from a population of moderate to severe Crohn' s disease patients indicated that patients having CCL20 levels lower than or equal to 22.6 pg/mL (the median CCL20 level for the population of patients in the study) had increased clinical responses to an anti-IL23 antibody, while patients with CCL20 levels higher than 22.6 pg/mL had reduced clinical responses similar to those in the placebo group.
- the predetermined CCL20 threshold level is about 22.6 pg/mL CCL20 protein expression in serum as measured using the CCL20 immunoassay described in Example 3.
- the predetermined CCL20 threshold level is about the median CCL20 value in serum measured from a plurality of patients having an IL23-mediated disease as measured using the CCL20 immunoassay described in Example 3.
- a "low level of CCL20" (CCL20 LO) is defined as a value below the median value of about 22.6 pg/mL CCL20 protein expression in serum as measured using the CCL20 immunoassay described in Example 3.
- a "high level of CCL20 (CCL20 HI) is defined as a value equal to or above the median value of about 22.6 pg/mL CCL20 protein expression in serum as measured using the CCL20 immunoassay described in Example 3.
- the predetermined CCL20 threshold level is about 22.6 pg/mL +/- 10 pg/mL CCL20 protein expression in serum as measured using the CCL20 immunoassay described in Example 3. Accordingly, the CCL20 threshold level can be about 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32 or 33 pg/mL.
- a "low level of CCL20" (CCL20 LO) is defined as a value below one of these threshold levels, whereas a “high level of CCL20” (CCL20 HI) is defined as a value equal to or above the same threshold level (i.e., if the threshold level was 20 pg/mL, a low level of CCL20 would be below 20 pg/mL, and a high level of CCL20 would be 20 pg/mL or above).
- the predetermined CCL20 threshold corresponds to the 1 st , 2 nd , 3 rd , 4 th , 5 th , or 6 th , decile CCL20 baseline level as reported in TABLE 6.
- the predetermined CCL20 threshold level is about 11.8 pg/mL, 14.5 pg/mL, about 16.3 pg/mL, about 20.8 pg/mL, about 22.6 pg/mL, about 26.5 pg/mL, or about 32.1 pg/mL CCL20 protein expression in serum as measured using the CCL20 immunoassay described in Example 3.
- a "low level of CCL20" (CCL20 LO) is defined as a value below one of these threshold levels, whereas a “high level of CCL20” (CCL20 HI) is defined as a value equal to or above the same threshold level.
- the predetermined CCL20 threshold level as measured using the CCL20 immunoassay described in Example 3 corresponds to a concentration of CCL20 in serum between 5 pg/mL and 55 pg/mL, e.g. , about 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, or 35pg/mL.
- IL22 protein levels quantified using the IL22 immunoassay described in Example 5 from serum samples from a population of moderate to severe Crohn's disease patients indicated that patients having higher or elevated IL22 levels greater than or equal to 15.6 pg/mL (the median IL22 level for the population of patients in the study) had increased clinical responses to an anti-IL23 antibody, while patients with lower or reduced IL22 levels less than 15.6 pg/mL had reduced clinical responses similar to those in the placebo group.
- the predetermined IL22 threshold level is about 15.6 pg/mL IL22 protein expression in serum as measured using the IL22 immunoassay described in Example 4.
- the predetermined IL22 threshold level is about the median IL22 value in serum measured from a plurality of patients having an IL23-mediated disease as measured using the IL22 immunoassay described in Example 4.
- a "low level of IL22" (IL22 LO) is defined as a value below the median value of about 15.6 pg/mL IL22 protein expression in serum as measured using the IL22 immunoassay described in Example 4.
- a "high level of IL22" (IL22 HI) is defined as a value equal to or above the median value of about 15.6 pg/mL IL22 protein expression in serum as measured using the IL22 immunoassay described in Example 4.
- the predetermined IL22 threshold level is about 15.6 pg/mL +/- 10 pg/mL IL22 protein expression in serum as measured using the IL22 immunoassay described in Example 4. Accordingly, the IL22 threshold level can be about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 or 26 pg/mL.
- a "low level of IL22" (IL22 LO) is defined as a value below one of these threshold levels, whereas a “high level of IL22” (IL22 HI) is defined as a value equal to or above the same threshold level (i.e., if the threshold level was 20 pg/mL, a low level of IL22 would be below 20 pg/mL, and a high level of IL22 would be 20 pg/mL or above).
- the predetermined IL22 threshold corresponds to the 2 nd , 3 rd , 4 th , 5 th , 6 th , 7 th or 8 th decile IL22 baseline level as reported in TABLE 4.
- the predetermined IL22 threshold level is about 7.9 pg/mL, about 11.3 pg/mL, about 12.7 pg/mL, about 15.6 pg/mL, about 19.6 pg/mL, about 23.1 pg/mL, about 31.4 pg/mL or about 46.8 pg/mL IL22 protein expression in serum as measured using the IL22 immunoassay described in Example 4.
- a "low level of IL22" (IL22 LO) is defined as a value below one of these threshold levels, whereas a “high level of IL22” (IL22 HI) is defined as a value equal to or above the same threshold level.
- the predetermined IL22 threshold level as measured using the IL22 immunoassay described in Example 4 corresponds to a concentration of IL22 in serum between 7.9 pg/mL and 31.4 pg/mL, e.g. , about 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, or 31 pg/mL.
- the predetermined LCN2 threshold level is about 215 ng/mL LCN2 protein expression in serum as measured using the LCN2 immunoassay described in Example 4.
- the predetermined LCN2 threshold level is about the median LCN2 value in serum measured from a plurality of patients having an IL23-mediated disease as measured using the LCN2 immunoassay described in Example 4.
- a "low level of LCN2" (LCN2 LO) is defined as a value below the median value of about 215 ng/mL LCN2 protein expression in serum as measured using the LCN2 immunoassay described in Example 4.
- a "high level of LCN2" (LCN2 HI) is defined as a value equal to or above the median value of about 215 ng LCN2/mL LCN2 protein expression in serum as measured using the LCN2 immunoassay described in Example 4.
- the predetermined LCN2 threshold level is about 215 ng/mL +/- 70 ng/mL LCN2 protein expression in serum as measured using the LCN2 immunoassay described in Example 4. Accordingly, the LCN2 threshold level can be about 145, 150, 155, 160, 165, 170, 175, 180, 185, 190, 195, 200, 205, 210, 215, 220, 225, 230, 235, 240, 245, 250, 255, 260, 265, 270, 275, 280 or 285 ng/mL.
- a "low level of LCN2" (LCN2 LO) is defined as a value below one of these threshold levels, whereas a “high level of LCN2" (LCN2 HI) is defined as a value equal to or above the same threshold level (i.e., if the threshold level was 250 ng/mL, a low level of LCN2 would be below 250 ng/mL, and a high level of LCN2 would be 250 ng/mL or above).
- the predetermined LCN2 threshold corresponds to the 1 st , 2 nd , 3 rd , 4 th , 5 th , 6 th or 7 th decile LCN2 baseline level as reported in TABLE 5.
- the predetermined LCN2 threshold level is about 142.8 ng/mL, about 163.6 ng/mL, about 184.3 ng/mL, about 201.3 ng/mL, about 214.6 ng/mL, about 233.4 ng/mL, about 261.1 ng/mL, about 294.8 ng/mL, or about 326.6 ng/mL LCN2 protein expression in serum as measured using the immunoassay described in Example 4.
- a "low level of LCN2" (LCN2 LO) is defined as a value below one of these threshold levels, whereas a “high level of LCN2" (LCN2 HI) is defined as a value equal to or above the same threshold level.
- the predetermined LCN2 threshold level as measured using the LCN2 immunoassay described in Example 4 corresponds to a concentration of LCN2 in serum between 143 ng/mL and 261 ng/mL, e.g. , about 145, 150, 155, 160, 165, 170, 175, 180, 185, 190, 195, 200, 205, 210, 215, 220, 225, 230, 235, 240, 245, 250, 255 or 260 ng/mL.
- the threshold level is the average or mean expression level measured from samples obtained from healthy volunteers as reported in the manufacturer's manual of a commercial immunoassay used to detect the presence or absence of biomarkers disclosed herein (e.g. , CCL20, IL22, LCN2, FCP or CRP) in a sample.
- biomarkers disclosed herein e.g. , CCL20, IL22, LCN2, FCP or CRP
- a solid phase sandwich ELISA kit to quantify CCL20 is available from R&D Systems (Human CCL20/MIP-3 alpha Quantikine® ELISA Kit, Cat. # DM3A00).
- Other biomarkers disclosed herein can also be quantified using other R&D System' s Quantikine® ELISA Kits namely IL22 (Human IL22 Quantikine® ELISA Kit, Cat. # D2200), LCN2 (Human Lipocalin-2/NGAL Quantikine® ELISA Kit, Cat. # DLCN20) and CRP (Human C- Reactive Protein/CRP Quantikine ELISA Kit, Cat. # DCRP00).
- the predetermined CCL20 threshold level is about 26.3 pg/mL for serum, about 14.3 pg/mL for EDTA plasma, and about 14.2 pg/mL for heparin plasma as measured by the Human CCL20/MIP-3 alpha QUANTIKINE® ELISA Kit (Catalog Number DM3 A00); R&D Systems) following the manufacturer' s instructions, for their respective samples.
- the predetermined IL22 threshold level is about 35.7 pg/mL for serum, about 29.3 pg/mL for EDTA plasma, about 31.7 pg/mL for heparin plasma, and/or about 35.2 pg/mL for urine as measured by the Human IL22 QUANTIKINE® ELISA Kit (Catalog Number D2200; R&D Systems) following the manufacturer's instructions, for their respective samples.
- the predetermined LCN2 threshold level is about 119 ng/mL for serum, about 94 ng/mL for heparin plasma, about 320 ng/mL for saliva, and about 9.94 ng/mL for urine as measured by the Human Lipocalin-2/NGAL QUANTIKINE® ELISA Kit (Catalog Number DLCN20 / SLCN20 / PDLCN20; R&D Systems) following the manufacturer's instructions, for their respective samples.
- the expression level of a biomarker disclosed herein (e.g. , CCL20, IL22, LCN2, CRP, and/or FCP) measured in the sample is above or below the threshold level or threshold value.
- the expression level can indicate that the patient from whom the sample was taken may benefit or not from treatment with an IL23 antagonist (e.g. , an anti-IL23 antibody targeting, e.g. , the pl9 subunit of IL23, or an antigen -binding fragment thereof).
- an IL23 antagonist e.g. , an anti-IL23 antibody targeting, e.g. , the pl9 subunit of IL23, or an antigen -binding fragment thereof.
- the extent to which the measured expression level is above or below the threshold level or threshold value may be to any extent.
- the measured expression level of a biomarker disclosed herein is at least or about 10% greater or lower than the threshold level, e.g.
- the threshold level at least or about 15% greater or lower than the threshold level, at least or about 20% greater or lower than the threshold level, at least or about 25% greater or lower than the threshold level, at least or about 30% greater or lower than the threshold level, at least or about 35% greater or lower than the threshold level, at least or about 40% greater or lower than the threshold level, at least or about 45% greater or lower than the threshold level, at least or about 50% greater or lower than the threshold level, at least or about 55% greater or lower than the threshold level, at least or about 60% greater or lower than the threshold level, at least or about 65% greater or lower than the threshold level, at least or about 70% greater or lower than the threshold level, at least or about 75% greater or lower than the threshold level, at least or about 80% greater or lower than the threshold level, at least or about 85% greater or lower than the threshold level, at least or about 90% greater or lower than the threshold level, at least or about 95% greater or lower than the threshold level.
- the measured expression level of a biomarker disclosed herein is at least 2-fold greater or lower than the threshold level, at least 3 -fold greater or lower than the threshold level, at least 4-fold greater or lower than the threshold level, at least 5-fold greater or lower than the threshold level, at least 6-fold greater or lower than the threshold level, at least 7-fold greater or lower than the threshold level, at least 8 -fold greater or lower than the threshold level, at least 9-fold greater or lower than the threshold level, or at least 10-fold greater or lower than the threshold level.
- a biomarker disclosed herein e.g. , CCL20, IL22, LCN2, CRP, and/or FCP
- the level of a biomarker disclosed herein can be determined using methods known in the art.
- a biomarker disclosed herein e.g. , CCL20, IL22, LCN2, CRP, and/or FCP
- QUANTIKINE® assays there are numerous methods available in the art that would allow the skilled artisan to determine threshold levels as described throughout this section, including the methods and immunoassays described in the Examples.
- the predetermined threshold level of a biomarker disclosed herein is defined with respect to a certain percentile value in a population of subjects (e.g. , a plurality of normal healthy patients, patients with a non-IL23 -mediated disease and/or patients with an IL23 -mediated disease).
- the predetermined threshold level for CCL20 corresponds to the 10 th , 15 th , 20 th , 25 th , 30 th , 35 th , 40 th , 45 th , 50 th , 50 th , 55 th , 60 th , 65 th , 70 th , 75 th , 80 th , 85 th , or 90 th percentile.
- the predetermined threshold level for IL22 corresponds to the 10 th , 15 th , 20 th , 25 th , 30 th , 35 th , 40 th , 45 th , 50 th , 50 th , 55 th , 60 th , 65 th , 70 th , 75 th , 80 th , 85 th , or 90 th percentile;
- the predetermined threshold level for LCN2 corresponds to the 10 th , 15 th , 20 th , 25 th , 30 th , 35 th , 40 th , 45 th , 50 th , 50 th , 55 th , 60 th , 65 th , 70 th , 75 th , 80 th , 85 th , or 90 th percentile;
- the predetermined threshold level for CRP corresponds to the 10 th , 15 th , 20 th , 25 th , 30 th , 35 th
- the threshold level (e.g. , a protein expression level or a gene expression level) of a biomarker disclosed herein (e.g. , CCL20, IL22, LCN2, CRP, and/or FCP) can vary based on the nature of the assay, e.g. , the capture and detection antibodies used, the source, purity, and composition of the standard, and the like.
- the patient's level of a biomarker disclosed herein can be compared to one or more control levels.
- the test sample e.g. , a sample from a patient suffering from an IL23-mediated disease or disorder
- one or more control samples e.g.
- samples taken from normal healthy individuals e.g., asthma, COPD, IPF, Crohn' s Disease, UC, or atopic dermatitis, a pre-determined standard amount of isolated biomarker protein or gene or a fragment thereof, or a combination thereof).
- a non-IL23 -mediated subset of the patient's disease e.g., asthma, COPD, IPF, Crohn' s Disease, UC, or atopic dermatitis, a pre-determined standard amount of isolated biomarker protein or gene or a fragment thereof, or a combination thereof).
- the results can be expressed as a ratio with the control samples to determine a percent increase or a percent decrease in the patient's biomarker levels (e.g., a protein expression level or a gene expression level) compared to the control biomarker levels.
- the control sample can be a matched pair with the patient sample, e.g.
- a biomarker expression level can be recorded in a patient's medical record.
- a low level of CCL20 (lower that about 22.6 pg/mL in serum as measured using the CCL20 immunoassay disclosed in Example 3) is predictive of positive clinical response to an IL23 antagonist (e.g. , an anti-IL23 antibody targeting, e.g. , the pl9 subunit of IL23, such as MED 12070, or an antigen -binding fragment thereof) in a patient having an IL23-mediated disease (including, e.g. , CD).
- the high level of CCL20 is a value between about 12 pg/mL and about 55 pg/mL as measured using the CCL20 immunoassay disclosed in Example 3.
- CCL20 can be combined with other biomarkers such as IL22, LCN2, FCP and/or CRP.
- CCL20 can be combined with IL22 and/or LCN2.
- a high level of IL22 at least about 15.6 pg/mL in serum as measured using the IL22 immunoassay disclosed in Example 4
- a high level of LCN2 at least about 215 ng/mL as measured using the LCN2 immunoassay disclosed in Example 4
- CCL20 values below the threshold levels disclosed above are predictive of positive clinical response to an IL23 antagonist (e.g. , an anti-IL23 antibody targeting, e.g. , the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof) in a patient having an IL23-mediated disease (including, e.g. , CD).
- an IL23 antagonist e.g. , an anti-IL23 antibody targeting, e.g. , the pl9 subunit of IL
- the high level of IL22 is a value between about 7.9 pg/mL and about 31.4 pg/mL as measured using the IL22 immunoassay disclosed in Example 4.
- the high level of LCN2 is a value between about 143 pg/mL and about 261 pg/mL as measured using the LCN2 immunoassay disclosed in Example 4.
- a level of CCL20 below about 11.8 pg/mL, about 14.5 pg/mL, about 16.3 pg/mL, about 20.8 pg/mL, about 22.6 pg/mL, about 26.5 pg/mL, or about 32.1 pg/mL CCL20 protein expression in serum as measured using the CCL20 immunoassay described in Example 3 is predictive of positive clinical response to an IL23 antagonist (e.g. , an anti-IL23 antibody targeting, e.g. , the pl9 subunit of IL23, such as MED 12070, or an antigen -binding fragment thereof) in a patient having an IL23 -mediated disease (including, e.g. , CD).
- an IL23 antagonist e.g. , an anti-IL23 antibody targeting, e.g. , the pl9 subunit of IL23, such as MED 12070, or an antigen -binding fragment thereof
- an anti-IL23 antibody targeting e.g. , the pl9 subunit of IL23, such as MED 12070, or an antigen-binding fragment thereof
- a patient having an IL23 -mediated disease including, e.g. , CD.
- administering results in a Crohn's Disease Activity Index (CDAI) response score reduction of at least 100 points, or reduction of the total CDAI score to below 150 points after first administering the IL23 antagonist (e.g. , an anti-IL23 antibody targeting, e.g. , the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof).
- CDAI Crohn's Disease Activity Index
- the administration of the IL23 antagonist results in a Crohn's Disease Activity Index (CDAI) response score reduction of at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, or 150 points after administering of one or more doses the anti- IL23 antibody or antigen-binding fragment thereof .
- CDAI Crohn's Disease Activity Index
- CCL20 alone or combined with other IL23 pathway biomarkers disclosed herein (e.g., IL22 and/or LCN2), and/or in combination with other biomarkers indicative of inflammation (e.g., FCP and/or CRP) can be used, for example, to determine whether to treat, select for treatment, monitor the treatment, or a begin, modify, or cease the treatment of a patient suffering from an IL23-mediated disease or disorder with an IL23 antagonist (e.g. , an anti-IL23 antibody targeting, e.g. , the pl9 subunit of IL23, such as MEDI2070, or an antigen- binding fragment thereof).
- an IL23 antagonist e.g. , an anti-IL23 antibody targeting, e.g. , the pl9 subunit of IL23, such as MEDI2070, or an antigen- binding fragment thereof.
- IL23 antagonist refers to any agent that can affect the expression, activity, or half-life of IL23 either in vitro or in vivo, or symptoms, pathology, or sequelae caused by or exacerbated by IL23 in a subject with an IL23-mediated disease or disorder, e.g. , CD.
- An IL23 antagonist can be any therapeutic agent as defined herein, which either directly or indirectly can inhibit, lessen, or neutralize IL23 activity, inhibit or reduce IL23 expression, reduce IL23 half-life, or can prevent exacerbation of symptoms due to IL23.
- an IL23 antagonist is an anti-IL23 monoclonal antibody.
- Specific IL23 antagonists contemplated herein specifically bind and inhibit IL23, but do not inhibit IL12.
- An IL23 antagonist or binding agent of the present disclosure e.g. , and antibody such as MEDI2070
- competitively inhibits binding of a reference molecule e.g. , a different IL23 antagonist or binding agent
- a reference molecule e.g. , a different IL23 antagonist or binding agent
- Competitive inhibition can be determined by any method known in the art, for example, competition ELISA assays.
- An IL23 antagonist or binding agent of the present disclosure e.g.
- an antibody such as MED 12070 can be said to competitively inhibit binding of the reference molecule to a given epitope by at least about 90%, at least about 85%, at least about 80%, at least about 75%, at least about 70%, at least about 65%, at least about 60%, at least about 55%, or at least 50%.
- the IL23 antagonist is an anti-IL23 antibody targeting, e.g. , the pl9 subunit of IL23, the p40 subunit of IL23, or both.
- An exemplary IL23 antagonist contemplated is the anti-IL23 antibody MED 12070, which targets the pl9 subunit of IL23.
- MEDI2070 is a fully human, Chinese Hamster Ovary (CHO) cell-derived, immunoglobulin G2 (IgG2) monoclonal antibody (MAb) that specifically binds to human IL23 with high affinity and prevents IL23 from interacting with the IL23 receptor.
- the molecule is a heterotetramer, consisting of 2 heavy chains of the IgG2 subclass and 2 light chains of the lambda subclass, which are covalently linked through disulfide bonds. See International Publ. WO 2011/056600, herein incorporated by reference.
- MEDI2070 comprises a Heavy Chain of SEQ ID NO: 17 and a Light Chain of SEQ ID NO: 18.
- MEDI2070 comprises a heavy chain variable region (SEQ ID NO: 7) comprising VH-CDR1, VH-CDR2 and VH-CDR3 with sequences corresponding to SEQ ID NOs: 33, 34 and 35, respectively.
- MEDI2070 comprises a light chain variable region (SEQ ID NO: 8) comprising VL-CDR1, VL-CDR2 and VL-CDR3 with sequences corresponding to SEQ ID NOS: 36, 37, and 38, respectively.
- the term "MEDI2070” refers not only to an intact MEDI2070 immunoglobulin, but also to MED 12070 antigen-binding fragments, variant, or derivatives thereof, antibodies or fragments thereof that bind to the same IL23 epitope as MEDI2070, or an antibodies or fragments thereof that competitively inhibit binding of MED 12070 to IL23.
- Antibodies (or fragments thereof) that are identical or similar to MEDI2070 in amino acid sequence, particularly in the variable regions, or in the CDRs thereof (however, variations in the constant regions are also contemplated) are contemplated.
- MEDI2070 refers to a polypeptide having an amino acid sequence that is about 70%, about 75%, about 80%, about 85%, about 90%, about 92%, about 95%, about 98%, about 99% or 100% identical to that of an MEDI2070 polypeptide disclosed herein (the heavy chain of MEDI2070, the light of MEDI2070).
- MEDI2070 is an isolated IL23 specific antigen binding protein comprising at least one, two, three, four, or the six complementarity determining regions of MEDI2070.
- Another exemplary IL23 antagonist contemplated is an anti-IL23 antibody which targets the pl9 subunit of IL23 comprising a VH of SEQ ID NO: 45 and/or a VL of SEQ ID NO: 46.
- the IL23 antagonist comprises a heavy chain variable region comprising VH-CDR1, VH-CDR2 and VH-CDR3 from SEQ ID NO: 45 (i.e., SEQ ID NOs: 47-49), and/or a light chain variable region comprising VL-CDR1, VL-CDR2 and VL-CDR3 from SEQ ID NO: 46 (i.e., SEQ ID NOs: 50-52).
- the IL23 antagonist binds to the same IL23 epitope as an antibody comprising a VH of SEQ ID NO: 45 and a VL of SEQ ID NO: 46. In some aspects, the IL23 antagonist competitively inhibits binding of an antibody comprising a VH of SEQ ID NO: 45 and a VL of SEQ ID NO: 46 to IL23.
- Antibodies (or fragments thereof) that comprise a VH and/or a VL domain identical or similar in amino acid sequence to a VH of SEQ ID NO: 45 and/or a VL of SEQ ID NO: 46, particularly in the variable regions, or in the CDRs thereof (however, variations in the constant regions are also contemplated) are contemplated.
- the IL23 antagonist is a polypeptide having an amino acid sequence that is about 70%, about 75%, about 80%, about 85%, about 90%, about 92%, about 95%, about 98%, about 99% or 100% identical to a VH of SEQ ID NO:45 and/or a VL of SEQ ID NO:46.
- the IL23 antagonist an isolated IL23 specific antigen binding protein comprising at least one, two, three, four, or the six complementarity determining regions of a VH of SEQ ID NO:45 and/or a VL of SEQ ID NO: 46.
- IL23 antagonist encompasses also the antibodies targeting IL23 described for example in U.S. Patent Nos. US7491391, US7807414, US7872102, US7807160, US8362212, US7935344; or US7790862; U.S. Application. Publ. Nos. US2012282269, US20090123479, US20120128689, or US2012264917: or International Publ. Nos.
- IL23 antagonist encompasses antibodies and antigen fragments thereof (including, e.g. , constructs such as scFvs) comprising one, two, three, four, five or six of the CDR sequences of the antibodies disclosed in the cited references.
- IL23 antagonist encompasses antibodies and antigen fragments thereof (including, e.g. , constructs such as scFvs) competing for binding to IL23 with the antibodies disclosed in the cited references.
- the term "IL23 antagonist” refers to ustekinumab (CNTO- 1275, STELARA®) (SEQ ID NOS: 19, 20), briakinumab (ABT-874) (SEQ ID NOS: 27, 28), Guselkumab (CNTO-1959), tildrakinumab (MK-3222; SCH-900222) (SEQ ID NOS: 29, 30), BI-655066 (see Krueger et al. J. Allergy Clin Immunol. 136: 116- 124 (2015)), LY-3074828 (see Gaffen et al. Nature Reviews Immunology 14: 585-600, (2014)), or an antigen-binding fragments thereof comprising one, two, three, four, five and/or six of their respective CDR sequences.
- the IL-23 antagonists of the present disclosure can also be used in combination with one or more antagonists of other cytokines (e.g. antibodies), including but not limited to, IL17A, IL17F, TNF-a, IL- ⁇ , IL-6 and TGF- ⁇ . See, e.g. , Veldhoen, Immunity 24: 179-189 (2006); Dong, Nat. Rev. Immunol. 6(4):329-333 (2006).
- cytokines e.g. antibodies
- the IL-23 antagonists disclosed herein comprise antigen binding fragments of antibodies, such as fragments of any of the IL-23 antagonist antibodies referred to herein.
- Such fragments include, but are not limited to Fab, Fab', Fab'-SH, Fv, scFv, F(ab') 2 , nanobodies, and diabodies.
- IL23 antagonist also encompasses antagonists such as aptamers (see, e.g. , U.S. Pat. Appl. Pub. No. 2007066550), peptides (e.g., as disclosed in Quiniou et al., Am J Physiol Regul Integr Comp Physiol. 2014 Nov 15;307(10):R1216-30), orally stable peptides against the IL-23 receptor, or small molecule inhibitors (e.g. , Synta Pharmaceuticals' STA- 5326).
- aptamers see, e.g. , U.S. Pat. Appl. Pub. No. 2007066550
- peptides e.g., as disclosed in Quiniou et al., Am J Physiol Regul Integr Comp Physiol. 2014 Nov 15;307(10):R1216-30
- small molecule inhibitors e.g. , Synta Pharmaceuticals' STA- 5326.
- IL23 pathway biomarkers that are differentially expressed in subjects having an IL23- mediated disease such as CD, for example CCL20, can be applied to predicting clinical outcomes when the subjects are treated with a certain therapy, for example, an IL23 antagonist (e.g. , an anti-IL23 antibody targeting, e.g. , the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof).
- an IL23 antagonist e.g. , an anti-IL23 antibody targeting, e.g. , the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof.
- a single IL23 pathway biomarker e.g., CCL20
- CCL20 can be combined with other IL23 pathway biomarkers, such as IL22 and/or LCN2.
- additional biomarkers e.g., biomarkers indicative of inflammation such as FCP and/or CRP, can be combined with CCL20.
- the IL23 antagonist is an anti-IL23 antibody or antigen-binding fragment thereof which can specifically bind to the pl9 subunit of IL23 (SEQ ID NO: 15), to the p40 subunit of IL23 (SEQ ID NO: 16), or both, for example the anti-IL23 antibody MEDI2070, which targets the p 19 subunit of IL23.
- the anti-IL23 antibody or antigen-binding fragment thereof comprises the heavy chain (HC) (SEQ ID NO: 17) and/or the light chain (SEQ ID NO: 18) of MEDI2070, or an antigen-binding fragment, variant, or derivative thereof.
- the anti-IL23 antibody or antigen-binding fragment thereof comprises the heavy chain variable region (VH) (SEQ ID NO: 7) and/or the light chain variable region (VL) (SEQ ID NO: 8) of MEDI2070.
- the anti-IL23 antibody or antigen-binding fragment thereof comprises at least one of the complementarity determining regions of MEDI2070 (SEQ ID NOS: 33-38).
- the anti-IL23 antibody or antigen-binding fragment thereof comprises a VH region comprising the sequence of SEQ ID NO: 45 and/or a VL region comprising the sequence of SEQ ID NO: 46, or an antigen-binding fragment, variant, or derivative thereof.
- the anti-IL23 antibody or antigen -binding fragment thereof comprises at least one of the complementarity determining regions of SEQ ID NOS: 47-49 (CDRs of the VH of SEQ ID NO: 45) and/or SEQ ID NOS: 50-52 (CDRs of the VL of SEQ ID NO:46).
- the IL23 antagonist is an anti-IL23 antibody selected from ustekinumab or briakinumab (targeting the p40 subunit of IL23), guselkumab, tildrakizumab, BI-655066 or LY-3074828 (targeting the pl9 subunit of IL23), an antigen-binding fragment thereof, or a combination thereof.
- the IL23 antagonist is a molecule (e.g.
- an antibody competing for binding to IL23 with an antibody selected from ustekinumab or briakinumab (targeting the p40 subunit of IL23), guselkumab, tildrakizumab, BI-655066 or LY-3074828 (targeting the pl9 subunit of IL23), an antigen-binding fragment thereof, or a combination thereof.
- This finding can be applied, for example, to devise new methods of determining treatment (e.g. , by selecting patients as candidates for a certain therapy), methods of treating an IL-23 -mediated disease, methods of monitoring efficacy of therapeutic agents (e.g. , anti- IL23 antibodies) to treat IL23-mediated diseases and disorders, or methods to adjust formulations, dosage regimens, or routes of administration.
- determining treatment e.g. , by selecting patients as candidates for a certain therapy
- methods of treating an IL-23 -mediated disease e.g. , by selecting patients as candidates for a certain therapy
- methods of monitoring efficacy of therapeutic agents e.g. , anti- IL23 antibodies
- the methods disclosed herein include prescribing, initiating, and/or altering prophylaxis and/or treatment, e.g. , for an IL23-mediated disease such as CD, based at least in part on a subject' s expression level of CCL20, alone or in combination with one or more additional biomarkers.
- additional biomarker is an IL23 pathway biomarker such as IL22 and/or LCN2.
- additional biomarker is an inflammation biomarker such as CRP and/or FCP.
- the present disclosure provides a method of determining whether to treat a patient having an IL23 -mediated disease or disorder with a therapeutic regimen comprising the administration of an IL23 antagonist (e.g. , an anti-IL23 antibody targeting, e.g.
- an IL23 antagonist e.g. , an anti-IL23 antibody targeting, e.g.
- the pl9 subunit of IL23 such as MED 12070, or an antigen-binding fragment thereof
- the method comprises: (a) measuring or instructing a clinical laboratory to measure the level of CCL20 (and optionally levels of additional biomarkers such as IL22, LCN2, CRP, FCP, or combinations thereof) in a sample taken from the patient, and (b) treating or instructing a healthcare provider to treat the patient, or suspending the treatment, not initiating the treatment, denying the treatment, or instructing a healthcare provider to suspend, not initiate, or deny the treatment with a therapeutic regimen comprising the administration of an IL23 antagonist (e.g. , an anti-IL23 antibody targeting, e.g.
- an IL23 antagonist e.g. , an anti-IL23 antibody targeting, e.g.
- the pl9 subunit of IL23 such as MEDI2070, or an antigen-binding fragment thereof
- the patient is determined to have a higher or lower level of CCL20 (and optionally levels of additional biomarkers such as IL22, LCN2, CRP, FCP, or combinations thereof) in the sample compared to a biomarker predetermined threshold level or levels, or compared to a biomarker level or levels in one or more control samples.
- the disclosure provides a method of determining whether to treat a patient having an IL23 -mediated disease or disorder with a therapeutic regimen comprising the administration of an IL23 antagonist (e.g. , an anti-IL23 antibody targeting, e.g.
- an IL23 antagonist e.g. , an anti-IL23 antibody targeting, e.g.
- the pl9 subunit of IL23 such as MED 12070, or an antigen-binding fragment thereof
- the method comprises: (a) measuring or instructing a clinical laboratory to measure the level of CCL20 (and optionally levels of additional biomarkers such as IL22, LCN2, CRP, FCP, or combinations thereof) in a sample taken from the patient, and (b) treating or instructing a healthcare provider to treat the patient with a therapeutic regimen comprising the administration of an antibody or antigen-binding fragment thereof that specifically binds to IL23 if the patient is determined to have a lower or decreased level of CCL20, and higher or increased levels of at least one optional additional biomarker such as IL22, LCN2, CRP, FCP, or a combination thereof in the sample compared to a predetermined biomarker threshold level or levels, or compared to a biomarker level or levels in one or more control samples.
- the disclosure provides a method of determining whether to treat a patient having an IL23 -mediated disease or disorder with a therapeutic regimen comprising the administration of an IL23 antagonist (e.g. , an anti-IL23 antibody targeting, e.g.
- an IL23 antagonist e.g. , an anti-IL23 antibody targeting, e.g.
- the pl9 subunit of IL23 such as MED 12070, or an antigen-binding fragment thereof
- the method comprises (a) measuring or instructing a clinical laboratory to measure the level of CCL20 (and optionally levels of additional biomarkers such as IL22, LCN2, CRP, FCP, or combinations thereof) in a sample taken from the patient, and (b) suspending the treatment, not initiating treatment, denying the treatment, or instructing a healthcare provider to suspend, not initiate, or deny the treatment of the patient with a therapeutic regimen comprising the administration of an antibody or antigen-binding fragment thereof that specifically binds to IL23 to the patient if the patient is determined to have a higher or increased level of CCL20, and lower or decreased levels of at least one optional additional biomarker such as IL22, LCN2, CRP, FCP, or a combination thereof in the sample compared to a predetermined biomarker threshold level or levels, or compared to a biomarker level or levels in one or more control samples.
- an IL23 antagonist e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof
- a method of selecting a patient diagnosed with an IL23-mediated disease or disorder as a candidate for treatment with an IL23 antagonist comprising (a) measuring or instructing a clinical laboratory to measure the level of CCL20 (and optionally levels of additional biomarkers such as IL22, LCN2, CRP, FCP, or combinations thereof) in a sample taken from the patient, and (b) treating or instructing a healthcare provider to treat the patient with an IL23 antagonist (e.g., an anti- IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen- binding fragment thereof) if the patient is determined to have a lower or decreased level of CCL20, and higher or increased levels of at least one optional additional biomarker such as IL22,
- an IL23 antagonist e.g. , an anti-IL23 antibody targeting, e.g. , the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof
- a patient diagnosed with an IL23-mediated disease or disorder as a candidate for treatment with an IL23 antagonist
- an anti-IL23 antibody targeting e.g. , the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof
- a patient diagnosed with an IL23-mediated disease or disorder as a candidate for treatment with an IL23 antagonist
- an anti-IL23 antibody targeting e.g. , the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof
- an anti-IL23 antibody targeting e.g. , the pl9 subunit of IL23, such as MED 12070, or an antigen-binding fragment thereof
- the patient is determined to have a higher or increased level of CCL20, and lower or decreased levels of at least one optional additional biomarker such as IL22, LCN2, CRP, FCP, or a combination in the sample compared to a predetermined threshold level or levels, or compared to a biomarker level or levels in one or more control samples.
- the methods disclosed can entail ordering and/or performing one or more additional assays. For example, if the level of CCL20 (and optionally levels of additional biomarkers such as IL22, LCN2, CRP, FCP, or combinations thereof) (e.g. , a protein expression level or a gene expression level) is determined to be within a normal range (i.e., not elevated), the CCL20 assay (or assay for another biomarker) may be repeated to rule out a false negative result, and/or one or more additional CCL20 assays (or other biomarker' s assays) may be performed to monitor the subject's status. Conversely, if the CCL20 level (e.g. , a protein expression level or a gene expression level) is determined to be elevated, it may be desirable repeat the CCL20 assay to rule out a false positive result.
- additional biomarkers such as IL22, LCN2, CRP, FCP, or combinations thereof
- the predetermined CCL20 threshold level is at least about 22.6 pg/mL as measured in serum using a CCL20 immunoassay (including, e.g., the CCL20 immunoassay described in Example 3).
- the predetermined IL22 threshold level is at least about 15.6 pg/mL as measured in serum using an IL22 immunoassay (including, e.g. , the IL22 immunoassay described in Example 4); and/or the predetermined LCN2 threshold level is at least about 215 ng/mL as measured in serum using an LCN2 immunoassay (including, e.g. , the LCN2 immunoassay described in Example 4).
- the presence of CCL20 above or below a predetermined threshold level in a patient with an IL23-mediated disease can be used in combination with one or more of biomarkers specific for such disease.
- biomarkers specific for such disease for example, for patients with inflammatory bowel disease (IBD) (including, e.g. , CD or UC), the measurement of CCL20 can be combined with measurements of other IL23 pathway biomarker levels (e.g. , IL22 and/or LCN2 levels) and other biomarkers such as C-reactive protein (CRP) and/or fetal calprotectin (FCP) levels.
- IBD inflammatory bowel disease
- CRP C-reactive protein
- FCP fetal calprotectin
- levels of CCL20 can be combined with IL22, LCN2, CRP and/or FCP levels in any of the methods disclosed herein (i) to determine whether a patient suffering an IL23-mediated disease (e.g., IBD, CD or UC) is eligible or non-eligible for a specific treatment or will respond to a specific treatment with an IL23 antagonist (e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen- binding fragment thereof), (ii) to determine whether a specific treatment (e.g., with an IL23 antagonist such as MEDI2070) should commence, be suspended, or be modified, (iii) to diagnose whether the disease (e.g., IBD, CD or UC) is treatable or not treatable with a specific therapeutic agent, or (iv) to prognosticate or predict the outcome of treatment of the disease (e.g., IBD, CD or UC
- mean levels of C-reactive protein are high or elevated (and thus indicative of having active disease) if they are > 5 mg/L as measured using an assay suitable for measuring CRP levels in a patient, including, e.g., the Dade Behring hs-CRP immunoturbidometric assay following the manufacturer' s instructions.
- mean levels of fecal calprotectin are high or elevated (and thus indicative of having active disease) if they are > 250 ⁇ g/g as measured using an assay suitable for measuring fecal calprotectin levels in a patient, including, e.g., Phadia ELIATM Calprotectin assay following the manufacturer's instructions.
- mean levels of C-reactive protein are high or elevated if they are at least about 2, 3, 4, 5, 6, 7, 8, 9 or 10 mg/L as measured using an assay suitable for measuring CRP levels in a patient, including, e.g., the Dade Behring hs- CRP immunoturbidometric assay following the manufacturer's instructions.
- mean levels of fecal calprotectin are high or elevated if they are at least 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, 300, 310, 320, 330, 340 or 350 ⁇ g/g as measured using an assay suitable for measuring calprotectin levels in a patient, including, e.g., the Phadia ELIATM Calprotectin assay following the manufacturer' s instructions.
- the levels of fecal calprotectin are high or elevated if they are > 250 ⁇ g/g, ⁇ 200 ⁇ g/g, ⁇ 150 ⁇ g/g, ⁇ 100 ⁇ g/g, or at least about 100 ⁇ g/g to at least about 250 ⁇ g/g as measured using an assay suitable for measuring calprotectin levels in a patient, including, e.g., the Phadia ELIATM Calprotectin assay following the manufacturer's instructions.
- an assay suitable for measuring calprotectin levels in a patient including, e.g., the Phadia ELIATM Calprotectin assay following the manufacturer's instructions.
- Phadia ELIATM Calprotectin assay following the manufacturer's instructions.
- CCL20 levels e.g. , a protein expression level or a gene expression level
- a specific action would be taken (e.g. , treating a patient having an IL23 -mediated disease with an IL23 antagonist) if the CCL20 levels (e.g. , a protein expression level or a gene expression level) in a sample taken from the patient are below a predetermined CCL20 threshold level, or are decreased relative to the CCL20 levels in one or more control samples.
- CCL20 levels e.g. , a protein expression level or a gene expression level
- a protein expression level or a gene expression level can be used according to the methods disclosed herein, including but not limited to treatment, diagnostic, and monitoring methods, as negative selectors, i.e. , a specific action would not be taken (e.g. , treating a patient having an IL23 -mediated disease with an IL23 antagonist) if the CCL20 levels (e.g. , a protein expression level or a gene expression level) in a sample taken from the patient are above a predetermined CCL20 threshold level, or are increased relative to the CCL20 levels in one or more control samples.
- the CCL20 levels e.g. , a protein expression level or a gene expression level
- the disclosure includes methods, assays, and kits to facilitate a determination by a healthcare provider, a healthcare benefits provider, or a clinical laboratory to as to whether a patient will benefit from treatment with an IL23 antagonist (e.g., an anti- IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen- binding fragment thereof).
- an IL23 antagonist e.g., an anti- IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen- binding fragment thereof.
- the methods assays and kits provided herein also facilitate a determination by a healthcare provider, a healthcare benefits provider, or a clinical laboratory to as to whether a patient will benefit from treatment with any other IL23 antagonist (e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof) disclosed herein or known to those of ordinary skill in the art.
- any other IL23 antagonist e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof
- the methods disclosed herein include making a diagnosis, which may be a differential diagnosis, based at least in part on the levels of CCL20 of a patient.
- the methods disclosed herein include informing the subject of a result of the CCL20 assay and/or of a diagnosis based at least in part on the CCL20 level. The patient can be informed verbally, in writing, and/or electronically.
- This diagnosis can also be recorded in a patient medical record.
- diagnosis of an IL23-mediated disease e.g., CD
- a specific IL23 antagonist e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof
- medical record or "patient medical record” refers to an account of a patient's examination and/or treatment that typically includes one or more of the following: the patient's medical history and complaints, the physician's physical findings, the results of diagnostic tests and procedures, and patient medications and therapeutic procedures.
- a medical record is typically made by one or more physicians and/or physicians' assistants and it is a written, transcribed or otherwise recorded record and/or history of various illnesses or injuries requiring medical care, and/or inoculations, and/or allergies, and/or treatments, and/or prognosis, and/or frequently health information about parents, siblings, and/or occupation.
- the record may be reviewed by a physician in diagnosing the condition.
- the medical record can be in paper form and/or can be maintained in a computer- readable medium.
- the medical record can be maintained by a laboratory, physician's office, a hospital, a healthcare maintenance organization, an insurance company, and/or a personal medical record website.
- a diagnosis is recorded on or in a medical alert article such as a card, a worn article, and/or a radiofrequency identification (RFID) tag.
- RFID radiofrequency identification
- worn article refers to any article that can be worn on a subject's body, including, but not limited to, a tag, bracelet, necklace, arm band, or head band.
- diagnosis means detecting a disease or determining the stage or degree of a disease.
- a diagnosis of a disease is based on the evaluation of one or more factors and/or symptoms that are indicative of the disease. That is, a diagnosis can be made based on the presence, absence or amount of a factor which is indicative of presence or absence of the disease or disorder.
- Each factor or symptom that is considered to be indicative for the diagnosis of a particular disease does not need be exclusively related to the particular disease, e.g. there may be differential diagnoses that can be inferred from a diagnostic factor or symptom.
- there may be instances where a factor or symptom that is indicative of a particular disease is present in an individual that does not have the particular disease.
- diagnosis also encompasses determining the therapeutic effect of a drug therapy, or predicting the pattern of response to a drug therapy.
- the diagnostic methods may be used independently, or in combination with other diagnosing and/or staging methods known in the medical arts for a particular disease.
- the term "differential diagnosis” refers to the determination of which of two or more diseases with similar symptoms is likely responsible for a subject's symptom(s), based on an analysis of the clinical data.
- the term is also used to refer to the determination of whether a patient is susceptible to treatment with an IL23 antagonist (e.g., an anti-IL23 antibody targeting, e.g., the l9 subunit of IL23, such as MED 12070, or an antigen-binding fragment thereof) depending on whether the measured CCL20 levels in a patient sample are below a predetermined threshold level, or decreased relative to the level in one or more control samples.
- an IL23 antagonist e.g., an anti-IL23 antibody targeting, e.g., the l9 subunit of IL23, such as MED 12070, or an antigen-binding fragment thereof
- prognosis refers to a prediction of the probable course and outcome of a clinical condition or disease.
- a prognosis is usually made by evaluating factors or symptoms of a disease that are indicative of a favorable or unfavorable course or outcome of the disease.
- determining the prognosis refers to the process by which the skilled artisan can predict the course or outcome of a condition in a patient.
- prognosis does not refer to the ability to predict the course or outcome of a condition with 100% accuracy.
- prognosis refers to an increased probability that a certain course or outcome will occur; that is, that a course or outcome is more likely to occur in a patient exhibiting a given condition, when compared to those individuals not exhibiting the condition.
- favorable prognosis and “positive prognosis,” or “unfavorable prognosis” and “negative prognosis” as used herein are relative terms for the prediction of the probable course and/or likely outcome of a condition or a disease.
- a favorable or positive prognosis predicts a better outcome for a condition than an unfavorable or negative prognosis.
- a "favorable prognosis” is an outcome that is relatively better than many other possible prognoses that could be associated with a particular condition
- an unfavorable prognosis predicts an outcome that is relatively worse than many other possible prognoses that could be associated with a particular condition.
- Typical examples of a favorable or positive prognosis include a better than average remission rate, a lower propensity for metastasis, a longer than expected life expectancy, differentiation of a benign process from a cancerous process, and the like.
- the disclosure includes methods of treating an IL23-mediated mediated disease in a subject based on the changes in expression of IL23 pathway biomarkers, for example, CCL20.
- the disclosure provides a method of treating a patient having an IL23-mediated disease or disorder, comprising: administering an IL23 antagonist (e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof) to the patient if the patient is determined to have a lower or decreased level of CCL20 in one or more samples taken from the patient compared to a predetermined CCL20 threshold level, or compared to the CCL20 level in one or more control samples.
- an IL23 antagonist e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof
- a sample is obtained from a patient and is submitted for measurement of
- the disclosure also provides a method of treating a patient having an IL23-mediated disease or disorder comprising: (a) submitting a sample taken from the patient for measurement of the levels of CCL20 in the sample, and (b) administering an antibody or antigen -binding fragment thereof that specifically binds to IL23 (e.g., to the pl9 subunit of IL23, such as MED 12070) to the patient if the patients has a lower or decreased level of CCL20 in the samples taken compared to a predetermined CCL20 threshold level, or compared to the CCL20 level in one or more control samples.
- an antibody or antigen -binding fragment thereof that specifically binds to IL23 (e.g., to the pl9 subunit of IL23, such as MED 12070)
- Also provided is method of treating a patient having an IL23 -mediated disease or disorder comprising: (a) submitting a sample taken from the patient for measurement of the levels of CCL20 in the sample, and (b) suspending or not initiating the administration of an antibody or antigen-binding fragment thereof that specifically binds to IL23 (e.g., to the pl9 subunit of IL23, such as MEDI2070) to the patient if the patients has a higher or increased level of CCL20 in the sample compared to a predetermined CCL20 threshold level, or compared to the CCL20 level in one or more control samples.
- an antibody or antigen-binding fragment thereof e.g., to the pl9 subunit of IL23, such as MEDI2070
- the disclosure also provides a method of treating a patient having an IL23-mediated disease or disorder comprising: (a) measuring the levels of CCL20 in a sample obtained from the patient; (b) determining the level of CCL20 in the sample, and, (c) advising a healthcare provider to administer an antibody or antigen-binding fragment thereof that specifically binds to IL23 (e.g., to the pl9 subunit of IL23, such as MEDI2070) to the patient if the patient is determined to have a lower or decreased level of CCL20 in the sample compared to a predetermined CCL20 threshold level, or compared to the CCL20 levels in one or more control samples; or to suspend or deny the administration of an antibody or antigen-binding fragment thereof that specifically binds to IL23 to the patient if the patient is determined to have a higher or increased level of CCL20 in the sample compared to a predetermined CCL20 threshold level, or compared to the CCL20 level in one or more control samples.
- a method of treating a patient having an IL23-mediated disease or disorder comprising: (a) submitting a sample taken from a patient for measurement of the level of CCL20 in a sample obtained from the patient, and (b) administering an antibody or antigen-binding fragment thereof that specifically binds to IL23 (e.g., to the pl9 subunit of IL23, such as MEDI2070) to the patient if the patient is determined to have a lower or decreased level of CCL20 in the sample compared to a predetermined CCL20 threshold level, or compared to the CCL20 level in one or more control samples; or suspending, not initiating, or denying the administration of an antibody or antigen-binding fragment thereof that specifically binds to IL23 (e.g., to the pl9 subunit of IL23, such as MEDI2070) to the patient if the patient is determined to have a higher or increased level of CCL20 in the sample compared to a predetermined CCL20
- the method comprises administering to the subject an effective amount of an IL23 antagonist (e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof).
- an IL23 antagonist e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof.
- the IL23 -mediated disease is a pulmonary disease, an inflammatory bowel disease, a chronic inflammatory skin disease, an inflammatory disease, an autoimmune disease, a neurodegenerative disease, an infection, or a cancer.
- the IL23-mediated disease or disorder is selected from the group consisting of: asthma, IPF, COPD.
- UC ulcerative colitis
- celiac disease atopic dermatitis, allergic contact dermatitis, eczema, psoriasis, alopecia areata, palmoplantar pustulosis, psoriatic arthritis, anklyosing spondylitis, arthritis, rheumatoid arthritis (RA), a rheumatic disorder, ANCA vasculitis, Bechet's disease, autoimmune thyroiditis, type 1 diabetes, multiple sclerosis (MS), Sjogren's syndrome (SS), systemic lupus erythematosus (SLE), Alzheimer's disease, mycobacterial disease, leishmaniasis, a fungal infection, a viral infection, gastric cancer, colorectal cancer, esophageal cancer, leukemia, hepatitis B virus (HBV)-related hepatocellular carcinoma, breast cancer, lung cancer, and nasopharyngeal cancer.
- UC ulcerative
- the patient's CCL20 level is measured in an immunoassay as described herein employing one or more anti-CCL20 antibodies or antigen binding fragments thereof which recognize human CCL20 or antigen-binding fragments, variants or derivatives thereof.
- the sample is obtained from the patient and is submitted for measurement of the level of CCL20 in the sample, for example, to a clinical laboratory.
- the patient's CCL20 level e.g. , DNA or RNA level
- the CCL20 detection assay (e.g. , an immunoassay) is performed on a sample obtained from the patient, by the healthcare professional treating the patient (e.g. , using an immunoassay as described herein including, e.g., the immunoassay described in Example 3, formulated as a "point of care" diagnostic kit).
- a sample is obtained from the patient and is submitted, e.g. , to a clinical laboratory, for measurement of the CCL20 level in the sample according to the healthcare professional's instructions (e.g. , using an immunoassay as described herein including, e.g., the immunoassay described in Example 3).
- the clinical laboratory performing the assay will advise the healthcare provide as to whether the patient can benefit from treatment with an IL23 antagonist (e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof) based on whether the patient's CCL20 level is below a predetermined CCL20 threshold value or is decreased relative to one or more control samples.
- an IL23 antagonist e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof
- the second measurement is conducted 1, 2, 4, 8, 12, or 28 weeks, or at intervening times, after administering the IL23 antibody or antigen-binding fragment thereof that specifically binds to IL23 (e.g., to the pl9 subunit of IL23, such as MED 12070).
- the IL23 antibody or antigen-binding fragment thereof that specifically binds to IL23 e.g., to the pl9 subunit of IL23, such as MED 12070.
- this disclosure includes a method of treating a patient having an IL23 -mediated disease over a period of time, comprising: measuring a first CCL20 level (e.g. , protein expression level or gene expression level) in a first sample taken from the patient, or submitting a first sample taken from the patient for measurement of a first CCL20 level in the sample, wherein the patient's CCL20 level is, for example, measured in an immunoassay, including, e.g., an immunoassay described in Example 3, employing one or more anti-CCL20 antibodies or antigen binding fragments thereof which recognize human CCL20, and administering an IL23 antagonist (e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof) to the patient if the patient' s CCL20 level in the first sample is below a predetermined CCL20 threshold level, or is lowered relative to the
- the method can further comprise: measuring a second CCL20 level (e.g. , protein expression level or gene expression level) in a second sample taken from the patient, or submitting a second sample taken from the patient for measurement of a second CCL20 level in the sample, wherein the patient's CCL20 level is again measured, for example, in an immunoassay, including, e.g., an immunoassay described in Example 3, employing one or more anti-CCL20 antibodies or antigen binding fragments thereof which recognize human CCL20; comparing the first and second CCL20 level in the patient, and altering the dose, e.g.
- a second CCL20 level e.g. , protein expression level or gene expression level
- IL23 antagonist therapy can be discontinued if, e.g., the patient' s CCL20 level in the second sample is lower than the CCL20 level in the first sample.
- the amount or frequency of the IL23 antagonist administered to the patient can be maintained or reduced if the patient's CCL20 level in the second sample is higher than or about the same as the CCL20 level in the first sample.
- a "loading" dose of an IL23 antagonist e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof
- an IL23 antagonist e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof
- the loading dose does not affect the patient' s CCL20 level (e.g. , protein expression levels or gene expression levels) significantly or the patient' s CCL20 level decreases, a decision could be made to discontinue treatment - e.g. , to use a non-IL23 antagonist therapy.
- results of an immunoassay as provided herein can be submitted to a healthcare benefits provider for determination of whether the patient' s insurance will cover treatment with an IL23 antagonist (e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof).
- an IL23 antagonist e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof.
- this disclosure includes a method of treating a patient having an IL23-mediated disease comprising: measuring, e.g. , in a clinical laboratory, the CCL20 level (e.g. , protein expression level or gene expression level) in a first sample obtained from a patient having an IL23-mediated disease, e.g.
- a sample provided by a healthcare provider wherein the patient's CCL20 level in the first sample is, for example, measured in an immunoassay, including, e.g., an immunoassay described in Example 3, employing one or more anti-CCL20 antibodies or antigen binding fragments thereof which recognize human CCL20, determining whether the patient' s CCL20 level in the first sample is below a predetermined CCL20 level, or is decreased relative to the CCL20 level in one or more control samples; and advising a healthcare provider to administer an IL23 antagonist (e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen- binding fragment thereof) to the patient if the patient's CCL20 level is below a predetermined CCL20 threshold level, or are decreased relative to the CCL20 level in one or more control samples.
- an IL23 antagonist e.g., an anti-IL23 antibody targeting, e.g., the pl
- these methods can further comprise: measuring the CCL20 level (e.g. , protein expression level or gene expression level) in a second sample obtained from the patient, e.g. , a sample provided by a healthcare provider, wherein the patient's CCL20 level is again measured, for example, in an immunoassay, including, e.g., an immunoassay described in Example 3, employing one or more anti-CCL20 antibodies or antigen binding fragments thereof which recognize human CCL20; determining whether the patient's CCL20 level in the second sample is higher than, about the same as, or lower than the CCL20 level measured in the first sample; and advising a healthcare provider to adjust the IL23 antagonist therapy (e.g., a therapy comprising the administration of an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof) if indicated, e.g.
- the IL23 antagonist therapy e.g., a
- the patient's CCL20 level in the second sample is lower than the CCL20 level in the first sample, or to maintain or reduce the amount or frequency of the IL23 antagonist administered to the patient if the patient's CCL20 level in the second sample is higher than or about the same as the CCL20 level in the first sample.
- a sample is obtained from the patient and is submitted, e.g., to a clinical laboratory, for measurement of the level of CCL20 alone or in combination with the level of at least another IL23 pathway biomarker, e.g., IL22 and/or LCN2; at least one inflammation biomarker, e.g., CRP and/or FCP; or a combination thereof (e.g., protein expression level or gene expression level) in the sample, e.g., using an immunoassay.
- IL23 pathway biomarker e.g., IL22 and/or LCN2
- inflammation biomarker e.g., CRP and/or FCP
- a combination thereof e.g., protein expression level or gene expression level
- the clinical laboratory performing the assay will advise the healthcare provide as to whether the patient can benefit from treatment with an IL23 antagonist (e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof) based on whether the patient's CCL20 level (e.g., protein expression level or gene expression level) is below a predetermined CCL20 threshold value or is low relative to one or more control samples.
- an IL23 antagonist e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof
- CCL20 level e.g., protein expression level or gene expression level
- methods of treatment contemplated herein comprise administering to the subject an antibody or antigen-binding fragment thereof targeting IL23 (e.g., to the pl9 subunit of IL23, such as MEDI2070) in a sufficient amount and/or at sufficient interval to achieve and/or maintain a certain quantity of IL23-specific antibody per volume of serum, using, for example, an assay as described herein.
- an antibody or antigen-binding fragment thereof targeting IL23 e.g., to the pl9 subunit of IL23, such as MEDI2070
- the antibody or antigen -binding fragment thereof targeting IL23 can be given to achieve at least about 15 ng/ml, 20 ng/ml, 25 ng/ml, 30 ng/ml, 35 ng/ml, 40 ng/ml, 45 ng/ml, 50 ng/ml, 55 ng/ml, 60 ng/ml, 65 ng/ml, 70 ng/ml, 75 ng/ml, 80 ng/ml, 85 ng/ml, 90 ng/ml, 95 ng/ml, 100 ng/ml, 120 ng/ml, 140 ng/ml, 160 ng/ml, 180 ng/ml, 200 ng/ml, 220 ng/ml, 240 ng/ml, 260 ng/ml, 280 ng/ml, 300 ng/ml
- the antibody or antigen-binding fragment thereof targeting IL23 can be given to achieve a concentration of IL23- specific antibody in serum from about 12.5 ng/ml to about 1000 ng/ml.
- concentration of IL23-specific antibody in serum from about 12.5 ng/ml to about 1000 ng/ml.
- methods of treatment contemplated herein comprise administering to the subject an IL23 antagonist (e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof) in an amount and at an interval of: 15- 54 mg every 0.5-1.5 months; 55-149 mg every 1.5-4.5 months; 150-299 mg every 4-8 months; or 300-1100 mg every 4-12 months.
- an IL23 antagonist e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof
- the amount and interval are: 15-21 mg every 0.5-1.0 month; 55-70 mg every 1.5-3.0 months; 150-260 mg every 4-6 months; or 300-700 mg every 4-8 months. In some aspects, the amount and interval are: 21 mg every month; 70 mg every 3 months; 210 mg every 6 months; or 700 mg every 6 months. In some aspects, the amount and interval are: 210 mg every 3 months or 700 mg every 3 months. In some aspects, the amount and interval are: 210 mg every 1 month or 700 mg every 1 month.
- the IL23 antagonist e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MED 12070, or an antigen-binding fragment thereof
- IV intravenously
- the IL23 antagonist e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof
- SC subcutaneously
- the IL23 antagonist e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof
- the doses as administered every week, every two weeks, every three weeks, every 4 weeks, every 5 weeks, every 6 weeks, every 7 weeks, every 8 weeks, every 9 weeks every 10 weeks, or every 12 weeks.
- the dose comprises about 1 mg, 2 mg, 3mg, 4 mg, 5 mg, 10 mg, 15 mg, 20 mg, 25 mg, 30 mg, 35 mg, 40 mg, 45 mg, 50 mg, 60 mg, 70 mg, 80 mg, 90 mg, 100 mg, 110 mg, 120 mg, 130 mg, 140 mg, 150 mg, 160 mg, 170 mg, 180 mg, 190 mg, 200 mg, 210 mg, 220 mg, 230 mg, 240 mg, 250 mg, 260 mg, 270 mg, 280 mg, 290 mg, 300 mg, 310 mg, 320 mg, 330 mg, 340 mg, 350 mg, 360 mg, 370 mg, 380 mg, 390 mg, 400 mg, 410 mg, 420 mg, 430 mg, 440 mg, 450 mg, 460 mg, 470 mg, 480 mg, 490 mg, 500 mg, 510 mg, 520 mg, 530 mg, 540 mg, 550 mg, 560 mg, 570 mg, 580 mg, 590 mg, 600 mg, 610 mg,
- the dose is about 210 mg of IL23 antagonist (e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof) administered SC.
- IL23 antagonist e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof
- the dose is about 700 mg of IL23 antagonist (e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof) administered IV.
- IL23 antagonist e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof
- the anti-IL23 antibody e.g., MEDI2070
- the anti-IL23 antibody is administered at a fixed dose of 210 mg Q4W for 26 doses.
- the anti-IL23 antibody e.g., MEDI2070
- the IV administration is followed by administration of the anti-IL23 antibody (e.g., MEDI2070) at a fixed dose of 210 mg SC Q4W for 100-weeks.
- a therapeutic agent e.g., and IL23 antagonist
- an anti-IL23 antibody targeting e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof
- the antagonist may be administered through any suitable means, compositions and routes known in the art.
- dosage regiments a single bolus can be administered, several divided doses can be administered over time or the dose can be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation.
- the IL23 antagonist e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof
- the pharmaceutical composition can be administered, for example, via intraarticular, intravenous, intramuscular, intralesional, intraperitoneal or cutaneous routes (including intra-, trans- or sub-dermal, and subcutaneous), by bolus injection, or continuous infusion.
- the pharmaceutical composition is administered by an intravenous route.
- the pharmaceutical composition is administered by a subcutaneous route.
- compositions are administered by oral, buccal, rectal, intratracheal, gastric, or intracranial routes.
- Localized administration e.g. at a site of disease or injury is contemplated, for example, by enema or suppository for conditions involving the gastrointestinal tract.
- transdermal delivery and sustained release from implants are contemplated. Delivery by inhalation includes, for example, nasal or oral inhalation, use of a nebulizer, inhalation of the antagonist in aerosol form, and the like.
- Other alternatives include eyedrops; oral preparations including pills, syrups, lozenges or chewing gum; and topical preparations such as lotions, gels, sprays, and ointments, prefilled syringes and autoinjectors.
- the IL23 antagonist e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof
- a composition comprising one or more additional components such as a physiologically acceptable carrier, excipient or diluent.
- the composition additionally comprises one or more physiologically active agents for combination therapy.
- a pharmaceutical composition may comprise an IL23 antagonist (e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof) together with one or more substances selected from the group consisting of a buffer, an antioxidant such as ascorbic acid, a low molecular weight polypeptide (such as those having fewer than 10 amino acids), a protein, an amino acid, a carbohydrate such as glucose, sucrose or dextrins, a chelating agent such as EDTA, glutathione, a stabilizer, and an excipient.
- an IL23 antagonist e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof
- one or more substances selected from the group consisting of a buffer, an antioxidant such as ascorbic acid, a low molecular weight polypeptide (such as those
- Neutral buffered saline or saline mixed with conspecific serum albumin are examples of appropriate diluents.
- preservatives such as benzyl alcohol may also be added.
- the composition may be formulated as a lyophilizate using appropriate excipient solutions (e.g. , sucrose) as diluents.
- the IL23 antagonist e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen -binding fragment thereof
- the IL23 antagonist can be provided at a concentration of about 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, 150, 155, 160, 165, 170, 175, 180, 185, 190, 195 or 200 mg/ml.
- Exemplary formulations useful for the present invention are those that include a glutamic acid, citric acid or acetic acid buffer at an appropriate pH, from 4.5 to 5.2, an excipient such as sucrose, glycine, proline, glycerol, and/or sorbitol at an appropriate concentration such as 1 to 20% (w/v), and a surfactant such as a non-ionic surfactant like polysorbate (polysorbate 20 or 80) or poloxamers (poloxamer 1888) at an appropriate concentration of 0.001% - 0.1% (w/v).
- a surfactant such as a non-ionic surfactant like polysorbate (polysorbate 20 or 80) or poloxamers (poloxamer 1888) at an appropriate concentration of 0.001% - 0.1% (w/v).
- the formulations comprise sodium acetate, sucrose and polysorbate 20.
- the formulations comprise 70 mg/mL anti-IL23 antibody (e.g. , MEDI2070), 10 mM sodium acetate, 9% (w/v) sucrose and 0.004% (w/v) polysorbate 20, at pH 5.2.
- Suitable components are nontoxic to recipients at the dosages and concentrations employed. Further examples of components that may be employed in pharmaceutical formulations are presented in any Remington' s Pharmaceutical Sciences including the 21 st Ed. (2005), Mack Publishing Company, Easton, PA.
- an anti-IL23 antibody e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof
- additional IL23 antagonists as described in the section of the description entitled "IL23 Antagonists" in combination with additional therapeutic agents.
- the IL23 antagonist is an anti-IL23 antibody which can specifically bind to the pl9 subunit of IL23 (SEQ ID NO: 15), to the p40 subunit of IL23 (SEQ ID NO: 16), or both.
- the anti-IL23 antibody or antigen-binding fragment thereof comprises the heavy chain (HC) (SEQ ID NO: 17) and/or the light chain (SEQ ID NO: 18) of MEDI2070, or an antigen-binding fragment, variant, or derivative thereof.
- the anti-IL23 antibody or antigen-binding fragment thereof comprises the heavy chain variable region (VH) (SEQ ID NO: 7) and/or the light chain variable region (VL) (SEQ ID NO: 8) of MEDI2070.
- the anti-IL23 antibody or antigen-binding fragment thereof comprises at least one of the complementarity determining regions of MEDI2070 (SEQ ID NOS: 33-38).
- the anti-IL23 antibody or antigen-binding fragment thereof comprises a VH region comprising the sequence of SEQ ID NO: 45 and/or a VL region comprising the sequence of SEQ ID NO: 46, or an antigen-binding fragment, variant, or derivative thereof.
- the anti-IL23 antibody or antigen-binding fragment thereof comprises at least one of the complementarity determining regions of SEQ ID NOS: 47-49 (CDRs of the VH of SEQ ID NO: 45) and/or SEQ ID NOS: 50-52 (CDRs of the VL of SEQ ID NO: 46).
- the IL23 antagonist is an anti-IL23 antibody selected from ustekinumab or briakinumab (targeting the p40 subunit of IL23), guselkumab, tildrakizumab, BI-655066 or LY-3074828 (targeting the pl9 subunit of IL23), an antigen-binding fragment thereof, or a combination thereof.
- the IL23 antagonist is a molecule (e.g., an antibody) that competes for binding to IL23 with ustekinumab or briakinumab (targeting the p40 subunit of IL23), guselkumab, tildrakizumab, BI-655066 or LY-3074828 (targeting the pl9 subunit of IL23), an antigen-binding fragment thereof, or a combination thereof.
- ustekinumab or briakinumab targeting the p40 subunit of IL23
- guselkumab guselkumab
- tildrakizumab tildrakizumab
- BI-655066 BI-655066
- LY-3074828 targeting the pl9 subunit of IL23
- Examples include using combinations of an anti-IL23 antibody and one or more other therapeutic moiety having anti-inflammatory properties (for example, non-steroidal antiinflammatory agents, steroids, and/or immunomodulators), or of an anti-IL23 antibody and one or more other treatments (e.g. , surgery, ultrasound, or treatment effective to reduce inflammation).
- an anti-IL23 antibody and one or more other therapeutic moiety having anti-inflammatory properties for example, non-steroidal antiinflammatory agents, steroids, and/or immunomodulators
- an anti-IL23 antibody and one or more other treatments e.g. , surgery, ultrasound, or treatment effective to reduce inflammation.
- Useful agents that may be combined with an anti-IL23 antibody include those used to treat, for example, Crohn' s disease or ulcerative colitis, such as aminosalicylate (for example, mesalamine or substances that are metabolized to mesalamine, including, for example, ASACOL®, SALOFALK®, PENTASA®, DIPENTUM®, COLAZIDE®, LIALDA® and ROW ASA®), corticosteroids/glucocorticoids (including prednisolone methasulfobenzoate, tixocortol pivalate, fluticasone propionate, beclomethasone dipropionate, and budesonide), antibiotics such as metronidazole or ciprofloxacin (or other antibiotics useful for treating, for example, patients afflicted with fistulas), and immunosuppressives such as azathioprine (for example, IMURAN® and AZASAN®), 6- mercaptopurine (for example, PURINET
- IL23 antibodies or antibody derivatives, or the aforesaid combinations can be used in conjunction with one or more molecules or other treatments, wherein the other molecule(s) and/or treatment(s) do not directly bind to or affect IL23, but which combination is effective for treating or preventing the condition being treated.
- an anti-IL23 antibody can be used in combination with probiotic therapy, or other therapy used to restore or maintain normal gut flora, including gut flora transplant.
- one or more of the molecule(s) and/or treatment(s) treats or prevents a condition that is caused by one or more of the other molecule(s) or treatment(s) in the course of therapy, e.g., nausea, fatigue, alopecia, cachexia, insomnia, etc.
- a condition that is caused by one or more of the other molecule(s) or treatment(s) in the course of therapy, e.g., nausea, fatigue, alopecia, cachexia, insomnia, etc.
- agent(s) or therapies may be administered by routes, and at dosages and intervals, that are known in the art and described in the prescribing information.
- IL23 antibodies or antibody derivatives, or the aforesaid combinations can be used in conjunction with one or more elemental diet treatment. See, e.g., Voitk et al. Arch Surg 107:329 (1973); Yamamoto et al. Int J Colorectal Dis 28:335-340 (2013).
- Additional supportive therapies are included in possible combination treatment with IL23 antagonists (e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof); such supportive therapies as (without limitation), analgesics, and anticholinergic and antidiarrheal agents. Combining such supportive therapies can be useful in the beginning of a treatment regimen in reducing a patient's symptoms and improving their quality of life.
- Supportive therapies include administering oral iron, folate, and vitamin B i 2 .
- Antidiarrheal agents include, but are not limited to diphenoxylate, codeine, loperamide, and anticholinergics (or pharmacological equivalents thereof), which can be administered to patients with mild disease to reduce the frequency of bowel movements and relive rectal urgency. Cholestyramine can be used in patients to prevent bile salt-induced colonic secretion in patients who have already undergone limited ileocolic resections. Anticholinergic agents include, but are not limited to, clidinium bromide, dicyclomine hydrochloride, tincture of belladonna and the like, and are useful to reduce abdominal cramps, pain and rectal urgency. Supportive or therapies may be administered by routes, and at dosages and intervals, that are known in the art and described in the prescribing information
- the individual molecule(s) and/or treatment(s) can be administered in any order, over any length of time, which is effective, e.g. , simultaneously, consecutively, or alternately.
- the method of treatment comprises completing a first course of treatment with one molecule or other treatment before beginning a second course of treatment.
- the length of time between the end of the first course of treatment and beginning of the second course of treatment can be any length of time that allows the total course of therapy to be effective, e.g. , seconds, minutes, hours, days, weeks, months, or even years.
- kits can comprise containers, each with one or more of the various reagents (e.g. , in concentrated form) utilized in the method, including, for example, one or more anti-CCL20, anti-IL22, anti-LCN2, anti-CRP, and/or anti-FCP antibodies.
- One or more anti-CCL20, anti-IL22, anti- LCN2, anti-CRP, and/or anti-FCP antibodies can be provided already attached to a solid support.
- One or more antibodies anti-CCL20, anti-IL22, anti- LCN2, anti-CRP, and/or anti-FCP antibodies, e.g. , detection antibodies can be provided already conjugated to a detectable label, e.g. , biotin or a ruthenium chelate.
- the kit can also provide reagents for coupling a detectable label to an antibody (as well as the label itself), buffers, and/or reagents and instrumentation to support the practice of the assays provided herein.
- a labeled secondary antibody can be provided that binds to the detection antibody.
- a kit provided according to this disclosure can further comprise suitable containers, plates, and any other reagents or materials necessary to practice the assays provided herein.
- a kit comprises one or more nucleic acid probes (e.g. , oligonucleotides comprising naturally occurring and/or chemically modified nucleotide units) capable of hybridizing a subsequence of the CCL20, IL22, and/or LCN2 gene sequences under high stringency conditions.
- one or more nucleic acid probes e.g. , oligonucleotides comprising naturally occurring and/or chemically modified nucleotide units
- capable of hybridizing a subsequence of the CCL20, IL22, and/or LCN2 gene sequence under high stringency conditions are attached to a microarray chip.
- a kit provided according to this disclosure can also comprise brochures or instructions describing the process.
- the sandwich immunoassay process comprises a first anti-CCL20, anti-IL22, and/or anti-LCN2 "capture” antibody or antigen-binding fragment thereof attached to a solid support, and a second anti-CCL20, anti-IL22, and/or anti-LCN2 "detection” antibody or antigen binding fragment thereof.
- the immunoassay can be performed by methods provided herein or methods well known and understood by those of ordinary skill in the art.
- the immunoassay comprises attaching a capture antibody or fragment thereof to a solid support; applying the test sample or a control sample, allowing CCL20, IL22, and/or LCN2, if present in the sample, to bind to the capture antibody or fragment thereof; applying the detection antibody or fragment thereof, which can bind to CCL20, IL22, and/or LCN2 already bound to the capture antibody or fragment thereof; and measuring the amount of detection antibody or fragment thereof bound to CCL20, IL22, and/or LCN2.
- the assay can further include washing steps, blocking steps and incubation steps.
- Test kits can include instructions for carrying out one or more CCL20, IL22, and/or LCN2 detection assays, e.g.
- kits can be affixed to packaging material or can be included as a package insert. While the instructions are typically written or printed materials they are not limited to such. Any medium capable of storing such instructions and communicating them to an end user is contemplated. Such media include, but are not limited to, electronic storage media (e.g. , magnetic discs, tapes, cartridges, chips), optical media (e.g. , CD ROM), and the like. As used herein, the term "instructions" can include the address of an internet site that provides the instructions.
- the methods disclosed herein can be provided as a companion diagnostic, for example available via a web server, to inform the clinician or patient about potential treatment choices.
- the methods disclosed herein can comprise collecting or otherwise obtaining a biological sample and performing an analytical method to detect and measure the levels of CCL20 alone or in combination with at least one IL23 pathway biomarker, e.g., IL22 and/or LCN2; at least one inflammation biomarker, e.g., CRP and/or FCP; or a combination thereof (e.g., protein expression levels or gene expression levels of CCL20, IL22, LCN2, FCP, CRP, and/or combinations thereof).
- IL23 pathway biomarker e.g., IL22 and/or LCN2
- inflammation biomarker e.g., CRP and/or FCP
- a combination thereof e.g., protein expression levels or gene expression levels of CCL20, IL22, LCN2, FCP, CRP, and/or combinations thereof.
- Levels of CCL20 alone, or in combination with the levels of one, two, three, or more biomarkers, including, e.g. , IL22, LCN2, CRP, FCP, and combinations thereof (e.g., protein expression levels or gene expression levels) or normalized scores derived from measured levels can be used alone (e.g., for treatment, diagnostic, prognostic, or monitoring purposes), or in combination with levels or normalized scores derived from other biomarkers (e.g., a panel a genes used to derive a gene signature).
- these scores can also be combined with other scores corresponding, for example, to clinical biomarkers such as (i) gender, (ii) age, (iii) body mass index, (iv) smoking status, (v) concomitant drugs, (vi) health assessment quality (HAQ), or a combination of two or more to yield a diagnostic score.
- the diagnostic score may be a single number determined from the sum of all the marker calculations that is compared to a preset threshold value that is an indication of the presence or absence of disease.
- the diagnostic score may be a series of bars that each represent a biomarker value and the pattern of the responses may be compared to a pre-set pattern for determination of the presence or absence of disease.
- the computer system comprises hardware elements that are electrically coupled via bus, including a processor, input device, output device, storage device, computer-readable storage media reader, communications system, processing acceleration (e.g., DSP or special-purpose processors), and memory.
- processing acceleration e.g., DSP or special-purpose processors
- the computer-readable storage media reader can be further coupled to computer- readable storage media, the combination comprehensively representing remote, local, fixed and/or removable storage devices plus storage media, memory, etc. for temporarily and/or more permanently containing computer-readable information, which can include storage device, memory and/or any other such accessible system resource.
- a single architecture might be utilized to implement one or more servers that can be further configured in accordance with currently desirable protocols, protocol variations, extensions, etc.
- protocols protocol variations, extensions, etc.
- Customized hardware might also be utilized and/or particular elements might be implemented in hardware, software or both.
- connection to other computing devices such as network input/output devices (not shown) may be employed, it is to be understood that wired, wireless, modem, and/or other connection or connections to other computing devices might also be utilized.
- the system further comprises one or more devices for providing input data to the one or more processors.
- the system further comprises a memory for storing a data set of ranked data elements.
- the device for providing input data comprises a detector for detecting the characteristic of the data element, e.g., such as a fluorescent plate reader, mass spectrometer, or gene chip reader.
- the system additionally may comprise a database management system.
- User requests or queries can be formatted in an appropriate language understood by the database management system that processes the query to extract the relevant information from the database of training sets.
- the system may be connectable to a network to which a network server and one or more clients are connected.
- the network may be a local area network (LAN) or a wide area network (WAN), as is known in the art.
- the server includes the hardware necessary for running computer program products (e.g., software) to access database data for processing user requests.
- the system can be in communication with an input device for providing data regarding data elements to the system (e.g., expression values).
- the input device can include a gene expression profiling system including, e.g., a mass spectrometer, gene chip or array reader, and the like.
- a computer program product may include a computer readable medium having computer readable program code embodied in the medium for causing an application program to execute on a computer with a database.
- a "computer program product” refers to an organized set of instructions in the form of natural or programming language statements that are contained on a physical media of any nature (e.g., written, electronic, magnetic, optical or otherwise) and that may be used with a computer or other automated data processing system. Such programming language statements, when executed by a computer or data processing system, cause the computer or data processing system to act in accordance with the particular content of the statements.
- Computer program products include without limitation: programs in source and object code and/or test or data libraries embedded in a computer readable medium. Furthermore, the computer program product that enables a computer system or data processing equipment device to act in pre-selected ways may be provided in a number of forms, including, but not limited to, original source code, assembly code, object code, machine language, encrypted or compressed versions of the foregoing and any and all equivalents.
- a computer program product is provided to implemented the treatment, diagnostic, prognostic, or monitoring methods disclosed herein, for example, to determine whether to administer an IL23 antagonist (e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MED 12070, or an antigen-binding fragment thereof) to a patient in need thereof if the level of CCL20 in a sample taken from the patient is above or below a predetermined threshold level.
- an IL23 antagonist e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MED 12070, or an antigen-binding fragment thereof
- a computer program product is provided to implement the treatment, diagnostic, prognostic, or monitoring methods disclosed herein, for example, to determine whether to administer an IL23 antagonist (e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MED 12070, or an antigen-binding fragment thereof) to a patient in need thereof if the levels of CCL20 and the levels of one, two, three, or more additional biomarkers, e.g. , IL22, LCN2, CRP, and/or FCP, in a sample taken from the patient are above or below their respective predetermined threshold level.
- an IL23 antagonist e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MED 12070, or an antigen-binding fragment thereof
- additional biomarkers e.g. , IL22, LCN2, CRP, and/or FCP
- the IL23 antagonist is an anti-IL23 antibody which can specifically bind to the pl9 subunit of IL23 (SEQ ID NO: 15), to the p40 subunit of IL23 (SEQ ID NO: 16), or both.
- the anti-IL23 antibody or antigen-binding fragment thereof comprises the heavy chain (HC) (SEQ ID NO: 17) and/or the light chain (SEQ ID NO: 18) of MEDI2070, or an antigen-binding fragment, variant, or derivative thereof.
- the anti-IL23 antibody or antigen-binding fragment thereof comprises the heavy chain variable region (VH) (SEQ ID NO: 7) and/or the light chain variable region (VL) (SEQ ID NO: 8) of MEDI2070.
- the anti-IL23 antibody or antigen-binding fragment thereof comprises at least one of the complementarity determining regions of MEDI2070 (SEQ ID NOS: 33-38).
- the anti-IL23 antibody or antigen-binding fragment thereof comprises a VH region comprising the sequence of SEQ ID NO: 45 and/or a VL region comprising the sequence of SEQ ID NO: 46, or an antigen-binding fragment, variant, or derivative thereof.
- the anti-IL23 antibody or antigen-binding fragment thereof comprises at least one of the complementarity determining regions of SEQ ID NOS: 47-49 (CDRs of the VH of SEQ ID NO: 45) and/or SEQ ID NOS: 50-52 (CDRs of the VL of SEQ ID NO: 46).
- the IL23 antagonist is an anti-IL23 antibody selected from ustekinumab or briakinumab (targeting the p40 subunit of IL23), guselkumab, tildrakizumab, BI-655066 or LY-3074828 (targeting the pl9 subunit of IL23), an antigen-binding fragment thereof, or a combination thereof.
- the IL23 antagonist is a molecule (e.g., an antibody) that competes for binding to IL23 with ustekinumab or briakinumab (targeting the p40 subunit of IL23), guselkumab, tildrakizumab, BI-655066 or LY-3074828 (targeting the pl9 subunit of IL23), an antigen-binding fragment thereof, or a combination thereof.
- ustekinumab or briakinumab targeting the p40 subunit of IL23
- guselkumab guselkumab
- tildrakizumab tildrakizumab
- BI-655066 BI-655066
- LY-3074828 targeting the pl9 subunit of IL23
- the computer program product includes a computer readable medium embodying program code executable by a processor of a computing device or system, the program code comprising: (a) code that retrieves data attributed to a biological sample from a subject, wherein the data comprises CCL20 levels values (presence/absence, amount, or data otherwise derived from these level values) alone or combination with values corresponding to other biomarkers in the biological sample (e.g., biological markers or clinical markers) such as IL22, LCN2, FCP, CRP, or combinations thereof.
- CCL20 levels values presence/absence, amount, or data otherwise derived from these level values
- other biomarkers in the biological sample e.g., biological markers or clinical markers
- values corresponding to clinical biomarkers can also be combined with values corresponding to clinical biomarkers, for example, indicative of the severity of the disease or disorder or to the patient's predisposition to have such disease or disorder; and, (b) code that executes a classification method that indicates, e.g., whether to administer an IL23 antagonist (e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof) to a patient in need thereof.
- an IL23 antagonist e.g., an anti-IL23 antibody targeting, e.g., the pl9 subunit of IL23, such as MEDI2070, or an antigen-binding fragment thereof
- aspects can be code stored in a computer-readable memory of virtually any kind including, without limitation, RAM, ROM, magnetic media, optical media, or magneto-optical media. Even more generally, some aspects could be implemented in software, or in hardware, or any combination thereof including, but not limited to, software running on a general purpose processor, microcode, PLAs, or ASICs.
- Vedolizumab DWMTQSPLSLPVTPGEPASISCRSSQSLAKSYGNTYLSWYLQKPGQSPQLLIYGISNRF LC SGVPDRFSGSGSGTDFTLKI SRVEAEDVGVYYCLQGTHQPYTFGQGTKVEIKRTVAAPSV FIFPPSDEQLKSGTASWCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
- Adalimumab EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSAITWNSGHIDY HC ADSVEGRFTI SRDNAKNSLYLQMNSLRAEDTAVYYCAKVSYLSTASSLDYWGQGTLVTVS SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS SEQ Description Sequence
- the Phase 2a study evaluated the efficacy and safety of multiple IV doses of MEDI2070 (700 mg) or placebo administered on Week 0 (Day 1) and Week 4 (Day 29) during an initial 12-week treatment period in subjects with moderate to severe CD who failed or are intolerant to anti-TNFa therapy.
- a 100-week, open-label, treatment period was included to allow evaluation of the long-term safety of MED 12070 (administered at 210 mg SC Q4W) and to provide information on PK and efficacy data.
- the primary objective of this study was to evaluate the efficacy of MEDI2070 versus placebo to induce a clinical effect (defined as at least a 100-point reduction in CDAI from baseline) or remission (defined as CDAI ⁇ 150)) at Week 8 in subjects with moderate to severe CD.
- Secondary objectives of this study included evaluating: the efficacy of MEDI2070 versus placebo in achieving CDAI remission at Week 8; the effect of MEDI2070 versus placebo in achieving at least a CDAI 100-point reduction from baseline at Week 8; the effect of MED 12070 versus placebo in achieving at least a CDAI 70-point reduction from baseline at Week 8; the effect of MED 12070 versus placebo in achieving CDAI remission or at least a CDAI 100-point reduction from baseline at Week 12; the effect of MED 12070 versus placebo on the change from baseline in CDAI at Week 8; the safety and tolerability of MEDI2070; and the PK and immunogenicity (IM) of MEDI2070.
- IM immunogenicity
- Exploratory objectives of this study included evaluating: the effect of MEDI2070 on other measures of clinical effect including but not limited to CDAI response, change from baseline in CDAI at other timepoints, and sustained CDAI response; the effect of treatment on inflammatory markers in blood and stool; the predictive value of blood or fecal biomarkers with respect to subject response to MEDI2070; and the effect of MEDI2070 on Patient Reported Outcomes (PROs).
- subjects at the completion of the double-blind, placebo-controlled, treatment period (Week 12) had the option to enter a 100-week, open-label, treatment period where they received open-label MEDI2070 (210 mg SC) Q4W (Week 12 through Week 112) as described in FIG. 1.
- MEDI2070 or placebo was administered as an IV infusion over a period of at least 60 minutes via an infusion pump on Week 0 (Day 1) and Week 4 (Day 29).
- MEDI2070 The doses of MEDI2070 in this study were 700 mg IV Q4W in the 12-week, double- blind, placebo-controlled, treatment period (Weeks 0 and 4) and 210 mg SC Q4W in the 100- week, open-label, treatment period (Week 12 to Week 112).
- MEDI2070 700 mg or placebo was delivered in 5.0% w/v dextrose in a volume of 100 mL over a minimum of 60 minutes using an infusion pump. Before and after each IV infusion, the IV access was flushed with 5% w/v dextrose.
- MEDI2070 was administered by subcutaneous (SC) injection during the 100-week, open-label, treatment period. Each SC dose was administered to the subject's anterior abdominal wall by an experienced and qualified staff member.
- Each SC injection was no more than 1.0 mL in volume (i.e., 3 x 1.0 mL injections for the 210 mg SC dose).
- the dose was equally divided in 3 syringes and administered as multiple SC injections on alternating (left or right) sites on the subject's anterior abdominal wall with no more than approximately 30 seconds of time between each injection and at a distance of at least 2 cm apart.
- CDAI The CDAI is the oldest and most widely used of several multi-item instruments that have been developed and is validated for use in clinical studies to measure disease activity in CD (Best et al. Gastroenterology 70:439-44 (1976); Sands et al. N Engl J Med. 350(9):876-85 (2004)).
- the CDAI measures the severity of active disease using symptom scores that are monitored over the previous week and includes patient-reported symptoms, physician-assessed signs, and laboratory markers.
- the CDAI score is calculated by summing weighted scores for subjective items (number of liquid or very soft stools, abdominal pain and general well-being) recorded by a diary during a 1-week period, and objective items (associated symptoms, taking antidiarrheal such as loperamide/opiates, abdominal mass, hematocrit, daily morning temperature, and body weight).
- the CDAI scores range from 0 to 600, with higher scores indicating greater disease activity.
- Subjects with scores of ⁇ 150, 150 to 219, and 220 to 450 represent remission, mild disease, and moderate to severe disease, respectively; whereas subjects with scores of > 450 have very severe disease (Buxton et al. Value Health. 10:214-20 (2007)).
- the CDAI was calculated at the site in order to determine the eligibility for the study. For statistical analysis, CDAI for all visits was also calculated.
- Patient Reported Outcomes The study assessed patient reported outcomes (PROs) using the IBDQ.
- the IBDQ was completed by subjects using a paper questionnaire at study visits, scheduled at Weeks 0, 4, 8, and 12 and was administered before any other assessments.
- IBDQ Inflammatory Bowel Disease Questionnaire
- the IBDQ is a validated, disease-specific PRO instrument that measures health-related quality of life in patients with IBD (Guyatt et al. Gastroenterology. 96:804-10 (1989)).
- the IBDQ covers the following dimensions: bowel symptoms (10 items), systemic symptoms (5 items), emotional function (12 items), and social function (5 items). Items are scored on a 7-point Likert scale, yielding a global score in the range 32 to 224 (with higher scores indicating better quality of life).
- the IBDQ has been frequently used in drug approval applications to assess treatment efficacy in IBD.
- the IBDQ was designed to be self-administered and completed in 5 minutes.
- the primary endpoint of the study was CDAI response at Week 8, defined by either a CDAI score of ⁇ 150 or a CDAI reduction from baseline of at least 100 points. Baseline was defined as the latest nonmissing observation prior to first administration of the investigational product.
- Missing data was imputed by nonresponder imputation approach; i.e., any subject with missing information on primary endpoint was assumed as nonresponder.
- subjects with a clinically meaningful increase in steroid use were assumed to be a nonresponder for the primary analysis perspective.
- a sensitivity analysis was performed by adjusting for baseline CDAI score and/or other baseline covariates by extending the model planned above for subjects in mITT population.
- a mixed effect longitudinal logistic regression model was implemented on the observed responses. This logistic random-effect model includes a random intercept to account for the variability between subjects. Fixed categorical effects include stratification factor, treatment, visit, and treatment-by-visit interaction, as well as the continuous fixed covariates of baseline score.
- a sensitivity analysis was performed by adjusting for baseline CDAI score and/or other baseline covariates by extending the model planned above for subjects in the PP Population.
- CDAI remission at Week 8 as defined by a CDAI score of ⁇ 150; 2) A reduction of at least 100 points from baseline in CDAI at Week 8;
- CDAI response (either remission defined by CDAI ⁇ 150 or a CDAI reduction from baseline of at least 100 points from baseline) at Week 12.
- Secondary endpoints 1, 2, 3, and 4 were analyzed in a similar way to the primary endpoint.
- a sensitivity analysis was performed by carrying forward the last response on or before the Week 8 visit to Week 12 for subjects who had increased steroid (defined as 5 mg/day prednisolone, or equivalent, or 3 mg/day budesonide).
- AEs including SAEs, significant changes in laboratory values and vital signs. All safety-related endpoints for the 12-week, double-blind, placebo-controlled, treatment period were reported based on safety population using the actual treatment received. Subjects randomized to placebo with at least one dose of MEDI2070 were included in the active arm; also the subjects randomized to the MEDI2070 arm without any active dose were included in the placebo arm.
- the Medical Dictionary for Regulatory Activities (MedDRA) was used to code all AEs.
- Treatment-emergent AEs were defined as any AE with onset on or after the administration of the first dose of investigational product up to and including 36 weeks post-last dose.
- IM immunogenicity
- the phase 2a study (clinicaltrials.gov identifier: NCT01714726) described in Example 1 included a 12-week, double-blind, placebo-controlled treatment period followed by a 100-week open-label treatment period to evaluate short-term efficacy and short- and long-term safety of MEDI2070 in patients with active moderate to severe Crohn's disease who failed prior anti-TNF-a therapy. Conducted at 60 centers worldwide, the study included adults aged 18 to 65 years diagnosed with ileal, ileo-colonic, or colonic Crohn' s disease for at least 6 months.
- Patients must have received at least one anti-TNF- ⁇ therapy at approved doses for Crohn's disease, with primary nonresponse (signs and symptoms of active disease, despite at least 1 induction regimen, including at least 2 doses of anti-TNF- ⁇ therapy at least 2 weeks apart) or secondary nonresponse (recurrence of symptoms of persistently active disease during maintenance anti-TNF- ⁇ therapy following initial clinical benefit) or intolerance (including but not limited to infusion-related reaction, demyelination, congestive heart failure, or infection).
- primary nonresponse signals and symptoms of active disease, despite at least 1 induction regimen, including at least 2 doses of anti-TNF- ⁇ therapy at least 2 weeks apart
- secondary nonresponse recurrence of symptoms of persistently active disease during maintenance anti-TNF- ⁇ therapy following initial clinical benefit
- intolerance including but not limited to infusion-related reaction, demyelination, congestive heart failure, or infection.
- Exclusion criteria included having an allogeneic bone marrow transplant or cell- based transplantation; short-bowel syndrome; obstructive stricture within 3 months of study; bowel surgery within 12 weeks of study; ileostomy or colostomy; a clinically significant concomitant disease; or prior treatment with a biologic agent targeting IL12 or IL23.
- washout of other prior therapies was required, including infliximab for 8 weeks before study, adalimumab or certolizumab for 10 weeks, natalizumab for 12 weeks; cyclosporine, mycophenolate mofetil, sirolimus, thalidomide, or tacrolimus for 4 weeks; intravenous or intramuscular corticosteroids for 2 weeks; or topical mesalamine or rectal corticosteroids for 2 weeks.
- Concomitant use of 5-aminosalicylates and glucocorticosteroids was permitted if doses were stable for at least 2 weeks before randomization and remained stable through week 8.
- concomitant use of immunomodulators e.g. , azathioprine, was permitted if the dose remained stable from 8 weeks before randomization through week 8.
- Use of oral antibiotics for Crohn's disease, probiotics, and antidiarrheals was allowed.
- the primary outcome measure was the proportion of patients achieving clinical effect, defined as at least a 100-point CDAI score reduction from baseline or CDAI score less than 150 at week 8.
- Secondary measures included the proportion of patients achieving CDAI remission (defined as CDAI score ⁇ 150) at week 8, at least a 100-point CDAI score reduction (CR100) from baseline at week 8, at least a 70-point CDAI score reduction (CR70) from baseline at week 8, clinical effect at week 12, CDAI remission at week 12, and the safety and tolerability of MEDI2070, including adverse events, serious adverse events, and significant changes in laboratory values and vital signs. Serum MEDI2070 concentrations and the presence of ADAs were evaluated at baseline, week 8, week 24, and end of study.
- Exploratory outcome measures included inflammatory markers in the blood and stool (CRP and FCP), responses of other biomarkers and their predictive value for clinical effects, sustained clinical effect between weeks 8 and 24, and sustained CDAI remission assessed at weeks 8 and 24.
- Biomarker assessments included changes in IL22 serum levels (expressed in high levels in Crohn's disease patients and a marker of disease activity [Schmechel et ah, Inflamm Bowel Dis, 14 -.204-212 (2008)]) from baseline after treatment with MEDI2070 versus placebo at weeks 8 and 12; association of change from baseline in IL22 levels with clinical effect and CDAI remission after treatment with MEDI2070 versus placebo at weeks 8 and 12; and assessment of higher IL22 serum levels at baseline as a predictor of clinical effect and CDAI remission after treatment with MEDI2070 compared with placebo at weeks 8 and 12.
- the modified intent-to-treat population included all randomized patients who received at least one dose of study treatment during the double-blind period.
- the safety population comprised patients who received any study treatment during the double-blind period.
- the per-protocol population included patients who received all treatment doses and had no major protocol deviations.
- the open-label population included all patients who received at least 1 dose of MEDI2070 during the open-label period.
- Clinically meaningful increase in steroid dose was defined as an increase of at least 5 mg/day for at least 3 days of prednisone or equivalent, or an increase of at least 3 mg/day for at least 3 days of budesonide. Missing data for continuous measures were handled using the inverse probability weighting generalized estimating equations method, adjusting for prior anti-TNF- ⁇ agent use.
- FCP least squares mean change -179.6 vs -55.1
- least squares mean difference -124.6 [90% CI: -221.2 to -27.9]
- P 0.034
- CRP least squares mean change: -13.4 vs -2.6 with placebo
- least squares mean difference -10.8 [90% CI: -17.6 to -4.1]; P 0.008).
- the proportion of patients in the placebo/MEDI2070 group achieving both composite end points at week 24 was similar to those in the MEDI2070/MEDI2070 group.
- changes from baseline in FCP and CRP levels were maintained between weeks 12 and 24; in the placebo/MEDI2070 group, decreases in FCP and CRP levels were observed between weeks 12 and 24.
- Sustained effect is defined as achieving the criteria of effect at both week 8 and week 24. Percentage calculated using number of patients in the open-label population.
- Sustained remission is defined as achieving the criteria of remission at both week 8 and week 24. Percentage calculated using the number of patients in the open-label population.
- treatment-emergent adverse events were observed in 67.3% of patients in the MEDI2070 group and 65.4% of those in the placebo/MEDI2070 group, with treatment- related adverse events observed in 25.0% and 21.2% of patients, respectively.
- Treatment- emergent adverse events of at least grade 3 severity occurred in 13.5% of patients in the MEDI2070 group and 3.8% of patients in the placebo/MEDI2070 group; serious adverse events were observed in 15.4% and 7.7% of patients, respectively.
- Antidrug antibodies were detected in two of 119 patients.
- One patient receiving MEDI2070 had antidrug antibodies at baseline, but not in subsequent assessments.
- MEDI2070 was well tolerated, with rates of treatment-emergent adverse events, grade 3 or greater adverse events, serious adverse events, and discontinuations owing to treatment- emergent adverse events similar to those of placebo at 12 weeks. Rates of serious or severe infections were less than 10% in the MEDI2070 group at week 12. At week 24, overall rates of treatment-emergent adverse events were similar between the MEDI2070 and placebo/MEDI2070 groups; rates of grade 3 or greater adverse events and serious adverse events were numerically greater in the MEDI2070 group versus the placebo/MEDI2070 group (13.5% vs. 3.8% and 15.4% vs. 7.7%, respectively), as were rates of discontinuations attributable to treatment-emergent adverse events (9.6% vs.
- the safety profile of MED 12070 also compares favorably with other biologies available for patients with Crohn's disease.
- IL22 expressed at high levels in Crohn's disease, is an effector cytokine that supports mucosal barrier integrity and is an indicator of IL23 axis activity [Schmechel et al., Inflamm Bowel Dis,14:204-212 (2008)]. Serum IL22 levels were reduced in the MEDI2070 group compared with the placebo group. Additionally, baseline serum IL22 levels greater than or equal to 15.6 pg/mL were associated with an increased likelihood of clinical effect in the MEDI2070 group, whereas MEDI2070-treated patients with baseline IL22 levels less than 15.6 pg/mL had CR100 responses similar to those in the placebo group. FIG. 5.
- MEDI2070 treatment demonstrated consistently robust efficacy, with an acceptable safety profile in patients with Crohn's disease who failed prior anti-TNF-a therapies.
- CCL20 can be detected and quantified according to the exemplary method disclosed in this Example (Example 3). This method was applied, for example, to obtain the CCL20- related experimental data presented in Example 5 (see below). The method was also used to test samples for the phase 2a study presented in Examples 1 and 2.
- CCL20 (MIP3 alpha) was measured using a quantitative ELISA based immunoassay.
- a Human CCL20/MIP-3a Quantikine Elisa kit from R&D Systems (Cat# DM3A00) was used.
- the kit included a 96 well plate pre-coated with capture antibody and pre-blocked (Part# 890831) ready for the application of ⁇ per well, of either Reference standards (RS), quality controls (QC), negative control (NC), or serum test samples diluted to the Minimum Required Dilution (MRD) of 1:4 using the provided RD6U calibrator diluent (Part# 895148).
- RS Reference standards
- QC quality controls
- NC negative control
- MRD6U calibrator diluent Part# 895148
- the assay plate was incubated for 2 hours + 0.5 hours at room temperature (RT) on a plate shaker with gentle shaking and unbound analyte was removed by washing the plate 4 times with Medimmune Elisa-wash buffer (IX PBS pH 7.4 / 0.05% Tween-20).
- Medimmune Elisa-wash buffer IX PBS pH 7.4 / 0.05% Tween-20.
- 200 ⁇ 1 of anti-MIP-3 alpha conjugate Part# 890832 was added to each well and the plate was incubated for an additional 2 hours + 0.5 hours at room temperature (RT) on a plate shaker with gentle shaking. Unbound detection conjugate was removed by washing the plate 4 times with the Wash buffer (IX PBS pH 7.4 / 0.05% Tween-20).
- IL22 and/or LCN2 can be detected and quantified according to the exemplary methods disclosed in this Example (Example 4). These methods were applied, for example, to obtain the experimental data presented in Example 5 (see below). The methods were also used to test samples for the phase 2a study presented in Examples 1 and 2.
- IL22 levels were measured using a quantitative ELISA-based immunoassay.
- a mouse monoclonal antibody specific for human IL-22 was pre-coated onto a microplate (R&D Systems, Cat #D2200).
- One hundred microliters of assay diluent were first added to wells of microplates followed by addition of 100 of standards, controls and samples. The plates were incubated for 2 hours + 15 minutes at room temperature to allow IL22 to bind to the capture antibody on the plates.
- IX Wash buffer IX PBS pH 7.4 / 0.05% Tween-20
- the detection antibody anti-IL22 antibody-HRP conjugate, (R&D Systems, Cat #D2200) for 2 hours + 15 minutes at room temperature.
- the plates were washed again and incubated with 150 of TMB, a chromogenic HRP substrate (Neogen, Cat # 331176) for 20 minutes + 3 minutes at room temperature in the dark.
- the enzyme reaction was stopped by the addition of 100 of stop solution (1M HCL).
- a standard Meso Scale Discovery plate (MSD, Cat# L15XA) was coated with 1 ⁇ g/mL of a rat- anti-human Lipocalin-2 antibody (R&D Systems, Cat# MAB 17571), at 50 ⁇ at 2°C - 8°C overnight.
- the plate was washed three times with 200 iL ELISA Wash Buffer (0.05% Tween-20/PBS) and blocked with 150 ⁇ of I-Block buffer (IBB) (0.5% Tween-20/0.2% I-Block Buffer/PBS) for at least 60 minutes on a plate shaker with gentle shaking.
- IBB I-Block buffer
- the assay plate was incubated for 2 hours at room temperature on a plate shaker with gentle shaking. Unbound analyte was removed by washing the plate.
- a biotin-conjugated goat-anti-human Lipocalin-2 antibody (R&D Systems, Cat# BAF1757) was added at 30 ⁇ / ⁇ and the plate was incubated for an additional 60 minutes on a plate shaker with gentle shaking. Unbound detection antibody was removed by washing the plate.
- Streptavidin SULFO-TAGTM detection dye (MSD, Cat# R32AD- 1) was added to the plate at 0.5 ⁇ g/well and the plate was incubated for an additional 30 minutes covered to protect from light exposure.
- the plate was washed and IX Read Buffer (MSD, Cat# R92TC-2) was added at 150 ⁇ and the plate was read on a MSD Sector Imager within 20 minutes.
- ECL (electrochemiluminescence) values for each plate were collected using the MSD Sector Imager.
- the ECL values for the reference standards were plotted with Softmax Pro GxP v6.4 software (Molecular Devices, Sunnyvale, CA) using 5-Parameter Logistic model of curve fitting.
- the concentrations of unknown samples were interpolated from the standard curves on the same assay plate.
- the Softmax-derived data was then imported into Microsoft Excel Software to generate data reports and graphs.
- the assay's dynamic range was established to be from 0.70 ng/ml to 1000.00 ng/niL adjusted to 100% serum.
- IL23 is expressed primarily from activated dendritic cells and macrophages (see Gaffen et al (2014) Nature Revs Immunol 14: 585-600; Oppmann et al (2000) Immunity 13: 715-251) and acts directly on a variety of hematopoetic cell types including Thl7, Th22, ⁇ T cells and innate lymphoid cells (ILCs) to induce cytokines including IL22, IL21, IL17A, IL17F, IL17A/F, TNF alpha and GM-CSF (see, e.g., Gaffen et al (2014) Nature Revs Immunol 14: 585-600; Zheng et al (2007) Nature 445: 648-51; El-Behi et al (2011) Nature Immunol 12: 568-575).
- IL23 -induced IL22 can stimulate IL22-receptor expressing epithelial cells and keratinocytes to secrete antimicrobial proteins such as LCN2 (Sonnenberg et al (2010) Adv Immunol 107: 1-29; Stallhofer et al (2015) Inflamm Bowel Dis 2015 Aug 7; Behnsen et al (2014) Immunity 40: 262-73).
- the CDAI response rate at week 8 (as measured by the percentage (%) of subjects achieving a CDAI score ⁇ 150 or a reduction in CDAI score of >100) in those subjects exposed to MEDI2070 and with baseline CCL20 levels ⁇ 20.8 pg/mL, i.e., below the 4 th decile, was 51.6%. 16 subjects exposed to MEDI2070 and with baseline CCL20 levels below the 4 th decile for the study population (20.8 pg/mL) were found to be CDAI responders at week 8.
- the numbers of CDAI responder and non-responders in the MEDI2070 and placebo exposed groups, and the CDAI response rates at week 8 of the study in subjects with baseline IL22, LCN2, or CCL20 values greater than or equal to each decile cut are also indicated in TABLES 4-6, and differences between treatment and placebo response rates for each decile cut is provided in FIG. 7.
- Two additional measurements of clinical response - the difference between the percentage (%) of subjects treated with MEDI2070 versus those treated with placebo achieving a 100 point improvement in CDAI score at week 8 (FIG.
- CDAI score ⁇ 150 or a reduction in CDAI score of >100 also achieving a >50% reduction in either FCP or CRP compared to baseline FCP or CRP at week 8 (FIG. 9) - as a function of baseline IL22, LCN2, and CCL20 levels/deciles described in TABLES 4-6 were also performed.
- FIGs. 7-9 and reported in TABLE 4 below CD patients treated with MEDI2070 having increasingly higher levels of baseline IL22 achieved higher CDAI response rates at week 8 compared to placebo (as measured using any of the three different clinical response measurements shown in FIGs.
- CDAI response rates and CDAI remission rates observed in IL22 high subjects treated with MEDI2070 in the Phase 2a study are amongst the highest clinical response rates to biologies therapy for CD reported to date. For example, as shown in FIG.
- the CDAI-100 response rate differential (defined as the difference in the percentage (%) of subjects achieving a CDAI- 100 response between treatment and placebo) and/or CDAI remission rate differential (defined as the difference in the percentage (%) of subjects achieving a reduction in total CDAI score to below 150 points between treatment and placebo) achieved in patients having elevated baseline serum IL22 treated with MEDI2070 for 8 weeks were highly increased compared to the published CDAI- 100 response and/or CDAI remission rates of patients treated with a number of other compounds currently approved or under development to treat CD including: Ustekinumab (response rates after 6 weeks or 8 weeks of treatment with a 6 mg/kg dose as reported in Figure 1 of Sandborn et al., N Engl J Med.
- Placebo achieved in patients treated with MEDI2070 for 8 weeks who had a baseline CRP > 5mg/L; baseline IL-22 > 11.3pg/mL; baseline IL-22 > 15.6 pg/mL; or baseline IL-22 > 11.3 pg/mL + CRP > 5mg/L (as measured using the IL22 immunoassay described in Example 3) were greater than the reported CDAI-100 response rate differential and/or the CDAI remission rate differential for Ustekinumab, Vedolizumab and Adalimumab reported in FIG. 10.
- FIGS. 7, 8, and 9 and TABLE 6 also show that CD patients treated with MEDI2070 having increasingly lower levels of baseline CCL20 achieved higher clinical response rates (as measured using any of the three different clinical response measurements shown in FIGs. 7, 8 and 9) at week 8 compared to placebo, supporting that MEDI2070 induced better clinical responses in patients with low baseline CCL20 serum levels.
- CCL20 low subjects including, e.g., subjects with CCL20 levels at the 1 st , 2 nd , 3 rd , or 4 th deciles (0.1, 0.2, 0.3 or 0.4 quantiles)
- CCL20 high subjects including, e.g. subjects with CCL20 levels at the 7 th or 8 th deciles (0.7 or 0.8 quantiles)
- high IL22 serum levels and/or high LCN2 serum levels and/or low CCL20 including, e.g., the median baseline IL22 and/or LCN2 serum levels identified in the study and/or serum IL22 levels between 7.9 pg/mL and 31.4 pg/mL and/or serum LCN2 levels between 142.8 ng/mL and 261.1 ng/mL and/or serum CCL20 levels between 4.9 pg/mL and 22.6 pg/mL
- an IL23 antagonist including, e.g., an anti-IL23 antibody or fragment thereof such as MED 12070.
- CDAI- 100 response rate differential (defined as the difference in the percentage (%) of subjects achieving a CDAI-100 response between treatment and placebo) and CDAI remission rate differential (defined as the difference in the percentage (%) of subjects achieving a total CDAI score of below 150 points between treatment and placebo) for various subgroups.
- IL23-induced IL22 induces cells to secrete LCN2.
- baseline serum levels of two separate IL23 pathway members i.e. elevated IL22 or LCN2
- MEDI2070 e.g. CDAI- 100 Response Rate at week 8
- other IL23 pathway biomarkers may also predict an increased likelihood of clinical effect in response to treatment with MEDI2070.
- serum baseline levels of IL22 and/or LCN2 or any other IL23 pathway analyte including, e.g.
- IL23 axis activity a patient determined to have increased IL23 pathway activity (as determined by measuring one or more IL23 pathway biomarkers) may be more likely to benefit from treatment with an IL23 antagonist (including, e.g., an anti-IL23 antibody or an antigen-binding fragment thereof such as MED 12070).
- an IL23 antagonist including, e.g., an anti-IL23 antibody or an antigen-binding fragment thereof such as MED 12070).
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Molecular Biology (AREA)
- Engineering & Computer Science (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biomedical Technology (AREA)
- Hematology (AREA)
- Urology & Nephrology (AREA)
- Biochemistry (AREA)
- Cell Biology (AREA)
- Microbiology (AREA)
- Pathology (AREA)
- Physics & Mathematics (AREA)
- General Physics & Mathematics (AREA)
- Food Science & Technology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Analytical Chemistry (AREA)
- Biotechnology (AREA)
- Veterinary Medicine (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Epidemiology (AREA)
- Endocrinology (AREA)
- Mycology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Investigating Or Analysing Biological Materials (AREA)
Priority Applications (13)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| RU2018124603A RU2018124603A (ru) | 2015-12-22 | 2016-12-16 | Ccl20 как прогностический фактор клинического ответа на антагонисты ил-23 |
| BR112018012626A BR112018012626A2 (pt) | 2015-12-22 | 2016-12-16 | ccl20 como um preditor de resposta clínica a antagonistas de il23 |
| AU2016379157A AU2016379157A1 (en) | 2015-12-22 | 2016-12-16 | CCL20 as a predictor of clinical response to IL23-antagonists |
| EP16879907.0A EP3393515A4 (en) | 2015-12-22 | 2016-12-16 | CCL20 AS A PREDICTOR OF THE CLINICAL RESPONSE TO IL23 ANTAGONISTS |
| MX2018007589A MX2018007589A (es) | 2015-12-22 | 2016-12-16 | Ccl20 como indicador de respuesta clinica a antagonistas de il23. |
| US16/063,803 US11220541B2 (en) | 2015-12-22 | 2016-12-16 | CCL20 as a predictor of clinical response to IL23-antagonists |
| KR1020187017346A KR20180096633A (ko) | 2015-12-22 | 2016-12-16 | Il23-길항제에 대한 임상적 반응의 예측인자로서의 ccl20 |
| JP2018532465A JP2019508370A (ja) | 2015-12-22 | 2016-12-16 | Il23アンタゴニストに対する臨床応答の予測因子としてのccl20 |
| CA3007098A CA3007098A1 (en) | 2015-12-22 | 2016-12-16 | Ccl20 as a predictor of clinical response to il23-antagonists |
| CN201680075323.4A CN108472367A (zh) | 2015-12-22 | 2016-12-16 | 作为对il23拮抗剂的临床应答的预测因子的ccl20 |
| IL259704A IL259704A (en) | 2015-12-22 | 2018-05-30 | Chemokine 20 ligand as a predictor of clinical response to interleukin 23 antagonists |
| JP2021172872A JP2022031643A (ja) | 2015-12-22 | 2021-10-22 | Il23アンタゴニストに対する臨床応答の予測因子としてのccl20 |
| US17/536,663 US20220144935A1 (en) | 2015-12-22 | 2021-11-29 | Ccl20 as a predictor of clinical response to il23-antagonists |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201562271156P | 2015-12-22 | 2015-12-22 | |
| US62/271,156 | 2015-12-22 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/063,803 A-371-Of-International US11220541B2 (en) | 2015-12-22 | 2016-12-16 | CCL20 as a predictor of clinical response to IL23-antagonists |
| US17/536,663 Continuation US20220144935A1 (en) | 2015-12-22 | 2021-11-29 | Ccl20 as a predictor of clinical response to il23-antagonists |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2017112536A1 true WO2017112536A1 (en) | 2017-06-29 |
Family
ID=59091179
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2016/067120 Ceased WO2017112536A1 (en) | 2015-12-22 | 2016-12-16 | Ccl20 as a predictor of clinical response to il23-antagonists |
Country Status (12)
| Country | Link |
|---|---|
| US (2) | US11220541B2 (enExample) |
| EP (1) | EP3393515A4 (enExample) |
| JP (2) | JP2019508370A (enExample) |
| KR (1) | KR20180096633A (enExample) |
| CN (1) | CN108472367A (enExample) |
| AU (1) | AU2016379157A1 (enExample) |
| BR (1) | BR112018012626A2 (enExample) |
| CA (1) | CA3007098A1 (enExample) |
| IL (1) | IL259704A (enExample) |
| MX (1) | MX2018007589A (enExample) |
| RU (1) | RU2018124603A (enExample) |
| WO (1) | WO2017112536A1 (enExample) |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN108957014A (zh) * | 2018-09-27 | 2018-12-07 | 郑州大学第附属医院 | 结直肠癌血清标志物、表达评估方法、试剂盒及应用 |
| EP3946592A4 (en) * | 2019-03-26 | 2023-01-04 | Astrazeneca Collaboration Ventures, LLC | PATIENT POPULATIONS LIKELY TO BENEFIT FROM IL23 ANTAGONIST THERAPY |
| EP3883606B1 (en) | 2018-09-24 | 2023-07-12 | Janssen Biotech, Inc. | Safe and effective method of treating ulcerative colitis with anti-il12/il23 antibody |
| EP4240238A1 (en) | 2020-11-30 | 2023-09-13 | Mindera Corporation | Microneedle devices and methods, and skin condition assays |
Families Citing this family (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JO3244B1 (ar) | 2009-10-26 | 2018-03-08 | Amgen Inc | بروتينات ربط مستضادات il – 23 البشرية |
| CN108290058B (zh) | 2015-09-17 | 2023-05-16 | 美国安进公司 | 使用il23途径生物标志物预测il23拮抗剂的临床应答 |
| CN113092652B (zh) * | 2021-03-19 | 2022-09-30 | 浙江工商大学 | 一种用于评估个体过敏程度的试剂盒 |
| CN114113630B (zh) * | 2021-11-24 | 2023-07-28 | 中南大学湘雅医院 | Serpinb3/b4作为靶点在玫瑰痤疮等炎症性皮肤病治疗药物中的应用 |
Citations (36)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4833074A (en) | 1983-07-11 | 1989-05-23 | Ciba-Geigy Corporation | Purified human granylocyte L1 proteins methods for their preparation, monospecific antibodies and test kits |
| US5455160A (en) | 1993-05-27 | 1995-10-03 | Fagerhol; Magne K. | Diagnostic test and kit for disease or disorders in the digestive system |
| WO1999005280A1 (en) | 1997-07-25 | 1999-02-04 | Schering Corporation | Mammalian cytokine: interleukin-b30 and related reagents |
| US5892019A (en) | 1987-07-15 | 1999-04-06 | The United States Of America, As Represented By The Department Of Health And Human Services | Production of a single-gene-encoded immunoglobulin |
| US6171586B1 (en) | 1997-06-13 | 2001-01-09 | Genentech, Inc. | Antibody formulation |
| US6225072B1 (en) | 1996-11-01 | 2001-05-01 | Magne K. Fagerhol | Process for the extraction of proteins |
| US20050261191A1 (en) | 2004-05-06 | 2005-11-24 | Barasch Jonathan M | NGAL for reduction and amelioration of ischemic and nephrotoxic injuries |
| WO2006091035A1 (en) | 2005-02-28 | 2006-08-31 | Mogam Biotechnology Research Institute | A therapeutic agent comprising lipocalin 2 against cancer metastasis, and methods of early diagnosis and inhibition of cancer metastasis using lipocalin2 |
| WO2007027714A2 (en) | 2005-08-31 | 2007-03-08 | Schering Corporation | Engineered anti-il-23 antibodies |
| WO2007076524A2 (en) | 2005-12-29 | 2007-07-05 | Centocor, Inc. | Human anti-il-23 antibodies, compositions, methods and uses |
| WO2007147019A2 (en) | 2006-06-13 | 2007-12-21 | Zymogenetics, Inc. | Il-17 and il-23 antagonists and methods of using the same |
| WO2008103432A1 (en) | 2007-02-23 | 2008-08-28 | Schering Corporation | Engineered anti-il-23p19 antibodies |
| WO2008103473A1 (en) | 2007-02-23 | 2008-08-28 | Schering Corporation | Engineered anti-il-23p19 antibodies |
| US7491391B2 (en) | 2005-06-30 | 2009-02-17 | Centocor, Inc. | Anti-IL-23 antibodies, compositions, methods and uses |
| WO2009043933A1 (en) | 2007-10-05 | 2009-04-09 | Glaxo Group Limited | Il-23 antibodies |
| WO2009082624A2 (en) | 2007-12-10 | 2009-07-02 | Zymogenetics, Inc. | Antagonists of il-17a, il-17f, and il-23 and methods of using the same |
| US20090233304A1 (en) | 2008-03-14 | 2009-09-17 | Exagen Diagnostics, Inc. | Biomarkers for Inflammatory Bowel Disease and Irritable Bowel Syndrome |
| WO2010027766A1 (en) | 2008-08-27 | 2010-03-11 | Schering Corporation | Lyophilized formulatons of engineered anti-il-23p19 antibodies |
| WO2010062663A1 (en) | 2008-11-03 | 2010-06-03 | Schering Corporation | Inflammatory bowel disease biomarkers and related methods of treatment |
| US20100221752A2 (en) | 2008-10-06 | 2010-09-02 | Somalogic, Inc. | Ovarian Cancer Biomarkers and Uses Thereof |
| WO2010129964A1 (en) | 2009-05-08 | 2010-11-11 | The Board Of Trustees Of The University Of Illinois | Drug targets for prevention of arrhythmia in heart disease |
| US7872102B2 (en) | 2005-08-25 | 2011-01-18 | Eli Lilly And Company | Anti-IL-23 antibodies |
| WO2011056600A1 (en) | 2009-10-26 | 2011-05-12 | Amgen Inc. | Human il-23 antigen binding proteins |
| WO2011088120A1 (en) | 2010-01-15 | 2011-07-21 | Amgen Inc. | Antibody formulation and therapeutic regimens |
| WO2012009760A1 (en) | 2010-07-20 | 2012-01-26 | Cephalon Australia Pty Ltd | Anti-il-23 heterodimer specific antibodies |
| WO2012094651A2 (en) | 2011-01-06 | 2012-07-12 | The Board Of Trustees Of The University Of Illiois | Scn5a splice variants for use in methods relating to sudden cardiac death and need for implanted cadiac defibrillators |
| WO2012175616A1 (en) | 2011-06-21 | 2012-12-27 | Calpro As | Competitive s100a9 immunoassays |
| WO2012175602A2 (en) | 2011-06-21 | 2012-12-27 | Calpro As | Elisa for calprotectin |
| US20130005596A1 (en) | 2009-11-25 | 2013-01-03 | Nestec S.A. | Novel genomic biomarkers for irritable bowel syndrome diagnosis |
| WO2013132338A2 (en) | 2012-03-06 | 2013-09-12 | Calpro As | Competitive immunoassay for calprotectin |
| WO2013132347A2 (en) | 2012-03-06 | 2013-09-12 | Calpro As | Improved elisa immunoassay for calprotectin |
| US8541180B1 (en) | 2010-10-11 | 2013-09-24 | Genova Diagnostics, Inc. | Compositions and methods for assessing gastrointestinal health |
| US20130303398A1 (en) | 2008-10-09 | 2013-11-14 | Alfagene Bioscience, Inc. | Use and identification of biomarkers for gastrointestinal diseases |
| US20140141990A1 (en) | 2011-05-16 | 2014-05-22 | Nestec S.A. | Performance of a biomarker panel for irritable bowel syndrome |
| US20140199709A1 (en) | 2009-06-25 | 2014-07-17 | Nestec S.A. | Methods for diagnosing irritable bowel syndrome |
| US20150065530A1 (en) | 2012-04-03 | 2015-03-05 | The Regents Of The University Of Michigan | Biomarker associated with irritable bowel syndrome and crohn's disease |
Family Cites Families (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| RU2006135119A (ru) | 2004-03-05 | 2008-04-10 | Аркемикс Корп. (Us) | Аптамеры к семейству цитокинов il-12 человека и их применение в качестве лекарственных средств для аутоиммунных заболеваний |
| EP1954719A2 (en) | 2005-12-02 | 2008-08-13 | Genentech Inc. | Compositions and methods for the treatment of diseases and disorders associated with cytokine signaling involving antibodies that bind to il-22 and il-22r |
| WO2007098065A2 (en) | 2006-02-17 | 2007-08-30 | The United States Of America As Represented By The Department Of Veterans Affairs | Human sodium channel isoforms |
| EP2414393A1 (en) | 2009-04-01 | 2012-02-08 | Glaxo Group Limited | Anti-il-23 immunoglobulins |
| EP2435480A1 (en) | 2009-05-27 | 2012-04-04 | Ablynx N.V. | Biparatopic protein constructs directed against il-23 |
| WO2012061448A1 (en) | 2010-11-04 | 2012-05-10 | Boehringer Ingelheim International Gmbh | Anti-il-23 antibodies |
-
2016
- 2016-12-16 JP JP2018532465A patent/JP2019508370A/ja active Pending
- 2016-12-16 MX MX2018007589A patent/MX2018007589A/es unknown
- 2016-12-16 BR BR112018012626A patent/BR112018012626A2/pt not_active Application Discontinuation
- 2016-12-16 WO PCT/US2016/067120 patent/WO2017112536A1/en not_active Ceased
- 2016-12-16 US US16/063,803 patent/US11220541B2/en active Active
- 2016-12-16 EP EP16879907.0A patent/EP3393515A4/en not_active Withdrawn
- 2016-12-16 CA CA3007098A patent/CA3007098A1/en not_active Abandoned
- 2016-12-16 CN CN201680075323.4A patent/CN108472367A/zh active Pending
- 2016-12-16 RU RU2018124603A patent/RU2018124603A/ru not_active Application Discontinuation
- 2016-12-16 KR KR1020187017346A patent/KR20180096633A/ko not_active Withdrawn
- 2016-12-16 AU AU2016379157A patent/AU2016379157A1/en not_active Abandoned
-
2018
- 2018-05-30 IL IL259704A patent/IL259704A/en unknown
-
2021
- 2021-10-22 JP JP2021172872A patent/JP2022031643A/ja active Pending
- 2021-11-29 US US17/536,663 patent/US20220144935A1/en active Pending
Patent Citations (43)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4833074A (en) | 1983-07-11 | 1989-05-23 | Ciba-Geigy Corporation | Purified human granylocyte L1 proteins methods for their preparation, monospecific antibodies and test kits |
| US5892019A (en) | 1987-07-15 | 1999-04-06 | The United States Of America, As Represented By The Department Of Health And Human Services | Production of a single-gene-encoded immunoglobulin |
| US5455160A (en) | 1993-05-27 | 1995-10-03 | Fagerhol; Magne K. | Diagnostic test and kit for disease or disorders in the digestive system |
| US6225072B1 (en) | 1996-11-01 | 2001-05-01 | Magne K. Fagerhol | Process for the extraction of proteins |
| US6171586B1 (en) | 1997-06-13 | 2001-01-09 | Genentech, Inc. | Antibody formulation |
| WO1999005280A1 (en) | 1997-07-25 | 1999-02-04 | Schering Corporation | Mammalian cytokine: interleukin-b30 and related reagents |
| US20050261191A1 (en) | 2004-05-06 | 2005-11-24 | Barasch Jonathan M | NGAL for reduction and amelioration of ischemic and nephrotoxic injuries |
| WO2006091035A1 (en) | 2005-02-28 | 2006-08-31 | Mogam Biotechnology Research Institute | A therapeutic agent comprising lipocalin 2 against cancer metastasis, and methods of early diagnosis and inhibition of cancer metastasis using lipocalin2 |
| US7807414B2 (en) | 2005-06-30 | 2010-10-05 | Centocor Ortho Biotech Inc. | Anti-IL-23 antibodies, compositions, methods and uses |
| US7491391B2 (en) | 2005-06-30 | 2009-02-17 | Centocor, Inc. | Anti-IL-23 antibodies, compositions, methods and uses |
| US7872102B2 (en) | 2005-08-25 | 2011-01-18 | Eli Lilly And Company | Anti-IL-23 antibodies |
| US8362212B2 (en) | 2005-08-31 | 2013-01-29 | Merck Sharp & Dohme Corp. | Engineered anti-IL-23 antibodies |
| WO2007027714A2 (en) | 2005-08-31 | 2007-03-08 | Schering Corporation | Engineered anti-il-23 antibodies |
| US7807160B2 (en) | 2005-08-31 | 2010-10-05 | Schering Corporation | Engineered anti-IL-23 antibodies |
| US7935344B2 (en) | 2005-12-29 | 2011-05-03 | Centocor Ortho Biotech Inc. | Human anti-IL-23 antibodies, compositions, methods and uses |
| WO2007076524A2 (en) | 2005-12-29 | 2007-07-05 | Centocor, Inc. | Human anti-il-23 antibodies, compositions, methods and uses |
| US7790862B2 (en) | 2006-06-13 | 2010-09-07 | Zymogenetics, Inc. | IL-17 and IL-23 antagonists and methods of using the same |
| WO2007147019A2 (en) | 2006-06-13 | 2007-12-21 | Zymogenetics, Inc. | Il-17 and il-23 antagonists and methods of using the same |
| WO2008103432A1 (en) | 2007-02-23 | 2008-08-28 | Schering Corporation | Engineered anti-il-23p19 antibodies |
| WO2008103473A1 (en) | 2007-02-23 | 2008-08-28 | Schering Corporation | Engineered anti-il-23p19 antibodies |
| WO2009043933A1 (en) | 2007-10-05 | 2009-04-09 | Glaxo Group Limited | Il-23 antibodies |
| WO2009082624A2 (en) | 2007-12-10 | 2009-07-02 | Zymogenetics, Inc. | Antagonists of il-17a, il-17f, and il-23 and methods of using the same |
| US20090233304A1 (en) | 2008-03-14 | 2009-09-17 | Exagen Diagnostics, Inc. | Biomarkers for Inflammatory Bowel Disease and Irritable Bowel Syndrome |
| WO2010027766A1 (en) | 2008-08-27 | 2010-03-11 | Schering Corporation | Lyophilized formulatons of engineered anti-il-23p19 antibodies |
| US20100221752A2 (en) | 2008-10-06 | 2010-09-02 | Somalogic, Inc. | Ovarian Cancer Biomarkers and Uses Thereof |
| US20130303398A1 (en) | 2008-10-09 | 2013-11-14 | Alfagene Bioscience, Inc. | Use and identification of biomarkers for gastrointestinal diseases |
| WO2010062663A1 (en) | 2008-11-03 | 2010-06-03 | Schering Corporation | Inflammatory bowel disease biomarkers and related methods of treatment |
| US20110212104A1 (en) | 2008-11-03 | 2011-09-01 | Schering Corporation | Inflammatory bowel disease biomarkers and related methods of treatment |
| WO2010129964A1 (en) | 2009-05-08 | 2010-11-11 | The Board Of Trustees Of The University Of Illinois | Drug targets for prevention of arrhythmia in heart disease |
| US20140199709A1 (en) | 2009-06-25 | 2014-07-17 | Nestec S.A. | Methods for diagnosing irritable bowel syndrome |
| WO2011056600A1 (en) | 2009-10-26 | 2011-05-12 | Amgen Inc. | Human il-23 antigen binding proteins |
| US8722033B2 (en) | 2009-10-26 | 2014-05-13 | Amgen Inc. | Human IL-23 antigen binding proteins |
| US20130005596A1 (en) | 2009-11-25 | 2013-01-03 | Nestec S.A. | Novel genomic biomarkers for irritable bowel syndrome diagnosis |
| WO2011088120A1 (en) | 2010-01-15 | 2011-07-21 | Amgen Inc. | Antibody formulation and therapeutic regimens |
| WO2012009760A1 (en) | 2010-07-20 | 2012-01-26 | Cephalon Australia Pty Ltd | Anti-il-23 heterodimer specific antibodies |
| US8541180B1 (en) | 2010-10-11 | 2013-09-24 | Genova Diagnostics, Inc. | Compositions and methods for assessing gastrointestinal health |
| WO2012094651A2 (en) | 2011-01-06 | 2012-07-12 | The Board Of Trustees Of The University Of Illiois | Scn5a splice variants for use in methods relating to sudden cardiac death and need for implanted cadiac defibrillators |
| US20140141990A1 (en) | 2011-05-16 | 2014-05-22 | Nestec S.A. | Performance of a biomarker panel for irritable bowel syndrome |
| WO2012175602A2 (en) | 2011-06-21 | 2012-12-27 | Calpro As | Elisa for calprotectin |
| WO2012175616A1 (en) | 2011-06-21 | 2012-12-27 | Calpro As | Competitive s100a9 immunoassays |
| WO2013132338A2 (en) | 2012-03-06 | 2013-09-12 | Calpro As | Competitive immunoassay for calprotectin |
| WO2013132347A2 (en) | 2012-03-06 | 2013-09-12 | Calpro As | Improved elisa immunoassay for calprotectin |
| US20150065530A1 (en) | 2012-04-03 | 2015-03-05 | The Regents Of The University Of Michigan | Biomarker associated with irritable bowel syndrome and crohn's disease |
Non-Patent Citations (105)
| Title |
|---|
| "Antibodies in Cell Biology", vol. 37, 1993, ACADEMIC PRESS, INC., article "Methods in Cell Biology" |
| "Basic and Clinical Immunology", 1991 |
| "Concise Dictionary of Biomedicine and Molecular Biology", PEI-SHOW, 2002 |
| "NCBI Reference Sequence", Database accession no. NM 002965.3 |
| "Remington's Pharmaceutical Sciences including", 2005, MACK PUBLISHING COMPANY |
| "The Dictionary of Cell and Molecular Biology", 1999, CRC PRESS |
| AHEM ET AL., IMMUN REV., vol. 226, 2008, pages 147 - 59 |
| AKERSTROM ET AL., BIOCHIM BIOPHYS ACTA, vol. 1482, 2000, pages 1 - 8 |
| AMBROSINI ET AL., J. NEUROPATHOL. EXP. NEUROL., vol. 64, 2005, pages 706 - 15 |
| ANGRIMAN ET AL., CLINICA CHIMICA ACTA, vol. 381, 2007, pages 63 |
| BEHNSEN ET AL., IMMUNITY, vol. 40, 2014, pages 262 - 73 |
| BEST ET AL., GASTROENTEROLOGY, vol. 70, 1976, pages 439 - 44 |
| BONIFACE ET AL., J. IMMUNOL., vol. 174, 2005, pages 3695 |
| BRAND ET AL., J. BIOL. CHEM., vol. 290, 2015, pages 14717 - 28 |
| BUNDGAARD ET AL., BIOCHEM. BIOPHYS. RES. COMM., vol. 202, 1994, pages 1468 |
| BURTON ET AL., NATURE, vol. 445, 2007, pages 1329 - 51 |
| CARGILL ET AL., AM J OF HUMAN GEN., vol. 80, 2007, pages 273 - 90 |
| CARGILL ET AL., AM. J. HUM. GEN., vol. 80, 2007, pages 273 - 90 |
| CORBIN ET AL., SCIENCE, vol. 319, 2008, pages 962 |
| CUA ET AL., NATURE, vol. 421, 2003, pages 744 - 48 |
| DEUTSCHER: "Guide to Polypeptide Purification", vol. 182, 1990, ACADEMIC PRESS, INC., article "Methods in Enzymology" |
| DOHLMAN ET AL., INVEST. OPHTHALMOL. VIS. SCI., vol. 54, 2013, pages 4081 - 91 |
| DONG, NAT. REV. IMMUNOL., vol. 6, no. 4, 2006, pages 329 - 333 |
| DUER ET AL., SCIENCE, vol. 314, 2006, pages 1461 - 63 |
| EL-BEHI ET AL., NATURE IMMUNOL, vol. 12, 2011 |
| EL-BEHI, NATURE IMMUNOL., vol. 12, 2011, pages 568 - 75 |
| FARAGO ET AL., ANN. RHEUM. DIS., vol. 67, 2008, pages 248 - 50 |
| FLOWER, BIOCHEM J., vol. 318, 1996, pages 1 - 14 |
| FRICK ET AL., SCAND. J. IMMUNOL., vol. 78, 2013, pages 298 - 305 |
| GAFFE ET AL., NATURE REVS. IMMUNOL., vol. 14, 2014, pages 585 - 600 |
| GAFFEN ET AL., NATURE REVIEWS IMMUNOLOGY, vol. 14, 2014, pages 585 - 600 |
| GAFFEN ET AL., NATURE REVS IMMUNOL, vol. 14, 2014, pages 585 - 600 |
| GE ET AL., DRUG INF J, vol. 45, 2011, pages 481 - 493 |
| GORDON ET AL., INVEST. DERMATOL., vol. 132, 2012, pages 304 - 314 |
| GOTTLIEB ET AL., BR. J. DERMATOL., vol. 165, 2011, pages 652 - 660 |
| GUTTMAN-YASSKY ET AL., J IMMUNOL., vol. 181, no. 10, 2008, pages 7420 - 7427 |
| GUYATT ET AL., GASTROENTEROLOGY, vol. 96, 1989, pages 804 - 10 |
| HAIDER ET AL., J. IMMUNOL., vol. 180, 2008, pages 1913 - 1920 |
| HARLOW ET AL.: "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY PRESS |
| HASAN ET AL., J. IMMUNOL., vol. 176, 2006, pages 6512 - 22 |
| HASHIMOTO ET AL., ONCOLOGY LETTERS, vol. 6, 2013, pages 1271 - 1276 |
| HOMEY ET AL., J. IMMUNOL., vol. 164, 2000, pages 6621 - 32 |
| HOSOKAWA ET AL., CLIN. EXPER. IMMUNOL., vol. 142, 2005, pages 285 - 91 |
| ILLES ET AL., NEURO LETTERS., vol. 431, 2008, pages 36 - 38 |
| KASER ET AL.: "Increased expression of CCL20 in human inflammatory bowel disease.", J CLIN IMMUNOL., vol. 24, no. 1, 2004, pages 74 - 85, XP 002559789 * |
| KESHET ET AL., AM. J. MED. SCL, vol. 337, 2009, pages 248 |
| KIMBALL ET AL., BR J DERMATOL., vol. 167, no. 1, 2012, pages 64 |
| KJELDSEN ET AL., J. BIOL. CHEM., vol. 268, 1993, pages 10425 - 10432 |
| KRUEGER ET AL., J. ALLERGY CLIN IMMUNOL., vol. 136, 2015, pages 116 - 124 |
| LABAERE ET AL., UNITED EUROPEAN GASTROENTEROLOGY JOURNAL, vol. 2, 2014, pages 30 - 37 |
| LANGHORST ET AL., AM. J. GASTROENTEROL., vol. 103, 2008, pages 162 |
| LANGLEY ET AL., J AM ACAD DERMATOL., vol. 66, 2012, pages AB195 |
| LEACH ET AL., SCAND. J. GASTROENTEROL., vol. 42, 2007, pages 1321 |
| LEE ET AL., INFLAMMATORY BOWEL DISEASES, vol. 11, 2005, pages 1070 - 79 |
| LEE ET AL., J EXP MED, vol. 199, 2004, pages 125 - 30 |
| LEONARDI ET AL., LANCET., vol. 371, no. 9625, 2008, pages 1675 - 84 |
| LI ET AL., BRAIN., vol. 130, no. 2, 2007, pages 490 - 501 |
| LIN ET AL., INFECT. IMMUN., vol. 71, 2003, pages 365 - 73 |
| LISIGNOLI ET AL., J. CELL. PHYSIOL., vol. 210, 2007, pages 798 - 806 |
| LUGERING ET AL., DIGESTION, vol. 56, 1995, pages 406 |
| MANNON ET AL., N ENG J OF MED., vol. 351, no. 20, 2004, pages 2069 - 79 |
| MARAFINI ET AL.: "CCL20 Is Negatively Regulated by TGF-Beta1 in Intestinal Epithelial Cells and Reduced in Crohn's Disease Patients With a Successful Response to Mongersen, a Smad7 Antisense Oligonucleotide.", J CROHNS COLITIS., 25 October 2016 (2016-10-25), XP055556929 * |
| MCGOVERN ET AL.: "The IL 23 axis plays a key role in the pathogenesis of IBD.", GUT., vol. 56, no. 10, 2007, pages 1333 - 1336, XP 055397315 * |
| MELIS ET AL., ANN. RHEUM. DIS., vol. 69, 2010, pages 618 - 23 |
| MRABET ET AL., RHEUMATOLOGY INTERNATIONAL, vol. 33, 2013, pages 265 - 66 |
| MSVAKNIN ET AL., J OF IMMUNOL., vol. 176, no. 7768, 2006, pages 74 |
| NAKAE ET AL., J. LEUKOCYTE BIOL, vol. 81, 2007, pages 1258 - 1268 |
| NAKAE ET AL., J. LEUKOCYTE BIOL., vol. 81, 2007, pages 1258 - 1268 |
| NAKAYAMA ET AL., INT. IMMUNOL., vol. 13, 2001, pages 95 - 103 |
| OPPMANN ET AL., IMMUNITY, vol. 13, 2000, pages 715 - 251 |
| R. SCOPES: "Polypeptide Purification", 1982, SPRINGER-VERLAG |
| REICH ET AL., N ENGL J MED., vol. 365, 2011, pages 1586 - 1596 |
| RUBIE ET AL., TUMOUR BIOL., vol. 27, 2006, pages 166 - 74 |
| RUTGEERTS ET AL., ALIMENT PHARMACOL THER., vol. 17, no. 12, 2003, pages 1435 - 50 |
| SANDBORN ET AL., ANN INTERN MED, vol. 146, 2007, pages 829 - 38 |
| SANDBORN ET AL., GASTROENTEROL., vol. 135, 2008, pages 1130 - 41 |
| SANDBORN ET AL., GASTROENTEROLOGY, vol. 135, 2008, pages 1130 - 41 |
| SANDBORN ET AL., N ENGL J MED, vol. 369, 2013, pages 711 - 21 |
| SANDBORN ET AL., N ENGL J MED., vol. 367, no. 16, 18 October 2012 (2012-10-18), pages 1519 - 28 |
| SANDBORN, ANN INTERN MED., vol. 146, 2007, pages 829 - 838 |
| SANDS ET AL., N ENGL J MED., vol. 350, no. 9, 2004, pages 876 - 85 |
| SANDS, GASTROENTEROLOGY., vol. 147, no. 3, September 2014 (2014-09-01), pages 618 - 627 |
| SCHLENK ET AL., J. RHEUMATOL., vol. 32, 2005, pages 2291 - 98 |
| SCHMECHEL ET AL., INFLAMM BOWEL DIS, vol. 14, 2008, pages 204 - 212 |
| SCHMIDT ET AL., INFLAMM BOWEL DIS., vol. 11, no. 1, 2005, pages 16 - 23 |
| SCHUTYSER ET AL., CYTOKINE AND GROWTH FACTOR REVIEWS, vol. 14, 2003, pages 409 - 426 |
| SHANG, CIRCULATION RESEARCH, vol. 101, 2007, pages 1146 - 1154 |
| SOFEN ET AL., DRUGS DERMATOL., vol. 10, no. 8, 2011, pages 885 - 92 |
| SONNENBERG ET AL., ADV IMMUNOL, vol. 107, 2010, pages 1 - 29 |
| STALLHOFER ET AL., INFLAMM BOWEL DIS, 7 August 2015 (2015-08-07) |
| STROBER ET AL., BR J DERMATOL., vol. 165, 2011, pages 661 - 668 |
| TANG ET AL.: "Interleukin-23: as a drug target for autoimmune inflammatory diseases.", IMMUNOLOGY., vol. 135, no. 2, February 2012 (2012-02-01), pages 112 - 124, XP 055085235 * |
| TOEDTER ET AL., AM J GASTROENTEROL., vol. 104, no. 11, 2009, pages 2768 - 73 |
| TZELLOS ET AL., J EUR ACAD DERMATOL VENEREOL, vol. 27, 2013, pages 1586 - 1587 |
| UCHIDA ET AL., GASTROENTEROLOGY RESEARCH AND PRACTICE, 2015, pages 856532 |
| UITERWEER ET AL., J. CLIN. IMMUNOL., vol. 24, 2004, pages 74 - 85 |
| VEERAYUTTHWILAI ET AL., ORAL MICROBIOL. IMMUNOL., vol. 22, 2007, pages 5 - 13 |
| VELDHOEN, IMMUNITY, vol. 24, 2006, pages 179 - 189 |
| VERMERIE, INFLAMM. BOWEL DIS., vol. 10, 2004, pages 661 |
| VOITK ET AL., ARCH SURG, vol. 107, 1973, pages 329 |
| VON ROON ET AL., AM. J. GASTROENTEROL., vol. 102, 2007, pages 803 |
| WILSON ET AL., NATURE IMMUNOLOGY, vol. 8, 2007, pages 950 - 7 |
| XIE ET AL., J. BIOL. CHEM., vol. 275, 2000, pages 31335 |
| YAMAMOTO ET AL., INT J COLORECTAL DIS, vol. 28, 2013, pages 335 - 340 |
| ZHENG ET AL., NATURE MEDICINE, vol. 14, 2008, pages 282 |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3883606B1 (en) | 2018-09-24 | 2023-07-12 | Janssen Biotech, Inc. | Safe and effective method of treating ulcerative colitis with anti-il12/il23 antibody |
| CN108957014A (zh) * | 2018-09-27 | 2018-12-07 | 郑州大学第附属医院 | 结直肠癌血清标志物、表达评估方法、试剂盒及应用 |
| EP3946592A4 (en) * | 2019-03-26 | 2023-01-04 | Astrazeneca Collaboration Ventures, LLC | PATIENT POPULATIONS LIKELY TO BENEFIT FROM IL23 ANTAGONIST THERAPY |
| EP4240238A1 (en) | 2020-11-30 | 2023-09-13 | Mindera Corporation | Microneedle devices and methods, and skin condition assays |
| EP4240238A4 (en) * | 2020-11-30 | 2024-04-03 | Mindera Corporation | MICRONEEDLE DEVICES AND METHODS AND SKIN CONDITION ASSAYS |
Also Published As
| Publication number | Publication date |
|---|---|
| BR112018012626A2 (pt) | 2018-12-04 |
| US20200262907A1 (en) | 2020-08-20 |
| CA3007098A1 (en) | 2017-06-29 |
| US20220144935A1 (en) | 2022-05-12 |
| US11220541B2 (en) | 2022-01-11 |
| JP2022031643A (ja) | 2022-02-22 |
| CN108472367A (zh) | 2018-08-31 |
| JP2019508370A (ja) | 2019-03-28 |
| IL259704A (en) | 2018-07-31 |
| RU2018124603A (ru) | 2020-01-24 |
| MX2018007589A (es) | 2018-11-09 |
| EP3393515A4 (en) | 2019-08-14 |
| KR20180096633A (ko) | 2018-08-29 |
| RU2018124603A3 (enExample) | 2020-04-06 |
| AU2016379157A1 (en) | 2018-06-21 |
| EP3393515A1 (en) | 2018-10-31 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JP7153775B2 (ja) | Il23経路バイオマーカーを使用するil23アンタゴニストに対する臨床応答の予測 | |
| US20220144935A1 (en) | Ccl20 as a predictor of clinical response to il23-antagonists | |
| TW201307845A (zh) | 預測方法及利用il-17拮抗劑治療關節炎的方法 | |
| JP2023058524A (ja) | 関節リウマチの治療のための臨床応答バイオマーカーとしての抗pad4自己抗体 | |
| AU2016349113A1 (en) | Dipeptidyl peptidase-4 and periostin as predictors of clinical response to eosinophil-targeted therapeutic agents in eosinophilic diseases | |
| JP2017507322A (ja) | ヒトペリオスチンを検出する新規アッセイ | |
| US20190352425A1 (en) | Assay to detect human dpp-4 | |
| US20220373539A1 (en) | Prediction of clinical response to il23-antagonists using il23 pathway biomarkers | |
| TW202448503A (zh) | 潰瘍性結腸炎的基因調控 | |
| De Vries et al. | REUMADAGARNA 2024-ABSTRACTS· Artritsjukdomar |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16879907 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 259704 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 3007098 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 20187017346 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2018532465 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2018/007589 Country of ref document: MX |
|
| ENP | Entry into the national phase |
Ref document number: 2016379157 Country of ref document: AU Date of ref document: 20161216 Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112018012626 Country of ref document: BR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2016879907 Country of ref document: EP Ref document number: 2018124603 Country of ref document: RU |
|
| ENP | Entry into the national phase |
Ref document number: 2016879907 Country of ref document: EP Effective date: 20180723 |
|
| ENP | Entry into the national phase |
Ref document number: 112018012626 Country of ref document: BR Kind code of ref document: A2 Effective date: 20180620 |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: 2016879907 Country of ref document: EP |